4OJDH

Crystal structure of a c-terminally truncated trimeric ectodomain of the c. elegans fusion protein eff-1 g260a/d321e/d322e mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
477
structure length
444
Chain Sequence
b'RAEPPHCSKTPIVRAQTSQNAMGMQMQFSIGLHTAVCFRLYSLLHTIRLEKLEHHHPITQRYTFGIPEVHASCICECDATSSTCTAESHQFTACPEDETSSCYRTFFPNQTPIGCSEDDIPKLCCDVRFKPYKNMTFLAVKLEQPTTYATFVYAAYDFVNGYWVEKDKTKIRSQLDGGTQDRHLDQKRRISLAVTAGARASHQLETGMYFSRTSNGGETEELRMQPLNEITDNNFDRLGWYRMDDSGHFHVNNGVVKMEEIHKAKVKNCKEQTYKSILSANHYMPGHFNLTRPLEVIKPWIQSARIFDSSLRQAVVTHAEGTNLQISIHLESQNLVFFHNASRIRDFSGSIIVDSKSNRLFNLTVYEASGKIDGSVKMSTGFGSDTIHTFTAYVSDLHASNRSMIIPLPAIVGQGARAICLRADSMADIDKICHVIEYFESPLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EFF-1A
publication title Structural basis of eukaryotic cell-cell fusion
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Membrane protein
total genus 98
structure length 444
sequence length 477
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ojdH03
2.60.98.60 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein; domain 1 4ojdH01
4OJDH 4OJEH 4OJCA
chains in the Genus database with same CATH superfamily
4LRIC 5FKAA 1ZV5A 1FGNH 2VSCA 5DJDA 2KZBA 2RFXA 3JQOB 5ANMA 4EEEA 5AKTA 2YAHA 3FK3A 1IGML 3HBPA 3HE6D 4HZLB 1U3HB 1WIUA 5GRJL 2X4UA 1F1AA 4XT1C 1RZJH 1QR1B 5GJSL 2WLLA 5IVXA 1HXMA 4OFKA 5E2UL 3TA3C 3J7HA 3B7SA 2ZP0T 5DHYB 3EXLA 1U9KA 4FG0A 5C0IB 4NWTH 5TPWL 3F7KA 4KKLD 4LOFA 3DGDA 4JZOB 3UO1L 2R8SH 1XGPA 2WWKO 4F7MB 4GW5B 2XIDA 3AY4A 4AW4A 3RL1B 3QUZC 4MCYB 4Y1AD 1XWVA 5JXAL 2VIRB 2RB8A 3ALWA 1N6VA 3GJFK 4FKKA 4XB7A 2A6JB 1RK7A 3OC8A 5EF1A 1E3FA 1UUNA 1H3PL 5E2WH 2WTRA 1CUOA 2KS0A 4OLWL 4FTVA 5KSVB 1JGVH 2HKFL 5EZIH 3LH9A 4PW9A 4BZ1L 3C5ZC 4YSQA 1DBBH 1JS4A 3RZWA 3WXVL 1TTBA 1SXNA 2R29A 3BE1L 5I2IA 5JORA 3D85D 3WEXB 1MG3C 4JKNA 4KKAC 4RMRA 4XAWH 4EO5A 3IMSA 4FG4A 4DAGL 1AQHA 2YMTA 1UOVA 1P0SE 3SD2A 1CBJA 2IIJA 2JVUA 3ECBB 4JQIA 3HVDA 1DVFD 4I87A 4Z7QB 3CC5B 5D96C 2E56A 5DJCB 2VMEA 3DXAE 4NUPA 3JVGA 3MBEC 1AXTL 3F3HA 1Y0LB 3LEXB 1PIFA 2ZOTA 3D8MA 3CH1B 2WO2B 2Y4SA 3ABGA 3BKJH 2A9AA 4JFYB 3VDAA 1DUZA 2OMVA 4NUJA 1A9BA 5GRVL 4BYHA 1GVIA 1RZIA 2JLLA 2X7LA 3DV4A 4OIIL 1VKXA 1NM4A 5G2NA 1L6PA 3BAYA 1NUNB 3OG4B 1D3CA 2HVKB 4WFFD 3T2NH 4LCIL 5AYUL 1G1CA 1RHHB 2OSLA 3MNVA 1KEMH 2C5DC 3P69A 1U92A 3BPLC 3PG2A 4HC1H 1F6LL 3FO9A 4XVOA 3OQRA 4R90L 1FNHA 2F53E 3KPSA 3HC2A 3OR7B 1X5FA 2ZCLH 1OCWH 5KTEL 5DQ9B 1XR9A 2BW5A 1T2QL 1KV3A 2Q8BL 4UZUA 3L9EA 2ZF8A 4HVBA 1IAIL 2XA8H 2C7UB 2K3HA 4IIZA 4TSCL 2ZCKL 4KK8D 3QPXL 4P5TD 1B0RA 4N0YH 2HRLA 1CLZL 3DECA 4DFIA 2OJ1A 2IH3A 1E6OL 1TETL 3DUHA 4QPEA 7FABL 5HHQA 3WUWB 4BFKA 2Y7QB 1PSKL 3MRJB 1AQDA 3U83A 4WKZA 4AZ8B 2CD0A 2YJQA 3I6LE 1T89C 1YEWA 2WYIA 5FGCE 3RJDA 4FXGC 1DN0B 4UT7H 4D0CA 5KJ4A 2MIZA 3CSTA 2VDNL 4WU7B 2XSKA 1JK9B 2J8UE 2XBDA 3F84A 1D9KA 6PCYA 3BQUC 4Y2OA 2HN7A 4J3TA 4OV6F 2Y2WA 4HGMA 4OIFA 1KCBA 4F2ME 3NZ8B 3RDTA 2WVVB 4YHMH 2DQGL 5FUOL 1A64A 1VRSA 1GYCA 1T1WB 4H88H 1IGTA 1IQDA 3PXLA 2BW4A 4CMHC 1BZ9A 3F6JA 4PJAB 1SM3H 3SE3A 4L29A 3C6LB 3V6OA 3IRPX 4I0KA 4YDVB 2XVKA 3W0WA 2OI9B 5I1CL 4V33A 3VCLA 1K5NB 4MA7H 3LKOA 2MOVA 4LLYA 5DVKA 1IM3D 2AS5M 3W2DH 4HQQL 4I0CC 5EN2B 1XCXA 2XQYG 4U7KA 5E8DH 3RWEB 1HU8A 1KCLA 5JOFB 1O9ZA 4UNTA 3Q5OA 3VU1A 1ITBB 3LHPH 4QYOB 4NZUH 1HH9B 2XWCA 4C4KO 1WGOA 1HILB 2IWGA 3POCA 3P30H 4KVPA 2WIMA 2XN9E 3DV6B 4LCCB 3G9VA 4AGLA 4Z77B 5T1LA 2B4CC 1F4HA 4KROD 3RY6C 3OBAA 3FT3B 2BHFA 3PE9A 2SEBA 1NICA 2HLFC 2PKDA 4R83A 3N41B 1TQTA 1R75A 3LRSB 4P23B 5CCGE 4LIQE 2WO3B 3CHXA 3UCQA 3FDWA 5FECA 4JM2D 4NI6A 1I3GH 5LGHL 3S98A 2F2HA 4KO5A 3NIDE 4HPYH 5EZJA 5E8EB 1PLGL 1CURA 2PPDA 5C09A 4G70B 5I1DA 4G7VH 4DGIH 3GKWL 4BFOA 4CRPA 1MCOH 3D06A 1UWYA 2W9DH 5CINH 2NXYD 1U6AL 2FQEA 2N0KA 4BQCA 5IMKA 4LIQH 3O6LL 4ZUUA 1CFBA 3TIDA 3P0VH 3K2UL 2JIXA 4FNRA 1C5CL 3LXCA 1KPVB 3A6CH 4R3SA 4RMWA 3L1EA 1NKRA 4AMWA 1A7PL 2H0EA 2VABA 2EICA 5DD6A 1UTDA 3HAEA 4JFWA 4Z7AA 3BVDB 2IQ9H 1DEDA 1VFMA 4LPUA 3CQFA 4Q4IA 3DUSA 1ZHBB 2WUBL 1EO7A 4KZEH 1SJHB 1CS6A 2I7SA 4FNTA 4EPSA 1FLRH 2YKLL 1JYNA 5LWYL 2D7QA 1CFNB 2D2OA 4JQVA 3RKPA 1HH6A 3KW8A 4L1HA 3BDYH 1QFWM 2K4WA 2YK1L 2I27N 4GG8B 2HT3D 3EJUA 1MW1A 2NY5L 2VH5H 1OGAD 4H44C 5F89B 3WTTA 4O9HH 2NY1B 1LWJA 4JFOB 1QHQA 5DJAB 1UCBL 2R2HB 3BSZA 5I1GL 5C0BD 2WQSA 1E2WA 1UT2A 2CUIA 5DHMC 1E5BA 2I25N 1E5AA 3S34L 3AC0A 1B0GB 4GI8A 4GQQA 3VXMB 1G43A 4DGWC 1MJ7L 3FPXA 3OKYA 2NT0A 3QNXB 4LEBA 3IFNH 1IGYA 5KVDL 4WENB 3L3HA 4XX1E 5C7ZA 1XMWA 1X44A 4P5MB 5I30L 3HE6C 4Y4FB 3BN9D 2MWCA 3L08A 4L23A 5IESH 3ZR6A 2DEXX 4AVKA 2A7BA 3OJMB 4PRHA 4I18A 3UG3A 3U1PA 4LOUD 3HI5L 2AJYH 4X8JA 4PUBL 3SJVA 3IMTA 5AZ2H 8FABA 4NKIH 4KKLC 2VW4A 3ZYZA 5CILH 4QAWA 3MJGX 5C0FA 2EYRB 1FE8H 4D0DB 4BFBD 3LN9A 5I8EA 4EUPB 2WXMA 3JV5A 5AG9A 2ALWA 1P5UA 2UZIH 3OKKB 4U0RC 4NQSB 1GGIH 1TQWA 2EDDA 3QEHB 1IMHC 5IEHA 2K6ZA 5F21B 1TVHB 2E86A 3O2DH 3S97C 1YMMA 1D5BA 2R56H 2DJ4A 2PTUA 5TD4A 1PG7W 3BLBA 4AGNA 1UJ3A 5CSGA 1EK3A 5D7JA 1A7RL 3Q3GB 4OJFL 5L2KB 1LL1A 4W9LC 2PABA 3VFPA 1J0YA 3O2VH 5KVMC 3O2WL 3LXUX 2E9GA 3U4AA 5DRXB 2JKXA 2K9UA 1TJGH 3KPSD 3HG1D 