4OJ3A

The crystal structure of v84p mutant of s. solfataricus acylphosphatase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
b'MLKRMYARVYGLVQGVGFRKFVQIHAIRLGIKGYAKNLPDGSVEVVAEGYEEALSKLLERIKQGPPAAEVEKPDYSFSEYKGEFEDFETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
publication title Edge strand engineering prevents native-like aggregation in Sulfolobus solfataricus acylphosphatase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 24
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oj3A00
2BUNA 4ZOSA 2K1RB 5F0UA 1SQEA 2GA7A 1IUJA 1FE0A 2BYCA 1FVSA 1S6OA 5K9FA 4Y2MA 1TL5A 1YJRA 2W4PA 3LGNA 1WD6A 1JWWA 1Q8LA 2HFOA 2VV5A 2ASYA 2RMLA 2HLTA 4NPOA 2HFNA 2BBEA 2HQIA 3BM7A 4HH1A 5F0WA 3TRGA 4OJGA 2BJDA 2ZDPA 1FD8A 3IWXA 3HHLD 2K7KA 3I9ZA 5A6PA 2JDJA 3F44A 3KG0A 4QOTA 1FEEA 1OQ3A 5B0DA 1AW0A 1U7LA 1MWYA 5B0EA 1GXTA 3LGMA 2N4DA 4OJHA 3KG1A 2ACYA 3QMQA 2XMTA 1YG0A 3DCAA 4HL9A 5IXUA 1GXUA 1X8DA 2Q3PA 5B0FA 3MCSA 4FNIA 2HIQA 2QLXA 1AFIA 2FB0A 2KT3A 3FGVA 5A6WA 2L3MA 2PGCA 2KYZA 3HHLA 2QIFA 2N4CA 1Q53A 2VH7A 1OQ6A 2KKHA 4A48A 1Q8BA 1TL4A 2XMVA 3T9NA 2LQ9A 3TOQA 3BF4A 1Y0HA 1LQ9A 1CC7A 3QGPA 4F67A 2GO8A 3HHLB 3TNVA 1Q4RA 2AJ1A 5B0CA 2AJ0A 1TUVA 2AW0A 4HI2A 3UDCA 2LDIA 2CRLA 3BN7A 1K0VA 1KVIA 1S6UA 2QYCA 3FRYA 4OIXA 1VQYA 4ZA1A 1N5TA 4HI1A 2GGPA 2ROEA 5B0BA 3MZIA 5T7LB 3IWLA 2OFGX 2PD1A 1N5SA 1OPZA 2OAUA 1Y3KA 4DL0C 3CJKA 1N5QA 1CPZA 3LO3A 2K2PA 2XMWA 1V3ZA 3FMBA 2GGPB 3K7RA 1YJVA 2QLWA 2RU9A 4U9RA 1P8GA 3E8OA 1MWZA 3HFKA 2OD4A 2BJEA 2IYIA 1ULRA 1Y9OA 2GCFA 5B0GA 4HH0A 2OFHX 1P6TA 2FTRA 2GFFA 3CJKB 5B08A 1RJJA 3BGUA 4OJ3A 1KQKA 3VTIA 4FNHA 1FVQA 4DPOA 2ZDOA 4Q2LA 1N5VA 1FESA 4Y2IA 5T7LA 4A46A 1YRXA 1W2IA 1CC8A 2OD6A 2OMOA 5KAKA 2GV1A 4A4JA 5B0AA 1TR0A 2XMUA 3BR8A 4Q2MA 4OJ1A 1OSDA 3HDSA 4EFAC 1APSA 2LQBA 3DXSX 1KVJA 2EW9A 2FHMA 1SI9A 1URRA 4NL5A 2IFXA 2ROGA 3HF5A 1X7VA 2IYGA 2LXFA 2OP5A 2ROPA 3BDEA 2K7JA 1FE4A 2AP6A 2OKQA 2KT2A 4YDXA 4YEAA 1VQSA 2N7YA 3KNGA 4Y2KA 2HLUA 4A47A 3GZ7A 2RILA 1Y3JA 1JK9B 2W4CA 2W4DA 2XMJA 1YJTA 3WDOA 2XMMA 3BB5A 2XMKA 3HX9A 1SB6A 1XBWA 1X0PA 2K1RA 3HHLC 5B09A 2FIUA 1YJUA 4DN9A 1QUPA 2RSQA 1AFJA 2G9OA 1TZ0A 1R6YA 3KKFA
chains in the Genus database with same CATH superfamily
1U1NA 3MEEA 2G2YA 2SXLA 4HT7A 3JTOA 3TQEA 3UDEA 1Q86T 2PA8D 1G7CB 3M6WA 8AT1B 1PYSB 1N32F 4WE1A 4NLSA 1JJHA 2UXCJ 1XJWB 3MR7A 2DR8A 4CO0A 3NGRA 4OI4A 1YHQS 3BF4A 2V34A 1VIOA 2IPOB 1MLAA 2RQCA 3KHHA 2MJUA 4DR1F 4DL0C 3OTCA 2VIHA 4G1QB 2ILYA 1YJVA 3FBBA 2OD4A 5BR8J 1D9DA 1YITS 1N8RT 4ZVPB 2BM1A 4FF1A 3VAJA 1FX4A 4M63A 3KK1A 2APOA 4F2RA 3KHLA 1LXNA 3IBFB 5A8WA 5DZ7A 2CQCA 3M7VA 2EFGA 2FJDB 4CWBA 3IN5A 4P72A 3HHLC 3NS5A 4LQ9A 3U1NA 3GQCA 3SSRA 1Z2LA 3G6VA 4A8MP 2ZD1A 1YJWS 3TJAA 3FZBA 4PXCA 1Y5LB 1GMWD 1RWNB 3GPAA 1REVB 4FXWA 1HR0F 3QFWA 2F9JA 2J6TA 3OJSA 6FDRA 1FO1A 5AE3A 3H2LA 3IWXA 1BQMA 2BJ9A 1XNQF 4JI3F 4NLXA 5DZ6A 3C3LA 4C8YA 1GX5A 3FK4A 1Y11A 2XWXA 4J7CA 3R6GB 1RT2B 1SCJB 2A10A 3VV2B 3KTQA 3MEKA 4KGMA 3V6DA 1WDTA 3PEHA 3GJSB 2IVYA 3G82A 1VQ5S 2NXNA 2UVVA 3W9JA 1HWLA 1X9WA 2DNQA 2MZSA 1X5PA 3I5AA 1WOOA 2CJQA 4B02A 3PX0A 3J7A1 3CDEA 3GJRB 2RS2A 2K7JA 4AD6A 4GKKF 4FF3A 1F0XA 4C3LA 1FNMA 3GG0A 4G1PA 4I6AA 4B9NA 5GADI 5J1EB 2ZM6F 5J2MB 3OD2A 4FKXA 4GVBB 4AL7A 2FZKB 2JWNA 4E98A 3ZFVA 5F9NA 4LR7A 3HHLD 3FSXA 2Z57B 1FT8A 4LUBA 4FBUA 3SMZA 3PW0A 4K4XA 2MLYA 2CWXA 4K4UA 1DRZA 4DUYJ 1SC3B 1Q8IA 3MM6A 3K2YA 5F8LA 2C2EA 2E66A 3P3DA 5J2PB 3KLIB 1XMQJ 1FDAA 4MYUA 2HQCA 2QSFA 4OYOA 4ELUA 2GMHA 1L3SA 1QUVA 4DV4J 3KLGB 2QLBB 1B7FA 4H4MB 2Y3YA 1DQAA 3THTA 1OSDA 2C2ZB 4KHRA 3U7JA 5KG1A 4B3MF 4HT5A 3BH7B 4J9RA 2ROGA 1TELA 3IGNA 4QIFA 1S48A 1FF2A 4K4YA 4KGXB 1X4AA 5HLFA 2NPIA 1KLNA 2IBOA 3QSIA 2RSQA 2HNYA 1LWEA 1RTIA 2V94A 2B6AB 3D3BJ 3RR7A 3ISNC 2DK2A 5K9FA 5EWGA 2COLA 2HGNA 5IOLA 1KWMA 3D3CJ 1RE1B 3NWRA 3CULA 5KFSA 4DMZA 5CQGA 4J37A 3M30A 9ATCB 1RHRB 3LOUA 3M2VA 4IFYB 1T05B 3PX4A 4I69A 3C15A 1TFWA 2DNYA 1IR2A 4LF9F 2A6MA 4OI6A 2PC6A 2N7CA 3FGVA 2HNDB 2XZTB 4N8OA 5LXRA 1ZBTA 4XAKA 4OHYA 2UV8G 2WONA 4N56A 1GK8A 3OBIA 2E1AA 1S1VB 4WFYA 5EGYA 3HHEA 2OFGX 3QFHA 1IWGA 1K73T 4W4MA 2F65A 3KNAA 3KYLA 3VTIA 3HVWA 3MURP 2PEHA 5A0YA 4P74A 1CC8A 4DFKA 3IMQJ 3LW5C 1VQNS 3MM8A 2WTFA 4P7VA 4YY3F 3B4MA 3DHWC 3OHAA 1JIHA 4M5IA 1E6VB 4DV5F 2XMMA 1QSSA 2ZOMA 4EWTA 3O6QA 5KG3A 2C28A 4WFNQ 1HHSA 4NXNJ 2MKIA 4UQTA 2CZ9A 2FC9A 1S10A 4EBDA 2A18A 3MDFA 5GMEA 2RAQA 5EDWA 4LF7J 1SKWA 2FLNA 1GMVA 1D1UA 3KJNB 3TA2A 3C14A 2V50A 5SUHA 4O44B 3UFCX 3ISND 2OTLS 4C3MA 1S0NA 4DBQA 3M6XA 4EBCA 3BKFA 1RT7A 1GT8A 1RAIB 1WC4A 1N36J 3CCMS 3A8JA 3PACA 2RF2A 2CRLA 2LMIA 3LA0A 2HBRB 1KTQA 1GXLA 5GADU 3QYYA 4KR0B 3MOZA 2W2OP 4XTTA 3PW4A 4WBFA 4YB6A 4M5GA 2CIMA 4B08A 1KQKA 1HMVB 4WFXA 1UA1A 3MMJA 3MCOA 3OUYB 2J76E 4ZVFA 3DLGA 5FDLB 3CCES 4MKAA 4ELTA 3H5XA 1IKXB 3WX4A 1VQPS 3POTA 2CQ1A 1KR4A 4C0HA 2UXBF 4DSJA 1H2VZ 1R8AA 2ALZA 2XS5A 4CLLA 1SH2A 4OZJA 5ETTA 1DJ0A 1DLOB 5ETRA 2F4VF 1WC1A 2FGOA 3FBCA 1WTFA 2YWHA 3T41A 3KJVB 2AJQA 2MKSA 4RNHA 2V8DA 4NLWA 3G8QA 1FRKA 2JH3A 1VQ9S 1MSWD 1YKWA 3V81B 3OXFA 