4OJDH

Crystal structure of a c-terminally truncated trimeric ectodomain of the c. elegans fusion protein eff-1 g260a/d321e/d322e mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
477
structure length
444
Chain Sequence
RAEPPHCSKTPIVRAQTSQNAMGMQMQFSIGLHTAVCFRLYSLLHTIRLEKLEHHHPITQRYTFGIPEVHASCICECDATSSTCTAESHQFTACPEDETSSCYRTFFPNQTPIGCSEDDIPKLCCDVRFKPYKNMTFLAVKLEQPTTYATFVYAAYDFVNGYWVEKDKTKIRSQLDGGTQDRHLDQKRRISLAVTAGARASHQLETGMYFSRTSNGGETEELRMQPLNEITDNNFDRLGWYRMDDSGHFHVNNGVVKMEEIHKAKVKNCKEQTYKSILSANHYMPGHFNLTRPLEVIKPWIQSARIFDSSLRQAVVTHAEGTNLQISIHLESQNLVFFHNASRIRDFSGSIIVDSKSNRLFNLTVYEASGKIDGSVKMSTGFGSDTIHTFTAYVSDLHASNRSMIIPLPAIVGQGARAICLRADSMADIDKICHVIEYFESPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of eukaryotic cell-cell fusion
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Membrane protein
molecule keywords EFF-1A
total genus 98
structure length 444
sequence length 477
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ojdH03
2.60.98.60 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein; domain 1 4ojdH01
4OJCA 4OJEH 4OJDH
chains in the Genus database with same CATH superfamily
4NN6B 4JG0H 4LGSB 1FYTE 3MRMA 3UJJH 3VRJB 5JHDD 1E5YA 4NZJA 3OAZH 3V4PH 1E5UI 2QVFB 4PRNA 3SO5A 3IBOA 4YHNB 3WTUA 4Y4KC 4P3CL 3RDTC 1O7VA 1RPUA 4X6EA 4GJTB 1TPXC 1G7HB 2PO6A 3O3DA 3VFPA 4Z7NB 2R15A 1X9RA 4G9FA 4AQ8C 3P30H 1JGEB 1HEZB 2F7QA 4OCSH 4Z7VE 4Y88A 4LARL 4B0MB 5BJTB 4JM2F 3QJHA 4EI5A 5IHZB 3MR9B 3ZUNC 4I87A 3NZHH 2GK0A 2K7PA 3MJ9H 3VI3E 1A7RH 4AQAB 3MOBH 2VR9A 4P06A 5F9AC 2A83A 2IANE 4U6HA 1VAHA 1E5ZA 4FJ6A 3TEWA 4P57A 3FT0A 4I0PA 5T3ZD 2P3YA 2VRQA 1XAKA 4AZUA 4W70A 4ABUA 2DWSA 3GLDA 1Z9NA 3H2WA 1JZJA 3MRQB 3FUMA 2CXKA 1S2EA 4H0IA 2IAMA 2XPGB 5AYUL 3WTVA 1GYCA 3EJSA 2RTTA 5BRQA 4PMFA 1FHNA 2C9XA 1KIUB 3W9DA 3QGVA 5EU6D 4BXVA 1ZHBA 1KB9J 3A6CL 3NIGB 2YFOA 2A6DB 5ADOL 1I8MA 3K2IA 3K72A 2WXKA 2YAOA 3CFJB 5TDPB 5DVKA 4XNYH 2ENQA 2I07A 2ZX9A 4Y2OA 1OQOA 1HOCB 1E40A 5F1IA 3IS0X 5KG9A 1L0PA 1FZOA 2IO5A 5LXGH 3HG0A 2XQYK 4HV8A 4HKBB 1OSEA 3CCHB 4FFYL 3V6OE 3UO1L 4YSPA 3N1MC 2AJUH 3RLSA 1A2YB 1R24B 3QG7H 5IVNA 4CC0A 4YDKL 4AXWB 1T0NA 5AVRB 5IMMA 5KBKA 4P3DA 4UTBA 4AYMC 2R0LH 3T3PF 4OM0L 2ORBH 3LPGA 4IK7A 4OZGE 3QDME 5KN5A 4W4OC 3V79C 4P4KB 3WEMA 3U1PA 3NK3A 3ARQA 3HS8A 2IADA 1MFAH 1SUHA 4TTDC 4K9JA 4DGIL 5DMIL 3HZYB 4QD2E 4YO0A 5FGBC 1J0HA 3MN8A 3Q1SL 2DRUA 4OIFA 1W8EA 4KO7A 4C4KT 1DJHA 3LN5A 4PJEF 3KPPB 2B59B 3V6FB 1QPXA 2OX5A 2EYSB 4YLCA 5BS0A 3JYCA 5HVHB 1P69B 2H6PB 2C9UA 3FMGL 1B0GA 3C60B 2YGNA 1F4XH 1U8JA 3QEGL 4PJDE 2Y1YA 1JF5A 2HN7A 3IFNL 5DVOA 1H0DA 1OB0A 1BVLA 1A7QL 4FZEL 2C8NA 4ZZFA 4HUMB 3AG3B 2EE0A 2Q20A 1AJ7H 1QLRB 3BO8B 1AZBA 3D7PA 3APCA 4JZJC 2A9BA 2WJ7A 3AW5A 3JV5A 4KJYB 5H37A 2ZCKH 5GS0L 1NLDL 3L08A 4L0YA 3O2DH 4NQCE 2OYLA 2HLEB 1ZV2A 4LFHD 5DFVC 4EIUA 4J12A 3GSOB 5CJQL 2IPTH 4ZQKB 5EUOF 4BZ2A 3I50L 4ZAKC 1UEMA 3MLYL 3K8LA 3WJLC 1O7DC 3EIFA 3NJVA 5GISL 3MXVL 4WTWA 5E6IA 2NUTA 5MHSD 3ULVH 1F11B 3ULUH 5CZKA 3GSNH 3ZYJA 3TIDB 1H6FA 1B0IA 3PL6D 4AV4A 3RHWK 1WQVT 3HE7B 1H6EA 4JVWA 1KB5H 1NCIA 2ROYA 2VZOA 5HJBA 1RUQL 3ELAT 4N5EC 4FFTA 2VQUA 2AQRA 2GB2A 4MWFB 2OTWB 5LG6A 1PY0A 4MQTB 4FJZA 1KEML 4QRRE 2EEDA 1HL9A 3ML9A 2KZKA 3FN9A 2YSSB 3GKWH 3CH1A 5HGGS 4APQD 5GZNC 1XHHA 1Y6KR 4GSDL 5LJYH 5AEAA 3H9ZA 4GQZA 1SHSA 2A74B 1DJWA 4OLEA 3SE3A 5E4EB 4XMPL 4ALAL 5ID0B 4PWIA 1A1MA 4CVWA 4G43B 1OD7A 2YHGA 4DQAA 4WHTB 3K2KA 1KZYA 4V2BA 1U3JA 2B15A 3CNKA 1I9RL 3DDGA 4OLYL 4GOSA 1E27A 4UT7L 1F6LL 1BHGA 2AK4E 2YGOA 4CBPA 3MYZA 1H15B 4I18A 4M9OA 4R97B 1HXYA 3DO7A 1BVKA 4IU2B 1T89A 1IBGL 1NKGA 3LPFA 1HCFX 1WWBX 1F4XL 3C8KB 3TWCL 1IGJB 2EDOA 4GKLA 2KDYA 2KL6A 4JVPA 3HPJB 3QFDB 1XZ0A 2YN5A 3QI9C 4HQQL 3UXFA 1W8OA 5CLTA 3UTSD 3MAWA 5I8OL 3U4BL 4N87A 1AS6A 2E47A 1DN2A 1H19A 1MHPL 3KBHE 2NXZB 4YE4L 5IGXL 2I27N 1NAMH 3BEVA 3KM2A 3T3MB 3QDMB 1KJVB 1IGIL 1XF4A 4LDLB 1IE4A 1MNUH 4XMLH 1NEUA 3VGBA 2B1AH 3GBLA 3LY6A 2J1XA 4E36A 5FYLL 3ZZLA 2MCPL 3FO2B 5CEZL 3KWXA 5T1LD 3CJJA 3RRQA 4OF5A 3MRFA 2XTSA 1BOGB 3QWOB 4UT7H 4BCZA 1LLAA 2DWDA 3BUQA 2JELL 3MRLA 4G6ML 4KXZH 4F15C 1KXVC 2DV6A 1DUYA 1KT2B 1QTPA 4PJAE 2B1OA 1KB5L 4PY8J 3BEWB 4R2GD 4DZ8A 4U3SA 5J3HD 5EOQH 4NXSA 1T1XA 1W16A 1CDIA 3KH4A 1KCBA 4HALA 4PJDB 3TBBA 1M1XB 2IOMA 4B9KC 5L9DH 3HAEG 5D7LE 4FL4B 3K3QA 4KDTA 1MCEA 1WA2X 4IBTA 4M4PA 1JZ7A 4GSDH 2CNYA 1F5WA 4C55A 1NIFA 4JFWA 1MCSA 3GMRB 1W8NA 3N1PC 4XMPH 1E3FA 4GW5A 1ZJAA 2DLFH 2KHAA 3LX9A 1CR9L 4X98B 1EHLH 4NUMA 2ITDB 3MBED 3U36B 1X6LA 5CEXA 1P6WA 4K5LA 4MMZC 4ZFOA 3FFDA 1CICD 2BOBA 3HC3H 4HKZA 4N28A 5J5EA 3LPOA 3BPCB 3E1ZA 4OFIA 2DQIH 1CFTB 3X13B 3SBWA 3IMBA 2Z0BA 3NABL 5CZVL 2IJ0C 5DDHB 4PB0H 3UCQA 3DV6B 2ZKHL 4H20L 5J1TC 3VFOB 1H5BC 2F53E 2G9HA 3ORJA 3Q8EA 4GS7B 5ETUA 1KJ2A 1JNHA 4NO5B 4Z0XB 1P5UB 5I71C 1PDKB 2O93L 1WFOA 2ADYA 3UIYA 4ZXBA 1EFXD 4WK4B 4MB3A 1R33A 3X11B 2BSBA 2HTKC 5E6RB 4U7KA 2OQJA 4YFLF 3VCLB 3W81A 3DYPA 3FCTB 4WWKC 3AU1B 4NO0A 2Z31A 3G04B 3TN0B 5J06A 4ZS6D 3F6IA 4B5EA 5HGBB 1S7TB 3KZ8A 5KVGH 3BSHA 4AC2A 5I82A 1UYWL 1RHHB 4LLVB 2F7RA 2IQAA 5CGYD 3EG9B 4I1NB 1DVSA 2L7UA 3KLHC 3BAWA 3PGFH 