4WU5A 3MGOA 2VDRH 2DQIH 3RWFA 2Y5TA 3MLTB 4LVHB 4K3EL 4J3OD 4XMWA 5D2LF 5EDSA 2OLDA 3O41A 4A63A 5JIQA 2J6EL 5A3ID 3G5YA 1MFAL 3H2QA 4IBTA 1MCNA 3WUWG 4Z0BH 5D8JH 4DSYA 1DVFC 1KFAH 1TZHB 2Z3FA 1HE8A 4WK2B 1A21A 5I1HH 5K1JA 4XNXH 1NGWA 2YJLA 3QQ3A 4K3HA 1BD2D 3HUJF 5CWSA 1AYOA 3V4PH 3PWVB 5JIKA 2R2BA 4XWOD 1ZT1A 4XZUA 4J2QA 4QRRB 5ISZE 1EGJA 4FL4C 5JPNC 5JR1L 5HJ3A 2VMCA 2ZXBA 3N1QC 4GRMB 1YYMH 3SPVB 3PGCA 4QY8B 1YY9D 5DR5H 3TCTA 5FOBA 4D0BB 1RUKL 4U6HB 2AAVA 1QWUA 4KUZH 2ZYIA 5GJTH 4OF0A 3QNYA 1J86A 1LILA 2R1YA 5CFAA 3TOPA 1QI3A 2ETWA 1E42A 3LEYL 3I9PA 1MQKL 4HJIA 5TDPA 4ONFL 4FMKA 1A5FH 5D55A 3L45A 3FYIB 3MRMB 5I8CB 2P5EB 3LZFL 2QKIA 4TUKH 4UQCA 2XOTA 1RULH 4NKDB 3ZUNC 5ID1B 2G4GA 2NY5C 4XXWA 1WAAE 3MV01 2QPEB 1EXUA 5KBPA 1FUNA 3MOBL 2YD5A 4UAOB 3FCGA 4ZNCD 3TTYA 3QDJE 4KK8C 4P5TC 5DJ8B 4DKEL 5DLMH 3K80A 4BZYA 4G80B 1I3VA 4PLNC 4L4VB 3OF6D 3ZKXB 3TVMA 3ZDXF 2JJVA 5C9JB 3P3YA 1B4TA 2H2SD 3QCTH 5FO9B 5MEPB 4QCIB 4A2GA 5DRZA 4U1NA 5ANHA 1CXKA 1F4YL 2EDWA 4NLHA 2R29L 5G4OA 8PAZA 4JHWH 4IBWA 3INOA 3QORD 1T5KA 4A7GA 1W0VB 2N59A 1JHKL 4YAQB 4AGQA 2EINB 1PX8A 5T1DL 2Q7YB 3T6VA 1BG9A 3EYUL 4TNEA 1CF1A 4EXKA 1JHLL 1BVLB 1NMCB 1OAYL 2NQCA 4JQIL 4DESA 3BCDA 1A7OH 1DVZA 2OTPA 3CHSA 5BXFB 1JPFB 1BAFL 4JVWA 4I0PB 1CFTA 1BYPA 4K3DL 1C16A 3VTAA 1RAMA 2BMKB 4L1SA 3UZQB 1ES0A 4PJXA 4L9LA 1TT6A 3VA6A 1ND0B 2XVBA 5FGSA 5I75C 1X6NA 1L9MA 1Z9LA 2WSKA 1KC5H 2E8ZA 2M2DA 1U8CA 3D0LA 4HP5A 1BVZA 2XC8A 1MF2L 1OB1B 1V3MA 2AITA 3SGKC 2EUZA 3BO8B 3CZFA 3MRIB 2EE3A 3CDYA 4ELME 4HD5A 5JDSA 3UBHA 1EV2E 3BVUA 3PQYA 1FDLH 4NPYB 2IPKB 5J6HB 3NOIA 4KROC 3MN8A 1JV5A 4YPGB 5GS0H 4F8NA 2X4NB 3LKPB 3U0TB 4FNUA 4Z3HA 1NFIB 4OB5L 4ZOBA 1MFCH 1GC1C 32C2A 3HFMH 4JM2C 2EKJA 2QGCA 1CGSH 1FZKB 4Y8AA 4GBXB 3VXRE 1UFGA 5A40E 3G5ZA 4JKWA 3BKYH 4F8QA 1HKFA 3PGFH 2F7RA 3JWOH 3ZL4H 2VR9A 4WI8A 2KLSA 4TS6A 1EAPB 5KYNA 2BWDA 3DROA 3T09A 1JGUH 4NUGH 4ZX3A 1MVYA 3BX7C 2NXYC 1J5CA 3SGEI 2G3ZA 4KVNL 3V0VB 2DMGA 1OWRM 4N8VB 2X0UA 5C92A 1T5XB 1TTFA 1MFDH 2HB0A 4EUPG 3CZKA 4U2ZA 1LK3H 1XDTT 3RJOA 3WFHB 1EDQA 1BXXA 4ODWA 4PRHD 1SYSB 5BUPA 1YLBB 5AOZA 3E8VA 1TYRA 1O9WA 1S9VA 4GIPD 4G2AA 5E08H 4L3AA 1VADA 2CK0L 3APFA 2O5NA 4BH8B 1SEBB 3N9GL 3NCCB 3MLYH 5ALBH 5I6OA 3GLZA 4HLEA 5D1XB 4U1JB 2CNYA 4TNGA 3ZU8A 3IDNA 2NDGA 4YXLH 3P4NA 1EDHA 2J7LA 4OVUA 4S1SL 3WEMA 2OK0L 2N7AA 3EO0A 4YR6B 4YXHH 1OV8A 4RMUA 5EBWB 1QLFA 1FL5B 1RUML 4GI9A 1OAZL 3LQAC 2HT3C 2UZYA 1V05A 4S1RL 2A74A 1NIAA 4HU2A 1IKFL 1NGXB 1QRNB 4DZBA 2OMWB 2MTAA 1NOAA 1ZA3A 4FRWA 4FN0A 3POHA 3QCUL 3HKFA 3TYFB 3CSFA 3OMZA 1Z6JT 1CU4L 1TZ8A 2FEDD 2XV2A 4G8FB 4PGBA 3ARDB 5CJXC 4P4KD 3UZVB 1P5VA 1YN7B 2CGZA 2O5YH 5DF0A 1KTBA 3UTQA 3L54A 2JF1A 3ARUA 5FYKE 3GMLA 4XP9L 1CICB 3SKJL 1FP5A 1QATA 1HI6B 3BN9C 4ZX5A 4A2LA 4FFYL 5DI8A 3CZEA 1D5XA 4XCEB 1BZ7A 2RCSH 3CFCL 1BOGA 3KWWA 4EXPX 4LOUC 1QNIA 2WW8A 2XYCA 4J8RA 3AQYA 3BW9B 3NRFA 1GHFL 4WEMB 3QE5A 3IJSA 4WI7A 5C0JB 4KNSA 1QZ1A 3SE6A 1YJDH 1YEKL 4LLDA 3AM8A 4WEBH 3WENA 1EEQA 2R0ZL 3HW7A 2LR4A 1X5HA 3ZMEA 2P7TA 3V4VA 1PCXA 4Q9QL 5FYKH 2ZD0A 1X5MA 5IFJA 4MHHI 2XZZA 2ZIDA 1MCCA 2TRHA 3WTYA 3Q2VA 2LLGA 3NT0A 2YSSB 5ESQA 3GMQA 3IVKB 5HHNB 4Q9BA 1Q0XL 4AGOA 4TULH 4MMXC 3FQXA 2OMTA 4CVUA 1MUJB 1DBJH 3Q8BA 3ARVA 3HTLX 4MXVE 5DZLA 5F1IA 4LEOA 1CYWA 3FFCA 2D8KA 4EIZC 3RNKA 5GRUL 1AS8A 3VSQA 5FPIA 1EZVY 5BVPL 4J3OC 1TNNA 4HV8A 4JR9H 5KG9B 5A3IC 3MLZL 3NJFA 2EACA 3FAXA 4P5KB 4MJ5B 2YQ2A 4IHBA 1TZGL 3BAEL 5AL8A 5IHZA 3ENEA 5LDUA 2F7PA 1ZLVK 3E1ZA 4X6EB 4NCC1 1H8NA 1Z0MA 2VLJE 4N2DA 3P77B 3X3FL 3PU7A 4XCCH 4XVJL 2ZSWA 5KWYC 2C9SA 4XWOC 3DSFL 4W9IC 1WV7T 3QAZC 4HUVA 4MJHA 3JWNE 4ADGA 2O61A 2OW7A 5FC9A 3VDBA 3T3ME 3BSZL 2L7UA 4MBRA 3VGEA 3W5MA 4PP1D 1A22B 1BEYH 4FAAB 4I9WD 4HPHA 1YY9C 4LHUA 2VXUH 4PJEB 3RGVD 1DBAH 2FGZA 3H9HA 3GMMB 3L5XH 4LVOB 3MUGA 7PAZA 1CT8B 1Q9OB 4BK8A 3V6ZB 1XGQA 3IDIB 3G5WA 3VH8A 5C0EA 2O5XH 3BWAB 3E1F1 5MP6L 4ZUSB 1YA5A 2BIMA 5C6WH 2CHNA 5E00B 5G5DA 3KYMA 3SDYL 1EX0A 1K4DB 3FB7B 2LLLA 4B53A 3JWNH 1Q38A 3U6RA 3IJEA 4PCKA 5FHAH 5H37A 3FRPA 1NIFA 2WXNA 4JNXA 2AJUH 1DDTA 3HEIB 3NFPA 4MDIB 1SYVB 2ENSA 3CBJB 1JRHL 1A4JB 1WZKA 2DBJA 2HFEB 3K8KA 3SDXA 3D1MC 4YWGH 3V4UH 5FW7A 4QRTA 1PTZA 1EHNA 3IU4L 4HKXB 1QLEL 1JZEA 1PQZB 1BFVH 3RIAF 1KDIA 4HIQA 4KHTH 4ZS7H 5KSBE 1T21B 2XY2A 3F7RA 2FYYA 4FA7B 2XX1A 3DPBA 4JPWL 5FW8A 3MLVL 2MNUA 4XI5D 2H2SC 1NBZA 1DHKA 1JK8A 4N90E 4AEHL 3K1DA 2XQBL 4UDUB 4IJ3B 4B9FA 5HHPB 1MDAA 3K72A 3QORC 1TJXA 4Z7WE 2IPUG 2Z4QB 4FFWC 2EDEA 2QR0A 4N8VG 2DQTH 1KTJA 2Z35B 4BH7A 3QNZB 1AKPA 4R7NA 2WHVA 6PAZA 1OB0A 3I85A 2FGWH 4UQ3A 5EBLB 4EBQH 3VW3L 1CD0A 1OHQA 3ZDZE 1DUYA 4Y5VC 3WMSA 3WELA 4K8RH 1J9RA 1USZA 3VGAC 1CZ8H 1AD9B 2FO4A 4E9XA 1G7QB 2LVEA 1DEEB 4TMPA 3L3IB 3RG1C 2QADB 2YD3A 2R2CA 2E27L 1ED3B 3I50E 4GFTB 1EGJL 4GLRI 1TLMA 2DZEA 5JA9A 5B4MD 3MBWB 3VNZA 4UQIM 5DDHB 2ZWYA 3PUUA 4B9PA 4F8TA 4OCNC 1G9EA 2ZX5A 3P9LB 2B5IB 3QXVA 4JO4L 4XBEH 3O4OB 4F80A 1BOYA 3FTYA 1IVLA 5F88A 1XGUA 4YE0A 3I50H 5C7XH 2OL3H 2NRDA 4Z7OF 4JQVC 4AIOA 3RX5A 4FNPA 2RQEA 3GWJA 3FO0L 1I7ZA 3FBQA 4QLWA 3Q7JA 2PLTA 2WXIA 4ZO6A 5GZND 2VSMB 3C60A 1A6TA 2JCCF 2LABA 5DRWB 5D1ZI 