1LXJA 4LF4J 2KKHA 2UUAF 2ZZTA 1PKUA 3JSYA 2U1AA 2NXJA 3B78A 2DNGA 3UR3C 4DCOB 2ZVSA 1EETB 3ENAA 3I6PA 2CJ9A 2HYIB 2OSQA 2MZJA 4V1Ak 3I4HX 4IRKA 1J27A 5HP1A 3HSJA 4HLBA 4QWEA 2B9XA 2DR5A 3FCWA 1VQSA 3D28A 4NYZA 1RISA 2CYYA 1Q7LB 1QAYA 1PCAA 5I42B 2ZH5A 3CB4A 1CJKB 3HVRA 2UXDF 3RB3A 1JWWA 3MOJB 5FLXU 3I9V9 2L9NA 2NCKL 4PQUB 1XIQA 1N0UA 2HQGA 1AB8A 1X60A 4K5RA 4KAIA 4B3RF 2G1HA 2CPXA 3TO8A 5CABA 1GXTA 3H90A 4WWSA 4UOFA 1WKJA 2C2NA 3VAGA 1R27B 3JAMY 1EHWA 5D6GA 3HHLB 1QJHA 1BE4A 3TAPA 2PN6A 2ROEA 2HRYA 2BR0A 4U8VA 5DRKA 1ULRA 5B0GA 3BREA 2HIYA 2FGCA 3KLIA 3KLFA 4FYVB 1M1KT 1M5KC 3MR2A 4HACA 3L4BC 3KLGA 2M3DA 1QDUB 1R89A 1N32J 3BBCA 3MR5A 3N6NA 3MFHA 1PYOB 2MKJA 3GYXB 1X4EA 3AODA 2MQ8A 2K1RB 1HNXF 3S1TA 1YIJS 3I5CA 3M1VA 4KGZB 2F3JA 2W1BA 1QTNB 1FDDA 2Q43A 3N79A 4QW9A 3FCVA 4ITSA 3W5YA 2B56A 1KTVA 3EGNA 1JLEB 3MGJA 3E01B 4FF2A 4DV3J 3FRYA 1VBXA 3HCXA 4R25A 2BACA 2ZZNA 2AJ2A 1P1TA 1TUWA 3MPWA 4BC7A 1VRUB 4JOUA 1FFWB 1RT5B 1XK8A 2XNQA 1CQMA 4JI1J 2XSJA 3CO9A 2RRBA 4CLWA 1VCTA 2YWFA 1F2HA 3QZ8A 3PYDA 3G6XA 1YJ7A 2KYXA 3RRKA 2CPZA 4EO8A 4AQYF 4DL6A 1LOUA 4CLUA 2B4UA 1RTHB 1ZM9A 3CCWA 1IR0A 2HLTA 3PFEA 5J2NA 2C2MB 4KFBB 4KIAA 3QSYB 3TZXA 3VAIA 3TZZA 3KG1A 3PRDA 2ADBA 2A2DA 2HBZB 3OSNA 3KG4A 1MN7A 2WK4A 1WKKA 4O44A 2RDDA 2WB1D 2LQ9A 2C42A 4RUHA 4BDPA 2LDIA 3EICA 2KJVA 4GKKJ 3DKDA 4I67A 2KHDA 4OZ2A 3C66A 3SEOA 4ED8A 1AA1B 3FUYA 1TKDA 3LP1B 2MQOA 1JXLA 4DSFA 3G86A 4A4JA 2DGOA 1R8PA 5CYQA 4TU9A 3KLEB 4A47A 2W4CA 1OS5A 1G6BA 1UVJA 3OUYA 1RT3B 1NMEB 5D0GA 4HR2A 4DQRA 3JS9A 1S77D 1IKXA 1MWQA 3IS9B 2H1YA 3KK3B 3T1YF 1R31A 3S01A 2HG4A 2OPSB 4EO6A 4JBCA 3R5AA 2VDIA 3IR6B 4IH7A 1ZA1B 1KFSA 4AL5A 4LSNB 4I56A 2YKMB 4DUZF 5F8JA 4DV0F 1M1GA 1K8AT 3HT3A 1VQ7S 1HW9A 3CDUA 3ZNUA 1U1KA 3LWLA 3HMJG 1PGZA 3CPWR 5ETMA 1RTJB 4RW4B 4FNHA 1C4AA 1CJTB 1EETA 3H4BA 4B9VA 1OY6A 2JEFA 2H54B 3BO4A 3CJRA 3CJQA 2UU9J 2NLWA 2W4DA 1JX4A 1BHNA 2PIIA 1JMTA 2OPRB 3MM7B 2I1RA 3HD1A 3CXCR 4Z7YA 1C1BB 2WVEA 2Z30B 2R8KA 4OYAA 3KG0A 1ZM4A 1QAIA 1RT1B 1FK9B 4F8RA 2YNIA 3H4DA 3S7RA 2B43A 1NO8A 5HMYA 3N0VA 1U24A 3Q83A 4OI2A 2OH2A 3PVXA 2M9KA 2IM3A 3NMRA 4K0KJ 4KYZA 3KK2B 3UDCA 2L48A 4HI1A 2GGPA 1NK4A 5K14B 4USVA 3K5OA 3OTEA 3BSAA 2V8GA 4Q43A 2DGTA 1T9TA 1WG1A 4L76A 4NX9A 5BYSA 1RLDA 3U02A 4I6YA 2IMOA 1SI9A 2QSWA 1VQMS 4P71A 1KS2A 3KNGA 4LT6A 1GTHA 4TVAB 2QA2A 3SCIE 5JMNA 4DN9A 3CC4S 2WAQD 3DHXA 1VC0A 1BQNB 4IG3A 5E7OB 2AKWB 3QGGA 2KG1A 3FMWA 1KFDA 3MD3A 3TZYA 2Y0BB 3UVJA 2XY5A 4NEYA 1DFDA 3W7BA 4WP9A 2IRUA 1S6PB 5E41A 2VH7A 3EGZA 3MUVP 4Q8EA 4TY8A 3PFOA 1RGVA 1G2EA 4MYTA 4ZPBA 2RIJA 1S6QA 1S7IA 2DHGA 3GILA 2IYIA 3BKTA 2XO6A 5CXTA 5EN1A 4DPOA 4KH1B 4PWDB 1XR5A 3K57A 2CG4A 4K50A 5KFNA 2VOOA 4JI8J 2X1BA 4X64F 1RT5A 3LPEA 4PEOA 2XC9A 5GVQA 2WVBA 2HS3A 3QJLA 1QE1B 5IT0A 2YWEA 5G0RB 1QUPA 4WYWA 1TKZB 1PAUB 3DLEA 4WXWA 3BR9A 2YH0A 2Z0GA 1FVSA 1S6OA 5KFVA 4LFBF 2M2BA 4IG0B 4W90B 4QIGA 2VBWA 1Q7YT 2KG0A 1V5VA 3JTNA 1RTHA 2NXUA 4C0OC 4RNNA 3DNCA 2FVRA 3AA9A 3TUJC 1YG0A 3M2RA 4USJC 2QX0A 2G4BA 2DIUA 4A8WA 4M5NA 1J5EF 2VG5B 3KHRA 4F3QA 1CS4B 3RUBL 1BWVA 4KFBA 1S9GA 4TU8A 2XS2A 2MQPA 4USUA 4G3IA 4OIXA 2HHXA 2ZE2B 2ZH4A 3W61A 3AD8C 1NCLA 1VMBA 3PG9A 2JZ5A 1UKUA 3PTWA 1T03B 3M8YA 3T1HF 2UXDJ 2XLKA 2HQ3A 1EP4B 2VPXB 4N7TA 2H51B 5DJBA 1XR6A 2QZ8A 1YJTA 4QW8A 3SQOP 4X4RA 1L3UA 1CULB 1NK9A 4PRFA 1TZ0A 2FY1A 3M32A 4C3KA 4MKBA 4K4ZA 4P52A 4X62J 1HARA 3IXQA 1U6BA 5IM0B 1K44A 4RPFA 5DO2A 1KQSR 1VDHA 2VZ9A 4UZBA 1IKWA 3HXMA 3H98A 2BOPA 2MLZA 2DPJA 4DSLA 3KK3A 5LMNJ 1HPZA 5A6WA 4DR5F 3MAAB 4I2PA 2KXNB 1ZPWX 2J8AA 2V5HG 1XNRJ 2AEMA 2EFPA 3MTKA 2WBMA 4WKRA 5A2QY 1N34J 3PRBA 1D09B 2C2OB 2V69A 2QE5A 5SZTA 2QLWA 1MWZA 3GJQB 2DXDA 1Y4ZB 1X9SA 3O2IA 3PJXA 1RB0A 4DFMA 2UP1A 1FA0A 4WTYA 5IQ6A 2FZCB 4JI0J 2KFZA 1LNQA 4M8LA 3LF0A 4RW4A 2HLUA 1SJFA 4Q45A 1CJTA 2FHKA 1J5OA 4I6WA 4X66J 2J6UA 1LK7A 2GA7A 2ATCB 2KDOA 4JYAF 4B17A 3UCGA 4DPTA 1SV5B 2R8JA 4NXMF 2KT5A 3LH2S 4L73A 2N4DA 2DR9A 4E8UA 3TUPA 4C9DA 3TI0A 1C1BA 1F9HA 3PR4A 1OQ6A 2B7CB 1NK8A 2GX8A 1M5PC 1Y0HA 1U45A 3ZZZA 4HYKA 1N33F 3AOBA 3N28A 3CCQS 1ZTWA 1H72C 4CO2A 3FMBA 1D8YA 4CLZA 1CVJA 3D9BA 1PJ5A 2XB2D 3SXLA 4UW2A 4EYHB 3T5LA 1TTHB 3GWCA 2RQKA 1VQOS 1WI8A 2BEFA 5K14A 3THVA 1U6FA 3SDEA 5K8OA 1URRA 1SBRA 4NZ6A 3TA1A 3K17A 2KJWA 3BH6B 5F3ZA 1X5SA 5ETSA 3TW0A 4IFVA 3QT7A 2RS8A 2D9OA 1MU2B 9RUBA 2DNPA 4ZP9A 1RBOB 2HHVA 4ECYA 2HHHF 2CPEA 2HQIA 3J7AN 1UEVA 2J9DE 4M5MA 3NS7B 3CJ0A 3C2PA 5H9FJ 1BQNA 3Q8RB 2R2SA 3PW5A 2RKIB 1NSAA 3FEZA 3N01A 1MNEA 1HBMB 2CQHA 1IBMJ 2MDAA 2CZVC 1VBZA 1DARA 2AW0A 3X1LB 4DN0A 3HHDA 4WXOA 2VFTA 4DLEA 3C6UB 2J9EA 7AT1B 1I94F 1PAEX 1G4CA 1UTAA 2FHJD 2RH3A 2FJEB 2P8IA 2U2FA 5LL6d 4ZCKA 1RWVB 3OR2A 1RAOA 2A0FB 2WW4A 4JI2F 2CPIA 2GO9A 3FSYA 3K8VA 1SL0A 4NOHA 4X4TA 3ZTSA 1JJ4A 4X4OA 5AE2A 3AXKA 2G2OA 3DLJA 1IN0A 3J80Y 4ZJQA 1CQNA 1RWUA 2K7KA 3ZO7A 3IA0A 1TKZA 1NBEB 4MJKA 2HVHA 5ETQA 3G8SA 4IG0A 1AFIA 3MUMP 5HQMA 3ZZRA 4I2QA 2GJIA 2AZ1A 4FP9A 1QSLA 4QWCA 1UVNA 1LEOA 1VHFA 1PG5B 3BO2A 4NLQA 1TK8A 3LAKA 4ES1A 3NNHA 1KD1T 4GC6A 4CM2A 4O4GA 3QLHB 3I56S 