2QVMA 2EDRA 1KCRH 2X6BA 4X9GA 1S7WB 3LEYH 4NFCA 5T5NG 4OI9A 2R29H 3GMMB 5IIEB 1OGAB 4BHUA 2FE0A 3PFUA 5AOIA 3RZCD 1BBJB 3D18A 1AD9A 3GXUB 3LKNB 5F6IC 5HGDB 2VLKB 3DGDA 4NJ9L 5EZLA 3GO1H 3HW7A 2JQZA 4TQEL 1NEZG 3PWJB 3MYJB 3WI9A 1BFTA 3ECQA 3ZDYB 5IHWA 3TNNA 3EW3B 4AENA 1JZ2A 5FUZL 4F33B 4H8PA 2QGBA 3T1FA 2FX7H 3BVTA 4NZFA 5AALA 1USZA 3IXTB 1AXSA 1TCMA 2GJ6B 4LNVA 2HB0A 5AL0A 3EXJA 2K3TA 2UXFA 1A25A 4LRIC 1NFDA 4PJHA 5KVDH 1CZ8L 2D31B 3PL6A 1G1CA 3JVGA 2EKSB 1FYHB 4Z7WE 1KWGA 5E9NA 1LWJA 5CCKL 3KPSE 3KYNA 3G5VB 3CSBA 1KC5H 4D9RD 3E7JA 1RZKC 3CHOA 3MV7D 4F58H 1QVOA 3HG1B 3NJHA 1BFSA 4TTGA 1IBBA 5TK4A 2ZP8A 1K85A 3SDAB 1M05A 1NDGB 3FRUA 3TYGL 4KY2A 1T7YA 3KL3A 3QR1A 3L6FB 4MJ5A 1MJUH 3MODL 3EH1A 3VFMA 3UZQB 2DM7A 3AQZA 4UM8A 1I8AA 1TUPA 4KO9A 2CM5A 3MFFA 1FWXA 1RJYB 4XI5D 4N0YL 4P04A 1FNAA 4RQQA 3QUMA 2EO9A 1IZKA 1ETJA 2UZIH 1M7XA 4NN5B 2Y3AA 1ECZA 2XCMC 3MZGB 4MJIB 1T3FA 4XPHH 4X9FA 4FTDA 5J11B 1OCWH 2HMIC 4IMKC 3IPBA 5H4YA 3KEDA 2EDBA 1FE8L 1NCUA 2VDKB 3SYAA 5BVPL 4YZFF 1Q0XL 9PCYA 1KJMA 5CSZB 5BRZD 6PCYA 5L8KB 4RGNB 3FOMB 4IJ3C 5IMLB 1J0ZA 3IJHA 1KFAH 1YN6A 2B1AL 1VFBA 4EDXA 2ZF8A 4U31A 5IHUL 4FFYA 4HWEH 2XA3A 4YDKH 3FUHA 2BFGA 5CLZA 2K9UA 1NBVL 3NGBC 1G1YA 3SQOL 1CU4H 4LSQH 3LDBB 4XCNA 4IMLB 3HB3C 4J1UB 3RTLA 2Q76B 1N19A 4FCHA 4AW7A 5I0XA 3BPLC 2WLKA 3O6KL 3VH8G 4AV0A 1XSJA 3NTCL 2ZWNA 2HLFD 2D03H 3DETC 4FRWA 1WAPA 3REWA 1C1EH 2EXTA 5K39B 3DSNB 3NSCA 3CHPA 1ACZA 1PW3A 2P5EE 4MNHA 4QYAA 5J4MA 5E08L 1AMYA 2VMCA 1BQHA 4LLYB 1GS8A 3QXWA 1S7XB 3B7RL 3GZPA 3RFZA 1HYRC 5D7IB 3O0RL 5IKCA 3BQUC 1MJ7H 1YNLH 2BXZA 2PYFA 2RQ8A 3BAXA 5HYJE 3CD4A 3CSPA 1X4XA 3OJ2C 4BFFA 1XO8A 1BBDH 1JV5B 1BJ8A 1I8KA 4NQUA 1KPUB 4LKXA 1XB6A 4UDTA 5D4JA 3ML8A 4HIIA 5T3XH 3RDTB 1VFAB 5IV2A 1ZPUA 3X12B 1QBBA 3J07A 3QEUB 4MNQA 4QHMB 3HG2A 4Z7OB 1MREH 2RALA 3SKOA 1Z0MA 4FQHB 5EF0A 3MV9A 4R6UA 1L9SA 1DBAL 1BJ1J 3BIBX 3RGVD 3D25B 1G7LA 2VAJA 1XF1A 3QCUH 3QIWD 5CJQH 1ED3A 4EO5A 2OP4L 3LPWA 2MEJB 4M3HA 4FLSA 3CQFA 2BP8B 1JXDA 1WAEA 4K23L 3K2UL 4KK5C 3NTCH 2W07B 2WM0A 3KPSD 4H44C 4F20A 4LMQI 2XA8L 4Y2DC 3V4PL 4ANUA 1RZJC 2VDKL 5K9OB 4P05A 2MHAA 1OP3K 2Q87A 3LHAA 3MO1B 2HVBA 3VXUD 4U3HA 3ZQ9A 2VIRA 4DOHB 1UXLA 5IBLC 1AI1H 4HHGA 3PWVA 5DWUL 4HVBA 5DJXB 5JXEC 4LCIL 2ZYIA 4N8CH 4ANKA 3QUYA 3R18A 5AW4B 2XN2A 3WNKA 3JWOL 5H4ZA 2HLFC 3DETD 3GIVB 1OAQH 2HG5A 2R2EA 3QDJD 4Y9GA 3DVFA 5DEJA 4UV7H 4PV8A 1MCPH 1KXTB 3GF8A 4L3ED 3CMGA 4LCCC 3S3PA 1EFXA 2VUOA 1TU2B 4ZFZA 5JXEA 5EHFA 4NRZB 1UEYA 3X3GH 4WEBH 4GPVA 1A3ZA 1J1XL 3ARGB 3QH3B 1NEZB 2C5DC 3B8YA 4CDHA 2KH2B 5IFAH 2OTUA 3EH3B 2D03L 3CLFL 4XTRD 4KITB 3B9KD 3LH2L 4JFDA 1SXCA 2DMGA 2VXUH 2N01B 4FHJA 4JPSA 4ZUSA 4UT6H 1ZTXH 5D7JC 1FVCA 3EYSL 5FUZH 1NGPH 2ISDA 5BMFH 1E6JL 1CGYA 1HNFA 2NY0B 4KHXH 4L4TE 2GIXA 4H4NA 35C8H 3K8KA 5GGSB 5I5MA 2CPUA 1TITA 4ZUWA 3HC4L 1E5BA 1GSKA 3H7BA 4GQRA 1HYSD 1G5AA 2JNZA 4G9DA 3RIKA 3G6JA 5F88A 2BZ7A 4BXSV 2AC0A 2NTFA 4U1LA 4CJ1A 4CKQA 1KGWA 5KS9A 3L1OL 5DVPA 1R17A 4M4RA 4S1SH 4PJXF 4ZX6A 4QRFA 4IHOB 3H1ZA 5EFIA 3DHJA 2W0PA 5D1XA 4HWUA 1NGYB 3H6AA 5J6GB 5EPMA 4JAMB 5D8JH 4KY1H 2VR7A 1UD8A 3K81A 3UABA 1SN2A 2G60H 2PW1B 1BQ5A 1O6SB 1XR8A 3CDCA 1A66A 2L0DA 2W38A 4X9YA 1U3HB 2ZOKB 2AEPL 2XWTA 3VGGA 5E0FA 3GSWA 3OR6B 5E8EB 2VE6A 3VE0A 4JJHA 2J71A 4PV9B 5A3ID 5TE4H 2W5PA 3QQ9C 1AYRA 3LS5L 3HPLA 1SXBA 5HYEA 3NN8B 3WLBB 5A6LA 3K6FA 4G7YH 2IVFC 4WI3A 3CVHB 4IM8A 3UROR 1K4DB 5DJYA 4C4KO 1JDDA 2RCSL 1P84J 4MAYC 5IVXA 2AJSL 2OXGB 5MENB 1AQDA 2D2OA 2EZ0C 4HMCA 4LARH 2EXWD 1J8HA 3FT3B 1QFWL 1USQA 4H8WL 5KJRL 2QGCA 3BLKA 4IRZH 1JZHA 2R2HA 1QFWI 3T0XA 3BZ4B 1RULH 1P7QB 3INUH 1Z66A 3PHQA 4UM9D 1FDLH 4HUXA 4XVSH 1CU4L 1NGZA 4JM2C 1JWMB 4ILDA 4LSQL 2EDTA 1Q0YH 2JKNA 2PTTA 4DP5X 4TPRL 4K3JL 4UV4L 6PAZA 2ZAGA 2X89A 1ZAGA 2DQIL 1GGIL 4OM1H 5JUEL 4L8DB 3DBSA 4M7KH 5B39G 4JRYE 5MERA 2IBZY 2VISB 4PJ9D 1YPZA 3ARBD 5AQ0A 3GRWH 2WKLA 5LLIC 1A7OL 2B4CL 2HVJB 2IGFH 4AUUA 3IGLA 5CR1A 2V33A 2ODIA 4CMHC 3I6KA 2VABA 4KRPB 5E08H 4AMXA 3F65A 2ITEA 1F90L 4Z76B 4U1GB 4FQ2H 1T5XB 3P4MB 4I5BB 3B6SB 3CXDL 2C9PA 1UKQA 1UENA 2RBLA 2NY2D 1OWWA 4LIQH 4X4MA 1GW0A 1IAKB 2WWNA 3JT2A 2FX9H 1VERA 3ZE2B 4PG9A 5KW9L 3HE6B 5FUOH 4JB9H 1PLBA 4Q9RL 4JEGB 1T66C 1QSZA 3P4LA 1GZQB 5LBGA 4E42B 5KVGL 4G6KH 4XGZA 1MIEL 3L9EA 4FG0A 1YMMB 43C9A 1LK2A 4ZTEA 4AM0Q 1JWSA 4HIJA 4XMKL 3E1F1 1L6XA 3FQWA 4OLUL 4GXUM 1C12B 2BSCA 5EBWA 2JXMB 5KUKA 3T0EA 4ELKA 3LXUX 4PS3A 3VWJC 4RMQA 2WGXA 2IXQB 3DK0A 3O41A 1SF5A 5AW6B 3UTQB 4YE0A 5F7WC 3MCYA 2K78A 3CFEB 2VUKA 2JIXB 1G9NH 1QSFD 2CHWA 3NSDA 2CMRL 4LHUA 1DANT 1WD8A 1UD5A 5FO9A 3ZR6A 3K1DA 3S8WA 4CVXA 3UDWA 3WFCH 2E76C 2F1BA 1C5DB 4LEBA 4QXVA 3T1WA 2ERJB 3VXNB 4N2DA 3F7LA 1BAGA 4PWJA 4EUPA 2QBWA 5ECGA 1TMCB 2A2QT 4P5MA 3NCJL 3QEHA 1PNCA 2FO4A 3G6JF 1E42A 5DU7A 4C54A 2DAVA 4OR1A 4L4VA 3F2LA 4JO3L 4JDZA 4LSUL 5B39A 2YXVA 3QCVH 1XX9C 1JHKH 3FT4A 1ERNA 5K9QG 5CINL 5I1AA 2DM3A 1KCSH 3VXMD 4NQDB 2WLLA 3WTSA 4NDMB 4R0LB 3ES6A 1KV7A 1I9JL 2PPAA 1TQCC 5BXFA 4J6IA 3PXLA 4X7SH 3UC2A 2C34A 4JKPH 1DBKL 2GVYA 2F8OA 2Q7YA 4MLIA 3QIBB 3QYNA 5T3ZH 1UVQA 1L9TA 3KLQA 5FV1L 3MLVH 3GUTB 1XD1A 4J27A 1FNGA 1XR9B 