4OJDH

Crystal structure of a c-terminally truncated trimeric ectodomain of the c. elegans fusion protein eff-1 g260a/d321e/d322e mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
477
structure length
444
Chain Sequence
RAEPPHCSKTPIVRAQTSQNAMGMQMQFSIGLHTAVCFRLYSLLHTIRLEKLEHHHPITQRYTFGIPEVHASCICECDATSSTCTAESHQFTACPEDETSSCYRTFFPNQTPIGCSEDDIPKLCCDVRFKPYKNMTFLAVKLEQPTTYATFVYAAYDFVNGYWVEKDKTKIRSQLDGGTQDRHLDQKRRISLAVTAGARASHQLETGMYFSRTSNGGETEELRMQPLNEITDNNFDRLGWYRMDDSGHFHVNNGVVKMEEIHKAKVKNCKEQTYKSILSANHYMPGHFNLTRPLEVIKPWIQSARIFDSSLRQAVVTHAEGTNLQISIHLESQNLVFFHNASRIRDFSGSIIVDSKSNRLFNLTVYEASGKIDGSVKMSTGFGSDTIHTFTAYVSDLHASNRSMIIPLPAIVGQGARAICLRADSMADIDKICHVIEYFESPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EFF-1A
publication title Structural basis of eukaryotic cell-cell fusion
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Membrane protein
total genus 98
structure length 444
sequence length 477
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ojdH03
2.60.98.60 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein; domain 1 4ojdH01
4OJDH 4OJCA 4OJEH
chains in the Genus database with same CATH superfamily
4GQPH 3MV8A 2P48B 2BCKA 3UZEC 2L8AA 1RIHL 5SWZD 1FG2B 1JRHH 5IWLC 4BSWA 3OWEA 2FX8H 4R7NB 4O2FB 4NRXA 1SF5A 5IIEB 3H9YA 3AG3B 1BVNT 1O9WA 3IYLW 3FDWA 2AS5M 3U46B 4KKLD 3P73A 3LB6D 5CLWA 3MRQB 1RZGB 3DVNB 3QQ3A 4OKVA 3BVVA 3W5NA 2Z9TA 5FCUL 4KUZL 1NGYA 1MFCL 1N18A 1TFPA 3CDYA 2F19L 3MUZ1 3BUQA 4GY4A 3MRFA 4NQEE 3X14A 4DKDC 1WA1X 3RL1B 3KCPA 3MNDA 3MV9A 4NT6A 3G5ZB 3RTLA 2YMOA 4LFHG 3NBNA 3ZIMA 3QPKA 4NNPH 5I8OH 4E5XA 1UA7A 4ABUA 3LKRB 2DIEA 1URLA 1JGEB 1OGTB 1FORL 2GUYA 2ITFA 3HG0A 4K3GA 2HUHA 1RD6A 4PRHE 2IPUK 3RHWK 1NAML 1EV2E 5HGBB 2PP8A 3QC5X 4M6NL 3LKSB 1OTSC 5GISL 4H25B 4I1RA 5JDJA 1PJWA 4N0YH 5C8JB 4AYBA 5LO7A 3CHOA 2DQTH 2OK0L 4XN2A 3CCHA 3UO1H 3ESPA 1WZKA 4RAVB 1NGWB 3REVA 1UM4H 2CAKA 2J1KA 2VABB 3L9YA 4NWUH 3AREC 3JUYA 4LBEA 2JLPA 2I07B 2VL4A 3LXBA 1CR9H 1ONQB 3BPCB 4TOYH 4HUXB 1MZYA 2WWOA 3ZKND 1KN4L 3OXSA 2XG5B 3G6AA 5HGDB 2BP5M 3LKNA 4P2RD 4X6BA 1TPXC 4CUCA 5I9QC 1CYWA 1ZVSB 1B0RA 3DBSA 3IKCB 4IRJD 3TWCH 5C92A 1INDL 3OG6B 4U7KA 5GS0L 1IVLA 5J6HB 4M93C 1I8KB 4UOQA 4AYFA 3RL2A 2P8LA 1SN5A 1HINL 3V6FA 3L2NA 3P77A 1TLKA 5DFWH 5I1CH 4NP9A 1WTGT 4N9GA 3BUBA 5F2FA 4DW2L 3T5WA 12E8L 1PSKL 3JTTB 4JFOB 1FNLA 3EJPA 4L0YA 3RZCD 1KGUA 2YUZA 1LXMA 4RA3A 1X5IA 3QORD 2WBXA 2R69A 3OX8A 1BG1A 5CGMA 1ZHLB 5C6TL 4PMEA 1XSJA 4DSYA 5CM1A 2WCGA 1K85A 2VN4A 3QZWG 1PDKA 4JDZB 3IMSA 4GUPA 1QASA 3U9UA 1HX0A 3UXFA 2WVVB 1NCOA 1ORQB 4MZ3A 1KXVC 4IIQA 4PJ7A 5C0NC 4UTAH 1MVUB 3B56A 3HVDA 2A6KA 1P6AB 4XBPB 3O41B 4P4RB 1S78D 4QY8B 4A37A 1FVDA 3K6IA 4HH9B 3T0WA 2VL5A 1LYQA 1NH6A 4Y1AE 2HMIC 3O4LB 2ITCB 3ULUF 2YUWA 3EDFA 3MREA 2DQFA 3FSOA 1MZZA 1U8HA 4MCZA 5F1SA 3O4OC 3LH2L 3L2MA 4TNGA 5EPMA 3P4OB 2XPGA 4Q9RH 2PCFA 4WK0B 2Z4QA 4Y2DD 3U2IA 4WWOA 1K2DA 2OSWA 4YXLH 5D70H 3GHBL 1OWWA 3GRGA 3L5WB 1AQDA 3U7WH 2NY3B 4IBUA 1IQDA 1DUYB 4L4JA 4LVHB 1YMHB 1RJZB 3TIDA 5LWYH 4G6JL 1R3IL 2ESVA 3WNIA 4MMXB 5ICZB 3ZKMD 3EFFA 3ZK0A 2AEQH 3TPKA 4OZGB 1RK7A 4UUJA 4QRPE 3G5WA 1JZ5A 1AR1C 4JFHD 5DLML 4JPQA 2LFEA 4DGUA 4TPRL 1KUMA 2NZ9C 5BUAA 1WWWX 2EC8A 4N28A 1DBML 1ACXA 2HB0A 4ZX3A 2Q0ZX 5DYFA 3RYMA 3FCBA 3ZQ9A 3LIUA 4Y5YA 3IN2A 4B3VA 1KGIA 2CJSA 4HJSA 3VU2A 4LLMA 4XPFH 1J88A 3TU6A 4DQAA 3HNTL 2ITEA 4NKMA 3SPGA 5C07A 4JFEA 1BJ8A 1HIML 2E5EA 1PD6A 3FQNA 5D93C 3HG1D 5EZJB 5AYUH 5FHAH 3ECVA 5MENB 4X7DC 3S48A 3DJSA 2JH2A 5L0QC 3BWSA 1M3IA 1M2OA 1U2HA 1VGKA 3FOMB 2HCZX 3FO0L 3UPRA 3B2VH 2QPUA 3QG6A 1HZKA 5DRNA 1EGJA 5BRZB 2DQ6A 1OW0C 3G6JE 1JZ7A 1D5XB 1LO0H 5F6IC 4NHUB 5KVFH 1NAMA 3HTLX 1EHLL 3VXUD 2WXPA 1QRND 4X6DA 2NY1D 1O7DE 4NJ9L 3L4CA 4PRPB 3OMIB 4IRJB 2C9UA 1UZGA 4MKMA 2ITDB 1BFOB 