3EPGA 5KG6A 1DZ5A 3DOMB 2I6WA 2XYPB 2WW8A 3IAS9 2EG2A 1R0AB 1VRTA 3V5RA 3AD7C 4NMLA 4DS5A 3VVTA 4QWDA 1FWLA 3EXYA 3HP6A 5DLFA 2IFXA 2VC0A 2E7XA 4JI7F 2X1FA 4M5KA 1TL3B 1CJVB 4IR1A 2I9SA 2Q6CA 3GIMA 2BZ2A 4CI0B 2HRTA 5I3QA 3BN7A 2HNZA 3F41A 1RT6B 4K2XA 2C3PA 3MECB 4N8NA 3DGPA 4OX9J 3QWPA 5C25B 4ICLA 4RUCA 2ASLA 4M5DB 1RAAB 3WIVA 3RBZA 1BXNA 2DNLA 1WWHA 4RO0A 2Q3PA 2QRRA 3IC1A 4LRAA 3D1OA 4FF4A 2PGCA 3TVZA 5C2CA 2DCLA 3W9HA 1S1XB 2R9LA 1TK0A 4ECSA 1SJ4P 2EXUA 2AJ1A 4CTAB 3F73A 1N5TA 3I0SB 2YPYA 4ZIWA 5DG7A 3P8BB 4QQBA 4DEZA 3UO0A 3HJFA 1UA0A 4TQSA 2RU9A 3G71S 3G9CA 1UMJA 4ZP6A 3W63A 4ZPAA 2GZOA 2OJ3A 1B70B 2CVEA 2W2NP 1DY3A 3ZZTA 5DQGA 3MPYA 1NB2A 1TMMA 1UW4A 3O3LA 3W2WB 1WC0A 1KP6A 5CYMB 5B09A 4NA1A 3KUEA 2R8HA 2V4QA 2IA6A 5T41A 2NYHA 1RYSA 2DGSA 2HMIB 1XWLA 4IO9Q 3P5BP 1SV5A 1T3OA 2P9EA 4OZLA 3AOAA 3KUHA 3RYLA 3VALA 4L6V3 2LU1A 2OGUA 2DB1A 3D54A 3W64A 5BJRA 2PA3A 2J7WA 1TVRB 5B0BA 4DR3J 2I38A 2IJFA 1NPPA 1Q8KA 2Y8YA 3BSNA 4X84A 3HJVA 1LFWA 1RWPB 1Z4UA 4Y0FA 1KONA 5B08A 5D15A 2JJ4D 1M1HA 2LXUA 4LRCA 2AF6A 2KU7A 2X51A 3HVTB 1VBYA 4OJ1A 1D0EA 3DOKA 4RWXA 4DS4A 4MKVA 4F02A 2VPYB 1PILA 3J81U 5IV3A 4A8FA 2DGWA 3WDOA 4DV2J 3TA0A 3OL8A 1KC8T 2ZBCA 3MMAB 4UZCA 4U8YA 3KLHA 2BBEA 2YNGA 1KBRA 5KFUA 5HJYA 5HBMA 2CQBA 2I5JB 4CQ1A 2UUTA 5E0OA 2I2YA 3PCOB 4YHHF 2GHPA 2V8PA 3TAQA 4ZK7M 4DL7A 2B7BB 3T9NA 1WJ9A 4OYBA 3GMGA 2BRLA 4BWJA 1JLGB 2VOPA 4NE9C 3BV8A 3C6TB 4F0KA 4F0MA 3ONQA 1LW0B 2GFFA 1RJJA 4O3NA 2HFVA 1JB0C 4ZVQB 2AJFE 3QO9A 1TKTA 3FFIB 4X65F 1T9XA 2W8LA 2B0GA 3M4XA 5C42B 1E6YB 3C6UA 2R3VA 2B4OA 1FX2A 3MD1A 2LCWA 4NL5A 2EC2A 4K4TA 3IR5B 4KJIA 3CDAA 4RUAA 3JSMB 3SCLE 2R7QA 1T9UA 3Q2SC 3BN4A 2EI5A 3S6EA 4DR5J 4EU0A 1VK8A 4JI5F 2WSFC 4DFPA 2BJ1A 2NXEA 3EGVA 1F2GA 2HGLA 1TL1A 1XR7A 4C8LA 4KE5A 2OEJA 1GFWB 5B0DA 3IG1A 3SQGB 4OJHA 1RHMB 4JB8B 5KG7A 2OEKA 4IR9A 5GAHU 3KXDA 5L9XA 3QIPB 1S1WB 1WEXA 3DYAB 5ETKA 2XHCA 3PXGa 2BKOA 3IBWA 5A8RA 3MPVA 5A8KA 1DQ8A 1FXRA 2C3UA 4S0MA 4M95A 4K59A 1PO6A 1D8ZA 4I7FA 2WSCC 4KPYA 5KG4A 3HD2A 4PXDA 1WF2A 4B3OB 2OMOA 2W25A 2RT3A 2YNFA 2IA0A 5HANA 1YK9A 4LF6J 1K1SA 2OHDA 5EUHA 2QV6A 5KFLA 3LANA 2DNRA 2AEJA 1N4LA 2M8DB 5D0HA 4MIAA 4FXVA 2DO0A 2ALYB 2E5LJ 4X4QA 1MMLA 3D0HE 1WG5A 3T6BA 4X4VA 1M5OC 4LBHA 2BW2A 1LV5A 4OHXA 3FKBA 2VG6A 2M0GB 4FVMA 4MT1A 1S72S 2YKQA 3NCQA 4OZ1A 4DZDA 4LF5J 2VICA 1VK3A 2QLXA 2FB0A 3CGIA 1K9MT 4QYRA 1N6QB 1D9FA 4LIRA 5KT6A 3DMJB 5LMUJ 5AJ3J 3FC9A 4RW6A 4I64A 2DR7A 2BANB 2YKNA 5KFBA 1X5TA 1V3ZA 4U9RA 1S1XA 2W2QP 5K8NA 2BE7D 4TLRA 4L74A 3HO1A 3V4IA 4OJ3A 3RZAA 4ZHRA 4L75A 1HBOA 4NA3A 2V4JB 4Q2MA 5DQHA 2RD5C 1DBDA 2FHMA 1ZM2A 1HNZF 4DDFA 4UQGA 4ETZA 1OYDA 2IYGA 1U25A 5CD4H 3UCUP 2C3OA 3CJ3A 1HWUA 3AAWB 4ECQA 4C4WA 5JXSA 1T02A 1T94A 4LJMA 3TP2A 2J0WA 4EK2A 3BGLA 4DL3A 2KZMA 1JNZB 2DO4A 3WC2A 3CF5Q 3U27A 5HMZA 5KFZA 2KI2A 2VODA 2CQ3A 4C11B 4OX8A 3FEYB 3D2WA 1I94J 1HW8A 2LLZA 1PC5A 5AXLA 2LKZA 3DDIA 2CA9A 4CLKA 3TOQA 4LSLB 2HMIA 4LBIA 2LP4A 4FKYA 4ZLJA 2DNMA 3NGSA 1BD6A 2XQCA 3OTBA 3UNGC 3D6FB 5FJ4A 2YQ3A 1WHVA 1NPRA 1HQEB 3PO5A 1RAGB 3AQPA 4ED7A 3MEGB 2BDPA 2ATLA 2F7VA 4IRDA 3T5JA 3OR1A 1JLBB 2P9GA 4DX8H 4JI4F 2EK6A 3GSDA 4CNZA 3MMBA 2DRDA 2WBRA 3AQOA 3DRRA 4NZ0A 1UETA 3J7ZT 3HVTA 1YDLA 1OSCA 2VBXA 2B4VA 4EUVA 4RW8B 1X0PA 2ZBIA 1LWFB 1FKOA 1WF1A 3UN2A 1UFWA 4MK8A 5KG0A 3CCJS 4U67Q 2DNNA 1HNIB 1QVFR 3OFEA 2FD2A 3BM7A 1B0VA 4XO0A 2W7OA 4LIWA 3ZTQA 4O3SA 4Q5VA 4PXEA 3MMAA 2OSRA 3LUYA 4J9PA 2XMTA 2E5IA 4CT9A 3CD7A 3SFGA 2XO7A 2CPDA 2HURA 4DUTA 5KFOA 1B3TA 1FRHA 2Z2MA 2E5GA 2VF3A 2NZ4A 2ASJA 1X4CA 2I5JA 2LFVA 1BLUA 3HKZD 3ILOA 4YB7A 3UW1A 3NGUA 4QPXA 4QWAA 1FKPA 2XM3A 4CYUA 2HFSA 3K5PA 4OI3A 4F36A 2JOQA 1NJWA 2YKPA 1YTYA 3HDSA 1UVMA 4NRUA 5GMDA 1SXLA 3BDEA 2XYGB 3DLKA 2M7SA 2BKNA 1RAHB 3OPKA 1E6YA 1IKYA 3U1MA 2OPQB 2HQDA 2EFQA 1B0TA 4X2BA 1IQZA 1D9AA 2MSSA 2BW7A 1UEKA 3FCHA 1RP5A 2CKWA 3HZEA 3H5UA 2FHJA 5G4DA 1RK8A 2PMHA 3JYTA 4J9KA 4DR2F 2RQMA 2PO4A 5IC4B 3MMCB 3DDKA 3QRPA 1QSYA 2D69A 2Z2LA 4AYBD 4DV6J 2JNJA 1RI7A 2XMVA 4F3OA 1FHTA 1SJRA 2XCAA 2EKYA 4H4KC 1YGYA 4LRDA 5F3TA 1KVIA 1O8BA 4RBUA 2B9EA 2GAGC 1N5SA 2E5HA 1ELOA 1N5QA 4ZPCA 2BOAA 5DM7Q 2HS4A 2IAJB 1FRMA 1P6TA 3FSIA 5DGBA 2ZC3A 3BGUA 2D3UA 3T1AA 2GIFA 3M8WA 4ED3A 3FEXB 2AJ4A 1HBUA 2VUGA 3JQJA 4LQ3A 3JQKA 2XGQA 2VQEJ 3Q8UA 2P6TA 3G8TA 1HQUB 4LRBA 4K5SA 4JI6J 2XY7A 3HX9A 5DG8A 2ZH6A 3W65A 3NRBA 4J9SA 1NDCA 3MUTP 2GC8A 1KHVA 3EM1A 2XGPA 4R0JA 5HVFA 3BGFA 2BM0A 4A8YA 1GAOA 1M5HA 5IWAF 1FJGF 3LTOA 3A8EA 2UZAA 2F5GA 4RLEA 5I3UA 3CCZA 5K8PA 2KZZA 2W2MP 3GB0A 5H1SV 5D0EA 2MKHA 1WOSA 2L08A 2LA6A 1D3WA 3RU0A 5DG9A 2E1MC 2PD1A 3CJKA 1IQTA 3JTPA 4TU7A 3R7BB 2FVSA 5ITHA 2LQ5A 1NEEA 2QMUB 3GCXP 5IFMA 1TKXB 3DMJA 1C1CB 5KFKA 3O44A 3W2VA 2BANA 2IVMA 1JLQA 1HA1A 2HWTA 2CNLB 4OYXA 4U96A 1HI1A 1REGX 4QYZJ 1S4FA 3P49B 1K0TA 3MF5A 5KT7A 2JC0A 2UUBF 2JEIA 5LOQA 1RACB 1AUSL 4DV7J 4DR7F 1VJWA 2W4PA 4OHWA 2B9YA 3MCNA 3IM8A 3H40A 4P10A 5BYRA 1F6TA 3I96A 2ZWPA 5KFDA 2XLJA 1RCXB 2W8KA 1A9NB 2XY6A 1Q0NA 3ETMA 5U47A 2JVOA 2CPHA 2IBKA 1NHKL 1Q8BA 4F7VA 3TEGA 4BCAA 4F67A 