4IJTA 2FNBA 4ZPVB 4EIGB 4Y16A 5IM7B 3FQNA 1H5BA 4PRIA 4LSTL 1AY1L 5EU4A 5E2WL 3RX8A 1VRSA 4H1LA 1R5VA 4PBXA 1HILA 1SF3A 2XXMB 4OJYA 4YC2C 5LGJB 3NCYP 5DZLA 4DGYH 1S7UA 2DWEB 2WHVA 3NSXA 2KZWA 3FSZA 1KDJA 3EO0A 2VZVA 3HLKA 4XZUB 1QSEB 1Z9PA 1J5DA 3L3JA 2WP3T 3L3GA 3M7FB 3BZEB 1SLUA 2XVLA 3SDXF 2DQJH 2X4QB 4ZS7H 1JDAA 3B5TA 3MNZB 2H1LM 1F02I 2JJTC 4ZRGA 1VGEH 4Q6IC 3BLPX 3D52A 2AQNA 2FYYB 3P11L 1B4JH 2WLYA 4Z7OF 3K6SB 1CL7H 1UB5B 3L54A 4ODHH 4ZAKA 3VDAA 1M42A 1EZUA 2DICA 1NBVH 2WIIA 1M2VA 2BVUA 3GSVA 3QZPA 5I74B 3TEUA 3CDGA 3T2OA 5I75C 4HF5L 4QOKE 4LLWA 2E27L 3U2HA 3QRGH 4U7SA 1IVTA 5LCVH 2XX1A 1WZAA 2QZ5A 2HT4C 4BCYA 4XXDB 1NFIA 3X14A 3ATEA 4HETA 1G7MA 2ZOUA 3B4NA 4FTVA 2CIKB 1OW0A 4IU3B 2AEIT 3SE3C 2DZEA 2WZPD 1WPCA 2GJPA 2CIIB 1KTLA 4JFVA 5B7FA 1BW8A 2YQ2A 5CHNB 3EJTA 4D7BA 3RTQA 3ZPDA 4KZEH 4Y0GA 5TF1H 4N2EA 2IBZX 2HJKA 4F7EA 5I8OH 2NCMA 4DFIA 1CFBA 4L3CB 2HJFB 2APVA 3RWHB 1FZMA 3PAYA 5HHVL 3W5NA 1F1DA 2H1XA 5SWZB 1SJHA 2VXTH 1ZVYA 5GRUH 2J72A 3BWUC 3T77B 3B2MA 2BOCA 3O3AA 1K8IA 2BSDA 3TO4A 3AS3A 3U0WL 2ZSVA 1CL7L 4XOBA 5E8OB 2WXGA 3VWKB 3MJ8A 2N1TE 2IH3B 2PWDA 4XP9H 1OAUL 5GGRY 1THAA 4L3EB 2EO7A 5DJDA 5EIIB 4PI2A 2B0SH 4RGOH 3WE6A 2J8UA 1S5HA 1X5IA 4KROC 1HEZA 4PJFE 4Q52A 4G59C 2LLGA 2WXPA 1JF1A 1NWOA 4JANB 1BPLB 5DHDA 3NCBB 2JI3A 4KKNA 1EJ8A 1A9BB 5H35B 4ATWA 1MEXH 5KZCD 3EGSA 4DGYL 3KVPA 2A83B 3Q2VA 3GIZH 4PJCE 5GGQH 1MW1A 5BNXD 4GNKB 1YA5A 3ZDXF 2B20A 3MROB 1RK7A 3MTRA 4FC3E 4QWWD 3STBA 1D7BA 1O75A 4I77L 4DVRH 1OAYH 1CC3A 2YD0A 4QDGA 5FM4A 5GIRA 4I89A 5HHVH 2FQGA 3MRQA 3T3PB 2VW7A 1ZXKA 2BK8A 1UWXK 2LGNA 1M7IB 1N7MH 4LF3A 4WU7A 3AACA 5CWSB 2E7LA 2F9BT 3A67H 3IGFA 1BAFL 1FIGH 4LRNL 3BYYA 3PDDA 4ODTH 4Z7UF 1SHMA 1I8MB 4PUBH 5DRZB 5GISH 1A14L 1IT9H 3P0VL 4O02B 2ZSWB 4LVNB 4K94C 5L2JB 4W4OA 2ED6A 3ZDXB 5CJBA 4HYTB 3T5WA 2UXGA 5FW7A 4JFEA 5CUSL 3DRQB 3AXIA 1ZDQA 2PLTA 5HYSA 5JW4N 1PY4A 2IDFA 3HUJB 1A2YA 1R24A 4JFHE 3BPOC 4JRLA 2DH2A 4BZYA 3D06A 1J8RA 3HCVB 1E5AA 1OE2A 4MVBC 4APQA 4TRPH 5LWYL 1PGRB 3FU6A 1AGEA 2K8MA 4JRXA 4ZDHB 3TT3H 2DLIA 5ESQB 3CSYB 1AHWA 3LKQA 4LQ1A 2IADB 2SODB 2NQ3A 1EEYA 1WCBA 4IEFA 1UOKA 5C9JB 5ABZA 1RJCA 4YDVA 5HHOB 1QLEL 1B2WL 5JW4Q 3NZ8A 5A43C 2ZE0A 3QG6A 2WLIB 2G2NA 1JZ8A 2FSDA 1UA3A 3EGXB 2FQEA 4XE5B 5F7HA 4BQ6A 7PCYA 4TULH 5FKPB 2I32A 1TQTA 4M00A 1S7VA 2VSDA 4KJQC 1JMZA 4KJPC 3EH5B 3DA0A 3UPRB 1NQBA 5I2IA 2EYSA 3ILQC 4J2XA 3I84A 4M7LT 4ZMZA 1NMBL 3DURA 1D2PA 1Q90A 4I0PC 4QRPE 5C7XH 2J57A 2W9LA 1NC4B 2A7BA 3PV7A 3X1GA 1AC0A 5HYQB 4WV1C 4PB9L 1CO1A 3OHMB 4W9ZA 3JVFC 3GMOB 3LRSB 1CUOA 4KV5F 3LN4A 4KK9D 1R4XA 4MHHG 3T0AA 4OCNC 4ZZKA 1A3LL 3MLZL 5JORB 4AW4A 1JK9A 2BNQA 2XXGA 3GJFA 2XKNA 3DX7A 3V6OA 4Y4KD 3L5JA 2FJSA 4EVNA 2RJMA 3TX4A 4JY4A 3DVGB 3R4RA 3AABA 5A2LH 4HEPA 2WXQA 3D0LB 3S5ZA 4ZQKA 5C0JB 4XR8C 3ZTDC 1IGFL 4PS8A 4ZBJA 5E6IB 4N4YB 1TTBA 1GTFA 1KBGH 5DD5L 1A6WL 4LP4A 2IANB 4K5OA 5CILL 1KNOA 4EKJA 1OAZH 2ESVB 5B8CC 6TAAA 2K1MA 5JW5A 4N2AA 4TPRH 4JDVA 2A6KB 5CD5D 1MHHB 1OQXA 4Q9BA 3IFLH 2WJ5A 3GSUA 3BUPA 2FEDC 5BV7C 4R5TA 4OFVA 5LQBL 2PN5A 1MDTA 3P1VA 4MD0B 3X3FL 1RZQA 4IOIA 5ILTH 1E8ZA 1I1FA 2YBGA 4H40A 5GSRB 1N67A 3SCMC 2Y1AA 2AQQA 3G5YB 2M83A 5IR1A 5E1IA 1YSOA 3QUXD 4S1DC 1RZKL 1V7ML 5EIIG 2ZUXA 1I8IA 4MXVF 4YHKL 4XVTL 4L8SA 4P2YA 3TNMB 3AROA 5FYJD 1JZ3A 2YPLA 3H4HA 2G30A 2AZAA 3OKOA 2NY6C 1NA8A 4N6RB 2WXLA 3MBEA 3WN6A 1E4WL 3SKNB 5C8JB 1UXSA 4NBXB 4TV3A 1I3GH 4FTVD 3EJYD 4NO3A 4PCTA 1D5XB 2H0FA 4Q9RH 5JNYB 4I48B 4WO0A 1KXQE 2BWDA 5CIPA 1Z2KA 1TETH 4M5YH 4M7JH 4JLRA 3S35L 5I1CH 1UTDA 1F2XK 3ME0A 3QORD 4NAQA 1Z3RA 4QR7A 1D5RA 3B3BA 4OZIB 5CGMA 1SLXA 4QGTA 4GXVH 4IW4C 3F3HA 3D8MA 3HR5B 4B9CA 7CGTA 4L05A 4NHUA 2J25A 2ADFL 2DYSB 5HI5D 3S0PA 3M1BA 5FAAA 4Z7WB 4K3EH 1AIFB 3MFGB 5HDQL 4RSYA 2NZIA 3S9DB 1T21A 2ICEB 4LLAA 1IGMH 1QO3B 2W9DH 1U95A 3DMMA 2G2RB 3HKZA 2AQ2A 1ZT7B 1GJWA 5E6UB 4JX0A 3OHXB 4FQCL 3FB6B 3RVUD 3EFDL 4FYTA 5IP4A 3UTZB 3IDXL 1UA7A 4W9JC 3ZHDA 3L4ZA 2NNCA 5JHMA 1I1YA 1KYDA 3OD3A 3L48A 1W72H 4CGUB 3N42F 5HDWA 3BKYH 4K4KA 4FNLL 1KTBA 3OSVA 1YRKA 5EO9A 3C87A 3A4AA 4QMEA 1D5BA 2FATH 5EDSA 3UAEA 3LEVH 3ZL2A 4XBPA 1KY7A 2WANA 1GIGH 2Z7UA 4MJ4A 4MAYB 1KPRB 3LQMA 1II4E 5KVGE 5F9JB 1U8CB 1Z3GH 1TQVA 4PIBA 1NUDA 4Q0XH 4KTGA 1Y18B 3TL5A 4DP4X 4Z5RB 4M6NH 4ODVH 1UZ8A 2CXGA 5D1ZC 3BHBA 2EIZA 4YX2L 1BPVA 4WIQA 3DX8B 4G8GE 4FMKA 3NPSC 4WWNA 3HIZA 1DYZA 1MIML 4PRDB 2AABL 3L2NA 3X2QB 1UACH 2DQGL 1IGYA 3TFKD 5D5MF 2CPCA 3V52H 2LU3A 1XZWA 1P9MA 1NC4D 4KZCA 4Z78A 2K4WA 1CICB 3WS3B 1U8QB 4EI5C 5KSBA 4FQCH 4G8GD 4RLDA 2A6JA 1E4XH 5J89A 1A3RL 1RK1A 4Z7IA 1ID5I 4LK4A 2YK1H 2D7TL 4GSQA 4N0UA 4R26L 4G42B 3ILDA 3MNWB 4NO2B 5CZXD 2P5EB 1BZ7B 5EWIL 1TQBC 1P7BA 2FEDD 1I8UA 2F8VA 4TULL 4XNZC 3UTPE 2F5BL 4NNXB 2WINB 1WEJH 4J39A 5EU6E 1FRGH 1KJ2H 2GTWA 1HHIB 2JTYA 1QQDB 4P3WA 1XVSA 2WQUA 1BFVL 3A6OA 3DBXB 3ILPA 2Y7LA 4H5SB 4MA7L 1B0RA 4PR5A 1MFAL 1L9RA 5GGVH 4Y5XB 1D5MB 4TSCH 5K1JA 4HIXH 3VI3A 1QFUH 1CE1H 1ETZB 2G5BA 3V9EA 4YS4A 5IBUB 2BNUA 2AK4B 2E27H 4A6YH 1J5OH 2YEQA 1X5LA 3FUIA 3HOGA 4YHLL 1AI1L 2ZWLT 4JG1L 4FQ2L 2JKIS 4LLVA 3OZLA 3CBRA 3IDXH 3NJLA 2IQAB 1R3HB 2WTPA 3VFTA 5IQ9B 