5JXEA 3V79C 1F45A 1HSAA 4ZW6A 1ILSA 3P11L 3O3BB 1R24B 4TQIA 3DRQB 3QI9B 3CAFA 5CLZA 2VW6A 4GLRH 4N2MA 1A7QL 1QBLL 1BZOA 2NDFA 3HZMB 5F6HJ 3ZIMA 4WSJA 4UWQB 2OMYB 2IGFL 4M43H 2ZCHL 3FHEA 2ZX7A 1QSVA 1RJLA 2YUVA 1JZ7A 3GIVB 1G1YA 1FORH 1O7VA 3U46A 2MH4A 4WTXA 4FI8A 4YSAA 4X0KA 5JLZB 2CHZA 1TLKA 1Q9KA 2FQDA 4DF9A 5E9AA 2ZF9A 2VISA 5IMLA 2XPGA 2C9RA 4WI3A 3HN5A 4YZFF 1PYWA 4LASH 3LV3B 4NJAH 1N7ML 1MREH 1URZA 2ZUYA 2YD9A 3S2AA 4NZ8A 2APWA 4G9FD 1I8KB 3WFBL 3OL2A 1U95B 4U1GB 4JPIB 1I7RA 3TJPA 4X9YA 3VWKA 1BQUA 1X4XA 2FTAA 2C3GA 1UJ3C 5T1MB 4KKZA 1BLIA 2F1BA 2IH1B 2IADA 3LIZH 4Q6IA 5TDNB 2F7OA 3U30C 1ET7A 2VL5A 2KHAA 5ITFB 4XP4H 2PWGA 3UP1A 3WFDL 1JN6B 3U0WL 2YD8A 1RPKA 2GITB 5B7FA 4ODHL 2VZ3A 4KRPB 3NFSH 1PL3A 2FEDC 4Y16B 4M48L 3L3GB 3U7WH 1FGVL 1I4FB 5IW6A 3OTTA 5LBSL 4P4KC 4ODVH 3GJEB 5DCCA 4ZJ9A 4MMZB 4P57A 3UBXB 1AGFA 1BREA 1M2VA 3BLKA 2QQKL 3I3DA 1ZDSA 5I16B 2BHZA 5HYIA 1JHTA 1G7HB 4XCFH 1HJBC 1LO2H 4NQEB 1JGLL 1RL1A 2JLPA 3NVQA 1LEGB 4ZQTA 3ZQ9A 3ARQA 3DX6B 3IE9A 5EO1A 4LSPL 2VAJA 4RIRA 4BZ2H 3QZWB 1GZPB 5D2LB 1FL3A 2HJFA 3GI9L 4U1HA 2VWEE 1M1XA 4Z76B 1MAML 2V17H 5CJQH 2YLHA 2A9BA 4UOW0 2DQJL 5E6ZA 4KHXL 3B9DA 5ES4B 4A2DA 3CUPB 4KDTA 3V5KB 4LCUB 1Q90A 1JF1B 1AIFB 4N4YB 1TSRA 1BVNP 1RIUH 2OR9L 4WHTB 3HUJB 3FMGH 2XIIA 2QLVB 4JY4B 4LO9A 2EXWD 4K7PH 4M1GL 2NYZA 3SO3B 4R26L 4KOCA 1IGCL 3TBSB 4TTDD 3MJ9H 1USQA 1NLDL 4AQ1A 2DW5A 4ERSL 4HWEL 2VLLB 4GG6F 2BP8B 3HMXH 2E7HA 2GKIA 4IBYA 3KM2A 1E6JH 2X3CA 4W4OC 1KIPB 4U4BA 3WEAA 4LK4A 4LOEA 1BLNB 4LLQB 2WCGA 5ICXB 3G5XB 4AC4A 1R5WA 4IRZA 4N0RA 1X5XA 3HR5A 3A22A 3C6EA 2P8LA 4PJHA 5IFAH 5JQ6L 3TYGL 2FX9H 3L4TA 5C6TL 4LFHD 3TEZA 5AAWC 5GZOA 4GRLA 1EHKB 3CN4A 3BVVA 4ILDA 4KWUA 4Y5YC 3QIWA 2X6VA 4OCSH 3HS0C 1S9YA 4KQ4L 1R17A 4PP1C 5DD0L 3SOBH 4PJIE 3RGVC 4W6YB 3VAEA 1UVQB 4NNYB 5DEFB 3C2AL 2JV6A 5DVLA 5GSVB 1YEDB 2J71A 1CD8A 2A73A 4X7SH 4ZX4A 1KYOK 2GI7A 1YYLL 4NZRH 3ZDXB 4A04A 1WVZA 4V2BA 3EH1A 1QUNA 3R4RA 4G6MH 5FDYA 3X11B 5CJ8A 3H9SB 4JX0A 1JNHB 1D2PA 5D7IE 2BC4A 2G75A 5ESAA 1N70A 1WGVA 5LXGH 2VT0A 4P49A 3FXIC 1DVYA 4PH8A 3UTPE 3FCSA 4P2OD 5HGDB 1XZ0B 2VNCA 2F1AA 5EC1B 3ZZLA 1SOKA 3GRWH 3NCYP 4L9LC 4FFVD 1IBFA 2BXZA 2WJ5A 3IFOB 4XP1H 3CMGA 1BJ1J 3FN0L 2CM6A 4BSVA 3MAWA 5TF1L 4MJ2A 1PX4A 3V4VL 4ISVB 1J8HD 5MENA 3TFKD 3HZVB 2APBA 1QWHA 1JV2B 2XQYA 3KPRA 4G6KH 2CLZB 4AM0A 2KPWA 3GM0A 5AVSB 1VEOA 5GHWH 2H8PB 3MREB 4KTEH 5JHDD 1XB8A 5JHAA 1OT4A 1O7DE 4D7PA 4UZGA 2A9ML 4XI5C 2EC8A 3FUFA 1CFQA 2W0LA 3VTTA 1IAKB 1MLCB 2XJLA 3C09B 3ISRA 3IXAA 4M7KL 4BK5A 1A2YA 4JLRB 5I73C 3VFOB 3INUL 3K3QA 5ADOH 2GTWA 4IBQA 2HFGH 4JHVA 5I6MA 2IG2L 4LCVA 5BMFL 1EO5A 3CLFL 3S36H 5BRZD 1RY7B 3C60D 4R0LB 4ZNEA 4DPRA 1JZFA 4WFHE 4YXKL 5JXED 4J28A 1UENA 4J1UB 4HZLA 2AZAA 2ZAHA 1XMEB 5HI3D 1RCYA 3US9A 1T0MA 1AO7A 1H3GA 3KNBB 1AR2A 4IKLA 2HKHH 1NPJA 2GQHA 4C55A 4PJBF 1NCCH 2RALA 4XE5B 3ECUA 5C0IA 2DWEB 3F00A 5EEWA 3CLEH 1LMIA 4ONHA 4JZOA 4F7MA 2VMDA 3MA7B 3P4OA 4GRWF 4GW5A 5B4MC 1KGXA 3QDMD 3F7LA 4M5YL 2L7EA 2DV6A 4U1MB 4LLVA 1NCDL 4HJJH 4GO9A 3X1BA 1IAMA 4DK5A 1NCWL 5E95B 5IR1A 1ORSA 1TFPA 5I5MA 3TBCA 4KK6D 5F3BB 4JM0A 2DQHH 3SE4C 3LD8B 4IIQB 3WEBA 3WTWA 5BS0E 1WT5C 4XBGB 1F4WH 4W9JC 3L3DB 4EI0A 2CIIB 1O6TA 4G7YL 2YBRA 5FV2A 5EO0B 4UYQA 3DBSA 4G9DA 1Y6MR 4XH2B 3H2PA 4Q6KA 4JS7A 3CZSA 3WO4B 1DCEA 2DQFA 2VDQB 5JO5B 5GZNC 3ULUF 1FLTX 1B2WH 3UBXG 1RUAL 3UTSE 3U82B 1IFRA 1KYUA 1NMBH 3VFGH 5JTWA 5MEQB 3UJTL 4X9BA 4AYBA 1UM6H 5SWSE 5CCHE 1RK1A 2XICA 4DTGL 1QG3A 5IKCB 4K7FA 2Q76B 3WKNA 3D52A 1VZGA 5DJCA 3QZWG 1F58L 4RQQB 4HHAB 4WO4A 1A1NA 3BT2H 2Z0BA 3REWB 5F9OL 1SLVA 2WQUA 3L7EB 1U2YA 4NNPH 3OX8B 3LEXA 3EJYD 4ECNA 1AOHA 4JFYA 1MCWW 3L95B 1HVXA 4GEJA 1KB5B 2OTUA 1PG7X 3FF7A 1N0LB 1I1FA 1CDCA 4XAKD 3GGWB 3MCKB 4BFIB 4L5FE 1FNSL 3OWEA 4K94L 5DJ6A 1ZPUA 1PG7H 5BV7H 4LLWB 1LE9A 3O45B 2HWZH 3CU7A 3QG6A 5F71A 2BNRD 1GMEA 3AB0B 4WHDA 4P9HL 3RIKA 4OLXH 4ZO7A 2GJ6A 3GSXA 3BVWA 3O9WD 2WN3A 5DD1L 4ZFZB 3VD9A 3GTNA 1AHWB 3UAJA 1P6WA 2PPCA 4L5FH 3V0WL 2NNCA 4ODTL 2A9NH 5FA3A 2WZ5A 1HZKA 5BRPA 1IIIA 1BDYA 3MRKA 4RGOL 4UI2A 4ZFGL 2YOAA 2OZ4A 5C71A 1DO6A 4B0MB 4NO0B 2WZPA 5LCVH 5J6GB 2GIYA 5KW9H 3G6JE 1L9NA 1VHPA 1KBWA 3EJJX 3LZOA 1E9PA 1TTRA 4OCYH 4DEPC 4FEMA 1NMAL 4Z7QE 3ZT6A 2R0KH 4XNBA 4ZXBB 4HJEA 1C1EL 1U3JA 2Y7QA 3MRJA 2AEPL 1UD4A 4HT1L 1I8MB 1AHKA 3IWVA 4PM1A 1OSZA 3QDGE 2VDPB 1QHOA 3E6HB 2DQ6A 1N5AB 2VYRE 4M3KB 5DYOB 5D72L 3L3JB 3CDFA 4CU8A 5GZOD 4QHNA 5DMJB 1KEGH 1F3JA 2C8NA 3DNKA 2F74B 3QJUB 1OAQL 5D7KD 1DLFL 4H26B 4XVUD 5DWUH 5A2LH 4DN3L 3ARYA 4PB9H 2ARJB 4BSWA 4JRXB 5CEZL 3CN2A 3NZ8A 3DX9A 5BZXA 4OV5B 2CBPA 3HZYB 2VRKA 1UXLA 1J9TA 2JSFA 3ROLA 3NP3A 1OEZW 2EXWC 1JCVA 4Y4HB 3FUEA 4JFFD 1XH0A 5AW4B 4TTDC 4Y1TA 2MPVA 5KVFE 4M6NH 3C6LA 4QGYA 5EUKB 1R3JA 4YMPA 4DPBX 3JT2A 4XXCC 3WHXB 4P2CG 1GL4B 1TZIB 2DDQL 2K4AA 3C08H 1N4XL 5JOPD 3V5DB 4KZCA 4U6YA 3WV0A 1A4BA 5EWIL 3TN0D 3GFUA 1H9DA 4ODBD 2GYSA 3IETB 4RDBA 1AG0A 1BGXH 1HH9A 4JB9H 3T6XA 3WTVA 2YGVA 1FH5H 1HILA 3GHBL 1J18A 2CO6A 5KVFH 5DHXB 4PGJA 5FUCE 3FHQA 3KPRD 5JW5A 1I9JH 1UXWA 1N59A 1LMKA 1UHVA 3FT3A 3AU0A 1S78D 3QDAA 1MWOA 4JZJC 4NQCB 5L8LB 3RIFK 4P23A 