5E3PA 2ZZMA 3K5NA 2Y1IA 4CRJA 2JX2A 4LFAJ 4RBTA 4FVCA 1DTQB 5F8HA 3GIKA 4RW9A 2CXEA 1K1QA 1IBCB 2DNZA 2MTLA 2YX4A 1IKVB 1SKRA 1FERA 3OXGA 1R0BG 1YQHA 3ITHB 3LAMA 4E0DA 4KGVB 3MAHA 3AB2B 1H0HB 1NUEA 2WOMB 1V3RA 2MKKA 2HGMA 3Q0AA 3OTDA 1S1TA 3OL6A 1IVZA 2HS0A 2PFDA 4RW8A 2FLOA 3GIRA 3BBFA 5A6PA 3F44A 1Q5VA 1DTTA 5H9FK 1KDNA 3B4DA 4LF2A 2KFYA 4YS2A 3QIDA 4KV8B 3TUZC 3I31A 3J7YI 2VFUA 4I0WA 4J9VA 3O1LA 1U0HA 2IC3B 1LW2A 3GSIA 1Y10A 4KBIA 1S0OA 2DHHA 4DL5A 3B6BA 1OPZA 2J0QD 1UJ4A 4OV6A 2D3ZA 1VJQA 1HNVB 1C0UA 1KLMB 3OLBA 3DRPA 1DAXA 3FVYA 3W62A 4NWBA 1S7HA 1M5SA 1S12A 1NDPA 5KOWA 4URQU 5HVGA 4CP5A 2R8IA 3T9ZA 2GMJA 3I0RB 7FDRA 3G4SS 2Z4PA 1JLFB 3MHYA 2MZQA 1X4FA 5JJBA 1U1MA 3Q8YA 4NRTA 1VFJA 4ZVEA 2XMAA 3RRGA 4KO0A 1XMOF 1TV6A 3FDSA 2D74B 3DM2B 4Z37A 4ZPTR 4KB7A 4CLPA 5KFMA 3UNYA 4ECZA 3BQ1A 2UV8A 2F8MA 2KRRA 2HVDA 1YJ9S 5LXYA 1S9EA 3QPIA 3MPUB 5KT4A 3BGRA 3O8WA 4RW7B 3HKWA 3EX7B 2VQFF 3UE2A 4DI6A 2BE2B 2GNKA 2IJNA 1RTDA 2FLLA 4LFCF 4GKJJ 3AT1B 2QL7B 5LSLA 4N41A 3LP0A 4ZJOA 4NASA 4MK7A 4XDDA 4CIOA 1WC5A 2V68A 5KTQA 2GJ2A 4LSZB 2FHOB 2C1EB 3LALA 1I3OB 4ZCIA 3DU6A 3JB9k 2CQDA 2Q1LA 4R5PA 2OPPA 4WP3A 2VDHA 5KT3A 1JJ2R 2BQ3A 4CCHA 3HPOA 2IAJA 3HF5A 5C24B 4KKOA 2D41A 2VHGA 5J2QB 3VHQA 4DZ6A 5FLXY 1X31C 3D66A 5D4OA 4WK3A 2J7UA 1JLCB 4C97A 1VBKA 2ASYA 2RMLA 3EPIA 4NI2B 1N52B 3M2UB 2CPFA 4XDCA 1NJZA 4ID8A 1F3FA 2ZH7A 5KFRA 4ZLNA 3ILIA 5DDOC 1FD2A 5KFQA 4DG1B 4YB5A 2DKOB 3Q8VA 2XHWA 1SL2A 2DNKA 4DR4F 4NYPA 1UPPA 2I0XA 2WSEC 2GVDB 4KC5A 2MB0B 1UJ6A 3PHTA 2V6AA 4PR6A 5L38A 4DCJB 4LF8F 1SH3A 4OI0A 2CPJA 5L1JA 1RCOB 3BO3A 2PMZD 2BE9B 2RUSA 3GU0A 2YTCA 2MQQA 1FESA 2F8HA 3NKYA 5LSOA 5MAOA 1SC4B 4B9UA 1K47A 3FQLA 1C1CA 1FE4A 1VQ4S 2QMWA 3J7YU 5IV4A 3V2UC 1BC6A 3CSKA 3T3FA 1BGXT 4W92B 1S57A 1IBKJ 4OV1A 3KOAA 4NLOA 1HQ2A 1UPMB 3DN9A 3VAFA 1T3NA 2HFNA 3TRGA 5F0WA 1IBLJ 1U02A 2F8EX 4EZ6A 1VQKS 2MEWA 4YP3A 1NHVA 2F63A 2H9ZA 4B3SJ 2Y1JA 5D77A 2HHQA 2J0SD 3JSRA 4F0HA 3JQMA 1O5JA 5KOXA 3RR8A 1X4BA 3FZ2A 4UOGA 5THWA 3FBFA 3QNWB 2JLGA 4LRFA 1FRJA 1RU2A 1HYSB 1Y9OA 2W24A 2AIRB 3H2VE 2VG7A 4DPUA 1NHUA 2J5AA 3BR8A 2W7PA 2K3KA 1Y7PA 1FKAF 2EBGA 2ZBRA 2AGPA 3RW6A 2IHR1 1LFPA 4DR6F 4YDXA 1FI4A 1IKVA 1SUQA 3M05A 2UXCF 3ITHA 5L1LA 1BWEA 2CJXB 3BKUA 3TWZA 2RU3A 2LA4A 4HDHA 3Q89A 2FJBB 1NSKL 3SSQA 4JV5J 2HHUA 2JVRA 3NL0A 4LVOP 5HATA 2Z56B 3GG1A 1SKSA 1OQ3A 2Q6BA 3TZWA 1U7LA 2EFNA 4A8SA 2JFDA 1F9EB 2NYIA 3CVKA 2KT3A 4IH5A 1ZZFA 4OYIA 4IOCQ 2PE8A 5JUMA 2KN4A 2Z2ZA 1TK5A 5KFEA 4G1QA 4ZA1A 3NCRA 1HLWA 4PAAA 2BQRA 1WELA 2BA9A 3CJ2A 4M5LA 2YWGA 4RU2A 1IXKA 2H4WB 1WDDA 1NAQA 3FJ2A 3TJ8A 1HNVA 3UI3A 2QN6B 2IDEA 1VQ6S 2VFSA 1XN9A 3DI6B 2B3TB 3J7Z5 3OFGA 5I3PA 1CJUB 1JLFA 2LEBA 1IWAA 4NLPA 1REVA 1VRQC 1RQ0A 1VR6A 3W8GA 3ZZ0A 3C19A 4J9MA 1WD6A 1TUGB 5KFJA 2ZHAA 1S1UB 4TN2A 4ENOA 4RR5A 1WHXA 1RLCL 3A3OB 2FVQA 1RT2A 1X8DA 3GLJA 1I1GA 2QC3A 2O67A 1ZOTA 4OZ3A 4F4AA 1JNRB 4BBYA 2FJXA 4KGKA 4RW7A 3KLVA 2C3YA 2DBBA 1NKEA 3MTJA 2BE2A 3MEDB 2H4YB 4YR3A 1VYAA 2UUBJ 4H54A 1JKHB 1TP7A 4ZJLA 3K5MA 2H3EB 1MW7A 1AXQA 1JQGA 2J6SA 3OSPA 4J9OA 2F40A 2MZTA 4KPCA 1SIWB 3RTVA 2R2RA 1ZAWA 5J1EA 3RW7A 4FYXB 1X4GA 2HQFA 4NYOA 5J2MA 3KMQA 3ET6B 3A8IA 3PYEA 4GVBA 2V9KA 4DPXA 2BUNA 3TANA 2W9CB 2BYCA 2JFKA 4DUYF 1FWPA 1XMQF 3MEEB 1AZSB 3KJFB 1U8WA 5B7WA 1EQ0A 2DITA 4OL8A 4G6VB 4DV4F 1ZETA 1R7IA 5GAEI 3ZNJ1 3M8SA 3P6YC 3SV3A 3OVSA 4YR0A 4WE1B 4DF8A 1EIYB 1U47A 2FLPA 2EG1A 3TX0A 5J2PA 3PHEA 1Q81T 2QO3A 1VQYA 3V6JA 1YBAA 1S0VA 3QZ7A 2JC1A 1SL1A 3GIJA 3BSOA 3R27A 4CO5A 4H4MA 3D6TB 2GVDA 1OY8A 3ENVA 3UPFA 2A3JA 3CD6S 3UD4P 4PYDA 3KJQB 5DGAA 2DY9A 3ZZUA 4PYAA 4PG5A 1WC3A 3MM5B 4ANCA 4DL4A 3GZ7A 4DR1J 2B6AA 2XMKA 4PWUA 2R42A 2VJVA 4P2XA 1U1LA 4TKTA 2VFVA 2J9CA 2W01A 1TL5A 2ZD1B 4O3OA 2EEYA 4IFYA 1T05A 3N4WA 5LT5A 3BBBA 1BQMB 1R8BA 2M4MA 3LGMA 5CZVA 3QMQA 1WHWA 2MHNA 2HNDA 4KRWA 5IT9U 4OZ0A 3OL7A 2ZJPQ 3ZZYA 4ED2A 1FRLA 1S1VA 3NGTA 2CJYB 4PG8A 3VZHA 2GO8A 1GNKA 4OYZA 1HR0J 1S6UA 2LXIA 1O6XA 1S0MA 3V6DB 3IAM9 1S79A 1QY7A 1JLAB 2XI3A 1XNQJ 3G82B 4JI3J 4F2SA 4WU3A 1NH7A 4LF7F 4OQJA 2AGOA 3FBEA 1TR0A 4K2JA 1F9FA 4D3HA 4ZKAA 2QYGA 1E6VA 1H2UX 3M9OB 2W7AA 4FBTA 5L39A 4ILLA 1UWBB 5KFTA 2V63A 3VR1A 4LR8A 2IIHA 3M6UA 1AT1B 2MY8A 4A8OA 2ZBPA 4Y2MA 2HFOA 5KFPA 5HVHA 2HVEA 4HEA9 2V0NA 4USHA 3Q8QB 1S5ZA 2W9AA 3T5KA 3PM9A 2G13A 4ED0A 2DRBA 2GJFA 2DTJA 2Y8WA 2ZM6J 3WHIA 3BYPA 1ITPA 2HZCA 3BSCA 4V19X 1PBAA 1MG7A 3MM6B 4UF4A 2DGXA 4DHVA 3A12A 1HMVA 1P8GA 5AE1A 3GFXA 4N76A 1L5UA 2CPYA 1R8CA 1NLKL 4YDDB 2FUG9 1CSJA 4Y2IA 3H5SA 5FDLA 2KM8C 5D78A 3PY8A 3I4PA 8ATCB 1X7VA 3G96A 3TR5A 5GAEU 7FD1A 5DETA 4R8UB 1T95A 4J9LA 3BGOP 2IY5B 5DLGA 4UTGA 1DLOA 4DR4J 3CJ4A 2DGVA 1LWEB 1RTIB 2HNYB 3LGNA 1YBUA 3P4UB 1Q16B 1X9MA 4ETXA 3KJVA 2LVWA 4G65A 1T9WA 4B3MJ 2G1DA 1V5IB 4J90A 3V81A 3M30B 2UVUA 3GYNA 1IJFB 1GMWA 4MH8A 5B0FA 4B3TF 4C8KA 3AHPA 1S1UA 3M2VB 2YX1A 2IMWP 5GMKa 3C15B 4PQAA 3R5GA 2CJAA 1LQ9A 4ZITA 4K7QA 4AE5A 1GX6A 3PIPQ 3H20A 2X3GA 2WONB 3G6YA 2GVZB 2O66A 3AJDA 3UR0A 2JSXA 1GTEA 4LF9J 3KMSA 4U7UD 1RXOB 5L1KA 2IVFB 3NGDA 2FJVA 4WZQA 5I42A 