1V7NH 3QJVB 2NY4C 5BVPH 4AVIA 1KV3A 1Z7JA 3MU3A 1CGSH 3RJOA 2CHNA 3OZKA 2BCMA 3U2JA 4QRSA 5IB1B 3ZO0A 1RUAL 4U4BA 3PP4H 4LOUC 3IJEB 2RACA 2QSVA 3GMMA 3CHQA 1EMTL 5IIEA 5J8OA 4XNUH 3CVHL 4XNMB 4RRPM 2YMXH 3G6JE 1U91B 3QDGA 1ZT1B 2A73A 3S97C 4MZRA 2A9CA 4FL4C 1CLCA 3ZRSA 1M6OA 3C2AL 5IT2H 4I1PA 1IL1B 5FOJA 4E68A 3G6AB 1VDGA 1ETA1 4Y19B 5C0CE 4BELD 4MJ6B 1KJ3L 2EVIA 2FO8A 3Q43A 1CFMA 1A9EB 4CL7A 4X7TB 5KBPA 1FZJB 1A4KA 1U8NA 5FYJU 4B50A 5EEYA 5DQJB 4NO0D 1J8KA 5JHDA 1T6BX 3QUML 5GS0C 2VRKA 2IFGA 3OGCB 1EEZB 3QQDA 4XVJH 5FV2A 2R69H 1YEIL 1J88A 3D39B 5DS8B 3L3DB 4ZFGH 1KBPA 2BS9A 5E8NB 2MKLC 3ATDA 3O0RH 4XVTH 3CHSA 1TQCB 3VYNA 2Y2TA 4PV1C 5JW4M 1K4CB 5ISZA 3EJYC 1CD1B 5E7BA 5L88L 3HC2A 2ZT9C 4NJAH 1ZKAA 3GLAA 1ZE3C 2VLJB 4X6DF 5C7ZA 3OJDA 1QSVA 3P9MB 4B27A 3CFKA 4OD1L 4XP6H 4Y7OC 3KBFA 2XDHA 2B2XH 3AT0A 1U8IA 4H26B 1QZ1A 5D8JL 4R7NB 1YLBB 2KPWA 3GBNH 4KMTL 4AY0A 4NYLA 1YZZA 4FLRA 1A6UH 3AADB 4RA0C 2HSIA 4KKBC 4FDWA 3KPOB 1RJYA 4DN3H 4H1LG 3BISA 4AMWA 1EIBA 1M3JA 2X28A 3QUMB 4U6YA 1MCWM 4HJGA 1K72A 1C9SA 5EC1B 4ZMPA 1R34A 1RKRA 3L3HB 4L8BB 3D51A 3FN0H 1UCBH 2DQCL 3BAIA 2P5WB 2EE6A 3QORA 3C9NB 4MAUL 4I8DA 1EXGA 4GKNB 1BM3H 1E0OB 5EBGA 2EH8H 4W9GC 4BFKA 4WJ5B 4DP6X 1WLGA 3S4SG 1W0YT 3MV7A 1NCOA 2R69A 5J9PA 3JV4B 4Z77B 1A5FL 4X8JA 1CLOH 1MW0A 1TTFA 3QUYD 1Z9MA 2I25N 1GJIA 3H9SB 3AREA 1JF6A 2AF2A 4NZDA 2JTDA 2RQEA 4M93C 2OK0H 2F8IA 5D7HA 1DSFL 1RXLA 2X2UA 3QNYA 4WFFE 4YBHA 4ZO7A 1OAXH 4LDCA 5ERWB 4YXLH 5EUOA 1VGKA 3FONB 2VZ1A 1PD0A 4RMSA 1PLGH 2F54B 4AJ0A 4Q0XL 1KLUA 2HXAA 3NP3A 3ZL4L 3NRQA 4JM0A 2LVEA 4N2LA 3REWB 4CC4C 4ZFFB 4LPCA 1A4BA 1EH9A 4UDUA 4PJGB 3RBGA 2QHRL 1W72B 2A1WL 5F0MB 3MRHA 5D4QA 4HUWA 2VO8A 4JMNA 1WITA 5D7IA 2EDKA 2J20A 4IRJA 2BSED 2P28B 3JTSA 2P24B 3GHEH 3IDIB 3V95A 5E2UL 1AAJA 1HSBA 1LEIA 3FTYA 2PYFB 3UYRL 2C7FA 4HG4J 3KYOB 3FRPB 4OT1H 1EAQA 4PJFF 1PYWA 1OY3B 4OF0A 4DUWA 2MPAH 2UY7B 3RY6C 2E7MA 1DVUA 3EJZC 1I75A 1FVDA 3SOBL 3V4VA 3ZKSD 1A6AA 1NSNH 1PZDA 2DQFB 5FUOL 3CU7A 3LN9A 3QEUA 3P02A 4LL4A 4C56D 3MREB 1DQJA 1DVFA 2XVKA 3QB7C 4Q14A 4PRHB 2EABA 1AZVA 4GAGH 3FSVA 3ZHLA 4MXQD 4AUYA 1LYQA 3GTVA 4OKVB 5I1EH 1HWHB 1ZK5A 3VFVB 1NAKH 4LEXH 2FJUB 1BLIA 4L4VE 4PP1D 5CINH 5J7CC 1QW8A 4HJUA 4B9GA 2DH3A 2UYLA 2PR4L 1QI5A 2A38A 1OSPH 3KPSB 1JHTB 5I6MA 2FVNA 3DO4A 1EHKB 4DZBB 2MHAB 4XRCA 1ZRUA 4F57H 4QAWA 3QQ3A 4O2CA 1NUFA 2VLMD 3FCBA 4K8RL 3NCXA 1CI5A 3GHBH 3PGCB 3OAYH 5D5MA 1UD6A 3PWVB 3VFUB 3C6LC 2ITCB 1N64H 1EA9C 4NKQB 5EV7A 1OCOB 3FN3A 5EUKB 3WNOA 2EUZA 1QR1A 4OT1L 1Q1PA 2APBA 1VSCA 4X5LA 3C2SA 3HB3B 5MEQB 1SEQL 3IYLW 1NGXB 3MLTB 1FO0A 1KXTA 3QEQA 4JHZA 5LXGL 3SJVB 4OLVL 4LVNC 5EORL 1P5VB 3LB6C 3N06B 5GS2H 4NRZA 2CE6A 1J05A 4PJ6A 1NJ9A 5IW1B 1UM4L 4FN0A 4AT6B 2XU9A 4DNLA 5IHZA 3A4DA 4GAGL 4KWUA 2GSMB 4A63A 1UGNA 4AVKA 4Z3TA 2C9VA 4GRLB 5DEGB 3DIVA 1ADQA 2NNRA 1ONQB 3BPOB 3T0EE 3MRDA 2CWRA 5DMJB 1PEWA 3V0WL 2NW3A 3RWGA 3O3BB 1FVCB 3G5WA 3P11H 2O6FA 1U2CA 2QKIB 2Z4QA 1JHLL 5K33A 3U1QA 3NA4A 4ADJA 4F57L 3D2UB 4LPWA 1GYAA 4YUEH 3IAPA 5DD3H 2P42B 4JPKH 4UT6A 3GHBL 3W0WB 4Z8FL 1E9OB 2D7PA 1U8OB 2XPZA 4G9DB 4HCIA 2WSDA 2JKTM 3UP6A 3A3YB 3EOTL 5L88H 3LZFH 4HJSA 5G5DA 5DZOA 2R0KH 1NGQH 1OGPA 4X4YA 2EUXA 3WSQL 5I1EL 1FZOB 3GEWB 5F71A 4F2ME 3C5JA 3N2JA 4B9YA 1I1CA 1BAWA 3CCHA 5B38G 3LVEA 5DHVB 2GAZB 2LFEA 1F13A 3BP4B 4C58B 2ZXAA 1AOZA 1TQUA 3HC3L 5HYFA 3MV8B 4LCWA 1CGTA 4KUCF 4DCQA 3KJ4C 1G9ML 3K6NA 1R3KB 1AXIB 1RLBA 1TZHA 2F2HA 4BK4A 2CRYA 1NDMA 3FPXA 4XBGB 4Z7OE 2Z7WA 4Z18A 3RL1A 3MXVH 5C08A 3RFZC 3KR3L 1MFEL 5BOPA 4WI0A 4Q6IA 1TOXA 4HUKB 5JO5B 3ZE1F 2BIMA 3MPCA 2P8MB 1ZHKB 3JT0A 4HJJH 3FN0L 1T66D 1I3RB 1JJUA 4YX2H 2QVIA 1QA9A 3MACL 4YDZA 4S1RH 3QPQC 3ATFA 2R0WH 3KPPA 3ECBB 1YNTA 3W2DH 5FO8B 4OVVA 4P9HH 4XO9A 3O45B 3Q2WA 4H7VA 4UQ3B 3FCSA 1NGZB 2Q3ZA 4F9PA 5IEHB 1U8MA 4F5CE 2HN7B 3HJEA 1OSYA 2I24N 1OALA 4RAHA 1WC7A 1LO3H 3I85A 3MMEA 4LCUB 5EZIH 3LRLA 1YUKB 1DLFL 2LR4A 3OKNB 1IAIL 1RPKA 4B9ZA 5MERB 3HE7C 3KPNB 2LV4A 1VF5C 1F42A 4KKLC 4KJYA 3ZSSA 2EACA 1SLVA 1DJXA 4N0CC 4ACTA 1LO2H 1QUNB 4M7LH 4PJBB 2D2CC 4DUXA 4FFWD 2XI9A 4Z76A 2Y7NA 2G5RA 1T5XA 2J4WH 3A23A 3SEPA 3PE9A 3C8HA 2FTAA 1XIWB 3AVEA 3CFDA 2O5ZH 4RMBA 4AJWA 4MA3B 2FB4L 1M71A 4QRQB 1LHZA 1CE1L 2NY7L 3CH8A 3DC0A 4F7PB 3DOIA 4OCWH 3HE7A 1EDYA 2W88A 4A6YL 4HCGA 3AU0A 2AI0L 2VN6A 3OM3B 2V2WB 5ESVA 3KPRE 3N43B 1F00I 4LLQA 2COQA 1OT4A 3SPIA 4OQTL 4NQQA 4FKHA 4OZFH 4AQEA 5I6XB 1MJ8H 3O3DB 3OXSA 3F7VB 3NRFA 5L2KB 4G6JH 1PZAA 5KANG 4G8EA 4R97C 5AAWC 3T0EB 3JVGC 4OJDH 4JDEB 3VNZA 4DGIH 1HQRB 1SEBA 3MUGB 5J6HA 2F74A 4Z3EA 3FU5A 4C56A 3GB7B 3P69A 4A38A 5E00B 2NNAB 2HG0A 2HKFL 3QPXH 3N43F 3OPZH 4LSPH 5AZEL 4AM0B 2H3XC 3HE6C 1HINL 2VYRE 5JHBA 5IHBA 3TCLA 4DO4A 5TJWK 3COOA 2WZPA 5IW6B 4G5ZH 1A7PH 3KL5A 5HDBE 3U1SH 3ZT6A 7FABL 3W5MA 4IBUA 1CGUA 3WEAA 3RUGB 2YIHA 2WGNB 3HPJA 3QFDA 2I9TA 3TYFA 2ZXDA 3V9FA 4RZCB 5E6YA 4P2QB 1TENA 5T1KB 4ATTA 1FORL 4BKLB 5HHPA 1NLDH 3GDCA 4AL8L 4ENED 2WB1A 5D7JD 4IRSD 5ELIA 1YO4A 3CN2A 4KHTH 4QJ4B 1T5WB 1JYWA 2NSMA 1EZVY 1KLGA 2IWGA 5I8CA 1QD0A 1QSFA 4LGRB 2W92A 1XQ4A 3V8CA 1ZA3B 1ZGLA 2X4UB 4PW3A 4LCVA 4AXWA 5BUGA 1FNGB 