4XTRD 5CEYB 5IBTH 1XF2A 1QLRA 3RLSA 3K6FA 3V8OA 5KTEH 3T2PA 4OQTL 1KTJA 4PJBF 5T3XH 3K6OA 4PGDA 5E70A 5FC9A 2XX0A 3TN0A 2FJHB 1HH6A 3RWIA 3ATEA 1P4UA 3JTBA 3K6NA 5GGQH 4PV9A 4RZKA 5MEPB 3Q6FB 4KK5D 2E9BA 3FB5A 4G1MB 4OLVH 1K5WA 4NAJA 3RZCB 5GS3A 3QJZA 4FXTA 4D8PB 4HULB 1DJHA 4Z5RA 4TSCH 5IROD 3GUFA 5CJ5A 3CVHL 3CPLB 2TSAA 3CUPB 1HHHB 4UT9A 2BXYA 3CVDA 5C0AA 5DZJA 3SE4A 4WIQA 3EGXB 1U0QA 5T1LB 4F9LA 3TT1H 1MHHB 4ZMAT 4OCRH 1TTCA 2HLFC 3RJQB 2ALWA 3T6WA 4UTBH 1TTBA 5FECA 4XMZA 3Q05A 4NKIL 1J8KA 3KHQA 4LLAA 1VFBB 4APQD 5AENA 2J6EH 4MA8H 1NGZA 3W9EA 5DFVD 3NFNB 3NIDF 4CN1A 1XFPA 3KL5A 1HZHH 1CQYA 1AI1H 1R3LA 4UQEA 4MQXC 4LFHD 1WGOA 2B1HL 1UD2A 1CLZH 5CBAB 1E4XI 4Y5XA 5D7IA 4OLYL 4DQOH 1D9KB 4JMNA 4JBSA 4R3SB 5E1IA 2IG2H 3ECQA 2Q8BL 5IFHH 4O2EB 1F4XL 2XWTA 2ZUTA 2X4NB 3AGWA 1LGVA 5D7JA 1EDQA 3WGVB 4OZ4B 4RH4A 4QHMA 1XL6A 2WAQA 5AUMB 1KCSH 3EG9B 4H88L 4ODXA 3RHWF 4CMMB 5BQ7B 3ZN6A 2VN3A 3DV6A 5L88L 2X4OB 1VZHA 4H0LC 2I5YH 4PG2A 5B38G 2CGRH 5HHMB 3NEEA 1RFDL 1DSWA 2H7WA 3K74B 3D8MA 2IVFC 4YPGB 2VKXA 5H94A 2MOVA 4IIQC 3SKMA 4F7MA 8FABA 5F7UA 2YAPA 1WF5A 4DPBX 1C8QA 2OMYA 4PJGA 1RZFH 1SXZA 2CIKB 2UVFA 3GO1H 3NDYE 4K0OA 1BYPA 5HJ3A 3VYNA 1NEZA 5ICXB 3ZRCC 1HHIA 4E68A 2JKJA 1D5MA 3EOAA 2CRMA 1WVZA 2PNDA 1RHHB 4XP1L 4HKJA 4I85A 1K8DB 5DC9B 3HLAB 4JPVL 1JGVL 3ISYA 4YFDB 1Z9MA 4Y4FB 3WFCH 1EMTL 1QFPA 4ES8A 1TQCC 1PD0A 2VR4A 2X2IA 4P3CH 4JO3H 5JQHC 1F56A 3O4LE 3FTSA 4WI4A 1DQLH 4EI5D 4AEIH 1QBLL 4DGIL 1C08A 1BLNB 1L7TH 3EYFA 1NGQL 2K70A 4KPHH 4KQ4L 2E4FA 1A4JB 4EZMA 2MQ0A 1H8SA 2XACC 3GXPA 4ZUTA 4LVOB 3QHFL 1DQKA 2PYFA 2BNUA 4JX0A 2EDRA 1A9BA 1KY7A 1NINA 2EO7A 1NC4A 4M1DH 5LG6A 4QNPE 2BCMA 1CLYH 2HZHA 2AQSA 1YRKA 2HT3D 1FRGL 3QI9A 4ZS6C 1FZKB 4MA3A 2FD6L 4OZGE 2FEEI 1SEQL 5AW7B 1M05A 4L1DA 1JI2A 1YMMD 4NB7A 1SXBA 1CGXA 4I77L 1Y1UA 2IDUA 4PCKA 4QAMB 1XCQB 5IV2A 2G5UA 2K8QA 5IP4A 3WO4C 4NQEA 5DA4A 3C5ZD 3GXIA 3R06A 4WFED 4XPBL 4N6QA 1QLFB 1WS7A 3N04A 5LCVA 4KXAA 5A2AA 4GKZA 4KU1A 4MYPA 5D71H 3ULVD 2XWJB 5HHPB 3QR1A 1T5WB 4PRHA 4UAOC 1TJGL 2FJFB 3UAEA 3I3DA 2L04A 3JTSA 4LCCB 1GGCH 5EUKA 5MENE 3GRWH 3T65A 1CGYA 1UACL 3CAFA 4MAUL 4APQB 1HDMB 4NC0B 3EYQD 1CE1L 1AC0A 2F53B 4CSTA 2HTKC 5KW9H 1G7LB 3MJ9L 5ILTH 2BOCB 4TQIA 4OR1A 4PJ9D 3UTQA 5ID0B 4CAGA 1A6WH 1QI3A 5CNHA 5BRZE 3UBHA 4NPYA 1N10A 1F42A 5I75B 4L8SB 1KXTA 3TN0C 4MB5A 1K4DB 1UFUA 2H45A 2ATPA 4PREB 3EF4A 4PRPE 5J4MA 2MTPA 2GI0A 1WC7A 5D1QD 5KSAA 2FNBA 3P3SA 4J3SA 3IFNH 1ZXQA 1OT2A 2E8YA 2JK5A 3QCTH 2LGNA 4YR6B 4Q0XH 1YQVH 4U1IA 2R2HA 5IB1A 3QS2A 5GS0C 4HFWA 2DLFL 5EBMA 4X8JB 2DQHH 3VI3F 4C54A 2JXMB 2D9CA 4PTTA 4LGPB 1CFQA 4JJHA 3UGEA 3DX2A 4NEHB 4RDQF 2GTZB 2EIEA 3GXDA 3OKEA 2IAMB 1RULL 3GPEA 3PGDA 3VFGL 3BSGA 3QR2A 4P3WA 5EO0B 2XZZA 4R0LB 4WDIB 1QFOA 1L0XA 3IK2A 5EMYA 1DBBH 1K6QH 2X4TB 2VAAA 1ZKAA 4D0CB 1WZLA 1YNLL 5J9PA 3UC0H 3VD9A 1XTMA 2BP8A 1G4RA 3GSQA 4MAZA 3U6XS 1W0WA 4G8IB 1IEBB 2ZCKL 3GNML 2BM3A 4NUPA 4Y5XC 5FYKH 1MCSA 5FYJL 3NCCB 4JO4L 4KMTL 2DYSB 2KPNA 4Y1AA 3LY6A 4I13B 2R8SL 2VLKD 1URZA 3MSPA 4IJ3B 1YPZF 2R23A 1FNGB 4IS6B 3QUYB 3KPRD 2G2RB 2Z34A 4I3SH 2IXQB 5L8LB 4XPGL 3O6FD 3QZWB 4JHWH 3QARA 2DLEA 4GMTH 5E8PB 2OYLA 3SDDC 4A2FA 4GRLA 4Z7OB 4NUJA 3L3KB 3QT2A 2HRPL 2BY1A 1U8MA 2X4RA 3DURB 3X11B 4XE5B 4JRWA 5E6ZA 1U2YA 2A1WH 1U36A 1HS6A 2YGPA 3JWOH 4TSAL 1RIVL 1BD2D 1EPFA 3MNWB 1C1EL 2YJQA 2EIMB 1W6LA 4N8CH 5G4MA 2XU9A 2A77H 5FUCC 5HHME 3OR7A 4X6EB 3L8QA 3DPBA 5E23A 3O2VH 3C5ZB 1NBQA 1GTNA 2IANB 2JKNA 1NMAH 4NSKB 3N6YA 3CXHK 43CAA 3QEQA 3S5LG 2JI1A 3LQZA 3MR9B 2BOBB 3GT6A 5DUMH 4Q6IB 1MI5B 4S11A 1NGPH 3IDJB 1KCUL 1R3KB 3H42L 3EBGA 1SOSA 1BQUA 2XNAA 3I50L 2PYEA 1OL0A 1XO8A 1BBJA 4FQXD 2N4IA 1AGCA 3UTZA 1FNEB 1G9NL 5D1ZA 1F90L 1G9MH 4JQIL 4U4IA 3VB9A 3PU7A 3B9DA 4XMPL 3NSDA 2G5RA 2XJLA 5GSVB 3M6DA 3OMZA 1H5BB 1OSZA 