4OX7A 5JVHQ 3PR5B 1CJKA 2CDRB 4UUWA 2EKNA 1R6VA 3NNAA 4PQUA 3R7SB 1F5AA 1SQGA 2RVJA 2LDYA 3ET6A 2YY3A 4GMKA 3K8WA 4ES2A 4ZLPA 2V2QA 4YY3J 3C14B 2CZ4A 2D1CA 3VAMA 3CJ8A 1VGYA 4DV5J 5HROB 3HHLA 1FJCA 1AZSA 2G0CA 1RT7B 2RHQB 1S49A 4HI2A 2VBZA 1BQXA 4DR6J 2RF2B 3OJUA 4DCPB 3AA8A 4WFZA 3LP2B 2AGQA 4L3NA 1W25A 1Q5YA 2XEXA 4WTOB 2FQQB 4RNMA 3OXLA 4KSEB 5DDRC 2AX1A 4QYZK 1VOMA 2WVCA 3D6MB 3DLGB 4PG4A 2RILA 2K1RA 4C8NA 1WEZA 3EVMA 3CC7S 1Y5NB 4Q44A 3POTB 4J91A 2NPFA 4ZOSA 4PPDA 5MLCV 1SQEA 4F4ZA 3MM5A 4CLTA 4DV3F 2YWKA 2OELA 1UVKA 3DLBA 3H7HB 1FRIA 4P7TA 5AXKA 5IXUA 2HHSA 2B51A 4V19J 2UXBJ 1WTBA 4MK9A 4JI1F 3D0IE 2F9DA 1JLEA 3E01A 2BABA 2CUYA 2Q79A 4L3KA 4O3QA 3EDRB 4OLPA 1N88A 5KT2A 1A0OB 2F4VJ 5T7LB 1QAXA 3U1LA 3W9IA 1VRUA 2LEAA 2OO4A 2FTRA 2ZITA 4CLSA 2VD3A 4Q2LA 1N5VA 3CIZA 1JLAA 1NSPA 2R4FA 2DH8A 2UUAJ 2WRMA 3DXSX 1R43A 3P45B 5HP1B 2D3OR 5A76A 4KHPF 1QVGR 1Q78A 3IFEA 3SFUA 1RA6A 4ED6A 2R2TA 4QR1A 4ECRA 3R5BA 1RSCA 1W26A 2BJ7A 3KKFA 2CQ0A 3PNIA 2CQGA 2RUGA 1I5OB 3UWTA 5E5NA 1UWBA 3CNQP 3VWSA 2ZJQQ 3CTRA 5KFXA 1ZM3A 3W5ZA 2R2UA 3DFEA 2P6SA 1W7WA 4P75A 2Z58B 4EBEA 4HL9A 3MCSA 3EWGA 4MKYA 1Q53A 3B8HA 2V67A 1NK6A 4OZ5A 3TNVA 2AJ0A 2HAIA 3CO0P 2AT1B 2MYFA 3WX8A 3LP1A 1HKAA 1URNA 2XMWA 4B3RJ 4I68A 4UY8T 3VCDA 2VJUA 1EJ7L 5ADZA 1O51A 4HTJA 4Y34A 3D7SB 3FNNA 2GHVC 4ILRA 2WVDA 4ZN3A 3KLFB 3OW2R 2YQ1A 3KLEA 4Y6IA 3CT9A 3VAKA 1RT3A 4HACB 5J1NA 1AUDA 4QZVB 1DURA 1ICEB 3NWGA 4RNOA 2FVCA 2DEIA 1X4HA 3EZUA 4KY3A 5KFYA 2FYXA 3CCRS 2MJNA 3IS9A 1YVFA 2JRSA 1RTZA 3KDNA 4R8UA 4MMOA 1FDBA 1I6JA 2OPSA 3C8YA 3M1VB 2ACYA 2AWZA 3TX8A 3NY0A 2DYAA 4LSNA 4RZRA 2BJ3A 2YKMA 3OLAA 3BS9A 4Y65A 2ZNZA 3SV4A 3IRXB 2CG8A 4EEYA 3ICLA 4ZCMA 2R7RA 1HNXJ 1P9YA 2UU9F 2GW8A 4ECUA 1DHMA 3VF0B 4FPRA 3ZTRA 1RTJA 2K3IA 3D67A 2M88A 3R97A 3HSZA 2A6OA 4DFJA 3DLLQ 2ERRA 3HI9A 2GVZA 1ACMB 5L8RC 4Q7AA 2XSJB 2DNOA 1G3OA 5J1PA 4ZP7A 1XBWA 1NJXA 3QWUA 2OPRA 3N6MA 3MM7A 4RBVA 1Z2ZA 4ZVTB 1N54B 3CCLS 2ZVIA 1UFKA 1KEKA 4K0KF 4RNFA 2R7TA 4YOEA 2P5VA 1PJ7A 2HSEB 1RT1A 1GH8A 4OJGA 1FK9A 3QT6A 2MY7A 4ECWA 2MLXA 2KM8B 2CQ4A 3DRSB 3NG8A 5J2NB 3PRVA 4QJVA 4AQYJ 5CHCB 5AT1B 2WHOA 3KK2A 2HRUA 4O3PA 4PWWA 3R3TA 3TYTA 2V2KA 2ZHOA 3JXOA 1K0VA 1NNDA 3T5HA 2I8EA 1ZH5A 5HROA 4P9SA 3V6KA 4X4UA 3M8PB 4ELVA 4USWA 5CYJA 1PJ6A 3PDNA 1YI2S 1WNEA 3J81Y 2E9TA 2ZDOA 5D4PA 2AYMA 2AD9A 4C48A 4LMZA 2IRXA 4QWBA 4WCEQ 4N77A 5L1IA 2KL8A 5CYQB 3LP2A 5DDPC 4QU7A 1SB6A 3M8ZA 4RKUC 3R1HA 4NA2A 4BHQA 1QAJA 4WPAA 3DU5A 2ZOFA 3BPSP 4ANEA 2HHPA 3UD3P 3QAUA 1A6LA 3L7OA 1RBLA 2KXFA 4B9TA 4I1TA 2DCUB 4DQPA 2E9RX 1S6PA 2QGFB 2DIVA 2KYZA 3VQTA 1UP1A 1OY9A 2E29A 3EJMA 4JI8F 3RBDA 5M2UA 1L3TA 5IT4A 3KHGA 2Y0SD 3T1YJ 3OVAA 4OHVA 3H59A 2IDLA 4WZMA 2KH9A 1ZAXA 2YNHB 2VA3A 4WFBQ 4PWDA 4F4YA 4C7QA 1RU1A 3DXBA 1F3VA 5T7LA 3I55S 1APSA 2W9BB 2KO1A 2UVRA 4DUZJ 4ERDA 4OLOA 4DV0J 3ILJA 2MSTA 1T8EA 2NSBA 1QE1A 4F4WA 5G0RA 1YLXA 3GR0A 2KHCA 4B3TJ 3W60A 1MMNA 2ZH9A 1VC5A 3DOLB 4PKDB 2LEPA 3IO1A 1RWOB 1H3DA 5CCLA 3I9ZA 1U2FA 2OIHA 1SKUB 4JV0A 2YKOA 2VB6A 2ZNYA 5K8MA 4M5JA 4AT1B 2VG5A 3R5JB 4CO1A 3VAHA 1CS4A 2HZVA 2YNIB 5LM7E 2ZE2A 4DSEA 4DU8A 4U95A 1U8SA 4RWWA 5C7PA 2L41A 1NU4A 1RWWB 4WKYA 1T03A 3R7NB 2GGPB 5FD1A 4KH0B 3HFKA 1N48A 5KFHA 4NZ7A 4NCAA 1VLOA 2DHSA 2CQIA 1EP4A 1M5VC 1W2IA 2ZEJA 4X62F 5DDQC 1PBUA 1F60B 2OP5A 3C46A 5CH7B 4UOHA 3SIPB 2N7YA 2YVSA 3RAMA 1CULA 1CLFA 5LMNF 1F5CA 4DOZA 4JV2A 1WACA 5HMWA 1FCAA 2VKZG 2GHWA 3L7UA 5F0UA 3HULA 1Y5IB 1NDLA 2NXCA 1XNRF 5IM0A 1YJRA 1AROP 3PW2A 1N34F 1CG2A 1Q82T 4IG3B 4IYQA 5ETPA 4DX6A 2J8SA 2BVZA 2QJ3A 1Z1ZA 1IR1A 2D7SA 2QL9B 3AB4B 2IM0A 3UVJB 3MAAA 4AFFA 4HVZA 2CQPA 2RE1A 3UD5A 3NXZA 4KQZA 4JI0F 4A48A 4ZVHA 2ZJRQ 4MFBB 4TY8B 3IP0A 3IRXA 3QT5A 3L09A 4ZPWR 1WKLA 2YH1A 4X66F 3NGKA 1S6QB 5K20B 5H9EJ 2X7IA 4FDFA 2GV1A 2E1PA 5ETOA 2GQ2A 8RUCA 4TY9A 1RKJA 3RRHA 1WI6A 1TL7B 5F8NA 2C2DA 5AXNA 3FRZA 5F8GA 1U2RA 1RHUB 3RB6A 2AMCB 2D9PA 2OEMA 2O01C 3DLEB 4ECXA 2ZBQA 4X64J 2M8HA 2N82B 3A3PB 3M2RB 1FXLA 1OIAA 3AY0A 5DS7A 4ZS6A 4TXSA 3DRSA 5ETVA 4PABA 4LFBJ 3CJSA 1FJ7A 1S9GB 3AOCA 2HBQB 4OX6A 2DR6A 3SCKE 4W98A 4KHPJ 4IOAQ 4QR0A 3Q8SB 4GC7A 4DWIA 4GVLA 2K2PA 1KQFB 1NKBA 2DH7A 3A3NB 4DQQA 4XPEA 3MI7X 1J5EJ 1X4DA 2XTJP 4EFAC 4DSIA 1H74A 3M8PA 1U1QA 2CDQA 4ER8A 3H0PA 2N3LA 2ZH8A 4J5OA 5K5MA 1NH8A 4Y2KA 3MXHP 3KDOA 1MU2A 3F0NA 4CO3A 2FDNA 4NMXA 1MMDA 4ZN1A 1M90T 4XPCA 3LWMA 1IBMF 1KRPA 4WFAQ 2QTWA 3T1HJ 3A13A 2PT0A 3M32B 2QA4S 3TVYA 1CBKA 2QFJA 2ZDPA 2XYHB 1FD8A 3CC2S 3EYZA 4OFZA 2H5IB 2BQUA 3A4TA 2P2CB 1N5YB 1MWYA 2RKIA 3GV5B 4NCBA 4ALZA 3PJ9A 1HBMA 3F56A 3ELHA 3CCSS 2OMLA 1IKWB 1L3KA 1HPZB 1IM6A 1CC7A 3N5FA 4I2PB 4FS2A 4WF9Q 3BQ0A 3AXMA 1FDNA 4DV1F 3DRYA 2E5JA 3V4MA 3E8OA 2POKA 2DJWA 1VC6A 2DGQA 2E7WA 1FNOA 3TVKA 3UN3A 3M9MB 2OD6A 1BMQB 4CH7A 1SVDA 3RAQA 1NKCA 2YNHA 4N5SA 2EW9A 4QIWD 4MIWA 3ZXWA 4F4KA 1S76D 1DQ9A 1V9OA 1VISA 3IRWP 4P2FA 3H8YA 1VS3A 4P2SA 2W9BA 3E51A 3N5BA 2CWKA 1R6YA 2PI4A 3BPDA 2CADA 1J5OB 2AZ3A 4D3GA 5E3AA 2GIRA 4CM0A 2P9CA 2QA1A 1XC9A 2DEJA 3J81j 2XI2A 4NLRA 2HWHA 1RAFB 5HK4A 1C4CA 3EGWB 2B9WA 4AUKA 