4YAQA 1PBYA 1N18A 4NQVB 3RL2B 4QYOB 5DRXA 3LXAA 3ZGIA 5CCGE 1X5KA 3ET9F 1MXDA 3WKQA 2IDUA 5EU4B 4K9EC 2V2XB 2IAND 2VXUL 5JDSB 4J6RL 4S1QH 1EV2E 3U30C 4ICWA 4XCCH 3EDEA 1MCBA 4QRTB 1IFRA 5D96B 5KJ7E 1TZGH 2Z8SA 4ZOEA 4XZUA 2YKLH 3U1SL 7FABH 5FKAA 1RZKH 1BJ1H 3SPJA 3HC4H 2GIMA 1XMWA 4TQHA 4G6JL 4N2NA 2ID5A 1ZXQA 2WNGA 4QRPB 5D72L 4R26H 2H6PA 4MNGA 3ZE1E 3DXAE 1NINA 1IKFL 1LD9A 2F6AA 4AI7A 3V4UH 2VLME 1RZFH 2KUTA 2ADGB 4ZFOB 2J55A 3KCPA 5K9QI 3JUZA 5CF3A 4Q9QH 4HKZB 5IJVA 5T1DL 1QBMH 1PX3A 4O5LH 4PGBB 1Z9LA 3DI2B 4DETA 3KM1A 2TAAA 1NFKA 1A8ZA 2X6AA 1VLXA 4I88A 3MX0B 3WE1A 2YAEA 1V3JA 4XCYB 1B0WA 5E6ZA 2FYVA 5LBSH 2OL3L 4EXPX 3HZKB 4AIOA 4J3OH 1QTYT 3GNML 3A6CH 4WI9A 4QF1B 3KPMA 1P1VA 3RVUC 2ZP9A 4B7IA 5E5MA 3BYTA 3VVWA 1GKEA 2E56A 4LCYA 1CK0L 1F11A 1YEKH 3Q44A 3RJQB 3ZL1A 4H88L 1CF1A 3OG6B 1GCYA 5IHHA 1NDTA 3PQYD 4UINL 5F7UA 2Q5BA 4TRPL 5LWYH 1J86A 1SXZA 1EGJH 4WO4A 5C08D 2UY6A 1C5BL 2PCPA 4Z23A 1NUNB 3CFNA 3HC0A 1JCVA 3AU1A 4JRXD 4P5RA 1I3GL 5KWYC 3WTTA 4JREC 2EH7H 3KXFD 3CIAA 4FFYH 3U2SB 1CT8A 2BMKA 5EH1A 1I1AA 3RX9A 3O9WA 1JI2A 1WO2A 3FUDA 2NUPB 4NKOB 4XCFH 2VDNL 3NFPB 3QORC 1OM3H 1ZLSL 3SJVD 1LE5B 4YC2B 2BIPA 2CO7B 2J8UB 2A0LD 3FQXB 3QIWA 3LMJL 4HS8L 2YXFA 3NIFB 2ZNXA 3DXAD 2F53D 2OL3B 5EOQL 1XDTT 1KB9K 3V0AC 1LJMA 2VN5A 1JXKA 1YJDL 3MCLL 3QUMH 4POZC 4W93A 2WUCH 2JFCA 1EBAA 2YQBA 1C7TA 3LSOA 4ENEC 4PRPE 5DJCA 3HUJF 1T6VN 4HWBH 3FQ4A 4X4ZA 3HMXH 4N1EA 5AVQB 2BY3A 5BRZB 4LCIH 3RWCB 3WNNA 2R1XA 4LXFA 4WU7B 2BSSA 1IGJA 4U1HB 4Q9CA 3MGAA 5D1QA 4XI5C 2AEQH 3NOIA 1BM7A 1QTSA 3K74B 3SB3A 5JXED 4G70B 1OIOA 5LAXB 1NFDB 3B7UX 3DOSA 4QRAA 5IBLD 1ADQL 2YD3A 2I85A 4JHUA 1CLYH 1EZSA 3S48A 5AOJA 1Z3GL 4XN1A 3G5VA 4YXKL 1OCZB 4NN5C 3KLAA 3DGGB 4Y8DC 2WN2A 5I1GL 3SHSA 3MRBB 1T04B 5FM8A 2BJML 4OJFL 3GDBA 2IQ9H 4P23D 4QRUA 4LCWE 1IMHC 4TKWA 1WIUA 4NB7A 2X12A 1HINH 4BUQA 1UACL 5EUOE 3TPKA 4F7CA 3FQTB 3CTTA 1RIVL 3UZQA 1TR7A 3KPRD 1JDCA 5AVYB 3DV4B 3Q01A 5MP6H 3L8QA 1DJGA 3IAQA 2ZXWB 3CSYA 4N24A 5DJ2A 4NENB 4PJ8A 5FYKH 1YNLL 4U3SB 1HHHA 3SE6A 3P0YL 3DX2A 2CBTA 1T1XB 3LDBC 4W81A 2FGZA 3BVVA 4MJJA 4AL8H 4CADA 4LHUG 2IEPA 3HBGA 5HI3C 2FNWA 3BVXA 1R5WA 4HXAH 5GJSL 1HOEA 1NCDH 4PJ5B 2BWIA 4FABH 2YD4A 5E2VH 1KGUA 1FCGA 1PKQB 5IJCC 3BUDA 2GK2A 4QRPD 2BY1A 3BH4A 1HWGB 4JFED 4EDXB 3BC9A 2HT3D 5DVMA 2DYPD 2G60L 1TJGL 1IM9B 4W9IC 4DHLA 1T2QH 1KGYE 3SN6N 4EN3A 2KQMA 1OZUA 1ORSA 4GMTL 4AITA 3CZEA 2WKGA 4Q4EA 1XCTA 3QUXB 1P6AB 3DKHA 3GT6A 4PVBA 3LIZL 5D2LB 4LZKA 4L2YA 2UWEB 1FG2B 5EU6B 1FAKT 4HK0A 1D9KD 2GHZA 3IMTA 3ABLB 2PUQT 3T4AA 1AG0A 3FW6A 3SPHA 4E0RA 4N0UE 4HCRH 2VXQH 4R7DA 3ARZA 1PDKA 4LLYA 1KCKA 2B5IC 2DEYX 1J8HD 2F58H 4N8CL 3KLKA 1WH0A 2CLVB 4TNEA 4B95C 4BUHA 2IANA 1MCFA 3FQRA 3HNVL 3CQQA 4QJ5B 4KK8D 2RR3A 3U82B 1RSYA 2HMID 1UH3A 3EF7A 1P7KB 3QHFH 1S7TA 4XWGH 2EUWA 4K3JH 1ZLDA 3SQBB 4IDJL 1BZ9B 5AL8A 4JGNA 2X9YA 2VQ4A 3LNGA 3BJLA 3NIFE 2XACC 4UZGA 1IEAA 4WKZA 4R5XA 2G0LA 4PP2B 1DEEB 1OGTB 3GXNA 4HSAC 4OLXH 1KBWA 1S7WA 5KVEE 5E03A 3QXAB 5IBTL 2GY7B 4D9RE 4FQ1L 3CZFB 5HPMA 3K6OA 4M43L 3U7YL 3TXAA 4YSEA 3HNTL 5MEND 3ZT7A 1YAIA 3BT2L 2FLBT 3HBQA 5BRZE 1JTTA 2V5TA 4XCEB 1LMIA 3H9HA 4HAGA 3D34A 4MCZB 5HHME 4K7PL 2J56A 5EA0L 4W6XB 3SKNA 3Q3GA 1SMAA 4MDRA 2E4FA 4LSVH 5GJTH 1H9DA 2NY5H 1YQVH 2XN1A 3ARVA 3T8XA 3WFEL 5JNYA 2D7NA 1T22A 1L5GA 3ARFC 4OU3A 3LKPA 1SQ2N 1BVNT 5H37G 5IVZA 1MIEH 2YA2A 4JJOA 3TTSA 4B60A 4BKTC 1EHLL 3E8UH 3IXTA 5TDNB 4BE5A 1FV1A 2E46A 2R2EB 4P46A 2IGTA 3PAUA 4WHYH 5DGRA 1JNNH 3GI9H 4G7RB 5INCB 4X0NA 1WFNA 3L3IB 1TYRA 3T0ED 3OXRB 2E6PA 4ZUVB 1ND0A 4TUKL 5IFHL 2EDNA 4LB8A 2DY2A 1BZOA 1OT1A 3DIDA 1T21B 3KW8A 4RRPG 2XICA 3MRNB 4PB0L 5EF2A 1KMGA 3DMMB 4CSTA 3HG1A 4XP9L 2W0LA 2YPLD 4JY5L 1BWWA 2PP7A 1SGKA 1T0PB 5IG7A 4Z8FH 1F6FB 3HA0A 4I85A 1M05B 1VESA 4UUJA 4W9HC 3DYOA 3GJEA 1YECH 3V6ZB 4BFIA 4WHDA 2YR3A 3IJ8A 1TVBA 1SJXA 4OZGB 4XC1L 4NQCB 5BO0D 4P23B 5J56B 1P4LB 5K93A 5I0WA 1DVTA 4F8QA 1G0XA 5ICXB 5F3HA 1ES0A 1BFOA 1BF5A 4TM9A 4ABQA 1A6VL 5LNDA 4ICXA 4ZK8A 5C0GA 2IWFA 3QUZA 1Y6MR 2OMZA 3GXPA 1XF3A 1L9NA 1A64A 4J8RA 3VFNB 3L3OC 3VXMA 2YAQA 5E24E 4Q4IA 3WFZA 2A77H 3GMQA 5IJKA 1N7ML 3M86A 2CGRH 4ZPTB 1J9SA 4X9BA 5CP3H 3JV0A 2ADJB 4BDVB 5L4JA 3MLRL 1G84A 1YDPA 5FPIA 1G6RA 3FT2B 5F1NA 5SV4A 4FNRA 5JA8B 2H9GA 1WWAX 4R96B 1BVNP 1T80A 4X6CA 2Z91A 3VRIA 4XCNB 1D9KC 2H2SD 2NY2B 1YUHA 3MRIB 4BWTA 3KPLB 2VSKB 3D0VB 1HL8A 2FJFB 4XC1H 4N0UB 4O58L 5CP3A 4XO4A 5KSUA 3VE0B 4APQC 4CW1B 1SMOA 4I2XE 3TM6A 4JM2B 4LIQL 1LE9A 2IH8A 3KNBB 4S0SD 4X5WB 4AMKL 1EO8H 1UWYA 4MRBA 1FP5A 3O6FA 4M1GH 4X6BA 3CZGA 3ZTJH 4Y5YB 4CDGC 2BVOB 1QQDA 1VIWA 3UTSB 1ZEAL 4PR5B 1PSKH 1JPSL 5DHVH 3SDCA 2HRPH 3NPSB 1YEEH 4A37A 1NPUA 5DTFB 4KX8A 1O5PA 4A2FA 4ZAKD 4HIHB 5G4NA 5CN2A 3T8VA 5KSVB 4LKXB 2DKUA 1T2QL 4TNWK 5FK9A 1D7FA 5FHAL 5HI3D 3WY1A 4BUGA 1ETZA 2X41A 5J3HC 5G4OA 3ULSA 2AJZA 4NM8H 1V05A 4IOFD 4ZTOL 4LESA 5HVWA 4G8GA 4PREA 1HKFA 3ZQXA 1NGPL 5CN1A 3KJ6H 1T5KA 2DIJA 3GPSA 1DEDA 2HFGH 4BFEA 5T33L 4WF7A 3ETTA 4PJ8C 4GP4B 4WUUB 4HJ0C 5ANME 5IK3A 4U1KB 4QOKA 1MDAA 3WELA 2XBZA 3V2AR 4BFNA 4MCYA 3T6ZA 2C4FT 5CJXC 1HXMA 3NAAH 1A22B 5FDYA 1XV8A 3V4PB 5EF3A 