1DE4A 1ICTA 3G6JA 3TA3A 2WPGA 2Z8RA 5DK0A 3RIAK 4WO0A 4PG9A 4WNJA 2DWDA 1QACA 5C0GA 1AOZA 4N25A 1JZ8A 1FG2A 1L6XA 4RLDA 2FBRA 5G4OA 4KKNA 4YE4H 4NXSA 4K5MA 4O2FA 1CXHA 3MJ9A 3Q44A 5EFIB 4WZ9A 1TMQA 4PY8I 2J1WA 1ZEAL 2WWMC 3PHAA 4LOFA 1WS8A 2J8UF 3CN4A 4B3EA 3UJJH 3DIDA 3U46A 3ISRA 3V6ZB 1PFOA 1W72B 3MRQA 1RZGA 3DVNA 1AXTH 3QUKB 4PLJC 3UYOD 4JNXA 3T0BA 4FFZA 1IC5H 3WFHB 3KWVA 3ILDA 3QEUB 5DRXB 3RL1A 5HI5C 2ZYHA 2PKDA 3G5ZA 3ZW3A 4WHYG 2VJ8A 5BOJA 2VTFA 3KW7A 3LKRA 3Q43A 4KHTL 5IJKC 1JGEA 1OGTA 1KENH 5FLUA 1FZMB 4EXPX 5SX5K 3TL5A 5HGBA 3V0GA 1VFMA 4OJCA 1GGTA 2FL5B 3LKSA 5DJZB 3V0EA 1PX4A 4H25A 4CVUA 5C8JA 3H2PA 3W2DL 3RU8L 4L05A 2F53E 4RAVA 2EUXA 1NGWA 1GAFL 1YSOA 1AS6A 2VABA 2UVEA 1DVXA 5CP7B 2CDGB 3KNBB 5C70A 3Q48A 2FQEA 2R4RL 3RWDB 4RGNB 2I07A 2XFGB 4WFHD 1ONQA 1MJ7H 3BPCA 3FCSB 4HUXA 3IS1X 4GI9A 3RWJB 5J12B 2DD8L 1T6BX 4ZW3A 3TX4A 1AD9B 1CXLA 2XG5A 3CSYB 1L7IL 1Y1DA 2AGJH 2DIAA 5HGDA 5LBSL 1YN7A 3S88L 3HR6A 4FNLH 2WVSA 4D9QD 2XX1A 4Z7UB 1ZVSA 3IKCA 3MUHL 3V0AC 4FCHA 5A2IH 1O0VA 5J6HA 2P5ED 1BD2B 1I8KA 2ED7A 3EYVA 4WLCA 2ATAA 2EDJA 1TVDA 4BCYA 5I71B 3N40P 3PV7A 1F1GA 5B8CB 4LIQH 3NSJA 5CFAA 4A04A 2WSKA 1LHZA 1VCAA 3VFTB 3JTTA 3FJTA 4JFOA 1JPSL 3LPWA 2YQ2A 5FFOA 4R90L 4CBPA 4DEPC 2BVYA 3TASA 2E86A 2DWXA 4TTGA 3T8VA 1GRWA 1ZHLA 4G3YH 4ZMNA 5T5NF 3PFUA 1K5NB 4JDZA 1AGDB 4JHAH 3EBAA 3I9PA 4PEEA 2WVVA 3SCMC 5LGYA 1ORQA 2DQEL 2M26A 2WKOF 5E1AB 3WCYA 4JZOB 1MVUA 2XVGA 3WNOA 4CBZA 2YA1A 4OI9A 3SZ6A 4XBPA 4E9RA 4WCYH 3ZTCC 3EUDA 3O41A 4P4RA 5A6MA 4QY8A 3WJLA 4HH9A 1RZJH 1QABA 3O4LA 5EZIL 2X1WL 2ITCA 3BKJH 4FEMA 4KKRA 1P0SE 2HVBA 1LL1A 1BFVL 2JCCB 5HYEA 5KYNA 2CE6A 5GGVL 4L4TD 3LX9A 4U1MB 3ZDXB 3P4OA 4LHJB 4Y7MA 3SKJL 1A7NH 3QRLA 3OAZK 4QOKD 4XPTL 3X1EA 4Z7OE 2WJ7A 4KK8D 4IBQA 3L5WA 4M5ZL 1U4EA 4QTFA 1DUYA 3L45A 1YMHA 1RJZA 4Z78B 3PWPD 1AHMA 4MMXA 5ICZA 4P2CG 3AS0A 3PY9A 4OZGA 4J23A 4AITA 1DLFH 2IDTA 4ZS7H 5LAXB 3CSTA 4WFEE 2IANE 5EBGA 5K59F 4XNXH 4TQ8A 3UTTD 2BSRB 3VI4F 1X44A 2J7LA 4O02H 2I27N 4Y16D 1MI5E 1DBAH 2EADA 3ULVE 4IDJL 4L3AA 1JL8A 3S97C 2DBLH 1UB5B 4IK7A 2AP2A 4DO4A 1AZZC 4FYQA 3ALWA 4UQCA 2H2PC 4Z7NB 1QNZH 3AZUA 5GGSB 3J7HA 3MNZB 5EZJA 1ZMYA 3B9KB 5AB9A 5MENA 5ESAB 5I8KH 2RAMA 4R7XA 3T0ED 5AOMA 1A3ZA 2LU7A 3L08A 1DVSA 3FOMA 1O7DC 5JIMA 3OJDB 3PNRB 4R4BB 1IFHL 3O0LA 1ANUA 5I0XA 5CD3B 1U91B 3L5HA 3DJ9A 4HMEA 1OCWH 5BRZA 1NCHA 4I88A 1D5XA 3HMXA 2HKHL 4NS0A 3TEXA 4NHUA 5A1AA 5JHLH 2AABL 3O3DB 2CU9A 2IWGA 4OF0A 4OB5H 2FX7L 2ODHA 1SFHA 2JQAA 1IGIH 3VXOB 4LKXB 4HD5A 5B3JF 4PRPA 4H26A 4IRJA 1IUZA 1GMEA 1BFOA 3WIHL 3VO0A 5ICYB 2EIDA 3QQNA 2CO2A 3QJTB 4GIAA 4K7FA 5DQDH 3TBCA 3RWGB 4XHQA 3F58L 1DDTA 3STZB 3X1NA 4DKFL 2FJHA 3O6KL 4CGTA 3D4GA 4S0SD 2J57A 4ONGH 1JGIA 1MHPH 4Q56A 5BO1H 2HT4D 2NY5L 5MEPA 1OHQA 1Q9OB 3QP3A 1AZNA 4HIHA 4J3UA 3Q6FA 3LNGA 4ZS6D 3BZ5A 3H9SB 4G1MA 4GUCA 3RZCA 3F7QA 4V1DB 3K5SA 1U21A 4LSPH 3FRUB 3MX0B 1YYMH 3S36L 1JNNH 3CPLA 3CUPA 4IMKA 1HHHA 1BQLL 3N85L 3EGXA 1F3JB 4Q14A 1I85A 2XQ0A 3ARDC 4FDWA 1SOKA 3LNFA 4LPTA 1F58L 2NT1A 1MHHA 4KZ0A 3L6FA 1VAHA 2HTLD 3PQYB 4J1UB 1EDYA 4TQEH 3Q2WA 3HC4H 1G1OA 5I8CB 1MCWM 2PWDA 4Z18A 3H56A 5A2FA 1ZLUK 1Y6KR 3DI2B 4DGVH 1CO1A 2ZAIA 3NFNA 4TL5A 4LRNH 5HDLA 4HJTA 4D8OA 3V52L 2NR6D 4RGNE 5EBWB 3CHQA 5ITFA 4R4FH 3M1CA 4IOSD 1UD3A 1LK3H 4QOKB 2GJ6D 3OZKA 1P4IL 5T5FH 4JKPL 1D9KA 4GRWF 2B2XH 2ZCHH 3F62A 4R3SA 3SBWA 4XP6H 3RWHB 4UM9D 1KCLA 4AJWA 4HC1A 4PJ7F 2F6AA 2PTVA 3MRBB 4O2EA 4Z7UE 1YEFH 2X4NA 2GT9B 4OZ4A 1SHXA 1BD2E 1J18A 2IV9A 2WSPA 2MCAA 5I18L 4TNWK 3X1FA 3P0GB 2B4CL 5AUMA 4X4XB 1JDDA 3VQ2C 3WNLA 5DGQA 3MODL 3P3UA 4CMMA 3Q6GL 1M9SA 4P2AA 5BQ7A 1VFAB 1XX9C 5K9KB 1AE6L 2Q20A 2X4OA 3WUWG 5DRZB 5FYJU 1FC2D 4X8GA 2C4FT 1QKZH 5J13B 2QQLH 3KR3L 4YPGA 1AGFA 2WMPB 3RB5A 2YPKB 5HYFA 2AZAA 1PTZA 3II3A 1YY8B 2E7MA 5JOFB 