3DOLA 4WP8A 1AYEA 3RBXA 1KKHA 1KSPA 4HKQA 2QA4G 2ZH2A 4EZ9A 4P73A 5F9LA 4C8MA 4UOCA 2RQ4A 1T9VA 3QLHA 4JYAJ 1N56A 3JAMU 3DOMA 3HHNB 1SJQA 1NSQA 4NXMJ 1CPZA 2G0JA 3HK2A 1R0AA 3W8PA 5LJ3Y 2DHXA 4LREA 1U48A 1FTRA 1HIYA 2Z8QA 4OX9F 2CNNB 1UVIA 1NK5A 3H2UB 4B9SA 1TL3A 2OI2A 3M8QB 1CJVA 4AXJA 1N0VC 3SDEB 1T0TV 1N33J 2KXHA 1H6KX 1ZTTA 3MR6A 1RT6A 3MECA 2UUWA 1S4EA 2FJAB 4IFVB 1OWXA 1H7WA 5C25A 1NZ8A 4M5DA 2RRNA 4ZVSB 4F3MA 3TAMB 2GS8A 3GFZA 5D3GB 3QQCD 3PIOQ 3OV7A 2DH9A 3B54A 2WVFA 2PI5A 2GQQA 2MQNA 2ZKTA 2UVWA 4LBPA 1VHIA 4CTAA 3GONA 2O5DA 4NCGB 3I0SA 1ZZNA 5KFFA 1RUSA 2HHHJ 2QYCA 1V3SA 2QG9B 2LQ8A 3MZIA 4DX7A 1NDKA 3Q86A 1FTCA 4UY85 1GQEA 2OFHX 2D3O1 2DNHA 5D0RA 4ZVGA 4C0BA 4MFBA 2X1GA 2QL5B 1TMJA 4FN5A 1XMBA 4JV1A 2DD8S 3FQKA 2HHWA 1IM4A 3W2WA 3GV8B 4H4OB 5BYQA 4URGA 2DY1A 2AYGA 1KVKA 3M9NB 3OR2B 5CYMA 3AD9C 4DLGA 2BKPA 1RWXB 1TL7A 1FE0A 3R5DA 1MROB 3UQSA 2QEXS 4EYIB 2HPUA 3K5LA 4DR3F 4J9NA 3LGHA 4CH1A 2JEGA 3MPDA 5KG2A 2MGZB 5F41A 1Q1KA 3HFZB 3DCAA 4JI2J 3IWNC 2AYEA 4OYWA 4IDKB 6FD1A 4EGLA 6AT1B 5EX0A 2C3MA 3SYZA 1H7XA 1FWKA 3THPA 1HL6A 2XS7A 1TVRA 4I2QB 4ZVRB 2HVIA 1Q4RA 3MR3A 4Y3CA 4X4SA 3CE8A 4F26A 1FFSB 4B9MA 2V8HA 3WQPA 4DV2F 2XZWA 2N3OA 4O4GB 4CO4A 2XBPA 1U49A 4HDGA 1H98A 2NUHA 3A1YG 4USMA 1VRTB 3R8YA 3X3UA 3PKMA 5LSRA 3PW7A 3GP9A 3DGVA 1OPIA 3SCJE 4BWMA 3Q22A 2XMJA 4M94A 3L3CA 3QRRA 3Q8PB 4PZVA 1TU0B 1JXVA 1PYTA 5E3QA 3H25A 4QR2A 2EC0A 2HNZB 3NP5A 2DISA 3US5A 3DGPB 3G2XA 1FEEA 2O3DA 3LQVA 4F25A 4ICLB 1HBNB 4JI7J 2KFNA 4BC9A 4XIUA 2ASDA 3CDBA 3QGHA 3EVOA 3KWMA 4ES3A 1P9QC 1YZ7A 4ATNA 4QIVA 4ZCLA 5HMXA 3B82A 4PG6A 3CMAS 1C2PA 3AJ1A 4IQMA 3TQ1A 1N5YA 4Q0BB 1JLGA 2EBEA 4HHJA 5IQQA 3C6TA 2XZDB 3UN5A 3MM9B 1LW0A 3GCWP 3FFIA 1TFYA 5C42A 3CCTA 2L9WA 1FVQA 2FPHX 3QRQA 2YBVA 1UW9A 3N9UC 2HK3A 3EUNA 5D4LA 3BJYA 2C2RA 4RU9A 2LU2A 3CCUS 3ILLA 3JSMA 4CT8A 4DPWA 3BEGB 3CMQA 3L9ZA 1NJYA 4M5HA 3HSDA 5L9NA 2GQCA 2FY8A 3PO4A 3T19A 1L3VA 1IUJA 5D4NA 2ZH3A 1RAJA 4ECTA 3WIUA 3SQGA 3RBEA 2FJWA 4QOTA 3CWJA 2OTJS 3LPYA 3QAEA 3Q23A 3NOCA 4CLFA 3CMES 3QIPA 3R2DJ 1S1WA 3DYAA 3GV7B 1EAYC 2XLIA 4LF6F 1G1XA 1VQLS 1OJ4A 3CCVS 2JLFA 2NZCA 4NLYA 2NREA 3LO3A 2E5LF 4CZCA 2EFOA 2Y1LB 3OTOF 4B3OA 2VKRA 4DPYA 2DGUA 2XULA 4Y2CA 5KFWA 5B0AA 1RYRA 3VVUA 2GIQA 2MPUA 1HWKA 2WCXA 2M52A 3DOKB 3RJMB 4LF5F 1UAWA 3TUIC 3DRXA 1UWAA 1U1RA 5M2RA 2JLEA 3IM9A 4QPTA 3M8QA 2RRAA 1RA7A 2CQ2A 4TQRA 4I4BA 4ZVOB 1HWJA 4GO7X 5LMUF 3TARA 1WG4A 4KT0C 1WSVA 5AJ3F 4C8OA 3KLHB 3L95X 3VGTA 1I51B 3PJWA 5EX3A 3Q24A 3GTYX 4J9QA 3QT8A 2ZUGA 2YNGB 2R8GA 1EB0A 5HBMB 2MZRA 1GXUA 1N6QA 2Y1RI 3TAMA 5KG5A 4LVNP 1HWIA 5D3GA 5HJXA 1U0SA 4GO5X 3EMTA 5JVGQ 1OMSA 1JJCB 4KHMA 4RL1A 2MXYA 5AXMA 1SPBP 4NCGA 2V9WA 3RB0A 4CH0S 2NR0A 2IM1A 2V4JA 1F1BB 1W2BR 2VU5A 4YHHJ 2BXJA 2UUCF 4FZVA 1RHJB 3QO9B 1TKTB 2HVZA 1NZAA 2IM2A 1KVJA 2CFXA 3NAHA 1S97A 1WSRA 1P1LA 1KHWA 2J7KA 4NEZA 4MAKA 2KB2A 1EZZB 4YB1P 3BQ2A 1AFJA 1U09A 4H4OA 2CJBA 4HH0A 5L46A 1SH0A 4JP8A 4X65J 4ANDA 2G2ZA 2EWHA 3PV8A 4C11A 4MTPA 3IR7B 4DV1J 1TL1B 1NPKA 1MROA 3IG1B 5CAAA 5CD4A 1WF0A 4LSLA 2ZWOA 1WORA 3PYFA 4JI5J 4YN3B 2XSFA 2MGZA 2V8VA 1YX2A 5F8MA 2AV5A 1J2VA 4Z2XA 4PUOB 3ZZPA 4ED4A 1HQEA 4Q8FA 3MEGA 4IDKA 5T14A 3R1LA 5A8RB 2DXEA 5A8KB 3BZQA 5IZHA 4OHZA 4U7CA 1JLBA 1MN9A 2YQ0A 3OL9A 1YRXA 4I7FB 1UVLA 2R7SA 1UEUA 4CNYA 4U6PA 4NLGA 2LQBA 2M70A 2YNFB 4TNOA 1LWFA 3ZTPA 4K4VA 4LF1A 4DJBA 3GR1A 1WHYA 2O1PA 1HNIA 1EKRA 4WIQA 3H42A 2FC8A 1U4BA 1S59A 4FYDA 3VGSA 3E2EA 2VA2A 4NPOA 5CA5A 4WJBA 4CDIA 3CJ5A 2J9DA 2VG6B 5KT5A 3C16B 5ETNA 2BRKA 1QLNA 1HBNA 3CW2C 2AX0A 2FVPA 4PXBA 5GAGI 5B0CA 1H73A 3RAXA 2HFZA 3PKYA 1XQIA 4ZPVR 1ZYQA 3T6JA 4RW6B 1U1OA 4IRCA 4K4WA 4Q0BA 3HFVA 2EFVA 1X5OA 2YKNB 4NLDA 3BDPA 1FEHA 5A2QU 1LK5A 4BLGA 2HBYB 5KAKA 3V4IB 3MM9A 4ZHRB 1ROFA 1HBOB 3BYRA 2LXFA 5HI7A 3PX6A 1FXDA 2QFIA 2OPQA 1S9FA 4DQIA 4TYBA 3EXCX 4ZDNA 3NBPB 1WC6A 2NUUG 1UZHA 2C2KB 4DV6F 2WZ1A 5GAHI 1GEHA 4A8KA 2M5YA 1B64A 1RBAA 3NS6A 3UDLA 1LWXA 1HNZJ 3G87A 4IUFA 3MMCA 1RABB 1SJ1A 4OZNA 1NK7A 1RADB 1B7YB 2L3MA 3N6LA 4ZLLA 1TL4A 4E2FB 4J9UE 4MIBA 1HNWF 4LR9A 3WC0A 2VQEF 4QBUA 2K06A 1EX8A 3MWBA 3JSBA 4DU7A 1KOHA 4JI6F 2VPZB 3DC2A 2XNRA 2VBYA 3R9LA 1Q79A 2A2CA 4HHUA 5CZXA 3HSGA 2E7VA 2H48B 1Y00A 3W3SA 1HQUA 3OR1B 4HHHA 2B4PA 2RDIA 2OKQA 3AJ2A 4YEAA 1KQGB 3NNCA 3MMBB 4F50A 2JHEA 5I4MA 3DRRB 3D4JA 1IJEB 4USTA 1VIXA 1FKOB 5HL7Q 4C8ZA 3SSSA 2R7VA 4NLUA 3MFIA 5ETLA 2F4FA 4ED5A 3CUNA 4JI4J 2JDJA 1V6HA 1WUUA 5HQ8A 4Z7CA 2KVQE 2ACMA 3W1YC 4WK1A 2Y9HA 5KFIA 1PSDA 1RDRA 5BXIA 1XEZA 4O0NA 1SC1B 4ID5B 3WBZA 4O3RA 3GYGA 2VC1A 2OAUA 1Y3KA 2R7WA 1S99A 1TKXA 2E44A 3D5MA 1WEYA 2QLJB 1FKPB 4QIEA 4CYUB 4DV7F 5H9EK 2YXLA 1RWKB 4FYWB 3HM9A 1RHQB 2CNKB 1HHTP 1SJ3P 4U7UK 2CVIA 1KN6A 4QCLA 2CNOB 2DHAA 2VONA 3P96A 2EPIA 5HSPA 3OFHA 1EKSA 4TLQA 3WZ0A 3D1QA 3DLKB 1NM2A 1U2CA 3Q2TC 2FIUA 2QMXA 1IKYB 2NSCA 2XCPA 5IC6B 1ZAVA 3R2CJ 2B5JB 5GAGU 2PMWA 3MAQA 3KFWX 1RZMA 5IT9Y 2AEFA 4LFAF 2G0IA 1C0TB 5RUBA 3OHBA 5E3CA 1TQLA 1NB7A 2E1CA 2MMYA 3JYTB 4FNIA 4YMEA 3J80U 2F1FA 2NS1B 5IS2A 1NJIT 2QIFA 3QJJA 2RHSB 4Y28C 