2WCPA 4R4FL 2IAAC 1ZLWK 1SDYA 3IGUA 1BX2A 3ARED 1JV2A 5EIQA 5C09A 4AKOA 2ZOTA 4YR6A 3SD2A 1WZKA 5DZNA 5EZJB 3F62A 2JB5L 2F8XC 4YSSA 4HA1A 4YHPB 4A66A 3NQIA 4AL8C 3IFOA 1OTTC 1DL7H 1XCWA 3GSQA 3SE4A 5DD0H 3DVIA 3ULVE 5C71A 5FCSH 4X6EB 1EO7A 1I8LA 4HZLA 2X4PA 1K2DB 2EDDA 4GW1B 3VFPB 3SY6A 2R29L 1IGCH 4FQ1H 1I7UB 2GTQA 3HJ0A 4FNQA 1B4LA 3QJHB 1SJMA 3S5LB 1S9WA 2NY1B 4JRXE 4HKXB 1WHOA 5ISZB 1DCEA 2WP3O 4HH9A 4WV1A 2IC2A 4FMVA 4ERSH 4XPFL 4FYRA 2WZ0A 4WWOA 1DQLL 5F0JB 3EXLA 4WU5A 5FC9A 5FO9B 4ZUSB 4PLJD 1QEWB 4N2BA 2XN0A 2ALWA 3GLZA 4KVCH 2ALAA 2FR4A 1MQKH 4EUPB 2VERN 2HRPL 3ERXA 4ES9A 1A0QL 3K0YA 4OLZH 3EJJX 1MAKA 3UBXA 2QQNL 3EYQD 5LDUA 3TBTB 2C1OB 4OD2A 4U1JB 5HDLA 4UIMB 1TEGA 4HHAA 2K0RA 4PEEA 5F1OB 3LH8A 3AM8A 3Q13A 3RL2A 5K9JL 1KYAA 4Z7UA 3C09C 2W91A 4TLTA 2I07B 1UA6H 5GRVL 3L3HA 4L8BA 5HP5A 4J3XA 2NW2B 1M56B 1V5JA 2XKUA 5BXFB 4AZ8B 2D73A 3TWCH 2FO1A 3ZHFA 4HIPA 2EZ0D 3GMNB 4LSSH 3L3KA 4YIQB 1J0JA 1UT1A 3HFMH 4PGDB 4L29B 1BOYA 4FFZA 3ARTA 2EE2A 2EXSA 3OZ9H 3KXFE 1KBBA 5E8DH 2ATPB 3SDXA 5I6OA 1RUPL 5I16A 5B7EA 2CAKA 1FFOA 3JWDC 4Q89A 4QRRD 4KVNL 2ZWYA 3BSZH 4J3VA 1HI6A 3LKSA 4KOBA 3WLBA 3KS0J 3H3KA 2ZKMX 2E9GA 2X5PA 4JJ5B 1CFSB 5E95B 2R9HC 1WICA 2WLJA 1I9IH 2GY5A 2OYMA 5JOPE 1HH6A 5HDRA 4BH8A 4ETQA 5CBAB 1RUMH 1MCPL 4K7PX 4NZRL 1I1RA 2WWMD 4HUWB 4OCXL 4G6MH 1NANI 1ZPLA 2ZUUA 3JTSB 3B2VH 5JDJA 2VDLL 1V54B 2ZTBA 1JGVL 2EIKB 4Z7VF 2VSMB 5MEOA 5HJDA 4P5SA 1ADWA 4NKIH 3U4AA 4HJEA 2VITB 1KG0B 1KENH 2MIZA 4HX1A 4F3FA 3TBSB 3Q6FA 3LH2H 1FVDB 2DEWX 1MELA 1YMHB 3VXUE 1Q9OB 2AABH 4HEPG 1SPDA 2Q0ZX 4GKOA 4ZXBD 3DRTA 1G7MB 4QI3A 4PJBE 4XXWA 3SO3C 2PWGA 3D3VD 2ZPKL 4OKVA 5AD0A 3Q06A 1ZY9A 5CD3A 3D39E 1KTLB 5I1IL 1KLFB 3RA7L 1IEBB 4XPAH 5EOTA 1K6QH 1FSKB 3QCVL 4WUKH 2HYMA 2YK1L 3C5XA 3EOYG 1OSZA 4PRIE 3NCWA 3MBWB 3APNA 3ZMRA 1OE1A 2H7WA 1KELL 3IK2A 3GFUA 3MLUH 3IFPA 1BIIB 1G9MH 2BY0A 1G7PB 1SHWA 2K70A 3EYVA 3VWJA 1IIKA 2ZOLB 1QNZL 4MJIE 3DSFL 3FDWA 4ODSL 1RZ7H 4MB5A 2ATKA 4MWFA 3D85A 1VKXB 1JP5A 3RZCA 2Q3XA 5KYUB 1R0AH 4RFNB 4LSSL 3LHPL 1UOVA 1PZSA 4FQJH 4M93B 4QXGH 5KSAD 5T5FA 4BZ1H 1LWRA 4PVLA 2YPKA 2H2PD 2Q2EB 3C5ZB 2YC1B 4J7RA 1C12A 5DUBA 1JK8B 2DYRB 1YY9C 3N1GC 4HK3N 2A74A 4DKFH 3PGDA 3CX5J 2ZCZA 1JPTH 5I0ZA 1GGYA 4CSSA 2E59A 1KTCA 3HG1E 1S3KH 1WGOA 3AC0A 3F05A 4HGWB 4KGLA 5HY9A 3VXQA 4GLRH 3BSZL 4U3CA 2NQDA 2OS7A 2W9EL 5IMOB 1EZLA 1QATA 3CV5A 4WFGD 5H35A 1AKJD 2D9QB 4WI2A 5C0DB 5I73B 5DEGA 4FXGB 5JPNB 4M48L 1LO3L 2X1XR 4HFWA 3PGFL 4W9DC 4MKTA 2GIYA 3K5SA 5F89A 2EP6A 3ATAA 4XMVA 1EBPA 4QOKD 4WCYL 4IRZL 1HXYB 2QKIA 4U6VH 5C09E 4BGDA 5HYQA 3U0TA 3F83A 1RZFL 1JPEA 3B2VL 3NIDB 3ZRCC 5F9DC 4UANA 3RDTD 1OL0A 2VXQA 3NEOA 2J8UF 2ZCHL 4U1MA 2DL2A 2VERA 3MNMA 2WB7A 1HIMH 4EZMA 2AXFA 3B7SA 2FH8A 3F00A 4OJCA 4NDMA 3T65B 4FQJL 1VPOH 3UTTA 1T1YA 3PIQA 2ZYRA 4PJIB 3GRWL 1QHPA 3DMMD 3ISRA 3B34A 2F61A 4G11A 5CFHA 4OJEH 2GITA 4Y5VA 2VJ8A 1MI5B 5IREA 4OF6A 4ZPVA 3HBZA 3FMGH 1N12A 3QUXC 4S1DD 1JERA 4ABVA 1I4FB 5EU3A 2CK0L 1FGVL 4ZG1A 2VDQL 1ZA6B 2CSPA 2CHDA 2XG4A 4LIQE 3STLB 5TE6H 1QSFE 4FABL 1BYNA 3F64A 3PUCA 1S7QB 4QNPF 3P9LB 3L1OH 3U48A 4HS6B 1SVCP 4JO4H 1FNEB 2GEQA 1EHNA 5GGVY 1UQSB 1LEKA 1KIQA 1A1OA 4GAYB 1ZHKA 1LTXA 4Y7MA 1RHFA 3Q5YA 4QXGL 4BZ1L 4HAFA 4LKCB 5EBMA 4ZW8A 5B38B 3NJIA 1TVHA 4URKA 1GC1H 1GCFA 4DO6A 1MHCB 2VL5A 4L37A 1XH3B 5IEKA 3OZ9L 3OKMA 4FQPA 4NRYB 4WGWB 4MHHI 5F9OH 1NCCH 4G9FD 4HJIA 1OOWA 3ZMEA 1OGSA 4OF7A 3FO9A 3O8XB 1W6WA 3S96B 2X70B 1FGNL 1PLCA 1PTZA 4FS0A 2CIKA 4EF3A 2BVYA 3CAFA 4AYDC 3F7YA 1EO8L 3L5IA 2G9HB 4XAWH 3SE9L 5D7JA 3RJDA 1RUML 3TBYB 1KCRL 5DVLA 5BV7B 5LUMA 1MRCL 1NIDA 1IC5L 4NQEE 1S9VB 3D0AA 2FECL 1SMDA 2JKLA 2KDGA 5ICYB 3DPBB 2A4CA 1PLGL 1R5IA 3HN5A 1OEZW 2X2IA 3RIFF 4ES8A 2Z64C 5FYJL 3HZMA 1MCWW 1L6ZA 1KNOB 3QQ4A 4UAOC 4FX5A 1BXVA 1JZFA 2I5YL 2MFNA 4GIAA 2AV7B 4LBEA 3TO4B 5I66A 2ZSVB 1UJ3A 4GXUN 3IF1A 3MLVL 5HYJA 5HPOA 2NT1A 3IKCA 3L7FB 2Y06L 3N85H 4X42A 1TZGL 1T7VA 2VDOB 2W95A 2P8PA 4Y8AA 8FABA 2AHIA 1MUJB 3PDGA 4IRSB 4F7MB 1E3ZA 3RA7H 3SY0B 5DLLA 3VXUA 1OAKL 5TH2B 3GBMH 2ETWA 3UACA 2NY1D 3ZZ1A 5KVDL 4H8WC 1HQRA 1R6VA 3FSAA 3TH3T 1JE6A 3ESMA 3BD3A 1BBJA 4TOYH 1JYVA 2XWZA 3WKPA 4IOSA 1PAMA 4X99A 2Z0UA 5F97E 1XIWC 2C1PA 1G7IB 3LV3B 1BIHA 5C2BH 4FFWC 4F2MB 2NT0A 2JCCE 2ICEC 2JB5H 2DEXX 4NO3B 4PHZA 4JPQA 3DO3A 2GT9A 4TVPD 2HVKA 4XHJC 4Y9BA 1GY2A 1L7TH 3QUZC 5D1XE 3TNNB 3WN5A 1N9PA 2CBOA 4F33A 5FO7A 3OVUB 3RAJL 3VUAA 5FM5M 3HE7D 2JJUA 3GM8A 4QHNB 2IALA 3MRPA 3ME0B 1BECA 3NFSL 2DJ4A 4X8GA 2K6ZA 2O5NA 3GBEA 3HEIB 5E6SB 2YS4A 1UWEL 5FFGA 1QLFB 4KNQA 1HHGB 2WD0A 1B2YA 3KYKH 2UZIL 4PJ7E 1KCVH 4M8QB 2WZAA 1TDQA 4P2QD 4POYA 4XPHL 1KB5B 4H0LC 3VGHA 2A4ZA 1AACA 1CBJA 1GHFL 2ZOOA 4WO4D 1MCDA 3FQUB 5HD8D 3W3BA 1H3PL 3DRQA 2WLMA 3U7WH 1OTUD 4HGKC 1NC2D 1QSFB 2C9QA 1A6VH 3NQKA 1KGIA 1D9KB 3FRUB 2Q6WA 4QY8A 5ABDE 1OE3A 4LRIA 1CTOA 3KXFA 5BZDA 3UTZA 1KTRL 2FIKB 3TVMA 3RDJA 1CR9H 4QJ3B 1Q9KA 4QYOA 5SWQB 4APQB 1H3VA 1RMFH 3CLEL 3WO4C 4TUJB 2WSKA 4JNXA 3T4YA 2MTAA 2KKQA 5D1QC 1FN4A 2H0JA 3JWDH 4P4RB 3MLRH 3OPUA 4J4PA 4Y9CA 5I6XC 1KEGL 2BINA 2VLLB 4MAYA 1XBRA 1CICC 1D6VL 3HN3A 1YYML 3SGJA 3RWJB 2YRLA 3F5WB 