3BDYH 2WNXA 3AY4C 4BKLB 2CA3A 4W4OA 2CIKA 3WJLC 2I25N 1QW8A 3GSUB 1KGCE 4ZW6A 1OP4A 2ZP0T 5ICXA 1KT2B 3RI5F 2GJZB 4ZTPH 4OLXH 1RHHA 2CBTA 1K8DA 2AQTA 3HLAA 1SBBA 3L4YA 3PHSA 3E9UA 4DO5A 4Y4FA 3VB8A 1IAOB 2ED9A 1JVKA 1ZT4B 2M1KA 3BUIA 3H4FA 3IDUA 4MJID 2JJSC 1EO8L 4EN2A 3NIGF 4EPSA 1BXUA 1UKTA 3GSNH 4BUHA 1G9NC 4HU8A 5KBLA 3PRZA 5BPPA 3KYMB 5AKTA 2NY3C 4JPKL 5I1HH 1BLNA 4LVHC 2JCCE 4UV4L 3D2TA 2Y7LA 5LBVA 3WXVL 1MWAL 2BIMA 1A4JA 3L3OB 4AEHL 1GS8A 3ZDXE 1VHPA 5KVGH 1I1AD 4H0IA 4C57C 3V0HA 2VJXA 4M61B 1N7MH 2FUQA 2WN2A 4JE0A 4XVSL 4KMQA 4JW3A 1SXCA 1QX1A 3RGBA 3DHPA 3SDDD 2MWCA 5BMFH 4YC2C 3PWUB 3DMMD 1FZKA 1QUNB 3L95B 1XIWC 4EQ3A 5T8IA 4AQ1A 5I1JL 3L16A 3BZFB 4ONOA 2DQJL 3M8OL 5DZOA 1UUSA 4R7LA 2LU4A 3LD8B 3TBSB 2DQIH 1RPQA 4X6DF 1QLFA 3VXMD 4M48H 4ZOBA 5C08B 4U6VL 2VOTA 5E8EB 3H4HA 5E2TL 1OHZA 4XBEL 4Z7NE 4WSKA 3C12A 1T5WA 2YRBA 3ARBC 2FJFA 3V5KB 2QJDA 4LCCA 4FYTA 4KVNL 2XXGA 3K2UH 3QNFA 5B7EA 4M5SA 2XN0A 5HYSB 2ZX5A 1FN4B 4APQA 1HDMA 2P8PB 3D52A 3F00A 3AMLA 1N5YL 2XZAL 5EIIG 4M6AA 3LPFA 2F53A 3TBBA 1COBA 1G7LA 2EEFA 2BOCA 1ZLVK 5K69A 5ECJE 2AHIA 1LO2H 2VERA 5ID0A 4FNPA 4WFHE 4FXGC 4Y8AA 5CSZB 3FT0A 2P47B 3KYNB 3LPOA 3MRPB 2X3CA 4J27A 2EICA 3FQYA 3EJYC 1K4DA 3M7OA 3EDEA 4PREA 1LDPH 4AUYA 4GSUA 2DQUL 2OMTB 2FX9H 1WYJA 2WP3T 3FN0H 1A6AB 2H4EA 2GITB 2VN7A 3OAUL 1A2YB 3K4ZA 4YR6A 1H0DB 1HL4A 3SE9H 4ZO7A 1LWJA 1MFDL 1OAZL 2ZUYA 3A47A 4X8JA 2JXMA 3U83A 1X7QB 3RB7A 4QGYA 3LRKA 1OQOA 4IU2B 4WSJA 1P53A 3WMPA 5AW1B 4FABL 2NYYD 3OHXB 3H9SE 2NNRA 4GKLA 2OJZL 2IAMA 4EUPG 4V1DE 2BP3A 1J0HA 3FU6A 4R0LA 5EO0A 3BOVA 4WDIA 1JG9A 3OQRA 5D7IF 5EA0H 1JRHL 1T1WB 2XJKA 5DMYA 5F3FA 2FX8L 2QHLA 1YYLH 2F1BA 2X4TA 3L4UA 2MJWA 2G0KA 4UINH 2CUHA 1CDCA 4D0CA 1OPOA 4P49A 1MLBB 2YAEA 3PQYE 3MVSA 5I1LB 4KMLB 1AVAA 2LR4A 3V7AG 4G8IA 1IEBA 3N43B 3BJLA 4UDUB 4EI5A 3FO1B 3SBWC 4OJDH 1ZHKB 5I8OL 4NNPL 3CLFL 3AY2A 4QMEA 4UM8B 1FNGA 4IS6A 2YQBA 3QUYA 4PJGF 4AMKH 1SQMA 1MFEH 2G2RA 4L3EB 2JKTM 2IXQA 4QOKE 5LNEA 1HNYA 3LZFH 3QZWA 4F58L 1ZANL 1QFUH 3DXAD 1KXQE 3QXUA 5E8PA 4AGQA 1E43A 1KGXA 4ZZFA 5C2BH 4N0YL 3L3KA 5CSBA 3X11A 3S3JA 3DURA 4C58B 3UO1L 4WK4B 4NN6B 4E2OA 1EANA 3HI5H 2J5LB 4KV5F 2VT0A 4NWUL 4YK4B 1FYHB 3MNWA 4W4OC 2CCLA 5ELIA 3I74A 2JWYA 4HMCA 2PN5A 1CR9L 3QR0A 4X6EA 4TOYL 1NJ9B 1WJ3A 2CMRH 3C5ZA 4LP5A 3K81A 2IANA 4NSKA 3HNVH 2PXYD 2VLME 4Y4FC 1UM5H 4K3DH 5BW7A 3MR9A 1S5HB 2BOBA 2EEDA 2OW6A 2Y2YA 4Q6IA 1MI5A 1KIRB 4LRIA 2WP3O 3IDJA 3TWCL 4JY6B 5AVTB 1R3KA 3I2CH 4R84A 3SDCB 4LOEA 3RFRA 3CFTA 3AWFA 2ZUQB 4YH6A 3SE6A 3EGDB 3PJLA 3QEGH 5E8NB 5KS9B 2MMXA 1DVTA 2JI3A 5I1CL 1T7WA 2QPFA 5HHNB 4GBXB 1FNEA 1DBKH 5I5RA 1RUAH 1FIGH 4J12A 2X1OA 4HIJB 5FF6B 3LCYA 2YUVA 5GSVA 2X4QB 4TNWF 2IC2A 1H5BA 1EX0A 4HF5L 3JV5A 1V7NH 1BDYA 2FEDD 4NKQB 2FT7A 4APXB 4BSVB 1ACYL 1IM3B 5HSFA 1N67A 3KL0A 4UTAL 4QXVA 4MVBD 4B60A 3KPSD 3CZGA 4AYGA 3IAPA 1SLWA 1JE6A 4LKCB 5EFIA 3KLQA 2C9QA 1JWSB 1PEWA 3NCMA 3QJOA 4NJAH 2A74C 3IJSA 3CHPA 1W72A 3HE6C 3RWCB 1TYEB 1REIA 1RU9H 1DBJH 3QUKA 1J10A 2YD6A 2X4PB 1HL5A 2NY5C 4MQ7B 3WFHA 1XCWA 4ATTA 4LCCC 2P52A 1AG6A 3QEUA 4KKQA 3VDCA 1ZPLA 1EK3A 4DKAA 4UOW1 1A5FH 5D70L 4YXLL 3WIFA 3U7WL 4UYPA 5C08E 2CRZA 1RZ8B 3V0VB 5JPMB 1FZMA 4ELMB 5DO2D 5LWYL 5IVXB 3KLAB 4DZBB 1M56B 2AEQL 3MRGB 2BVEA 1IFGA 3QJVB 4HWZB 2FL5A 2Z0BA 5DJZA 4MCNA 2P80A 2J1ZA 4L8SC 4AVHA 2H2PD 3LV3B 1MG3C 2AV1B 1DJSA 2Z7ZA 4U0QB 4MBOA 3D09A 3BD5A 3CNKA 2VLKA 3EBIA 4P2QD 5L9DH 1F00I 4PJDB 5E8DH 5CP7A 2CDGA 3DHUA 3RWFB 3KNBA 2WTOA 4NWTH 5B1JA 1M9WA 3RWDA 2X0VA 4F37K 8CGTA 4XPFL 3RWJA 3FCSA 3S34L 2JLLA 2XSKA 3DXAB 3KJ4B 3QG7H 1S9VA 5MERB 5AYUL 3RUGB 1AD9A 3CXHJ 3CSYA 3RY6A 3VGGA 3Q1EA 4KK6C 5GGTH 3NZHH 2IAMC 2IMMA 2VITB 3ATBA 4DFIA 2JKWA 4FNUA 3BAYA 4R0LC 2PO6C 4R97C 2FGZA 1BD2A 1HWHB 4W9FC 3IE4A 4AQAA 1BA9A 3B2VL 4JGUA 2WOBA 