1P4LB 1EEUA 4IDJH 1MNUL 5KOMC 5BO0D 5ITBH 1J1PH 1P7QB 2DD8L 3D4YA 4ZMWA 4QHLA 4OD3H 1W8EA 4S0HA 4JFPB 3AMLA 3P0YL 4XXDA 2BSDA 1KJVA 2AQ1A 3GLEA 4JANA 3DTXA 1R3IL 2DYPB 4OT1H 3M1CA 5I5IA 5CIPB 2NW3B 4G5ZL 1CF8L 2J5LC 1OKEA 3FQNB 1T03H 1B0IA 1EFXB 1UOLA 4QXGL 1QFWL 3D48R 1AS7A 1V7ML 3QCVH 5M95B 3EZ8A 3OVUB 4FFTA 5ID0A 3CXDL 4PJAE 1BQLH 4P2OC 3PL6A 2YD4A 3BPNB 3QYMA 3K71A 4FFVC 1CE1H 2GBAA 4PG2C 3PPEA 1II4E 1M71A 3GHEL 3WU1A 3FUMA 4MD0B 2V3EA 2FD6L 1MRFH 2FL5B 4R96B 2DMBA 2OS7A 1R3HA 3TFKC 1ZHBA 1T7YA 3WIHA 3ARBA 1PNDA 5DFVD 5B39B 1Z5YD 3S3CB 4QXTB 1T3FB 3ZY7A 2ERJC 3US1A 4BEIA 3IDUA 3AWFA 1R5IA 5H2BA 5C9KA 2G60H 3UYOD 5CBAB 1YY8B 4GG8A 5B1JC 4JUTA 5ICYA 3HG3A 2VN3A 5F89A 2VZSA 2AJSL 5EU4B 2A2QT 5DJAA 2R2HA 1O5DT 1H19A 1ZLWH 1E8YA 2P49B 3QXDA 4ZFOB 1N0XL 3ZE1E 2ESVD 25C8H 1I8IB 3BUBA 3NABH 5C08A 5BUGA 3C60C 3NIFE 4HHWA 3DXAA 4AZUA 3IRZA 1FN4B 5A6MA 3I9IA 2OCFD 4IRZL 5AWNL 1GR7A 4P5MA 4OGXL 5JW4Q 4E5XA 3V8CA 1EVTC 4MNGE 2VN6A 3HVNA 4XNQA 3EDDA 1FO0B 2CPCA 5HI3C 4Z7OB 4NAJA 4LAQH 3OZLA 2C26A 2EH8H 4ODSL 1T4KB 1YQVL 1BVKB 3ATFA 4MA8L 4DK6A 4ORGA 4DP5X 2JCCB 1AZVA 2EYRA 3H3BC 1RJZA 4GSDL 1KCUH 3U4EA 3T6QC 2XXCB 2HYMA 2OYPA 2YA2A 4GNKB 5F8RC 1T7VA 4MMYB 4NQSA 5HBBA 3UC2A 4PFEA 5DQJB 3BWUF 4TVUA 3L7FB 3R0MA 2DQDL 4B97A 1YNKH 1OWWA 3S96A 3ULVD 4U6XA 2XG4B 3AADB 4KK6C 3IYLW 4PIRF 5L2KA 3SE8H 3VYNA 3HHSA 1AI1H 1T66D 2XXFA 2PPAA 3A67H 4PJDE 3NEEA 2YUXA 3HLAA 4Z7VB 5B8CA 4R4FL 4N8CL 1FV1B 5CXPA 1J1XH 4H25B 3VACA 4XN2A 2FT8A 5FA4A 1NBQA 1DYZA 1EZSA 4Y2LA 4PGZA 3JT0A 4NUMA 4UANA 5KYWB 3FSAA 3FT1A 3TCLB 1T83A 2VDKH 2J8UA 3DMMB 1UACL 1HEHC 4PRPE 3FRUA 4H40A 4O58H 1AZZC 4G1MB 1PKOA 1C7TA 1LE5A 3L5JA 3EJYC 4F2MA 1UYWL 4UF7C 4WW2A 4P3DB 3KPOA 1KXVA 4A7TA 2IPTL 3D3VD 3NACL 3SPVA 3K5SA 1PLAA 4HH9B 1BIIB 4AENA 3WTUA 4CA4A 3KGUA 4QRQA 5D7LE 4WGWB 3HS9A 4HULB 4M6OH 4U6HA 1K4CA 3UC0H 1UWEL 3ESOA 5FCUH 3BP4B 3BXNB 4PG9A 1IC7L 2BZDA 2Y25A 2V9TA 3DX2A 1GPOL 4X5XB 1OALA 3ILEA 2NNXA 1XB6A 1KTLA 1KXQE 2XY1A 2E7BA 4R6UA 3O9WC 1KTDA 2NXZB 3QEGH 4X9GA 3UAAA 5KBLA 4AQ1C 2FDBP 2G2RB 3BIKB 5ID1A 2D7TL 4JFQA 5CN1A 1WBYA 2H1PH 2XN9A 1NLBL 1M7UA 3Q2LA 2BS71 5IQ7H 4OUUB 2WBKA 2PR4L 4ANXA 5K39B 4RGMB 3RJQB 4M3HA 3S88L 5I1AA 5IGXH 3GIZH 3B7UX 5F9JB 3QUYA 3SB3A 3CH8A 4MVBD 3T3PE 1FIGH 4GG6B 4S0SD 4P5RA 2PCFB 3M6DA 4QT5B 3CFJB 3H9YA 2IAND 4ZTPL 1HYSD 1YEEH 2VDMH 5EF2A 5DUMH 1B9ZA 3LDBC 3BFOA 2H0FA 4U4IA 2WBJD 3PWPE 3MRLA 4UQAA 1ACYL 3S8WA 2PMZA 1W0VA 2NY6D 4RAVA 3VG9B 3H1ZA 5LXVA 4UIKH 4XVUC 5CZKA 3WJLA 4ZFFA 4MB3A 5E8OB 2VR8A 4TSBL 2K0RA 3FCUB 5E9NA 4B6ZA 3MRHB 1BVLA 2X4TB 1KPUA 4DZ8B 1BZQK 4WFGE 2O6DA 4PV8B 2B1AH 4MQXD 3WKMH 2YAPA 4EKJA 5CJOL 4YDKL 1DQLL 4WY7H 3MODL 3W11D 1E8WA 1TEFA 4I1PA 3O6FD 2F7QA 3QULA 2BMKA 3QPQD 4MX7B 4YK4B 2VKXA 4DNLA 2NSXA 2YA0A 4QD2E 4QXWA 1GSMA 4AIZA 1RI8A 4E41E 5DFWH 2OMZB 3DX8A 3KLLA 4RAHA 4M61B 4N0CD 3GMPB 2C1OB 1OB1A 2R83A 3TN0C 2G5RA 3C8KA 4JDVB 1Y1UA 1KELL 3IE4A 1BPVA 3E8UL 3BO8A 1PZAA 1SJVA 1S3KL 4LQ1A 2NY7L 4HUKB 5MI0B 4DOHB 3PGDB 3T8MA 1VPOL 1BJMA 2IPKA 1E5CA 4FXKA 2PO6B 4YPGA 1S78C 1JWUB 3ABKB 2E4TA 3MBXH 3NGBB 3MRNB 5EUOF 1NFIA 1P4BH 5C97A 3UPRA 2B77A 1MCIA 4UM9D 5JZ7D 1FZKA 4XN9A 3PS6A 1S7RB 3STLB 3BKCH 3GXIA 4Y7MA 1TEYA 4MAYB 4PJ7E 2FJFB 3QQXA 2P80A 4J27A 2AK4B 1Z5LB 4ZUTB 2OZ4L 4YO0A 2A6DB 3N1GC 4HF5L 1DBKH 3MLXL 4GO6B 3BGFB 1CDJA 1XBDA 3VQMA 4WTZA 3FQTA 1LP9A 5IJKC 2BRRH 4POUB 5F1SA 1H15B 5AAMC 2C3XA 5C07E 1ZPLA 5E8NA 3TZVA 1MCDA 4PLJD 2YAFA 1A25A 1OE1A 3WFHA 1SYSA 3WNOA 5GGQL 4DUXA 4ABQA 4BH8A 4ENZA 3FT4B 4I3SL 3V5HB 2VZTA 2DQMA 4X5WB 2CKBH 5EORL 4U3XA 4N1HB 5M94B 1X5JA 2IAAC 4BGLA 3EOBB 5L7XH 4B0MM 1ZE3H 3AUVA 4LSDA 4PJBB 2IV9A 1SMAA 4YR6A 5CLYA 2YZ1A 2F53D 3MYZA 4H5SA 2AF2A 4TL4A 1L3WA 2AXWA 2HJLA 3DOHA 4CMMB 3M17B 5B1KA 1X5YA 4OGYH 2WCSA 2FBJL 1QSEB 3ROOB 3BEVA 4YVUA 4ZMXA 3ES6A 1QRNA 3DKHA 1WFUA 2WKGA 4EOWL 3QWRA 5DMGD 4CSSA 4CVXB 5EU6A 2KT6A 2WXOA 4TVPL 3CMOH 3JTTA 3K6DA 3QGVA 2CDGB 1FPTH 3BC9A 3OJDB 3B1TA 5I24A 4TVSa 1MCLA 1RZJL 5B1CA 3PV6A 4Z7NE 3I6LD 3O3AB 1A7NH 1KYDA 2E8YA 2RGSA 4CU7A 3ESPA 4RX4D 4XNUH 3L1OL 5HYEA 4P59H 2R7EB 2B8OT 2JB6A 3OZ9L 4I5BB 4NWTL 1R0AL 2NR6C 2YRBA 1UZ6F 3RY5A 2MMXA 1EPFA 4MJIE 5IB3B 1W91A 3TA4D 5C0JA 2A77L 2WQ8A 2IBBA 4GUPB 4DHLA 4AVHA 3VGGA 4FQ2H 3AUWB 3T65B 2FYVA 4G7SB 1RIVL 2F54E 4B50A 4MNQE 1EHLL 5E2WL 4KMTH 3ULVC 4M4PA 4QKXB 2Y6SD 4ZUVB 1JGVL 4UTBH 1K6QH 5AG8A 2YSSA 5F1NB 2FWLB 2O6PA 5HHNA 3HPJB 4X6CF 2MCG1 1EEYB 4NQDB 1E2ZA 1Q72H 4X99A 2H3XC 2Y72A 2X1XR 4JRYB 5EHFA 4FERA 3SCMB 1MJ8H 4QRPD 1T66C 1XQ4A 4F2FA 4ZSOE 5DS8A 2G2PA 3K91A 1VGEL 4BRJA 4IOSD 2C9PA 4BBWA 1NGQH 4TNVK 1U93B 4XAWL 3WMPA 1U4EA 2HG5B 4FOMA 5HDRA 2VM9A 4PW3A 4M1DH 5KJRH 1V3KA 1NCAL 1Q9WB 5KG9A 1FIEA 2XN9D 3P3SA 4P5KA 4MJ5A 2JJSC 5T3ZL 3LZNA 3WIHL 4HKZB 3QUXB 3UADA 5F44A 1M05B 3S9DB 1YPZF 3P77A 3LRKA 3PRZA 3VVWA 3QUYD 1LEIB 3AS3A 4JPKH 4QHMA 4A7UA 3BPCB 1NUFA 1PGRB 4QOKB 5HGAA 5AVYB 2YPLB 5J0BA 4LL9A 3CWGA 1FYTB 5HDBF 2OW6A 5C0DA 3RVTD 3F58L 2JELH 1ZXKA 2OYLA 2F08A 3DO4A 4PJEA 2X38A 3ZYJA 3M7FB 4AT6B 1S8DA 3RFZC 4AK1A 5HDLA 3V6ZA 3IDIA 4ELKB 1AACA 3BWAA 4QRUB 3K4DA 5LG6A 5EEZA 1CWVA 2CUMA 4O2FB 