3NIDF 5KS9F 1Y18A 4Z5RA 3QWRD 5SWSD 2F7PA 1VENA 2JMRA 2WTRB 4X4XB 4FI6A 4ELME 5FECB 2YUXA 4DK3A 1U92A 3AGVA 1MFDH 1G4RA 2LTQB 1E4KC 4XNZB 3EYUL 5BZWA 2J5LB 1ZLWH 3P4OA 3S6CA 3VAEA 5CEYB 3WHXA 4TL4A 1GC1C 1AY1H 3FB8A 1YEJH 3ISWA 5JOFA 3GIZL 4LVOC 3BUYB 5KVFE 3P9WB 1SNRA 3A5VA 4PD4J 2EKJA 3F6LA 5GS1A 5D1QD 1CS6A 4RH4A 5DA0B 4E5XB 2EIMB 1WWCA 4QGYA 3W11D 5TPWH 4O51A 1A8JH 4NS0A 2DI9A 5E0QA 4BFRA 3L5XL 2HT4D 4HOZA 4BKSC 4GT0A 1O9VA 1MRDL 4HLZH 4K3DL 1WDAA 3C2AH 3FT1A 3VXRB 4YNYB 4EDWH 1XD0A 1FNLA 3QO1B 2X6CA 1RQ5A 3A4EA 4G2AA 3AMLA 4XP5H 2ENYA 2XYCA 2ZXQA 3JWDL 2X89D 1I7TA 1E7VA 3NIFF 4NQXA 1IFHL 4OQTA 3VMPA 4AEIH 2B8OT 1OV8A 1HDMA 2NXZC 4RFOH 4PM1A 1WZMA 5GRZA 4F9LA 3ZYOA 4P5KB 3GI8L 4N0RA 1E90A 1A7OH 2IGFL 4Y5XA 2DIAA 1SXAA 2A6IB 2R69L 4MCMA 1E30A 1EFQA 3M17B 3MRJA 2P44B 3LNDA 4JFPA 2AEWA 3FH8A 4HWZA 1J9RA 3U7WL 2VM9A 2NY5L 3WFEH 2R56L 4QXWA 2C7UA 1DBJL 3FOLA 2RGSA 1G6RL 2NXYB 1AHMA 1TNNA 4WKXA 3UC0L 1ETB1 1X4ZA 3KWWA 5LG1A 3G5YA 5E2VL 4M3KB 4F9LC 3GMLB 5ENWA 5IR1B 2F54D 5TF1L 2CO7A 2ZD0A 1Z5HA 3LKRA 4L8SB 1ED3B 4Y2OB 1JNNL 3GI9L 3IKKA 1NAKL 3IJEA 1FZKA 2LABA 4R4BA 2HPTA 5F6HJ 3TP4A 3MBEB 2DQEH 5DMIH 2QR0B 1AGFA 5FYLH 2RH0A 2HH0L 2TRHA 2C4FU 3BKCL 1D5XA 3KWTA 3GJFK 5JPMA 4NZUH 4UM9B 1N4XH 2QLVB 3C60D 3DSFH 3EUUA 4ZYKB 1ZLVH 4NP9A 4MJ6A 2VKXA 3B2XA 4JDTH 3U4KA 2R1YA 1MFDL 4U1SA 1MCIA 4P4KA 4WTZA 3WIHL 4DW2H 2YD6A 4OBRA 5CZRA 3IETA 1XTMA 1S9XA 1U8LA 2JCWA 3O9WD 3HZYA 3DX0A 2CLRB 1F41A 1GYWA 1X5MA 4PJFA 2F58L 4L9LA 3CN3A 4WEEA 4X0KB 4KRPD 4AIEA 4ZT1A 3DOSB 1LP9E 4Y4HD 4HLZG 4PBWD 3EOBA 5DK2A 3ZUCA 1PU0A 4L9DA 5AUMB 3DX9B 2XFXA 2IH1A 4XMKH 1DSFH 3FB6A 2IDQA 2YZ1A 4MSWB 4N8VA 4JFDB 4AQZA 2GSIA 2I60L 5EZOH 1MH5A 1WAAF 4EIZC 3S37H 1TZ8A 4PJXA 4U6VL 2N59A 5I5IA 2XWBB 1WZ1L 4UILH 2XETA 1A1NA 4HIXL 2JCCA 3ARWA 5I26A 1AHKA 3PPEA 1YN7A 3VD3A 1BQKA 3APFA 5T3ZL 4J5VA 1J1OH 3LQZA 3SKMB 4F5CA 1KPRA 2CDGB 3DHMA 1JVKA 4ZMNA 4B3VA 4D3CL 3BXNA 4GFTB 1EAPB 2BHUA 2XZZA 4R4ND 1VADA 1KEMH 3IWVA 3INOA 4YWGL 2AJSH 4PJ5A 4WGVB 5E2WH 1NM4A 4OI8A 3L5WA 4YQXH 1MVUA 1NGYA 2J73A 5KYWA 2ICES 1Q38A 3B9DA 1PKOA 3BZ5A 4MJHA 1Y1DA 2NSQA 4JGMA 1SYSB 4HK3J 1PZ3A 1H8OA 3QULA 2JKJA 2X88A 2VCOA 4LNRA 1N5YL 1IGIH 1YY8A 1E9QA 1U33A 2EDJA 3QCTH 5DA4A 2V7HB 4G42A 1I9RH 1ILUA 1HJBC 4PV9A 1WUZA 2XWJB 3AAZA 4DGUA 3UTPD 2QZQA 4JO4L 4K94L 4OLWL 3U2IA 1FG2A 2W60B 4RMRA 3QFJE 1XEUA 3I6SA 3Q1SH 4MBOA 3E6FB 1W9XA 1CQYA 5IB4A 5LCVL 3U9PL 3QCUL 1ITCA 3IDYC 3MRHB 5HYSG 1YPZF 4LLMA 1AR1C 4AKQA 1EHXA 3P2BA 2PCFA 3MV01 4M61B 2CLVA 2P47B 3QEGH 3PWUA 3VI3B 3EYOB 3H53A 1TKWA 1JWMA 3E3QC 1A7QH 4FZEH 4I18B 3SKJL 1XF2B 1I3VA 1YEDB 2BC4A 5CEZD 2B2XL 5E94A 2UY7A 4FQQA 2CH8A 4WW1A 2XV0A 3TA3B 1BZ9A 2D3JA 3TWYA 3QWRA 5SWSA 3C5ZC 4KDWA 4EN3D 3NSFA 5DJ6B 2OLDA 3L95B 3TGXA 2NSXA 2OXHA 1LDPL 4FERA 2X2YA 4KQ4H 5A2BA 2MPVA 3MHZA 5BO1H 2YLKA 3BGFB 3ISYA 4R2GB 1T4KB 2PW2B 1UXWA 2IPTL 3BVNA 3GXIA 3HUJE 1FO0H 4K71B 4UOQA 5I76B 4D9QE 2ZKYA 4M7ZC 3P4MA 4PTTB 3BUIA 3X3GL 4XMZA 2I7OA 2UYLB 3OC5A 3M45A 2R7EA 2NRDA 3BFOA 3BVUA 3DROB 4MYPA 3VXPA 2WBJC 1XSKA 4GBXA 5FA4A 1INEH 4XPTL 4NT6B 3RUGF 5KVEL 1CBVL 2DKMA 4OCWL 1A9EA 4X7TA 4BFGA 1ZTXL 1MIMH 2NY4D 1T22B 3EO1A 4IMKA 1D2OA 1HAUA 2M26A 3FO0L 3LKPB 4KVCL 3QWOA 4MD4A 43C9B 1G7QA 4FF9A 1YEKL 2A4EA 1EEZA 3QQDB 3MUJA 2O5XL 4PJHF 1FV1B 2F1EA 4GP5B 5D5ME 1R3LA 3OKEA 4G6AD 5DD1H 2PR9A 3QEQB 3BH9A 3DDFA 1C16A 2QKIC 4W9LC 4ELKB 5ISZE 3O2DA 3BP7B 4PJDA 4Y4KB 1MWAB 4HPYH 4CN6A 4UYQA 3QZWB 1INQB 4KQ4L 2XG5A 2ZF9A 1WFJA 3CFEA 5K9JH 1Q72L 3SDAD 4NRXB 5LCVA 1T7XA 2PTVA 4HW6A 3R7QA 3WJMB 3FH7A 4YPJA 2E86A 3QA3A 1DBMH 4ZX5A 5FDWA 2BNRE 2DQUL 2BVQB 4FQIH 3QR2A 4ZTOH 3WFBH 4ENZA 3ABMB 3I9AA 4X9HA 3S36H 4NYLB 1V10A 1ZANL 3RWGB 2CJTA 3TN0D 1INEL 1OXYA 1XGUB 1JOIA 2LFGA 2G75A 1MY5A 2WUCL 2VXVL 1P4BL 3CPUA 4DP9X 4KTDH 2R2BB 4XNQB 4U1NB 1DQDH 1OLLA 3DUUB 4ANXA 4ESKA 5I1AB 3FYIB 2ESVE 3TONA 2W9DL 5JOEA 3O6LH 1A65A 2O5XH 2GKIA 3MJWA 3ZKXB 4Y2DA 5CP7B 3AWGA 4JFQA 4LHQB 4X4YB 1KYUA 3DMMC 4LE8A 1I31A 2FD6H 1VCBC 2NR6D 1BXXA 4BDVA 4A2EA 5SX4H 4MDJA 3RYMA 4AJVA 4DVBA 4FI7A 2ZQKA 2FWLB 1W72L 4X8JB 1A4CA 1ZE3H 1E65A 2VLRA 4NQSB 2H9GB 1KELH 4LPVA 1N6UA 3S35H 4TF4A 3RGVC 4ZW7A 1DBML 3I9IA 5HVHC 2FBRA 4L4TA 1MHEB 4DCQB 4OJAA 1N10A 2XQBH 5ERWA 1MJJA 1PZ5B 1E4JA 2YEZB 4KK9C 2C3GA 5HDQH 4D8PA 5KYXB 1S7UB 2DWEA 3R4DA 4KAQH 3M88A 3AQXA 4JZJB 2NY3C 3WKNA 4MXWL 2Y5TA 4UNUA 1K8DA 4K8RD 4F8NA 2PXYB 2VMJA 2D7QA 2YD2A 3QISA 3D18B 1A21A 4NERA 2ZUWA 1QA9B 2NYKA 2WYTA 1OP4A 3BQUD 4GAJL 2OSYA 1DVXA 5CLWA 4D2NA 2OJEB 1VZGA 4ZAKB 2WW8A 2CRIA 4HIHA 4KJWC 5D55A 1GZPB 5KSVA 3K6DA 3WGVB 3HVDA 1YHPA 1Q72H 5IQOA 1U8MB 3V4UL 5HI5C 4K0OA 1T1WA 4K15A 4DO5A 3GS0A 3BESR 3PREA 1YPZE 4OY9A 4XOCA 2BP0B 2BY2A 4O2FA 4M8UA 2XIIA 2ICWA 3LRGA 5M95B 3X14B 3ARDB 1IBFA 4FTVB 3FULA 3FPYA 3TYGH 1Y1UA 2P8LA 3L4WA 4X7EC 4FADA 4NCC1 5JIPA 5IB3A 1GS7A 4MVBD 4YSTA 5DI8B 4UT9A 2AQSA 4M6NL 2CKBA 2PPFA 4OLUH 4JPVL 3VFVA 5I15H 1Y7VA 5GGUA 5AB1A 2IMNA 3HHSB 3L3OB 3PWPA 5J6SA 4KK6C 1CG9B 5FM5O 2J44A 1DQDL 1XGYL 4BWUA 5AW9B 2AXGA 2HP4A 2BP5M 5E4EC 3WUWA 4BE6A 1A4JA 1AC6A 1S3RA 2AQPA 2DDQL 1PCSA 3Q1EA 4OGQC 1RUPH 5CIPH 