1FSKC 5B8CA 4HPOH 1LO0L 4JKMA 1A7QL 2B4CC 3DX7B 4BFNA 3X12B 4RGOH 5KVFL 1ASPA 2PXYB 3DYOA 5H37H 3VFTA 3FO9B 4PJFB 2OCCB 3QNYB 2XHNA 3IDGB 5F8RC 3DIVA 5C0RH 5JHDD 4LF3B 2VMCA 4XB8A 1QW9A 5IBTL 5KTEL 4HS3B 5EU7E 1R3JA 1K5NA 5T3XL 1AGDA 2BZCA 4FFTA 2QVFB 3K8KA 4JZOA 3QUYC 4JFTA 4JO2L 5GGQL 1UT1A 4FKEA 1FBIH 4OLVL 2X09A 4IKJA 3WUWB 5FA3B 2WLJA 2DI8A 4W9ZA 2ZG1A 4QHKJ 3LEYH 1J1XH 4XMKH 4Q6KA 4TVPH 2WN3A 3BQUB 3L3HB 1UXWB 4OM1H 2AAAA 2OSYA 2P3YA 2VC2H 4L3EE 2DM7A 4U1MA 4WWPA 3TT1L 3Q13A 3FTUA 3KXFD 4HG4J 1YJDH 3AADB 2HH0H 4OCRL 1DVFC 3LZNA 3TA4D 4FEIA 2VSMB 5IW3A 5JXED 3MZTA 1JGLH 1P5UC 3VYOA 4LLVB 2O6PA 1FFQA 2E46A 3QJSB 5AD0B 2FGWH 4KK9D 4Z78A 4XAWH 3IMRA 1KTBA 2J6EL 1PG7H 2GK2A 4Q6IC 2CO3A 4LRIC 5JOPD 1Q90A 3HZYB 4IIZA 3KZ8A 5JO5A 4FQJH 3DUHA 1AI1L 2V2WA 3VTTA 5T3ZH 3TGXA 5LAXA 5JW5B 3HFFA 3G6JF 1CLZL 4XCFH 4DQOL 2ARWA 2BSRA 5FYKE 2WQVA 4WEBH 2IG2L 5IFHL 5CN1A 2CM6A 5J1SC 2O5YH 4IBVA 5MEQB 3P0VH 4Y19D 5AW4B 3WLBB 1UB5A 1OE2A 2KZWA 3NK4A 3OJMB 2P4AB 3TFKD 1DCLA 2WB1A 5GGSA 3MNZA 1HKLL 4OLZH 1H5BC 1KCSL 5E6ID 5FDYA 2Z31C 5CAYB 3B9KA 2C7UB 1GOHA 3QWQB 3B2DC 5KS9E 5ESAA 4WGWB 1H3GA 3VU1A 4OI7A 2CBPA 2CGRL 4P2QB 3UYPB 3BKMH 3OJDA 4R4BA 1GMIA 1NCAH 1PLCA 1U91A 5CD3A 2UWEB 4HEME 4WI6A 1KN2H 1RZFL 3HC3H 3GO1L 4MB4A 2VR7A 4QD2E 1IJNA 3AG4B 1IC1A 4OLWH 2OX5B 3S8WA 3O3DA 2ZKHL 3APNA 1LWRA 4G5AA 5I66B 1DN0B 4LKXA 2VR3A 1U9KA 1SPDA 3WFCL 4MXWH 2PPCA 2HFTA 5ICYA 3B7TA 4O02B 3EBHA 4DF9A 3RWGA 2WTPA 2BVUA 3JT0A 3OKMB 4P3CL 3STZA 4L0ZA 1DQLL 4AEIL 4JAMB 4O2CB 3KEHA 3LKOB 2AKRB 1CL7I 1KBWA 4KPHL 1Q9OA 3DOHA 4S1RH 4X9HA 1KYUA 4N5ED 3H9SA 4XNYH 1SYVB 4XO4A 2FYVA 2WVUA 4V1DA 3TZVC 3FRUA 3MX0A 3UAJD 1ZE3C 1YNTB 4M1DL 3PHOB 4YHKH 5F9OH 1UKSA 2N7AA 4RFNC 3ZYZA 1CLYL 1MUJB 2QGEA 4LHUG 4DIXA 2LOEA 1F3JA 4YGVB 1CDUA 1FAIH 1UJTA 4ELME 3WD5H 1PZBA 3VTAA 4A66A 1WG3A 4UMGA 2YFNA 1KMGA 3B4NA 4L1TA 3SDYH 2OL3L 3UROR 1A6TB 4PHXA 4J1UA 4KZCA 2G2PA 5I8CA 5BS0D 2LABA 5LB1A 1Z3RA 2F74B 4A6YH 3A4AA 4RESB 1VGEL 4PJAE 4PJDE 2XWBB 3QO1A 4G6FB 5EBWA 5FW8A 5D71L 4QOKA 4N5UA 4R83A 3RUGE 4KUCD 2ZX7A 4ORGA 3RWHA 1KXQA 1A4BA 1YEWA 1GGCL 4WW2C 3MRBA 2NYZA 2GT9A 1TQTA 2WD0A 1MQ8A 1JP5A 4P04A 4NQCD 5ILTL 4JFSA 4K73A 5KW9L 1A3QA 1DUZB 1JNJA 4X4XA 2DW5A 5K9KA 1A6WL 3OJ2C 1VFAA 1OTTC 5DRZA 3QIWB 4G7YL 5DS8B 1TZ8A 4LPXA 1Q0XH 4PJFE 3GI8H 2WMPA 2YPKA 1BQRA 4JFWA 4UTBA 3KW8A 1YY8A 2R1YB 5FYLE 5GRVL 5JOFA 4XOEA 2CO4A 1QSVA 2IOIA 3J07A 1U42A 4BKLA 2B77A 3GSUA 3IFNL 4QNPF 1KT2A 4F37F 1YQVL 2GJZA 3QAQA 4I7ZC 4ZMTA 1HXYB 2DQHL 3T0EA 5DD1L 5JIIA 2J73A 3PWLB 1IAOA 2YZ8A 3U2SB 4OZGF 1XGUB 3ABKB 2CHWA 5ICUA 1ZT4A 4K2UH 3IDNB 2NY2D 4OJYA 3JVFC 3N44B 5GQBA 2EYSB 3KYMA 4HXBH 1HHGB 3Q9QA 2KC0A 1DBBL 1K6QL 2RALA 4JREB 4DP1X 5AW6B 1R75A 3RX7A 3L3OA 3FU8A 1DR9A 2FLMA 2GJJA 3ESUF 5IOPB 1U8PB 3U2HA 3BVUA 3EJSA 3GLDA 4MBRA 1R17A 5KEZA 3D3VD 1YEKH 2AFNA 5DXWA 3QIBD 4M61A 5DFAA 4HDIB 3TJHC 1FCGA 5E5RB 1YEJH 3BDXA 5DEFB 1OM9A 5LG1A 5BZZA 2ZXWB 1BXXA 3PWUA 4L4VD 4X9IA 3KYKH 3E9TA 3QJQB 1QUNA 3L95A 3MRLB 3IFOB 1JVOA 2ICWB 1GZQB 3GI9H 3GSRB 3BZFA 1ZV9A 1GIGH 4J3XA 4UAHA 4I3SL 2WWNA 3MCYA 1QD0A 2OJEB 4JHWL 2VB5A 1CQKA 1ZV2A 4GMTL 3TBSA 1NC2B 3CFDB 2G2NA 4KOBA 2FSEB 5C08A 3QDMB 1C5DB 1PNCA 3MAWA 4PV8B 4N3UA 1PKQB 5E8EA 3M88A 1ROCA 2A1WL 1NM9A 1L3NA 2F8XC 5FUOH 2JIXB 2FWSA 3V5KA 5EO9B 4LPCA 5BS0B 2ZOWA 2FRGP 4N8CL 4HAFA 2A77L 5HYSA 4QRRD 1FN4A 1S7XB 2O5XH 3WKNA 4P2QE 3O2VL 1CTNA 1NMAL 4OJEH 3JWNH 4FNTA 4ZMZA 2UWEE 4AC2A 5CSZA 4U1NB 1TITA 3IGLA 2P9RA 4W9GC 2IQ9L 4IOSA 1NGPL 4CKVX 3KYNA 3MRPA 3DIFB 2Q76B 4NZTH 3I02B 2VDNH 2BNRD 1ETB1 1H3TA 4R4ND 5C0CB 5CJBA 1JFQL 3DETC 3AACA 2OMTA 2YGOA 1X7SA 1QO3B 2BW4A 5HVWA 2B3RA 4U2YA 4GG6B 1A6AA 2GITA 5BV7B 1VDGA 5E08L 1F4YH 1H0DA 4MHHI 1G9ML 1UHVA 3QUZC 2NOYA 1RURH 2ATKB 2XV0A 1X7QA 1MFAH 4IU2A 4OIFA 1IX2A 