5BRQA 1R1CA 1H5BC 4NEHB 2ZCLL 1D5IH 3VD7A 4N6QA 3VFTB 2QTEA 3VXOB 4IYKA 3APNA 4L4TB 4ZDHA 5FO2A 1S7WA 4MDIA 1SYVA 4G8IB 2K7PA 4WNQB 5HGHA 4PWFA 12E8H 4FMVA 2D03H 2HFEA 4N0YL 2J20A 3OAUH 1X4ZA 2DIJA 4FHKA 4PRDB 2J56A 2ZKWA 3SGJC 3U9PH 1TOXA 4KTDL 4X6DE 4L1DA 3NCJH 5GS1A 3S3DB 4AUUA 2AVFA 2NW2B 4HUWB 4MVBC 5D5MF 1T21A 4JFDB 3VXRA 3EO1B 3GRGA 4UT7L 1HYSC 3DOIA 1P7HL 2EKSB 1OF2B 2EDFA 35C8H 4OCRH 4LSTL 4UDUA 1QQDB 3BSGA 2WBJC 3CHRA 3QJSB 4IMKC 3AS0A 3IFLH 1QOKA 4AWJC 3IJ9A 2NY6C 3GMRA 5DVOA 3H3PL 2ARJQ 2Z4QA 5IVXF 1IILE 4H88L 4D9LH 1MCEA 2VQ4A 3QNZA 4YHLL 3QIUA 4NQTA 1WDAA 2NSMA 3MI6A 1H0DB 3WFCH 4MQXC 1NC2B 1SM3L 2XUWA 1JTTA 1UXSB 1AD9A 3W11C 2O1AA 3O6FC 2MCPH 3QPQC 1ED3A 3TEYA 4OQTH 1YECL 1E5UI 5D1QE 1J9CT 3W2DL 4D9QE 1BECA 1PW3A 4WV1A 2B4CH 3NTCH 3RWDB 4PREB 4X6FB 1KBVA 3MBWA 3R1GH 5DDHA 3L9YA 4N0CC 3SPIA 1H9VA 5HDOA 1RJCA 4L3CB 4AGMA 4NGHL 3P9LA 1NCTA 2DYSB 5IBTL 4JE4B 2B1HH 2XZCL 4JFEA 3ZE2F 1UOKA 2ZXGA 3VXPB 1UZGA 4KQ0A 3MCLH 5A43C 4JCWA 4Z7UB 4HWZA 3B5HA 2WWOA 4X7TB 2PPFA 5DZJA 1I3GL 5G4MA 1KN2H 1MHEA 5JZ7C 1AGBB 3ZBMA 4HLZG 3H8NA 1DL7H 3SBPA 1A6ZB 1SXZA 3FU0A 3MCG1 3GK8L 1MCOL 3QBTB 2X89A 4FCAA 1P7KA 3N5AA 3ZR5A 5IJVB 4OF5A 4LIQL 4PJ5B 5AKSA 1B88A 3T4AB 3WN5A 3K0WA 1QTPA 4PB0L 3IJYA 4HFUH 3P0VL 5ISZD 2RH0A 1F6AB 4NBYB 2OX5A 4W81A 4PLJC 4WWKA 1QACA 3PWJB 4NQUA 1JPGB 3B9AA 3MBEB 3QJHA 4ETQA 5DSCB 4NM8H 2XN0A 1LK2B 3MPCA 2BDNL 3G9AB 4AV5A 2BHUA 1GKEA 2IQ9L 3QIBB 4OIBA 4LRNH 3B2VH 2BO0A 3WXWH 1XGRB 3KYNB 4AL8C 4IGBB 4PHZA 5I19L 1IQWH 5I23A 3TBVA 1JAEA 4GKSA 4BK4A 1I8KA 1TYJA 2P47B 2Y7SA 4AQOA 3UGUA 4J3OF 4F7EA 1QBMH 5T1MA 5D4HA 3H2WA 4O2EB 1QI4A 4PRIB 5T1KD 3D25B 4K0OA 5L4MA 3BPLB 1I1YA 5DJ0A 5TDNA 5TQ2H 3QDJD 3AU1A 4AIXA 1CPUA 3HC0B 3SYAA 3RY4A 2GJRA 3V55A 5CSZB 3FONB 2BRQA 5HGGS 3MRRB 2VLJA 4ZOAA 2O6FA 1VZIA 4R7LA 1IGIL 1UC6A 1GCYA 5E4EB 1G4RA 3GJEA 4Q14A 4MMZA 3WLBB 4I3GA 4HIJA 3UBXA 2DWDB 5IESL 3S3BB 3ZTJH 1VFBB 2DMHA 2NPLX 2XN1A 2X1WL 4UBDD 4DCQB 3FULA 1NFDB 1SZNA 1LEGA 5AZ2L 1UD6A 4NKIL 2L0DA 3AW5A 1FE8L 5ADPL 3QEQB 4NBXB 1I7TB 2IQAA 3KH4A 4R4ND 1R5VA 4HUUB 2EYSA 2UZIL 1CD1A 3QUMH 2Y22A 1GGIL 4D9RE 3OHXC 5BPPA 1OGTA 4FXGB 1F13A 1NJ9A 4JO1L 5TQ0H 1EVUA 3MV8B 1O6VA 3U9UA 2LU5A 3OZKA 3T8XB 3V5KA 1AIFA 5I6NA 1FQ9C 2Y6SC 4WHTA 3D9AL 4MCMA 4B9ZA 3OAWA 2GY5A 2QFPA 1AGDA 3O2VL 5GS0D 2CWRA 3CCHA 5HI5D 1A6AB 1YMHB 2WSPA 4KQ3H 1P4IH 1BG1A 2V2WA 4NSKA 3GTVA 5HYJE 2DQIL 3K8MA 1KIPA 1QBBA 4JFVA 4DGYH 4FQXD 2EE9A 5DFTA 5KSBA 3RRQA 4XMZA 1TQBC 2AQRA 3DHJA 4EN2A 5D8JL 4G42A 3NK3A 2O26U 3T0WA 5JIIA 1U8PB 4FKHA 5I1HL 5IW1A 1EXGA 2CALA 3QA3B 3TBYB 2VE6A 3T77A 1NGYA 2WXKA 4JFXB 5D71L 3QUYC 4JQXC 2X4SB 3O8XD 2D31A 3VXRD 1CK0L 2FCBA 1CXLA 3MJWA 4QTIH 3U6XS 4OZ4B 5EU3B 5D2LE 3WIFA 5DR5L 5DJYB 1NOLA 1YSOA 3RVTC 1BVNT 3GUTA 4Q7DA 4XMXA 3HS8A 2XZAH 3OD3A 4NZDA 4K2UH 4KUZL 3WL9A 4NNYA 2YN5A 2JK5B 5GSVA 1TITA 3SPGA 5IWLA 1A3LH 3US0A 5FO7B 4KUCD 3WJLC 2JKLA 3RDJA 1DQVA 5KBNC 2ZXEB 5CFHA 1A9EB 2OL3A 3X11A 3KLSA 4PMEA 2RBLA 1JNHA 4V1DE 4PJ9D 4ZMTA 2CHXA 15C8H 3F01A 4TUKL 3Q44A 1RULL 1IFGA 3LKNB 4Y19B 1VGKB 1K8DB 3ASWA 1WYJA 3S35L 3FQ1A 3C75A 1XVSA 3VFSA 1J9QA 3IFOA 2JTYA 2FBRA 3K2MC 2CO7A 3U7YH 5K9JH 5DLML 2VN5A 3EGXB 2D3JA 3TH3T 1D6EA 2OJEB 1VSCA 3EYFA 1IRAY 1D5MA 1H3TA 2F58L 1OARL 2IOOA 1J0JA 1W72H 4JJHA 4HPOH 1IEAB 2BSBA 3AAZB 1MPAH 2EH7H 4P46D 3QW9A 3CFUA 3MREA 2B15A 1E4XH 4IHOB 4K3JH 2BNQB 1MLCA 4XPHH 4NP4L 3EFOB 3CFEB 5BOZG 4JHWL 1MH5B 3KYKL 4JLRA 4CSTA 1KLUA 3MV9B 3GPSA 2CPUA 2CGYA 3B9KD 5AYQA 5C2BL 4LOVA 3JXAA 2AXGA 2DL9A 2ZXWB 4R0LA 5FYKD 1N8ZA 1RK0A 2B9AA 1ZLSL 3BJLA 4M56A 2FT6A 2VDNB 2VDOH 5H35B 4L18A 2F61A 4U3SB 5EUOB 3P54A 3ABZA 1IBDA 3WAJA 1FNEA 2PYEE 5JW3H 3H9SE 3LIZA 1JPST 3FHAA 1IAOB 3R06A 3EH2A 1XF5A 3OJVC 1HHIB 3ARPA 5J7CC 1KBKA 3PCYA 5K93A 1KC5L 4WWKD 5JHLH 5LKNA 4F7CB 3RTQA 3N50A 4M7LT 1I31A 3OSKA 1IEBB 5F6IB 1TKWB 4XMKH 1AKJA 4F8LA 1HHKB 1OQOA 1MI5A 4X0NA 1U8KB 1FDLL 4M03A 3MNZA 4U0RB 2P8MA 3OQ3B 4UCFA 5L8KB 4C4BA 1F3DH 2X6MA 5F3BA 3CU1A 4NN7C 1E2VA 2AQTA 4L05A 2NQDA 3UABA 4IIQA 5IQ9B 2CIIA 3EOTH 4C47A 2ZTBA 5EO0A 1RIHH 5FK9B 1K85A 3QFDB 1DN2A 2H45A 4BV1A 1IVTA 2UX7A 1FFPA 4KO9A 4ZD3H 2W0KA 5FOJA 2BVEA 3ZL4L 4OZFB 2P48B 1TCMA 1NGPH 5MEQA 4GI6A 1PU0A 3MZGB 1YRKA 4NQVA 3Q01A 1G0DA 2VLJD 3QJXA 4M7ZC 4NCC2 4AH2A 3NPSC 1MHPH 1QX1A 4N0UB 1FFNA 4HSCX 1R47A 1XXFC 4KJWD 2Q76A 3KYAA 2ICEA 4KI5F 1EO8L 4M62L 4XVSH 2BJMH 5HHVL 4HHAA 4PJCE 1DVFB 3M86A 5C0BE 3EUDA 3HMXA 3CVDA 5DJZA 5EBMA 3M8OH 4U7MA 1UB5B 3OX8A 5T3XL 2ICWB 3BD3A 2YHGA 4GS7B 1YUHB 1KIUB 1Y18A 2G3XA 3L95A 1KB5A 3QRBA 1LQSR 4P07A 5IK3B 3GGWA 3MCKA 3VDCA 2O30A 5EO9B 1GZQB 3SDDD 3A4AA 3MYJB 4LLWA 3EFFB 4I4WB 4N5UA 1RJYA 3WOVA 1W0YT 3CX2A 3DOSA 4J8QA 2Q86B 1WA1X 2CE6A 4FLRA 5IG7A 5EEXA 5AAPA 2AABH 2EABA 1PZ5A 4ZFZA 4LEXH 2MSPA 4FDWA 4XOAA 4L3FA 1AHWA 1S7SB 1MHHA 3OGOE 3T5WA 1FVCB 3BLPX 5DHDA 2DLFL 4M5TA 5IF0B 3S6CA 4EI5D 1L7IH 1BV8A 1Q1JH 1E27B 2J44A 2O5YL 4AEIL 4NO0A 4F3FB 1XXDC 2X53A 3EW3B 3ECVA 1MXGA 4YH6A 4X6CB 3Q2CA 2ZXCA 3GB7B 1F11B 5IJDC 2IFFH 1KCSL 9CGTA 3GKZA 4N90D 2RCSL 2ODHA 2Z31D 1PDKA 3MNMA 1X5ZA 3FO1B 4K71C 4JBSA 4K5NA 4UBDC 3G6DH 4A7GF 