3WNMA 2LAGB 3GUFA 1D6EB 4ZNEA 2Q10A 1EGJL 5FUCC 1BVOA 1XGQA 5DJ8A 3VTAA 1OP9A 1TT6A 3WFHB 3WU1A 4BZ1A 4QRRA 1MJ7L 3MFFB 1WS8A 2OCJA 4N2MA 1I1AD 2V2WA 1F56A 1FORH 3VXSB 1DQKA 1KFAL 5DHEA 5EBLA 3O2WH 5CEZE 1J10A 3MJ8B 3BD5A 3VFWA 3VG0H 5DJDB 4RISL 3MBXH 5D71H 4GKSA 4ZSOB 3ROOB 2BNRB 1FIGL 4ZI8A 3QIUA 4PJ9B 4UWQB 4XO8A 1Q9WB 4Y4HB 3RFRA 4A7UA 4HKXA 4IDLA 3TH2T 2IPUG 1KCSL 3AREC 1SEBB 1U41A 3MGOB 1CB4A 4R83A 3QI9B 1MLCB 3NSYA 3QDGE 2WN3A 4XH2B 3RKDC 3EO9H 4LOEA 1PQZA 3M07A 2VMEA 1CXFA 2YOCA 3UYPA 4Y1SA 2RB8A 4WENB 5E00A 4FXKA 4F37K 3Q6GH 4P2OC 3HZVA 5C09D 1NCJA 1HL5A 3WDIA 4FQXA 4P9HL 4WFEE 3TO2B 4A2LA 4UQAA 3BIKB 2PPCA 3BX7C 4HUUB 2HLAA 2HX7A 4M3JA 2H1PL 1B4TA 2X53A 3UAFA 4AYFB 3SE4C 1CZ8H 4I2XB 3NP4A 5C6TL 3TT1H 4B41A 3BGMB 3OAZK 5DJ0B 2XQYA 3HMWH 1GVIA 5H94B 4HUVB 2I9TB 1XH1A 1DVFC 1EJOH 3JWOH 4DEPB 4O02A 1EXUA 4N2GA 1SY6L 4UI2A 4OFPA 5DT1H 3ILQD 3FU0A 4Y4FC 2F53B 2Q3AA 1VCAA 2VDPH 4R84A 1TJHL 4KJPD 5DGQA 4BH7B 4FD0A 5BV7H 5HYSB 4MX7A 2GAZA 5JW4R 4OGAC 3HFFA 5DZVA 1O9ZA 4Y89A 4ODHL 3WIHA 1AZZC 3HCVA 4ANWA 1N8ZA 1U8KA 4OD3H 3VWKD 1AO7D 4NI3A 5AW8B 2VJXA 5ESQA 3MRCB 3GPEA 4GUPA 3V0VB 3RL1B 1X9LA 1TO4A 4TSAL 3SKOB 5KOMC 4YDVB 5HHOA 4KZDH 4PHXA 5AKTA 2DQTH 2Z8WC 3NZ8B 2LW3A 2Z4TA 3CXDH 4YFLI 5EN3A 1CYGA 5FYLE 3NFNB 2OR8A 2DWTA 3LJ3A 1MJ8L 3IRZA 3N91A 4F15B 1XF5B 4HKJB 2ZNWA 3EOAB 4CN1A 3O3UN 4U6XB 3UPRA 5F7FA 1P4IH 4XP4H 1BEYH 1CPUA 2H4EA 2OMYA 4QRPA 3CFUA 2CUAA 3L4UA 3ZR5A 5MEPB 2VDNB 2VLJD 3MZTA 3MI6A 1H3UA 1QYGH 2YGPA 3CXHJ 5M94B 5LN4A 4OFQA 2VDML 2XT1B 4Z3FA 4OZIF 4RMTA 1U8PA 1E7UA 1RD6A 5JQ6L 1W15A 2VLRE 4KUCD 3KLLA 2WOYA 3DGCR 4J23A 5F3FA 1YMHA 4WWKB 1OTTD 3KPNA 4Z95H 3ZZSA 2R23B 3DX7B 4XN5A 5F8RC 4ZX4A 1XGZA 4NQEB 4JFZL 4LASH 2XWRA 2BCKB 4UNIA 2FQFA 3A6BL 2NX5B 2VLRD 1F4AA 3B1UA 4JPKL 4XOAA 4YVNA 5C0ND 3SGKC 3WGUB 3S88H 3MBEC 3ARGA 3KYKL 3QDMD 3QH3A 5AKRA 5K1NA 5JOPD 4C47A 2YBRA 2DQHH 2X40A 2D8KA 4B97A 4AGNA 3GMPA 5KBNC 4RDQG 1GGBH 3QIBC 1OAJA 5ADPL 3C6SB 4UZSA 2AEOA 3GKWL 2CNZA 5K9KA 7TAAA 1SOKA 5GJTL 5I71B 3KPQA 3UAJD 1XL4A 3IDGB 4E9XA 3ZKND 1MCHA 1HNGA 2JJVA 3QRBA 3CZNA 1GOGA 3RGHA 5GGSA 1PSKL 1JPSH 2BLFA 4ZUWB 3QDGD 1XGRB 2C9SA 5IZ7A 3H7BB 3V5HB 1UASA 4FEMA 2YWYA 2CJ3A 2VAAA 2A6DA 3FB7A 1I9JH 4MNGE 1DBAH 5I15L 2WSPA 3CIQA 4WY7H 3BGAA 1LE5A 1I8IB 3D3VA 5IBTH 1WSST 2YA0A 3FUJA 1CFNA 1W0VB 3DX3A 3AUWB 2J21A 4M4RB 5DQ9B 5J6HB 2W59A 3KYMB 3US1A 3WFDL 2FX8H 3MJ6A 2DQTL 4YXHH 2EYTA 3GB7A 1E2ZA 4G7YL 2E75C 4PRID 3LEXB 1NCCL 2CKBL 5F7DA 1TNMA 1YECL 2J2ZA 3BRDA 1N64L 4ZFOL 3NUKA 5DXWA 5I75B 4AM0A 3QJOA 2NZ9D 4OZFG 1YQVL 3VWJD 2VQ1B 5EG6C 4KC3B 1L3NA 4G5AA 4TMPA 3UZEA 3W2DL 5AB0A 1E9PA 3TCLB 4PVNA 1BJMA 3QG7L 4MASA 4Z3HA 4ZMXA 1NGWB 5LGHH 1YMMD 2B08A 5I1HL 3N41F 1L9QA 4M29A 2X4NB 4P46D 3NN8A 4MS8C 4B7LA 1KTDA 2N0KA 2YGVA 1KSRA 1T03H 2WQVA 1Y0LA 2DQJL 4LEXL 4ZS7L 3NH7L 5A3IC 2P5WE 1B2WH 5EU5B 5D6CB 1OTUC 5IFHH 3K2MC 3I6LE 1CTMA 3O2DL 5BVJB 2R39A 1TSRA 1GJUA 3SDCC 3BDXA 4M1CD 4ODVL 1FSKC 4UBDC 3V5KA 2AVGA 3MNDA 1UOLA 2FWSA 2OX5B 2I5YH 3I6GB 3DIFA 3OHXA 3KLAB 2ENSA 4K8RH 4G83A 1P7QA 1ASPA 1MI5A 4U6TA 4MDIA 3GI8H 1UH4A 3ZTEA 5HGHB 3CBJB 3P3TA 3ULUL 4Q2ZA 3GS4A 4AVHA 4IJ3B 5IROA 1J11A 4XPFH 1MY7A 5E9DB 4L8DA 2V2XA 2FUQA 1CDYA 4KBPA 4XP1L 1J9TA 3Q9QA 3VI4A 3VWKC 4MTMA 5C6TH 3QRFM 5C07B 3E0GA 4NENA 3MGTB 3LZFL 5TDOA 1HQ4B 1EJOL 4MB4A 1A7RL 2AS5M 1IB5A 1UQSA 5E4IA 3IB4A 4D0BA 1P2CA 1FL6A 2VDNH 5DC4B 5JQHC 1AR1B 5FKAB 4I5BA 3VFRA 4AG4H 4FQXD 5DS1A 1A6TB 3SYPA 3UTTD 4BCXA 4MMXA 3V6BR 3OF6A 2EDYA 4DN3L 1GXEA 1AGBA 2WMPB 4XN8A 1TTGA 2XVGA 3NK4A 4O9HH 1V3LA 2VL5B 1TPXB 3IVKA 3GZOA 3QXTA 4TLSA 3JXAA 3DTDA 4PG9B 4EI0A 1NCAH 1S7RB 1NCTA 3SJVE 1EVTC 1UWGH 3RWIB 3Q05A 2XBTA 3VG9C 2X1PA 4HJ1A 3KCPB 3T2PA 3SDDB 4R90L 1MG3C 3KVDD 3P73A 1RK1B 5LGKA 3OWEA 1BA9A 1NAMA 3GXMA 1KCVL 4PWEA 1HU8A 3E3QE 1UD2A 3I6LD 3QQ9D 1XCTB 4MAUH 3WNPA 3NCCB 4HBCH 2Z35A 2CDEB 5C08E 3SZKC 1OTSD 1SUJA 1KBVA 2JKXA 1Z0NA 4X6CE 5GGRA 3HN8A 3HZKA 2RCSH 1QRNA 4NNXA 3HVNA 2IAMC 1MFUA 5IHLB 3KPMB 3MC0A 2OK0L 4JO3H 4LSUH 4YHKH 3EAKA 3KBPA 2QJDA 2BX5A 3THMH 5FGSA 4YXLL 1UB6B 4HWNA 2RIKA 2F15A 3TVMD 3RPIB 1RMFL 1PJWA 2R0LL 2I69A 2J6EL 3VGEA 1FVEA 4NHCL 4XBMA 3VD5A 4FP8L 4RNRA 2AK4A 2AP2A 3QUHA 4N2CA 3H9SD 2VB5A 4OLYH 2OYKA 3QP3A 1BVKB 4OJFH 5I66B 1I7ZB 1OSPL 3MV8D 1FLRL 1FH5H 5I6LA 1E43A 1IEAB 4WKZB 1XH0A 1HH9B 4KNUA 5IQ9A 2P8PB 4GMSL 3FT4B 3HZ3A 5C0FB 3ARFB 3ULUC 5A2IH 1L6PA 1E28A 2OJZL 3N9GL 4J3BA 3B5HA 3NCMA 4J6RH 5F1IB 3CZFA 1OK0A 4LCCB 4NZTH 3SYCA 1NBZA 1FL3B 4JZOB 2WXNA 1ZHNA 4LEOB 4POZD 2BO0A 3UCRA 5ADPH 3AB0C 3MRKB 1UVQB 1HTYA 3G6AA 1FL5A 1ZHLB 4JO1H 4NUJA 1BCIA 3C5SA 3EFDH 5EIVA 2GT9B 3AXLB 1NEPA 1AYOA 3EDDA 4GQPH 1K5NB 3ARGD 4F92B 2XFGB 3BI9X 3OGCA 1DUYB 1KT2A 4W9FC 5DCCA 2EEXA 1JIBA 1MAJA 4P46B 1LP9B 3ASOB 3B56A 5LAXA 5DJAA 4H20H 4E9RA 4X5RA 1RZGA 3LN5B 3O4OB 3JZ7A 3NZUA 2B59A 3V6FA 1UT2A 3X17A 1BQSA 3DK2A 4MA8L 3V0JA 3FQUA 3V4VH 3BP6B 4IOSD 1P4BH 1WVZA 2FYYA 2IFFH 3K6SA 4UTBL 4X98A 2PTUA 4P48A 3POHA 4H26A 4QY8B 1BVLB 1AQKL 3V6ZA 1Q1JH 2WVVB 3D69B 4G6FB 3HNSH 4RAVA 3SQRA 4IIQB 3FQTA 2KYIA 1M9SA 5D93B 2VZTA 4R8WL 4CVZB 1A4AA 2KZBA 1UM6L 1NFIB