3LRHA 4FLSA 4QHPA 1M1SA 3OHXA 4LOVA 4Y9EA 4BH8B 4BELD 3GRWA 2AANA 1OCOB 4HS8H 1JNLH 4F7KA 2J3SA 3BC9A 4J3OH 5KUMA 1R3HB 1T1WA 1WICA 3SGEI 4BQ9A 3ULUH 2W91A 2CBMA 4YE4L 4W9KC 3WDHA 2W9LA 3O2WH 2XLLA 5CLZA 1MLBA 4E9VA 5BVJA 2WLZA 5I1LA 3SYPA 1YNKH 3WNJA 3US9A 1WHPA 1AXTL 2K3TA 2NY2B 4CU8A 1IC5L 1V3KA 4CW1B 1JD9A 4UDUA 3E6HB 3U1PA 1F3DJ 3FO1A 2K8MA 2DLTA 1B4LA 4IRSC 4PB0H 5IVZB 4P23C 4DP2X 1IRAY 1ZHKA 2JB5H 4JFQA 3SGDI 4OFYA 2DJSA 4EN3D 4UM8A 3MV01 5B3SB 3FUJA 4JM2D 5DHXB 1KENL 1WBZB 3ZSTA 3HBQA 4L3EA 3D3VB 3WIIH 4OD2B 1DQVA 4LHUD 4RDBA 5AW3B 4XOCA 1CDYA 3WN6A 2HT2D 4OM0H 2WIIB 4P46D 3GMNB 5HHOB 4XC3L 1RPUA 1C12B 2R2BB 3E2HB 1BAGA 2O5ZH 4M8RA 5LGHH 4Q89A 1W0YT 1P7QD 2WB7A 4Y2NA 5T1JA 1Z7JA 3ZVVA 2MOGA 1Z1WA 1Z5LB 2AV7A 3FUEA 2PO6D 3QEHB 1LK2B 2ED6A 2XN9B 3FKUS 3UC0A 3Q8EA 4NUGL 1MJ7L 5F88A 4XNUH 4FGMA 2AMGA 2Q6WB 3A6OA 1JV2B 1S5HA 3SDAB 4FNLL 3D5OF 1KIRA 5E94B 2RJMA 2IDFA 4KFZC 4JY6A 2QQKH 1TMCB 3HLKA 4JUSA 5IB3B 5KBKA 3QYMA 3H3PH 3ZT6A 3SDCA 4U31A 2BMKB 5CF3A 5EBLB 3T71A 3EGDA 4LIQL 3OPZL 3L3OC 4X9BA 4YGAB 5D1XD 5E8NA 3O81A 4F5CE 5KS9A 5KVMC 5HHNA 4GBXA 3WXWH 3U1SH 1UD8A 5IHUH 2ETWA 2DIJA 2WYHA 5HHXH 2HFFB 4HIJA 3GSWB 3M45A 2X4QA 4HEMA 5DZAA 3ESNA 3UG5A 1BQHG 3RX9A 4YDVB 2BNRB 4YPJA 2APXA 1AO7D 5EF3A 4JHAL 4Y4KD 4APXA 3BH8B 4BSVA 1IM3A 1PCXA 1G87A 3MDJA 4IW4C 1MY5A 1GJIA 2L7JA 4BUQA 5KANG 3QDJD 4WCYL 2MIZA 1UD4A 1XL4A 4L5FH 5J57B 2KZKA 4BE5A 1JWSA 2BVPB 4JHZA 1RZJL 5EULV 1RJCA 3V4PH 5LQBH 2P49B 4UZSA 3HRPA 5FWQA 3BKJL 1JXJA 2L0DA 1QBMH 3RWCA 4LSRH 2QMKA 5AVSB 1J05B 5SX4H 3KBPA 4AKOA 2X4PA 5DJCB 3SQBB 1XMEB 4MQ7A 1A7NL 4NN7C 2QDWA 4FKHA 1X4ZA 4PS4L 4WO4D 2K9FB 3Q2VA 4UILH 3P40A 1I8LA 3FQTB 2I9TB 5HTSA 2D73A 1RZ8A 2Y6TE 3QDME 3V0VA 5FOBB 5I0WA 5DZ9A 3RTQC 1RZQA 1PKQE 5JPMA 3F7LA 2YBRB 5IVXA 3KLAA 3T6VA 4DZBA 2YOAA 2QELA 3MRGA 5BS0E 2VM4A 4HWZA 2P5WB 1KJ2A 4RIRB 1TUPA 5KVGE 2FJUB 4FG6C 4KRNA 1DLFL 1A1MB 3BVNB 3LV3A 4ZS7L 4RISH 3CC1A 2IPTH 2AV1A 3SIKA 2Z31D 4MSWB 4XNXL 1N0XH 5TQ2H 4H1LG 2X38A 3WE6B 4O02L 5E1GA 3ARFC 4GUQA 4PJDA 3NEOA 4JM2B 4R7VA 4WTXA 3RWFA 1DBAL 5B4MC 2APBA 3I85A 1R24B 4MA7H 2DBLL 4TNFA 1J9CT 4LPVA 4DVRH 1PCSA 1QTSA 3DXAA 1QNZL 3VRLE 2YC1B 5C0CE 3RUGA 3UBXG 3LQAH 2YLKA 5MERA 3DX1A 1CCZA 1MN4A 2E7CA 3BGMB 5I8KL 3OHXC 3TVMD 3DHMA 5C9JB 8PAZA 5FM5O 3MRKB 4GG6E 4IJTA 4YXKH 2YQGA 4P59H 3N06B 2C34A 4WFGD 1QYGH 4KRPD 4MB3A 2Q86B 2IJ0C 1OCWL 4KKAC 5E95B 3C87A 1CG9B 5EU7C 3DX7A 5DDHB 4E9SA 4ZFZA 3X12A 1B2WH 5JHLL 5ANMA 1RUQH 2PXYA 1GSKA 3PWNB 3FO9A 4GQRA 4ODUB 4PJFA 3QYNA 4OB5L 1HSBB 3IDGA 1OKEA 1IGIL 3IU4L 4NCC1 3BJ91 4FS0A 3DYPA 4LF3A 1KGJA 2EINB 5CLXA 4Z7OF 1IC7H 4X8XA 4X98B 4QXWA 5DVPA 3VW3L 4CC4A 2DMKA 1NIFA 4IEFB 5D1XB 3T08A 3GK8H 3HE7C 5I6XC 1P5VB 4JGMA 4ONGL 1MHPL 2KMWA 1E5CA 1N26A 2A83B 1M7IB 4JCWA 3SKOA 3WUWA 5FA3A 3EADA 1B0GB 1BCIA 3QS3A 1SRDA 1YYML 2H26B 3CHXA 2YRPA 1CGTA 3BQUA 3ETBF 3L3HA 3PP4H 1AO7B 2HJFB 4Y4KB 1VEPA 2EDYA 3ULVF 3D3VE 4QHNB 2J5LC 1AZVA 4YHMH 2DM3A 3FPXA 3QFJD 1AHWC 4TQEL 5HHOE 3ZZLA 1FYTD 3HC4L 1V27A 4FFYH 3MXWH 4LLVA 5F7MC 5AD0A 5EU5B 1H3UA 4DGVL 4ZUVB 4ZMOA 4DETA 3WJJC 2W0LA 4LRNL 3UX9B 5C0EB 3HZYA 4LE8A 1SJMA 2OP4H 2YPVL 5KBMA 1D5RA 3W39B 3WKQA 2XN9E 4R4FL 3BEWB 5JQIB 5JW5A 1NMCB 1WSST 2DEWX 2WQUA 4UCFA 3SDCC 3VWJB 2VXVH 1SMDA 5T5FL 4WO4B 2AVGA 2ZWLT 3M86A 4QO1B 2ZCHL 2EVIA 3FRPG 4BKSC 35C8H 1U8CB 3AXIA 4LNRB 1XF5B 1D7FA 4MS6A 2QVTA 4GBXC 1NFDB 3HPJB 3BI9X 1ZPUA 5MEQA 3WLBA 4NO3B 2Q1EA 4KO9A 3L2LA 1BV8A 4GFXA 4OFKA 4DKEH 3RGVB 1WCQA 1NPUA 4XVUC 1DQIA 4PYHA 1RAMA 1MW0A 4P2QA 1QKZL 2QQLL 1F5WA 1DN2A 1NCBL 4AGPA 3BLKA 3FZUC 3D51A 4LL1A 3BDYL 2UWEA 4JGJA 2CALA 3B43A 2BNRE 2CKBL 3HMWH 4ZTPL 2OX5A 2EKJA 4OLXL 4WI5A 5I66A 4KROC 3TBWB 3O6MH 3TVMB 1GY2A 5TPWH 4DZ8B 4GLRH 1LM8V 4O02A 3JV0A 1WLGA 2PCYA 1XSIA 4KRPB 2NXZD 5TJWK 3ILQD 3OKMA 