3S8FB 3D4GA 4XCYB 3JSSA 1KTKE 1PEZA 1G9MH 4PJIA 2W60A 4UB0L 3DRTB 4W9CC 5IT2H 1RFDH 3VXUB 3ZZSA 1S7QB 3V0IA 1XH2A 2VDQH 3LYRA 1Z1WA 2ZUQC 4Q56A 1EEZB 2IAMA 4MGXA 4R4NC 3SOTA 4GP5B 2F74A 3JV4A 1F2QA 4OGZA 3V0DA 3D33A 5D7IA 1KJMA 4OH2A 2DBLL 4U6VH 4JRXA 3OPZL 1YPZB 4KVCH 3KEHA 4PJXF 1DTUA 4RAUB 4ONOA 1ZGLB 1AY1H 4R8WH 4TULL 3L2NA 4H0LC 3IPEA 4L1BA 3C5XA 3LB6D 5E24E 2H26B 5GS0C 1DQMH 5HI5C 2QGEA 3R8BB 1DBJL 3WI9A 2X4QA 4EVNB 4POYA 4MXWL 5HDBB 3ZZ1A 1TQSA 5EUKA 4DN4H 2NCMA 1BBDL 1IM9A 1TZIA 3M07A 4FQXC 5FAAA 3V5DA 3VXSD 2X10A 3JWOC 3V8OA 1AP2B 1IM3B 3PDOB 1UM4L 5IQOA 2ADIA 1EJOH 5GGRY 2B3IA 3B9EA 5LQBH 2WY3B 5GS1C 4Q74A 3LRGA 4JGMA 3O8XC 4WDIA 5D7SH 4GT0A 4IDLA 4KROB 5H94B 4XNZB 5B3JF 2PXYA 1T1XA 4M9OA 1P7QA 3SY0B 3IJHA 4P2QA 2FATL 1BEYL 4N8PA 2VXUL 5FM8A 4JFPA 2BVQB 4B9GA 1DBAL 1MZYA 4U1LA 4M29A 1XZWA 3U2IA 3NIGE 3VFMB 5D5MB 3LKQA 2RACA 2W9EH 4NDMB 2FX7H 2W38A 4ES9A 4XC1H 5HYQB 3FQNA 1JL8A 2FX8H 2MPAL 3DIFA 2WVTA 3I9GL 3QDHA 5FKAB 4PJ9C 3KAAA 1PBYA 4D3CL 3PABB 5DJDB 2NXYB 3JZYA 1CGVA 5ANMB 5D1ZD 3EGSA 4OJEH 1YC7A 2P24A 2X4UB 4OLYL 4Z23A 5KYUB 2EXSA 4MD5A 5IVXB 4YWGL 1URLA 3ZLQC 3RTQD 4K07A 4IMLB 1LLAA 3H7LA 5DQDH 3WS3B 3IF1A 4R96A 2HUHA 4KHTL 1L9QA 2WAHA 5B39A 1XSIA 5K69A 5FWQA 5HJBA 3I2CH 3ZKQD 3ECQA 1MWAH 2OA9A 4P46C 1KZYA 3TNNA 5CBAA 1YY8A 3VB8A 2WTRB 4OLZH 3SQOH 1IBBA 5SWSA 5EU4A 5EOTA 3IFPA 1YJDC 4AITA 2WWMC 1WTLA 1OGAB 3B9KC 1I8IA 4KNUA 2BX5A 3SKOB 3CBKB 3ASOB 3EHBD 4EIBA 3TO4D 5K9QG 4EBQL 1GZHA 1KGCE 5I2IB 5JORB 5A2FA 1KLGA 1IC4H 1FO0A 4K8RL 1CZ8L 3QJOA 2Z7UA 1PZ2A 2F5BH 1HWWA 5G4NA 3QRFM 1KENH 4X4ME 4FNQA 5HHXL 2ZP8A 5KSAA 3DHUA 2FT7A 2CDFA 4N2NA 4RSVA 5DS1A 4XO5A 4WWKC 1SOXA 2JCCA 4F93B 5ECJE 1W0WB 3SY6A 3UTZB 4MZ3A 3L7FA 3ARGC 1U21A 4MFHA 3LNGA 2I60H 1DUZB 2LTQB 2OMVB 4NUJB 2DKUA 1RZIB 4JMXA 2UZXA 4B5ZA 2OL3L 5DJ2B 2X7LB 3DV4B 2WANA 2OV0A 4OZHE 1VKXB 5J1SC 5LBVA 1DE4B 3GDBA 2BINA 4H7VA 3UBFA 5E6UB 1ET5A 3TASA 1OQXA 4Z7VA 4MMXB 2O5ZL 3MNVB 4XBPB 4LT7A 2HX8A 5I6XC 1U92B 2LU3A 4AKPA 4AW7A 1IKNA 1OF0A 1QNZH 1QSFE 3D4ZA 3FO9B 5CF3A 1RPUA 4LDEB 1ZK5A 3LEVH 1KCVL 3MSPA 5B7MA 3KPSB 3HG1B 1P2CB 2X0VA 3LRLA 4RFOL 4TNWF 4W9KC 1BAWA 3QDGA 2KQMA 3ARFA 4KJWC 2ZNXA 4JDZA 1ERNA 1Q94B 4M43L 4IU3A 1ID2A 4S1QH 4IKJA 3N6YA 4Z7OE 1B0RB 1PAMA 2UY7A 3JWNC 3F6LA 4U6TA 3CN0A 3T4YB 5KYYA 3EBIA 3KD4A 1MRCL 2IH3B 1KIRA 4P3DA 4Z8FL 1SJXA 4PTTA 3KPNA 5HHQB 4YSCA 4JO5A 1BHGA 5C3TA 4WK0B 5DYFA 1AQDB 3GBMH 4AE0A 4LASL 4NJAL 5DK2B 5K1VA 1MREL 3KXFA 1CIDA 3SGDH 2G0KA 5DUBA 4D0CB 2XWJB 3SDDC 3CVHH 3VQLA 4CSPA 1NWOA 1AZBA 3UP6A 3KPMB 3X14A 1D9KB 3GEWB 5CJBA 1S7TB 4Y2OB 3T8VA 4X4YA 3GXMA 5AW2B 3UTPD 4X5XA 5CN3A 3VSVA 3QJRB 3KLDA 2CLVB 3LIZL 2LAGB 3D0VA 2NX5D 4MQSB 4F8PA 3SDXF 4EIGB 3HRPA 1IGTB 2G2RA 4JO2H 3PHAA 1LGVA 3PP3K 4G83A 5KYXA 1BZ9B 3NFSL 2HAZA 1VACA 5I6PA 1IM9D 4L29B 3MMEB 1GTNA 1KB9K 3QHZH 4EI5C 3VCLB 2J5WA 4DEUA 1GTFA 4LLYB 3HBQA 5IFHL 3SKMB 1MRDL 3FB6B 3MRGB 1LO2L 4NKMB 2BIHA 5EC2A 4GG6A 4Y4KD 5L4IA 3LKSB 2Z31C 2G9KA 5B7EA 1YEHH 3CGTA 3FJTA 4XGZB 1IFHH 5AW1B 3PP4L 4XPTH 1TQCB 3OB0H 1P4UA 3V95A 2KLRA 3ZTNH 4FQ1H 5CJQL 1U58B 2J88L 3ME0A 4WFHD 4OKDA 2SEBB 3B34A 3VG0H 3OSVA 3TLRA 3B9VA 5FECB 2XVGA 5KANI 3V6BR 2YAQA 4BUQA 3DLQR 1UEMA 1ONQB 2X4TA 4K7PL 4RGNC 2JB5H 4AVJA 2X12A 2GJZA 2MNJB 5C09B 4NCDA 2A99A 2DF3A 3HOGA 5I1DB 3LB6C 4L8SA 4K5OA 2WQWA 3K46A 2WXQA 3HMXL 1KOAA 2EDRA 2DN7A 1E6JL 4KKBC 5AZEH 3GBNH 1U8MA 2BWQA 4Y5VB 4ZQKB 4KMQA 3D7PA 4AXWA 4FZ8H 5LHDA 1PAZA 4K9JA 3BD5A 4AV0A 4LBEB 1KB5L 1QEWA 5E6ID 4APQD 3FTGA 3GMPA 2JIXB 2EUXA 1EERB 4R3SB 4FG6C 3TIEA 2APFA 2V3FA 3TBWA 1ZHKA 4F7KA 3PHQA 5BS0D 5DD6B 2FX9L 3HAEB 1JGIA 4W9GC 3MROB 4BXSV 4C56E 3CJJA 3BHBA 2JCWA 5D2NC 1UWGH 3M45A 1JWUA 2BM3A 2IPUK 3TT3H 2HJKA 2W92A 1LD9B 2NNAB 3UTSD 4OCSL 1A3RH 1MIEH 2EXTA 2UWEE 4GMSL 3STLA 5JMRA 5SWSD 3CTTA 1HH6B 3VD5A 4MNGA 5I0WA 1NSNH 2C4FT 1KJ2A 1I82A 1YG9A 3NESA 4X7SL 4HD9A 1FC2D 4NZRL 5JNYA 5KS9E 4CU6A 2LFGA 2QZ5A 1AIZA 1F2XK 1ILUA 4G6ML 2J12B 4G6JH 4URTB 4JL1A 3DVGB 3VVVA 4UINH 1H15A 3DYOA 2WXPA 3ZL1A 1YVLA 4JFHE 1IGYB 1OAXH 5A1AA 5IHUL 5EEUA 3L3HB 5D1ZC 4R97C 5D70H 4ZW3A 1YNLL 2Z93B 4LKXA 3N40F 4XP1L 1H8OA 4GUCA 1JF5A 3KR3H 3WY4A 5DEZA 4GAAA 3IU3B 1FFOB 3RTQC 4PRHB 1IBZA 3V5HA 1JPEA 4X8JB 3SJVB 4O02B 3GINA 3D39E 2X09A 4PJDA 4EDWL 4XMVA 4QXUL 4ADIA 3OB8A 1UKTA 2BVUA 2Q0ZX 4UOW1 5IEHB 3M17A 2LT9A 3O6KH 3QZLA 1D5BB 3VM7A 5ADOL 2HFGL 3CVIH 2GSGA 1UJ3B 3UROR 1N6QH 4HAKA 3QUGA 3MLWH 3S36L 1ZJBA 4CVXA 2KQNA 4PSRA 2PNDA 4J3OG 4E0RA 2Z1PA 3GZPA 3U30B 3GJFB 4JCMA 5FF6A 1IX2A 3UC0A 2VRAA 3NRPA 3V4LA 3UMTA 3F7VA 2CDGA 3EHBC 4E42A 3TO4C 4AI7A 1N64L 3RVXD 4PRPA 4KRMB 2AK1L 1DCLA 3OR6B 1K8IB 4K9EH 4WU5B 4Z3EA 3MGOB 5C0RH 3RWFB 4QIRA 4HSQA 2Y5TB 2HKHL 2Z8WC 3O3AA 3QDGD 4JFZL 2BY0A 3O41B 4P4KB 3ARFD 4FLOA 1ZGLM 3KWUA 2R7EA 2ICEC 2AGJL 2VWEC 5A2JH 5HVFB 4JFUA 1TZOA 4WWOA 4ONGH 5IB3A 4PRBA 2MRYA 5LUMA 5AFAA 1NGWB 3QQ3B 5CWSB 3VA2C 3RWGA 4YZWA 3A23A 3O3DA 4HJJL 2MOQA 3NA9L 2R2BB 3ORJA 1ZT1B 5DZNA 4XZUB 4XPGL 3QHFL 3P4LA 4AUJA 4AYGA 1SN5A 5HJ3B 3NFNA 1M4KA 4NWUH 4TSAH 4LESA 4X4ZA 4YBLB 4AE1A 4BRVA 5F1NA 1J5OL 4D8PB 1KFGA 3EBHA 3HPJA 2XHNA 3CDZA 