3A8KA 1A7GE 4P2MA 1DTQA 4G1IA 2X3DA 1Q95G 3QGIA 3K58A 2RJZA 1BY9A 4YUDA 4DR2J 4YR2A 4PUOA 1HD0A 1M0SA 2XMUA 2B8QA 3ZTOA 4OI1A 4RJVA 4DF4A 2WOMA 2VPWB 4A8QA 4IH6A 1HBUB 3HHKA 3SZ2A 2KT2A 3UDVA 4USKA 1Y3JA 2ZOGA 4O0IA 3BB5A 2HK2A 3GE9A 3AH6A 4EI2A 5BR8F 1YJUA 4ILMA 5KFAA 2AQ4A 1XTZA 3EDQB 4XK8C 2LECA 4R0EA 3DLHA 2ZC4A 4L72B 2BJDA 1LKZA 5CCMA 2IJRA 4KV8A 3AFGA 1R3NA 5B0EA 3OTOJ 2PEBA 4C98A 2HIQA 3OFFA 2IC3A 1LWCB 2RDJA 5I3UB 2Z2YB 1GMUA 2C22A 3M6VA 2VFRA 3QGPA 3EE3A 3C16A 5IWAJ 1FJGJ 1KLMA 4BS2A 3K7RA 3H5YA 2BX6A 4EMDA 2LYVA 4Y00A 3CJKB 3P5TL 3PYGA 1YRUA 3I0RA 5HAOA 2KRBA 4DXLA 3CD0A 4FS1A 3G6ES 3W2VB 4AXIA 1P27B 1JLQB 3GFYA 1SC6A 2RB7A 1JK9B 4X4PA 3DM2A 5EWFA 2HWIA 1OO0B 4RX6A 2LQJA 2G9OA 4WYLA 2ADCA 3ZZOA 2FZGB 4GKJF 4HH1A 3QJPA 2GAHC 1RHKB 2MQMA 1WOPA 3NBPA 1TAQA 4HTIA 2V4RA 3RB4A 5C2GA 2MKYA 2PSZA 1NXIA 1UJ5A 3V6HA 4ZMMA 3VGUA 1PIEA 2K8GA 3L7PA 2UUCJ 4DR7J 2OLWA 2XWYA 3ISZA 1UZDA 4UT4A 2QT7A 1H38A 3VGVA 2ZUAA 3PEJA 4QU6A 3ADAC 1U6ZA 4RW9B 4K8RA 4WIIA 2EVZA 1RT4B 5C24A 5E3RA 3W5XA 5J2QA 3EZ5A 1UFLA 3E3XA 2KVIA 2ROPA 3ENWA 3D6HB 4GRSA 2VASA 3PZPA 2YWWA 4IQXA 2PFFB 1JLCA 3KUGA 4NI2A 3EVWA 2DXFA 3M2UA 1UCNA 2H5EA 1S1TB 1VLYA 1CEZA 4N47A 2AYBA 4OYPA 2ILZA 1VQ8S 4DQSA 4DL2A 2YX7A 2YKAA 4DG1A 4OYMA 2E1RA 5LJ5Y 3TEHB 1DTTB 3UCZP 2ZHBA 1F5BA 3NLCA 4JUZA 4YFUA 2EK1A 4CLYA 2HFUA 3QATA 3R5CA 2N4CA 1TUVA 1UL3A 3S8SA 3I82A 2V2ZA 3HT0A 1U0HB 1O0PA 1LW2B 3KK1B 2CJKA 5DM6Q 2H65B 1SQFA 3GIIA 3VZIA 2W2PP 1ZA2B 1IBKF 5A8WB 1C0UB 4ID5A 4KTQA 4WU2A 2VL1A 3NEKA 3DRPB 3HLUA 1QD1A 1RAEB 1IBLF 5KFGA 3HZGA 4F4XA 3D0GE 4ECVA 1YSJA 2AP6A 5D8HB 5HQLA 4B3SF 2JEJA 4H4KA 1X0FA 1ZPVA 1HD1A 3QBCA 5E2QA 2HHTA 1B4SA 4KO0B 3NCPA 3NMAA 4FXDA 1TV6B 2DVIA 1FJEB 3DDNA 2VV5A 3GFHA 3CJTA 1KOOA 4A8XA 4Y2AA 4DX5A 3ETOA 4ZPDA 3NOGA 2B5JA 1S9EB 1NK0A 3BGRB 4FPIA 1FFGB 4NXNF 2MQLA 3D1HA 1XMOJ 1FRXA 2DT9A 1C0TA 5M2PA 2H5JB 2JL9A 3CEDA 1KNZA 1BUXA 4FYYB 2R7XA 3IWLA 1RTDB 1HYSA 2BJ8A 3LP0B 1OYEA 2DPIA 2A1BA 4USIA 4URSA 4IO1A 2J0XA 1HI0P 4DSKA 5F8IA 2VQFJ 4JV5F 1N36F 3I87A 1B0PA 4IOBA 4B9LA 2MZ1A 4R5PB 2OPPB 4PCQA 1RKIA 2CAJA 4ZVUB 4LFCJ 4M1KA 3RG6A 2MHEA 2HW3A 1QM9A 3M8RA 4ZIVA 4KKOB 1HI8A 1U26A 5EWEA 3OQ2A 4TYAA 2HEKA 4PG7A 3RGIA 4C6AA 4IKAA 2Q66A 1HHQA 1B99A 2IRYA 1Q8LA 1HNWJ 1R0CB 2HKEA 1AW0A 2WB4A 1TAUA 1YBTA 4AL6A 3MCMA 3GJTB 2X1AA 3TJ9A 3OVBA 1QTMA 1EQMA 2AU0A 3ENQA 2BMBA 2MKCA 4F04B 2ZKUA 1LWCA 1U1PA 4K4SA 5HN0A 2BJEA 2AHOB 2ZH1A 2GCFA 1NRKA 2KTQA 5C5JA 3SI8A 3K59A 4A46A 3I32A 1RWMB 3W66A 4LF4F 2B8PA 3DI6A 5HLFB 1YRTA 4OMFG 2OUGA 2HAFA 3ZC4A 1VI7A 2L9DA 1CJUA 1XERA 2HZAA 3R6LB 2NQPA 4NLTA 4ZP8A 2V2VA 4LF8J 2DRAA 4X4NA 2GMLA 3SBMA 2YPZA 3O5TB 3IBCB 3CDWA 3IGVA 4UUXA 1T11A 2ZFHA 1T9YA 5EHHA 1FNXH 3D68A 4NLVA 1YJNS 2XG8A 1H2TZ 3CD5A 3K0JA 4PPZA 1ZS6A 1T7PA 5DQIA 3CIMA 2R7OA 2BV3A 5FIIA 3HVAA 1YWXA 4P6QA 3MEDA 1SIZA 3K89A 2E9ZA 5A0YB 1EARA 4O23A 5E33A 3ULHA 5HO4A 1JKHA 1YZ6A 4O4RA 2R7UA 3MM8B 4ED1A 2RNEA 2ABYA 2PDAA 3EZOA 3I5BA 2VG7B 3OT9A 1JXEA 1PC4A 1HFEL 2QLFB 3NAIA 5KFCA 4RUBA 4C2MA 1RT4A 3VQSA 1R8HA 2W9CA 1SUQB 4YQWA
chains in the Genus database with same CATH topology
2FJAB 4IFVB 1OWXA 1RQ0A 1H7WA 5C25A 5AE2A 1U1NA 3MEEA 3ZZ0A 4M5DA 2RRNA 4J9MA 1WD6A 3DLJA 2SXLA 1IN0A 5KFJA 3J80Y 4F3MA 2ZHAA 1CQNA 1S1UB 3TAMB 4HT7A 3JTOA 1RWUA 3GFZA 5D3GB 2K7KA 1Q86T 4TN2A 3IA0A 1TKZA 2PA8D 1G7CB 3M6WA 4MJKA 1WHXA 3PIOQ 2HVHA 1N32F 4WE1A 4NLSA 3OV7A 2FVQA 3G8SA 2DH9A 1JJHA 1RT2A 1X8DA 4IG0A 2PI5A 2DR8A 1AFIA 1I1GA 2GQQA 2MQNA 3MUMP 3ZZRA 2ZKTA 2UVWA 4CO0A 4I2QA 2GJIA 2O67A 1ZOTA 4FP9A 4CTAA 1QSLA 4OI4A 1YHQS 2O5DA 4NCGB 4QWCA 1UVNA 3I0SA 1VHFA 3BF4A 1ZZNA 3BO2A 4NLQA 1TK8A 1VIOA 1JNRB 5KFFA 4BBYA 2FJXA 4KGKA 2QYCA 3LAKA 4RW7A 4ES1A 3KLVA 3NNHA 2RQCA 1V3SA 1KD1T 3MZIA 4GC6A 2C3YA 2DBBA 3KHHA 2MJUA 4O4GA 4DR1F 1NKEA 3MTJA 2BE2A 3QLHB 4DL0C 3MEDB 3OTCA 3I56S 3EPGA 4G1QB 4YR3A 2ILYA 1FTCA 1YJVA 5KG6A 4UY85 4H54A 1DZ5A 2OD4A 1GQEA 1JKHB 1TP7A 1D9DA 1YITS 2OFHX 1N8RT 3K5MA 1MW7A 1AXQA 2BM1A 2DNHA 2WW8A 4ZVGA 4FF1A 3VAJA 3IAS9 4C0BA 4MFBA 2EG2A 4M63A 1R0AB 2X1GA 1VRTA 2J6SA 3OSPA 3KK1A 3V5RA 4J9OA 2F40A 4NMLA 4DS5A 2APOA 4FN5A 1XMBA 4QWDA 4JV1A 2DD8S 2MZTA 3EXYA 3HP6A 1SIWB 3FQKA 4F2RA 3RTVA 2R2RA 5DLFA 2HHWA 1IM4A 2IFXA 3W2WA 4H4OB 5BYQA 1ZAWA 2VC0A 2E7XA 1LXNA 4URGA 3GV8B 5A8WA 2AYGA 4JI7F 2X1FA 5J1EA 2CQCA 3M9NB 1TL3B 3OR2B 5CYMA 3RW7A 4IR1A 2I9SA 2EFGA 2Q6CA 1X4GA 3GIMA 4NYOA 2FJDB 5J2MA 2BZ2A 3IN5A 3KMQA 4DLGA 3HHLC 3NS5A 4CI0B 4LQ9A 3U1NA 3GQCA 2V9KA 3SSRA 5I3QA 1Z2LA 3BN7A 3G6VA 4A8MP 2BUNA 2ZD1A 3TANA 2HNZA 3FZBA 1YJWS 3F41A 4PXCA 1RT6B 1Y5LB 4K2XA 2C3PA 3MECB 4N8NA 2W9CB 1FE0A 2BYCA 2JFKA 3R5DA 1MROB 3UQSA 4DUYF 2QEXS 1REVB 3DGPA 4FXWA 4EYIB 3QWPA 1HR0F 5C25B 2F9JA 1XMQF 2J6TA 2HPUA 3OJSA 3K5LA 6FDRA 3MEEB 1FO1A 4ICLA 5AE3A 4RUCA 3H2LA 3IWXA 4M5DB 1BQMA 2ASLA 4J9NA 1XNQF 4CH1A 2JEGA 5B7WA 5KG2A 4JI3F 2DITA 2MGZB 4OL8A 5F41A 4G6VB 1Q1KA 4DV4F 1ZETA 4NLXA 3C3LA 4C8YA 3DCAA 1R7IA 5GAEI 2DNLA 1GX5A 1WWHA 3M8SA 2Q3PA 3P6YC 2QRRA 3IC1A 3IWNC 2XWXA 3D1OA 3SV3A 3OVSA 4YR0A 4FF4A 4WE1B 2AYEA 4IDKB 