1BM7A 5GSRB 3GSNL 2BZDA 2UUDH 3C09B 4JAMA 4O2CA 1G9MC 1N3NB 3S35X 5I1HL 2VRAA 2AKRA 2F0CA 4DPRA 4C8XA 2GIXA 5JPMC 5ANHA 3MLUL 4G43B 3CV5A 4BH7B 5KVGL 1SYVA 2WSDA 1KLUB 2PCXA 3ORJA 4QCIB 2VQUA 1ITCA 1U8IB 2A4ZA 5C0FB 1N7ML 1K3ZA 1YNTA 3PHOA 4PJ8C 4JG1H 5TTRA 2NY6B 1MUJA 4Z3JA 3WELA 5CGYC 4YGVA 3QO0B 5BMFL 1WE5A 4HUCA 1DYZA 4Z3IA 2P5WE 1A6TA 3CPUA 1EIBA 1CFBA 1E0OB 4ORZC 2FTAA 3MRIB 2F74A 2YD4A 3C60D 2OCJA 3L4XA 1MCKA 4YSDA 4LBAA 1F8TH 4LESA 2JJTA 4EUPA 1CC3A 1IAIH 2DQIL 4LHQB 2XWBA 4M48L 2ZYIA 1JPST 1QA9B 2X28A 3NGBB 1OAYH 9PCYA 2CBQA 1VRSA 1TJMA 5JXEA 5D72H 1FYTB 5D8JL 1D3CA 3K2UL 2WM0A 1RK0B 1WEJH 1NBCA 1IAKB 4HIXH 3TTYA 3OMAB 5EWIH 3OTTA 3G9VA 1T2XA 4QRAA 3DETD 5ADOH 1E30A 1NSNH 4OUUB 1DUZA 2X40A 2CO1A 4Q4EA 3K7UA 2QADB 2YAFA 5DRWB 1UUNA 3QIWA 2YR3A 3COOA 5DS8A 3NFPB 2A73B 3GLZA 2A0LC 1HNFA 3ZDXF 4U3SB 1KJ3H 2O1AA 2R1YA 1LDPL 1UYWH 4A6YB 3IDXH 5INDB 2FX9L 3DVFA 4M6OH 4L23A 4DFHA 2EDEA 1BVZA 3AG1B 4UF7C 3SE9L 1MLCB 3SKNB 3BD4A 2NTFB 1TZAA 3V4VH 4WKZB 2F7QA 4A7SA 1TO5A 1HXYA 5D1XE 2DKUA 4FFWC 3UH8A 1ESOA 1HHKA 1D2PA 3PWLA 3BHBB 3VFOB 1IQWH 3U2SA 5T5FA 2WQRA 5BCAA 1L9QA 3RX8A 4GXUN 5H4ZA 4RZCB 3QZBA 3IDNA 3GGWB 2XKNB 3W37A 5SWSD 1PMYA 1RSYA 1FL3B 1RMFH 1D7DA 5EA0L 1MPAH 3T3MF 1HHGA 5E4EC 1IZKA 4K23L 2CO6B 3QC6X 1YYLL 4PWIA 5J56B 3FMGH 2RCSH 5IOPA 1TQBB 5J6GB 1N59B 1U8PA 2X4SA 5HGAB 4Z7NF 1MDTA 3C6LB 4HDIA 4FA8A 2YD0A 1OO2A 4X7CC 3UABA 2NXZB 4HUKB 2FBOJ 2QTVA 1E9OB 2X12A 3NZUA 5DEFA 5B39B 1RLBA 1F1AA 5TH2B 4HFUH 3NJLA 4K07A 4I18B 1X5GA 1CDIA 2NPLX 3MRLA 3IFOA 2ICWA 1RZJC 4DGYH 3GSRA 4D94A 4AMKL 1MFEL 3AMKA 1EZLA 2CQVA 3PYCA 3UAJA 1XVSA 3LZFL 1PX8A 2OJEA 4DVBB 1QFUL 1N6QH 4L9LB 1NC2A 3CFDA 5C2BL 5KANI 1NFDE 1O6VA 2FSEA 4OCXH 5J8OA 2OR8A 3QDMA 1C5DA 4PV8A 2ZTBA 1PKQA 5C7ZA 4TVPE 3HI5L 4OZFH 1JZDC 3Q2CA 2JIXA 2UZYB 5EO9A 5BS0A 4WU5B 4WWKC 3C60B 4OFIA 5CU9A 1S7XA 5D6CB 2OSLB 1EAQA 2CMRL 3WHE0 2VXQH 2JI2A 5DMGC 1UM5L 1EJ8A 4K3DL 1KFAH 4UOZA 1OTUC 5AW9B 1GXEA 2X6AA 4U1NA 1QTPA 4H2AA 5F8QC 2F8IA 3B3BA 2Z91B 4N0FB 3DIFA 2Q76A 4Q58C 5IQLA 3I02A 3WY2A 3VNZA 3ETSA 2CO7B 5I23A 2NCMA 5C0CA 4KXZH 5EOQH 2SEBB 3GLEA 3VWKD 4M4PA 5T3ZE 1DL7L 2ZIDA 3PS6A 1F4HA 2E3VA 2EUVA 3QEGL 4OVVA 1QO3A 2NUPB 4GG6A 3HN8A 3QPQD 2H3NB 1DBKL 5EZOL 1RUAL 1FIGL 4FNQA 2ATKA 4PTUB 3GSOB 4ZUWB 1SN0A 3O8XB 5C0BD 3RURA 5F89B 1EAPB 5HVFB 1QLEL 1V7NL 3R4RA 4ANVA 3WEAA 4E9LA 4CJ0A 4BH8A 5AVWB 2AQ1A 3UBXB 1R3HA 2F5AH 2XWXA 2GC4C 4Y9GA 1GJWA 4F27A 3VGAB 2HYMA 5HJDA 1A6UH 3LKQB 4DAGH 3P69A 5PAZA 1E9QB 1MG2C 2W65B 5CZXC 4JRXD 1E6JH 4L8DB 3MBWB 5IVOA 4L29B 3GBLA 3O0RH 1RU9L 1DBJL 3EOYG 3QIUC 4OCWH 1JCKA 3ARQA 4N86A 2EJ1A 4HP5A 3SY0B 4CW1A 3E6HA 2A9NH 5BOPA 2WLIB 3D39B 3IJHB 1PAZA 1F45A 5HI3D 3FUHA 1UURA 3AM8C 4QRSB 1A5FL 2PWHA 2H2SD 2WANA 1VA9A 4UQ9A 4BE6A 2Q3AA 1WBZA 1J8HD 3PGFH 5KWYC 3D3VA 3ARWA 1AQMA 2VSCA 4FTVB 4OD2A 4AW4A 3PNWB 1LVEA 5B4MD 1S7RB 1FYTE 1TETH 2PUQT 2WO4A 2YJLA 3VQMA 2V2XB 2WIIA 3GMNA 3QA3B 5HHOA 3WDIA 5CLTA 5K1JA 4G71B 1C12A 1WCBB 2G9KA 2R2BA 1T0OA 4NM8H 4XP9H 4HVBA 1R5VB 4PGEB 4B96A 2PR4L 5L9DL 1ZGLM 5AALA 4MLIA 5E8DL 1EO5A 2CR6A 4NFBA 1WZ1L 2PPDA 3QEHA 3R0MA 4NWTL 1LK2A 5DJ0B 1QZNA 2XN9A 3EOTL 2XRAH 4ZAKB 2D2OA 4MJ6B 3QG7L 2Q6WA 4ADGA 5I26A 5EC1B 2EUWA 3KLHD 3UTSE 3PXJA 3SDAA 1EERB 5MI0C 1FH2A 5DHVB 5E94A 3B2PA 1ZGLB 5DJDB 3GZOA 1SMOA 4JHVA 5IB3A 1XD1A 2L7EA 1G6VK 2BMKA 5EBLA 3FO2B 3CZJA 2B1AH 4HPOL 4H5SB 1B4TA 5IMLB 4RGOL 4R5VA 1KWKA 4N2NA 5I5MA 4JO5A 1E8XA 1ZTXH 1P9MC 4HJUA 2B0SH 3OL2A 2HFFA 2QEJA 3GSWA 1JFHA 1SBSL 1U58B 3ETBJ 3VMPA 2VW4A 3MOAL 4MZIA 4JRYD 4ENEC 3B1TA 5E2JA 4YDVA 2BNRA 3MRCB 3QDGD 2NW2B 3DUSB 3IT8D 3RY4A 3VWKB 3BH8A 3QNXB 2ZXDA 4J8RB 2ZWSA 4A63A 4FULA 1QZ1A 4BV1A 4A55A 3MO1B 4DTGH 1VSCA 3LPGA 3NOIA 3ARGD 2ZX6A 1FBIL 1UFGA 1JF6A 5C71A 4GAJH 3IBOA 4YHOH 2EH7H 2IWFA 4HJ0C 