3VO0A 1CB4A 1MEXH 1EEYA 2JKIS 4QTHA 1IL1A 4BWUA 2OSWA 4JRYA 3GO1H 3QNYB 1JPSH 2JXMB 2R1YB 4GRWE 3BZ4A 1OAKL 2FEEI 1EDYA 1P69B 5TDPB 4ZX6A 5CUSH 3DX1A 3TONA 4G3YH 2YFNA 4A6YB 4TRPH 2HG5A 2V0AA 5DURD 2FECI 3FCBA 3AITA 2GFBA 1F4XH 1Q9WA 2FB4L 3IXTB 4NIYE 1OTSD 5HDQH 5C0CA 3MRBA 3H7BA 3PWUB 1KG0B 5IUCA 4QMEA 1J87A 4HKZA 1AZNA 4KFZC 1RLWA 3EIFA 3FFDA 5D4IA 1HSBA 4TLKA 2MFNA 3L8QA 3TU6A 3LS4H 4GRWH 4XPBL 4NPKA 3I6SA 4K15A 4IBZA 3T6ZA 3BUPA 3BPCA 4HHGA 5JDJA 2OMXB 4HAFA 1VENA 4ZTOL 1N5YH 4JY6A 4HMCA 4TPRH 3MV7E 5AVTB 3M46A 4G1EA 4P3CH 4S1DD 5DGQA 1AXSA 2YA1A 2JE8A 5DRNB 4DPCX 3NSFA 3CXHK 4EJ1C 4J3XA 4DT2A 1PG7L 5BV7L 4HLZH 4CC0A 5DRZB 4U1NB 4HALA 1U8IB 2HWZL 4AT6A 5L6YL 3ZQXA 3IJ7A 3QZNA 1IJ9A 4ELKA 2J6WA 4QRUA 1FO0L 1SGKA 1WHOA 4JN1L 1HL8A 4TQEH 4E41A 2C4FU 4TV3A 2VXSH 3AVEA 3MLRH 3CZLA 3UJJL 1RMFH 3OHMB 3Q1EA 2XJKA 1QP1A 2FRGP 2Z65C 5JPMA 1CFTB 2OSXA 2Q6WA 3DX7A 4M6AA 4RA0C 1ES0B 3HAEG 5KW9L 1FG2B 2Q7NA 4L9LB 1L0YA 4YLBA 2XQ0A 4LSVL 4OCYL 2JI1A 4NN5C 3FUHA 1O7DC 1U8CB 2A6IB 4PJFE 3D0LB 3TEUA 3F05A 3LQZA 2VDLH 4Y4KC 1NBYA 2ATPA 4MRBA 1H8LA 1H6EA 3OAZH 4I3RH 4ZRGA 4PJ7A 1HQRA 1NH6A 3EO1A 3CZFB 2A3TA 4I13B 3UTTE 1DSFL 3PQYB 1KEGL 2HVBA 4QOKE 4HUMB 2P42B 5FHBH 4M8RA 1JV5B 2GK0A 1C5BH 2OMUB 3K4AA 3F04A 3ULSA 4LARH 1CFMA 2V5YA 3EZJB 1FL6A 1G6RB 5C07A 2DJUA 4LRIA 1TSHA 1QPKA 4GQZA 2WXHA 2CUAA 4KAQH 5FB8B 4GP8B 5IHLB 3G5ZB 2BP0A 2VLKE 1HINH 3ATBA 4M6NL 5F7MC 4BQ6A 5I18H 2X2IA 2RHEA 1UXSA 1TTCA 4YJZL 3D5OF 2AI0H 2VQ1B 3H42H 3BRFA 4IRSC 4RMSA 5ICZA 5SWZE 2YQ3A 4UQBA 1AQKH 1CGWA 3TA3A 3RZCD 3RWDA 4X6FA 3SZ6A 4DH2A 4N3UA 5E6IC 4APQC 3T0DA 1BGXL 4Z3JA 4OIAA 1F02I 1FH5L 1N3NB 3QUZA 3IDXH 3O0RH 1VADB 1I9JL 3ETTA 1ANUA 3MUJA 3DPDA 5HVWA 2Y2YA 2Y9RT 2N0MA 3WN6A 1IC5H 5CEYB 4Z7UA 1M56B 4KNTA 3P4NB 4MRCA 5FYJE 1WZMA 2LHAA 2B39A 1UADC 2ADFL 4UM8A 2UVFA 3VD1A 3I6GB 1AGBA 2ZNWA 4WUUE 3A0OA 3C5ZA 3EAKA 4DP4X 4AJWA 1JPTL 4OT1L 1MFEH 2KLTA 1BM3H 2UZYB 2JKRM 4HXAL 2N7BA 3NEOA 5JHDE 4DZBB 1DBMH 5E2VH 3CSYB 4Y4FD 1ZA3B 3FU5A 2TRYA 3W57A 1T03L 4OCXL 4FMFA 2B2XL 3OMNB 4LNVA 3KW7A 2R0WH 4HZ1A 3OKMA 3RGBA 5KVGL 3LX9A 3ZT5A 1OSPH 2F19H 1LDPH 2QGDA 4JRWA 2F54A 2VXQA 5I66A 3UJIH 3UTQB 3JWDC 5CZVH 4MNQA 1WBZB 2EDNA 3GMLB 3PWJA 1JPGA 2NNRA 3MBEA 2DWTA 5D7LD 1LK2A 5DI8B 2OP4L 4JDTL 4U1SA 1D5XB 4ZTEA 1BZ7B 1MRFL 3D50A 3MJ7B 4LMQI 3MRPA 4AKQA 3KWWB 2E6QA 1XGRA 4J8RB 4GAGH 2KERA 3IJSB 2AXJA 1FRGL 3EYOB 2Q9OA 1X9RA 4LLDB 5E1HB 5E1QA 4NN6C 4FABL 2Z7WA 2G60L 3V4VB 4G9FB 5EU7E 1HL9A 1QR4A 3DVNA 4Y1SA 3D25A 4Y2DD 5IQNA 3LJ3A 2YMOA 5KBDA 1ZY9A 4XMTA 4H8UA 3L3KB 3TPUA 5ESQB 1K3ZA 3GMQB 4P0DA 4LMQE 3JUYA 4KZ0A 3UO8B 4NHCL 2NCEA 2VLME 3NABL 3FQXB 2OMTB 2XWTA 4PJGF 2WKOF 5BO1H 2J3SA 4MDRA 4HBCH 5F1IB 1JZHA 4HK3N 3RVXC 3RNKB 1CBVL 3WLBA 3GZQA 4LAQL 2EH8L 2X2JA 1E3XA 1XGYH 5C70A 1KDJA 4HV8B 1QFHA 5E9DE 3ARFC 1G9HA 1PZBA 2WYHA 4OCMC 4RFNB 4QRRD 3RUGE 1NFDA 4DEPB 1SFDA 4A66A 3PWPD 1E67A 2VOTA 3QEQA 1KCUL 4NQXA 4PP2B 1EUUA 4FI6A 4C83A 1ZSDB 2DH2A 1T89A 2ZSWB 1KJ2L 1YNKL 4G8AC 5I8KH 4YHPA 5ELIA 4WFGD 4HUNB 5HD8D 2EDMA 1E9OA 2NT1A 4HUVB 3MV8A 4GAYB 3NJLA 2DH3A 3BQUA 2BOBA 4ZAKA 3SE8L 2YAEA 4N22A 3NYKA 5J56B 4LHUB 4FC3E 2FWUA 2YWYA 2CCLA 1A6AA 5EFIA 3H9HB 2X4RA 4ALAL 3MUGB 4NDMA 2K45A 4MASA 3D2UD 4XAKE 3RILA 4E41D 2N1KA 1OT1A 3HC4H 1XGQB 3VH8B 4YDIH 1J8KA 2AERT 3BWSA 4XMLH 1F00I 3VNYA 4X6DA 5DUJA 1WC7B 2OJZH 3KYMB 1INEL 4X80L 2BNRE 1J1XL 1HIMH 1S9XA 1XL6A 3RTLA 3IJEB 1ZSHA 1AD0A 5BZZA 1ZV2A 1OTSC 3S0PA 4BGDA 5FUCC 2YGOA 2NY3B 1OPGH 3FBKA 3NFPB 4YX2H 2YOCA 1CFSA 1DLHA 4L3EA 4DGVH 3QA3A 2VDKL 4MB1A 3SDXB 2R4SH 1DQIA 2X4SA 3GD1C 4QRTB 1LO0L 4PS4H 3LQMA 3RY6A 2VAAB 4NX0A 1RU9L 3ZHDA 4JZJB 5EU3A 4S1DC 5FS5A 2FYYB 4YDNA 2UVEA 3DPBB 5DJYA 2Y1AA 2CDEA 5H4ZA 2X2HA 4M6OL 3UC0L 2R1WA 4WUKL 4PGEA 1SLWA 4OLUL 4WFEE 3OPUA 1P6AB 2EEDA 1GGBL 1OP5K 5C07D 2QQQA 3K72B 4UV4H 2Z64C 2F8IA 2Z91A 3QEGL 2QR0B 1XSKA 1CGYA 3X1GA 1IGMH 5GRJH 4KH9A 4BH7B 3LKNA 4R7NB 2CMRL 4I48B 4Y19A 5BW7C 4WI0A 3ULUL 4G43B 3HMWH 4ACPA 5E2UH 1K8DA 2H1PL 1DUYB 3FQWA 3GSNB 3FZUD 1ESOA 1GYWA 5LB1A 5IQ7L 1B4RA 4RCAA 2FO4B 3EJPA 3ZXAC 4P2OB 3EGXA 1JGDA 4KI1A 2IOMA 2Q8AH 1E8ZA 4JFFE 3O4LE 3X13B 5I0VA 5IGXL 3VQ1C 1CDBA 4LCCC 3WNNA 5JXAH 4JKKA 3QUZD 1IEAA 3AAZA 1MFUA 1ZLVH 1J8HB 4UT9A 2VLRE 2Z1KA 2I9LB 3FU7A 1YEEL 2VDML 3CX5J 5IB2A 4OLWH 4OZIE 2EDBA 2LGNA 4R84A 4OTXH 1W16A 2YMXH 4P8QA 5F88B 1XGUB 2QSVA 3WXVH 3S3JA 1I1AA 4L4JA 3CXHJ 1AAJA 4L2YA 3BE1H 3OXRB 3FU6A 4DWHA 4KOBA 1JJUA 1KYFA 1I7ZB 3ZHFA 1KY6A 3WKML 5BRZB 3C60B 4DAGH 1A6TB 5EUOA 2EDJA 4HWBH 3QWQB 3HC3L 4MJID 1HSAB 1NA8A 4OZGE 3HE6A 3TP4A 3CFQA 5IMMA 2H6UA 1IAII 2WNXA 2VITB 4GP4B 4TLTA 2Z7ZA 3AT0A 1YEIL 4F7CA 4F91B 5F97E 4DERA 4MNQD 3RZCC 4FS0A 3Q6GL 3T0XA 3GNML 3SBWC 5D1XD 2ZX9A 1RJLB 4YE4L 1TKWA 5EU5A 4LCWE 3U46B 1HHKA 4EZJA 5T8IA 5IHHA 1BEXA 2E59A 4OBRA 4Y1AA 3QDMB 1ACCA 1Q9KB 4OIIH 5MHSD 4H8QA 4N68A 1DQDH 1KULA 1XH3A 2E74C 2VISB 2XPGB 5IMLB 1WFOA 3BAWA 4ZYKA 2ZKXA 5DZPA 5EIIB 3PFQA 1PYWB 3X17A 4LCIH 5AYUH 2FWOA 2GT9B 2MKWA 3ILQD 4CC1A 5INCA 2HRPL 5FK9A 3QUMA 2BVOA 3BKCL 1T7WA 1I7RB 5BNXD 3VWKB 2ZOWA 4MXQD 4R90H 1YAIA 3BAJA 3T0EE 4P4RB 4HBQA 4ICXA 4OZFA 