6FD1A 2PGCA 4EGLA 1RT2B 4DF8A 3TVZA 5EX0A 2A10A 2C3MA 3SYZA 1U47A 2FLPA 1H7XA 2DCLA 3THPA 1HL6A 3KTQA 2EG1A 1S1XB 5J2PA 2R9LA 2XS7A 1TVRA 4ECSA 1TK0A 3MEKA 3PHEA 4KGMA 4I2QB 1SJ4P 1Q81T 2HVIA 1Q4RA 2AJ1A 4CTAB 3F73A 3V6DA 3MR3A 2QO3A 3PEHA 4Y3CA 1VQYA 3CE8A 4X4SA 2IVYA 1N5TA 3I0SB 4F26A 4B9MA 2V8HA 3V6JA 5DG7A 1YBAA 4QQBA 1S0VA 4DEZA 3QZ7A 2JC1A 4DV2F 3GIJA 3BSOA 1SL1A 1VQ5S 1UA0A 2UVVA 3HJFA 4TQSA 2RU9A 3G71S 3R27A 1HWLA 2XZWA 2N3OA 3G9CA 4CO5A 4O4GB 4H4MA 1UMJA 4CO4A 2XBPA 1X9WA 4ZP6A 3ENVA 3UPFA 2A3JA 3CD6S 2DNQA 2MZSA 3UD4P 1X5PA 4ZPAA 3I5AA 1U49A 2OJ3A 4HDGA 1H98A 2NUHA 2CJQA 2CVEA 4B02A 3A1YG 3PX0A 3J7A1 3ZZTA 5DGAA 1VRTB 3X3UA 5DQGA 3PKMA 3CDEA 3ZZUA 3MPYA 4PG5A 2RS2A 5LSRA 3PW7A 2K7JA 4GKKF 4FF3A 1UW4A 3MM5B 4DL4A 1OPIA 1F0XA 3SCJE 4C3LA 1FNMA 4BWMA 3O3LA 3GG0A 4G1PA 3Q22A 3GZ7A 3W2WB 2XMJA 4I6AA 4M94A 4B9NA 3L3CA 2B6AA 2XMKA 5GADI 5J1EB 4PWUA 3Q8PB 5CYMB 5B09A 4NA1A 2ZM6F 2R8HA 5J2MB 1U1LA 5E3QA 4TKTA 3H25A 4QR2A 2VFVA 2J9CA 2V4QA 4AL7A 2IA6A 2JWNA 1TL5A 4E98A 2ZD1B 2EC0A 2HNZB 3ZFVA 4O3OA 5T41A 3NP5A 5F9NA 2DISA 3HHLD 3US5A 3FSXA 4IFYA 1T05A 1FT8A 4LUBA 1FEEA 3N4WA 1RYSA 2O3DA 3LQVA 4F25A 4ICLB 1HBNB 2DGSA 5LT5A 2KFNA 4FBUA 1BQMB 4BC9A 1R8BA 2M4MA 3LGMA 4XIUA 2HMIB 1XWLA 5CZVA 3QMQA 2ASDA 3CDBA 3QGHA 4IO9Q 1WHWA 3KWMA 3SMZA 2MHNA 2HNDA 4KRWA 4ES3A 1P9QC 4ATNA 4OZ0A 1SV5A 4QIVA 4ZCLA 3OL7A 5HMXA 3B82A 2ZJPQ 4PG6A 3CMAS 1C2PA 1T3OA 3PW0A 3ZZYA 2P9EA 4K4XA 3AJ1A 4IQMA 4OZLA 4K4UA 4ED2A 1DRZA 1FRLA 3TQ1A 1N5YA 3RYLA 1S1VA 4Q0BB 3VALA 1JLGA 2EBEA 4HHJA 4L6V3 4PG8A 3VZHA 1Q8IA 2GO8A 2LU1A 3K2YA 3MM6A 5IQQA 1GNKA 3C6TA 5F8LA 2C2EA 2DB1A 3D54A 1S6UA 2E66A 2LXIA 5BJRA 3P3DA 5J2PB 2PA3A 3KLIB 1S0MA 2J7WA 1TVRB 5B0BA 1FDAA 4MYUA 3V6DB 2I38A 3IAM9 2IJFA 1S79A 3MM9B 1QY7A 1LW0A 1JLAB 2XI3A 2QSFA 3BSNA 4ELUA 4X84A 2GMHA 1L3SA 1QUVA 1LFWA 3FFIA 4F2SA 4WU3A 3KLGB 1Z4UA 1TFYA 4Y0FA 1KONA 5C42A 5B08A 1NH7A 3CCTA 2L9WA 2JJ4D 1FVQA 1B7FA 2FPHX 2LXUA 4LF7F 4H4MB 4OQJA 2AGOA 2AF6A 2KU7A 2X51A 3HVTB 1DQAA 1VBYA 3N9UC 1TR0A 3THTA 4OJ1A 1OSDA 3EUNA 4KHRA 1F9FA 5D4LA 4D3HA 1D0EA 3U7JA 5KG1A 4ZKAA 4B3MF 3DOKA 3BJYA 4HT5A 2C2RA 4RWXA 4RU9A 2LU2A 1E6VA 2ROGA 4J9RA 3IGNA 4QIFA 1H2UX 4DS4A 1S48A 4F02A 2VPYB 1FF2A 3CCUS 3M9OB 1PILA 3JSMA 4K4YA 4CT8A 2W7AA 4FBTA 3BEGB 5L39A 4A8FA 4ILLA 1UWBB 2DGWA 5KFTA 1NJYA 3WDOA 1X4AA 5HLFA 2NPIA 3VR1A 1KLNA 3TA0A 2IBOA 5L9NA 2GQCA 2RSQA 3M6UA 2MY8A 2HNYA 1LWEA 1RTIA 2V94A 3OL8A 2B6AB 1KC8T 3PO4A 2ZBCA 3MMAB 3T19A 1L3VA 4A8OA 3ISNC 3RR7A 1IUJA 3KLHA 2DK2A 5K9FA 5D4NA 5EWGA 2COLA 4Y2MA 2HGNA 2HFOA 1RAJA 2ZH3A 5KFPA 4ECTA 2BBEA 3CULA 3SQGA 5KFSA 4HEA9 4DMZA 2V0NA 4USHA 5CQGA 4J37A 2YNGA 3M30A 3Q8QB 3RBEA 2FJWA 5KFUA 4QOTA 5HBMA 3CWJA 2CQBA 2OTJS 3LPYA 3QAEA 2W9AA 3T5KA 3PM9A 2G13A 3LOUA 3M2VA 3Q23A 4IFYB 1T05B 4ED0A 2I5JB 4CQ1A 2DRBA 3PX4A 4I69A 2UUTA 3CMES 1TFWA 3QIPA 5E0OA 2DNYA 1S1WA 2I2YA 4LF9F 2DTJA 3DYAA 2PC6A 4OI6A 2N7CA 3GV7B 3FGVA 4YHHF 2GHPA 3TAQA 2HNDB 4N8OA 4ZK7M 2XLIA 5LXRA 4DL7A 2B7BB 2HZCA 3T9NA 4LF6F 1G1XA 3BSCA 1ZBTA 4XAKA 4OHYA 1VQLS 3GMGA 2BRLA 3CCVS 2UV8G 2WONA 4N56A 4BWJA 4V19X 2JLFA 3OBIA 2E1AA 1S1VB 4NLYA 4WFYA 1JLGB 2VOPA 5EGYA 3HHEA 2OFGX 3MM6B 2DGXA 3C6TB 1K73T 4DHVA 2NREA 3LO3A 2E5LF 4CZCA 1HMVA 2EFOA 1P8GA 5AE1A 3GFXA 3OTOF 4N76A 3ONQA 4B3OA 2VKRA 1L5UA 3KNAA 1LW0B 2CPYA 2GFFA 1RJJA 4O3NA 3KYLA 1JB0C 3VTIA 3HVWA 3MURP 2AJFE 3QO9A 1R8CA 2PEHA 1TKTA 4YDDB 2FUG9 1CSJA 3FFIB 2DGUA 5A0YA 4X65F 4Y2IA 2W8LA 2XULA 4Y2CA 1CC8A 2B0GA 3H5SA 3M4XA 5C42B 1E6YB 3C6UA 5FDLA 5KFWA 2KM8C 5B0AA 4DFKA 2B4OA 5D78A 1RYRA 3PY8A 3I4PA 3LW5C 1VQNS 3MM8A 2WTFA 3MD1A 2GIQA 4P7VA 2MPUA 2LCWA 4NL5A 1HWKA 2WCXA 1X7VA 4K4TA 4YY3F 3B4MA 3DHWC 3G96A 3OHAA 2M52A 1JIHA 3TR5A 3IR5B 5GAEU 7FD1A 4KJIA 3DOKB 1E6VB 5DETA 3CDAA 4DV5F 4LF5F 4R8UB 1T95A 1UAWA 2XMMA 4RUAA 1QSSA 3TUIC 3JSMB 3SCLE 2R7QA 2ZOMA 3O6QA 3DRXA 5KG3A 4EWTA 4J9LA 2C28A 4WFNQ 1HHSA 1U1RA 3Q2SC 5M2RA 3BN4A 4UQTA 2MKIA 2JLEA 2EI5A 2FC9A 4QPTA 3S6EA 3M8QA 4EU0A 1S10A 5DLGA 2RRAA 1VK8A 4JI5F 1RA7A 2CQ2A 2WSFC 1DLOA 4I4BA 4TQRA 4EBDA 2A18A 4DFPA 3MDFA 5EDWA 3CJ4A 1HWJA 1LWEB 1RTIB 2DGVA 2HNYB 3LGNA 4GO7X 1SKWA 2FLNA 5LMUF 1F2GA 3TARA 1Q16B 1X9MA 2HGLA 1WG4A 4ETXA 4KT0C 3KJVA 5AJ3F 1TL1A 1D1UA 4C8OA 3KLHB 1XR7A 4C8LA 3L95X 4KE5A 2LVWA 3TA2A 5EX3A 3PJWA 3Q24A 4J9QA 2G1DA 5B0DA 5SUHA 4O44B 3IG1A 3SQGB 2ZUGA 3UFCX 3ISND 3V81A 2YNGB 3M30B 2OTLS 3GYNA 4C3MA 2UVUA 4OJHA 2R8GA 1IJFB 5HBMB 1S0NA 4DBQA 4MH8A 5KG7A 3M6XA 4EBCA 2MZRA 1GXUA 1N6QA 5B0FA 4B3TF 4IR9A 2Y1RI 4C8KA 3AHPA 1S1UA 3M2VB 1RT7A 3TAMA 4LVNP 1GT8A 2YX1A 1HWIA 5KG5A 5D3GA 2IMWP 5GAHU 5GMKa 5L9XA 4GO5X 3CCMS 3QIPB 1S1WB 3PACA 4PQAA 1WEXA 3DYAB 5JVGQ 2CJAA 4KHMA 1LQ9A 2RF2A 3PXGa 2CRLA 2LMIA 2MXYA 5AXMA 3IBWA 5A8RA 4AE5A 1KTQA 3MPVA 1GXLA 5GADU 1GX6A 3QYYA 5A8KA 3PIPQ 1DQ8A 3H20A 2X3GA 4KR0B 3MOZA 1FXRA 2C3UA 2WONB 3G6YA 4M95A 3PW4A 2O66A 3UR0A 4YB6A 4NCGA 2V9WA 2JSXA 3RB0A 4K59A 1PO6A 1D8ZA 4CH0S 4I7FA 2WSCC 4KPYA 2CIMA 5KG4A 4B08A 1KQKA 1HMVB 1GTEA 2IM1A 2NR0A 2V4JA 4PXDA 4WFXA 1WF2A 1UA1A 3KMSA 4B3OB 1W2BR