2IXQA 3ARDD 4OD1H 1RVFH 1DBKL 2FLRT 4ZO9A 4Q6IB 2J8UF 2YSTA 1M1SA 2Y36L 3D85A 2DL2A 4J7RA 2Q8BH 2VL5B 4Y4FC 4O5LH 1JZ4A 3P4MA 4AQEA 1IAIH 1LEKA 4TSCH 2ZCKH 4N0UA 3QPXH 3AXLB 4WW2F 2VXVH 1FNFA 5FGBC 2QSCH 1YNTA 3K1KC 1DVFA 4OF7A 3EDEA 3KEDA 5IW6B 2CA3A 2ESVE 3ZKMD 4P48A 5I1EL 1TETH 1ZVNA 4JAMA 2DICA 2ZWZA 4P57B 4YHZH 4R7DA 1AGFB 1UB5A 1L0QA 3AZUA 2DWYA 3VMNA 1QPXA 1BBJA 4QGTA 3WFZA 4ESKA 1JHTB 4LZKA 2CM5A 5J1AB 3PHSA 5EO1B 5IK3A 5JPNA 4Q0XL 5CS7A 4LHUG 3NJVA 1KBGL 4K3GA 1U8LA 3HE7D 1FL3B 3MYJA 2HJFB 1GGCL 4YNYA 4GEIA 1FVEA 4F1ZA 3HJEA 3K74B 2GHWB 4BHUI 5HYJA 4ZAKD 3VH8G 3W37A 3HG5A 2FO1A 1FC1A 2DQGH 2Q86A 4ZW7A 4ZG1A 5DUPH 2V33A 4HG4K 2DB8A 1PKQB 4GY4A 4Y2DC 2GB2A 4EN3A 2E46A 1Z9NA 5H37G 1MJJA 3D09A 1S7SA 4TQ8A 3NZHL 3O9WB 2WC7A 5DVNA 3R4DA 2BZ7A 2BS9A 4AQ1B 2ICWI 5I1CH 3FQRB 2H9GA 3NIDF 3T2PA 1ECZA 4HQQH 4F3FA 5ILTH 1A7NL 3GB7A 1C08B 2YPKA 3UPAA 1ZA6A 4P5TA 2WQXA 2Q10A 4DKFL 4LFHG 1FFTB 1S7UA 3MUZ1 3DBXB 5CMAA 3RKDD 4L2LA 1S7QA 4IKKA 3BD4A 1EEZA 5TFSL 2G5UA 3V0JA 1HCYA 3FOLB 4F24A 1U42A 2Y7LA 4KMTL 5LGHH 4JL2A 2HLAA 4V1DA 1W72A 4MJJA 5HD8C 1PLGH 4GKNB 1NL0H 3RL2A 1FNGB 3R0NA 1K6QL 1T2XA 3QIWB 4H8PA 3UACA 2ALAA 3DK0A 1OTTD 3OAYH 5DJXB 2OXGA 5D1QD 5IEKA 2A73B 3VRLE 4D9QD 4EVNA 4FQHB 1U6AH 4FQLH 1KY7A 1QUNB 2VXQL 2MEJB 1WFTA 4AJVA 4PJ8D 4LCYB 5ESAB 1INQB 2G75B 3K2UH 4M1DL 1C5CH 3MFFA 4UAOC 3HN3A 3TCXA 3WGVB 5KJRL 2IF7A 4YFLF 4TUJA 5FIEA 3IKCA 2DKMA 1OAUH 1Z3GH 3KPPA 4YDMA 1A7PH 1W8NA 1NBVL 3H4FA 4LU5H 1NBCA 4OVVA 3ZKXC 2RD0A 5K1NA 2XTJE 4PWEA 4X6CE 3SDAD 3QFJE 1WLGA 3L4YA 3RIAK 3SGKA 4JPKL 1GOHA 1E4KA 4LXFA 1L4IA 3N3EA 5JHLA 1A6WH 3GPEA 5LWYH 5KVDE 3KPRB 2D9QB 2P5WE 5I1KL 3CN3A 1P84K 2JELL 2YK1H 4AM0B 3VXUE 4LEEA 3OKEA 4OW6A 2BVQA 4RZKA 3EYSL 4AUYA 1CFQB 1LP9F 4JM2A 2D0HA 2PYEA 2VO8A 1I1AD 1ZRUA 1NMCC 3IXAB 2DTSA 5D5MA 3S34H 4POZD 1ZE3C 5E8PA 1GW6A 1MJ7H 4FGMA 4G11A 2E7LC 4BCYA 5HYQA 5CP7A 3V7AE 4B9YA 3F83A 5KVDH 5I9QC 3PABA 4ZPVB 1D5IL 5I30H 4NZFA 1EQWA 5IVZB 4OSUL 1H3WM 1JG9A 5IHWA 2EE0A 3W3BA 4IRJD 1T0MB 1AO7B 4WJ5B 5KYUA 3GXPA 12E8L 2EDYA 2D03L 3FZUC 1N12A 1XF4B 3HI5H 3OAUL 4PUBH 4IMLA 3WS3A 3GSUB 3I9AA 3NCJL 5HVHC 4ONHB 5EIIG 3P4OB 3QQDA 1Q0YH 2X6BA 1PLBA 4HJ0C 3WDIA 4Q8BA 4UQ9A 2MNWA 5AVUB 3X3GH 2VM3A 4LLVB 3ZKSD 5EIVA 2GC4C 4HCGA 5LG1A 3BISA 1NPNA 1I3RA 1ORSB 2ZUXA 2BH0A 3FSOA 3HKZA 3WNMA 5IR1B 5IB5B 3IFLL 1F3DJ 3GRBA 2AHIA 2XNAA 1CXFA 1SUHA 4YGVA 1OGAA 2R2EA 1GIGL 2B1OA 1KGYE 2YBRB 1U2CA 3SKOA 5FYLD 5HYSA 3WY2A 1JDDA 5C0BA 2VR6A 4PJCA 2AZUA 3OXSA 4OM0L 4G9DB 4ANVA 2YRZA 3QI9D 4K3EH 3VYPA 5FKPB 3NPZB 1HKLL 2DQFB 2DWSA 2PPEA 3ARXA 3RWIB 3WFCL 5CJXA 5BZWA 1HHHA 5DC9B 1MFBL 3QZOA 2MCPL 4X2UA 1RK1B 1E40A 3K81A 5ANME 4D9RD 2B4CL 3NTCL 2J2ZA 4K7FB 4ABUA 3NJNA 3DIDA 3RWJB 5JHBA 3A6BH 3BGMA 2XXGA 4JGNA 4WO4B 1A1NB 5I74B 1W0WA 5D1XC 3SPCA 1CGTA 3UTZA 2VMFA 1XV8A 3BCFA 1WAAF 5E56A 5JR1H 2C7FA 3OB0K 2Y06H 2B1HL 1XR8A 3IDJB 1DQKA 3MCLL 2QMKA 2W80C 2OTUB 1RUKH 1I1FB 3C8HA 5DJ2A 4XPAL 2V5TA 5HYJD 3IAQA 1DE4A 5DJ6B 2RR3A 3ILQC 1PJWA 3SDCD 1KN2L 1X3DA 1LE9B 3QG6B 1XGTB 3BDBA 1F1GA 4MMXA 1J0ZA 1DJYA 4XBPA 2Z0UA 1DL7L 43CAA 2DIEA 4KRPD 2A9DA 4MXQC 4FTVE 4EN3D 1RLBA 3BIBX 2GJ6B 2R0LH 3GSXB 4Y16D 4HIXH 3ARDC 3D6GA 2L7QA 1T5WA 3HG1A 4A2MA 1P2CA 4X98A 5IROD 1M53A 4FXTA 3ZE2E 1FHGA 3T08A 1H8SA 4FADA 3WUZA 4ZPTA 5FA3B 1Q94A 2WB7A 2WLKA 3MRKB 2KDGA 2D4FA 4FQCH 4UT9L 3VFNA 1TQUA 4QKTA 4A38A 1KYAA 4AL8H 3ZKMC 2ED9A 2ORBL 4WHYH 4PJEF 4F1SA 1E9PB 4NM8L 4CKVX 1BD2A 3MGTA 4LRNL 4PJGB 4B5EA 1PFOA 3B2VL 2JKSA 3U2HA 1CVSC 1SHXA 5DK2A 4ZMNA 1OSZB 1F4YH 3FQUB 3NSYA 5A2IH 4LF3A 2R29H 5I17B 2Q3XA 2XWJA 1XHHA 3D3VB 1ZIAA 3HE7C 4V1DD 2J25A 4QHNB 4ZI8A 1BMWA 1JHKH 1UCTA 1F3JB 3KPMA 2CRYA 5LN4A 1S7TA 3E6FB 1GYVA 3LNDA 4ZAKC 3EYUH 1UA7A 1VB9A 4BSWB 3RFZB 1OAYH 1K72A 2ZUSA 3TJHD 2CLVA 4F2EA 3DX9B 1N67A 1EZLA 5ICUA 4FYTA 1BAFH 3ROLB 2VSDA 3J8F7 4BKTC 4XC3H 1I1CA 4K3DH 3TPKA 1NKGA 1T0NA 4G8GE 4Y9FA 4LSSH 4RDQF 3G04B 3DSNB 5AVRB 2H47C 5FYKU 2FNBA 3MMEA 5KN5A 4RVBA 1L7TH 1R3JB 3WNKA 2FJUB 5EPMA 4HZAA 3TURA 2MCMA 3ZE0E 4QRPE 4X50A 4LP5A 2GY7B 2WIIA 3SKMA 2FUTA 2FO8A 3FB6A 3MRGA 4U6YB 4Y9BA 4NKMA 4CW1A 5L0QB 4LL4A 1VZHA 3EDFA 1JVKA 3LKSA 4PRAB 2WV3A 3OF6A 5ESVB 2HTKD 3F7PC 4XGZA 6TAAA 4KUCF 3RKDC 2JWYA 1T80A 2CO6B 4DP1X 5C86A 4CVWA 3QUML 3I3EA 4YHKH 3UGEA 1U58A 1UXWB 3GSRA 1N59B 1L9PA 4OB5H 5JW5B 4PR5A 5TQ0L 2G2NA 2H0JA 5LAPA 3MACL 2GK2A 5E4AA 3QORA 3F7YA 1DVQA 3E7JA 3S48A 3P2BA 2NY6B 1XF1A 2PYED 3H9SD 1MWAA 1ONQA 4QHLB 2FQGA 3HZKA 1OTTC 4HJTA 4XXDB 4F9LC 2BSED 3BZDA 4KQ3L 1KJVB 2WMPB 4HCIA 2ZUWA 4GXVL 4JANB 3QUKA 5DK0B 3DTXB 1CLYH 5D1QC 1YC8A 4XNYH 2HZHA 4CKQA 4OF8A 1X5GA 4ZQKA 4PIBA 2QL1A 4Y5VA 1RD6A 1ASPA 4DGYL 4B95C 2DQUH 4PJ8C 3EXJA 2BS8A 4LKCA 3O6FB 2B9BA 2X88A 2ZCZA 4LBEA 1I1RA 5PAZA 5ID0B 3PLYA 3K7UA 2CK0H 3PL6B 1WEJL 1N6UA 2QT6A 3E0GA 4OKVA 3W0WE 3K71B 4MD4A 3ZTEA 1YZZA 3VWJD 2CKNA 3SDAC 4EDXB 1T1ZB 1M71B 3CFMA 3PV7A 3MROA 4XO9A 3NJKA 4RBPH 1RUPL 2OK0H 1R3HB 5I8OH 5K9OA 4QTIL 2J21A 1LD9A 2NNAA 1SF3A 3ARBB 1W80A 4IJ3C 5E99L 5INDA 5JIMA 1RUMH 1OAZH 1MIMH 1MCPH 3ARTA 3REVA 4S1RH 1R5IB 5H2BB 2ZE0A 2CCVA 3A24A 1C5DA 5ICYB 3VI3E 4X4MA