5C0BB 2BVPA 3WMSA 2NW3B 3LEYL 4HWEH 4GINA 4QKTA 5DZVA 1XEDA 1DVQA 2EILB 4OM1L 5IUSA 1J05A 2VC2L 2VR5A 4EI0A 4B5ZA 1MDAA 5DJCA 4AEEA 3SQBA 4KOCA 4YZFE 1M53A 1YJDL 2AEIT 2HH0L 5DJYB 1UADC 2BVOB 5F9AC 4JPIB 3UAFA 1JGLL 2FBJH 3FQTA 2X41A 2XV6B 1CUOA 4ZPTB 4KKBC 1G5GA 5FOBA 2R69H 1IKOP 1BZ7B 2FGWL 5D4IA 4AYEC 2YBRA 1WBYB 2KH2B 2VQ4A 4GRWH 1PG7L 1MJUL 4JEGB 2P5WA 4RIRA 2XZCH 2Y7NA 5JUEH 4FQJL 4HBQA 3BVNA 1A1MA 3AB0B 3FNKA 1GZHA 1DSFL 1G94A 4MSWA 4EOWL 4XVUD 1F11B 4N2BA 4WFFE 4XCFL 3B34A 3WE6A 4EN3A 3ELAT 4CILA 3WN5A 5F0PB 4JM2A 3L54A 1A3RH 1KV3A 1NKGA 2O5YL 1R24A 1XHHA 3P0VL 4BA8A 5A2BA 3FZUD 2AJZB 4LHUA 3HZMB 4EMZA 4ES9A 2IOOA 4KGLA 4LSVH 4DUVA 2E75C 4OLZL 3QCVH 3GUTB 3BGMA 1T66D 5JW4N 2CJUH 5BRQA 5BZXA 3S5YA 5C9JA 3BKCL 3MRKA 2Y07H 1S2EA 4C83B 4HZ1A 4KC3B 4YDKH 2JMRA 3E3QE 5C09D 3BKML 3N43F 4DCQB 4JVWA 2VDMH 1NCAL 2Q86A 1KN2L 3APCA 3HC3L 4RSYA 4A7TA 1CG9A 3CK0H 2OYMA 1QFWH 4J6IA 5DDHA 3V0WL 1FF5A 3ZT7A 4OLWL 4NLHA 4ODUA 3PWNA 1R5WB 4ANUA 1YG9A 3BIKB 3PV6B 3Q5OA 5I1GH 2O5NA 5A7BA 3ULSB 1QVOB 4R2GB 4OZIB 4WI9A 4EZJA 4MXWL 2EDFA 3JWNE 2JKIS 3VG9B 3ZMEA 5A7EA 4KKCD 1EBAA 4X98A 5L2JB 2ZOOA 4LDEB 3A4EA 4KVCH 4PJ8D 4IEFA 5D1XA 3CFBA 1U3JA 1P5VA 2NY0D 3NIFB 5FDWB 1NL0H 5D4JA 4QXGH 2ZG3A 4S1RL 4B9ZA 4ZD3H 1NANI 2A83A 5FOJA 1M7IA 3B9VA 1B0GA 4XNYL 2NYKA 3D39E 4HLZG 4LEEA 1BX2B 1M1XB 5GGTA 4JRYB 2H26A 3UIZA 3CFIC 2Y1VA 1NWPA 2DMBA 5I8EB 4S1SL 1J5OH 2YZ1A 4YHKL 5LN4A 3FAXA 5F9OL 5J1AB 5L6YH 1AO7A 2HJFA 1EGJH 1T6WA 2KDYA 4PFEA 4Y4KA 3UCQA 3BKYH 4A2GA 1FAIL 1SXNA 4QHNA 3WD5L 1HESA 4FTVE 3N0PB 4P9HH 2XQYA 4M29A 2L7QA 3SDYL 3IDYC 3ARGB 4DUWA 1OK8A 2J44A 3QUXC 2Y6SC 2ZWYA 3RVXC 1Q72H 4A6YL 5KS9F 5EU5A 1ZVYA 4ZUVA 4TLTA 1S7VB 3ZTDC 1UT9A 3SDAC 5JXAH 1FGVL 3HN3A 3F7KA 3MLTB 1SVZA 2W80C 3OAZH 3VFWB 3W39A 3B2MA 2ZKXA 4NO5B 4AKPA 3BEWA 4OFDA 1IBHA 4OSUH 3VWJA 1H6TA 3U30C 1A7OH 4WO4A 4QO1A 1ZA3B 2CDEB 2P1YA 3FUDA 3FN9A 4LNRA 3HS8A 1XF5A 2FIKB 1NFDA 3HPJA 4PJXB 3MBED 4UT9H 4NO3A 3HG3A 2VM3A 3EFOB 2D3NA 4LCUB 2H3KA 1RH8A 4H20H 2Y1AA 1AQKL 3K5RA 3QHZL 5DC0A 3RGVA 3WHXB 5KVDH 1IE5A 3HFML 3IF1B 1BZQK 3ASNB 3EKCA 1WDAA 2FT8A 4FQLH 4XCEB 3BUPA 3KGTA 3MI6A 2R56H 5GZOA 3WTSA 1Q0XL 3IPBA 2YEZB 4R8WH 3GI8L 4MKTA 5E1HB 3ILPB 1EBPA 3Q7JA 1IBFA 3V9EA 1NBZB 3T09A 1RZ7H 4FI6A 1L0PA 1IGJB 4TUUA 2NNAA 4QRFA 1KC5H 4LLWA 2OZNA 3WEOA 3ZUCA 5IVXF 1BG9A 3TBWA 2EZ0D 3TVMA 5L4JA 1YQ2A 1NLBL 1H8OA 4EVNB 2EDXA 4DZ8A 4QKXB 3ZOAA 3K0WA 1RSFA 3WDJA 4K2UL 2OSXA 4WEEA 5C0BE 5E8OB 3MJGX 2OJ1A 5GSRA 4C4KT 2ZE0A 3OKDB 1BWMA 5CGTA 4HXBL 2P45B 4Q74A 3A22A 1AGBB 2FSDA 1N3NA 4K8RD 5AAPA 5DHEA 2AEWA 4PJDF 1YUKB 2C1OB 1WWBX 5F9WB 1JF1B 4BH7A 3JT2A 3ZQXA 3B5GA 1IL1B 4FA7B 1KLUA 3KPNB 2VIRA 4QCIA 1YEKL 1F97A 3ETTA 1U8IA 4J8QA 5C0FA 4HKXB 3RUGF 1GGIH 2WXFA 1I82A 1GZHC 1YEJL 2MNUA 1UXSB 3O11B 2ZCZA 3QO0A 4NIYE 2NY0B 3KYKL 4FERA 2GK0B 4J7RA 3U1QA 3GI9L 3D69B 1UASA 4JFFB 1GIGL 3MRIA 1JMXA 2E6JA 3RZWA 5GRUH 4WWKD 4BIKA 1T1XB 1AQHA 3NCYP 4PJFF 1E2VA 1YEDB 2C4XA 2WTRB 3EJRA 3GBDA 1QA9A 1AZBA 3S4SG 3UC2A 5DMGD 3VXSB 3SOBL 1MFUA 4NHCH 4GW4B 2VO5A 2WXGA 5LDSA 1FYTA 5FUOL 1NMBH 1Z66A 4X4KA 4IM8A 5HHVH 2BSSB 1RK0A 1FLTX 4H0GA 1M71B 3AROA 2O5XL 3FHEA 1URIA 4PB9H 4YSCA 4QYAA 4KJWC 4OUUA 4LSQH 5FB8B 4GP8B 2ZKWA 1GYUA 4G8GD 1IAIM 2N0KA 1WFOA 5DRWA 1MCNA 5FGBA 4NZTL 4XI5C 5KJRL 4POZC 2A73A 1HC1A 1KYFA 2Q2EB 4YSRA 1NLDH 2JCWA 2VDNL 3DO7B 4HCFA 4U3SA 5ACLA 3D85B 1JYXA 1DJYA 4A6YA 4OZIE 5INDA 1IGMH 2ICEA 3BP7B 5EO1B 5LCVH 1QI4A 4GEIA 3SKNA 1MLCA 1UGNA 2NTFA 4CNIB 5EF1A 3QDHA 4WKZA 2ZQKA 1RURL 4C4KO 4JPWH 1A7BA 3UJTH 3MN8A 4NZDA 5CINH 4HOWA 1MFAL 5KG9B 3BHBA 3VFOA 3ZPDA 1WFTA 4N0RA 1P7BA 4MMZB 3VFMB 2UY7B 3DC0A 4OI8A 4PCTA 4RZCA 3GGWA 2XKNA 3GM0A 1J0ZA 3VX1A 3ZL2A 1JNLL 1FL3A 2IWKA 4JRYE 4D2NA 4W9JC 3EUUA 3ULUL 4I3RH 3SPVB 4BBWA 4FLRA 2CO6A 3NJFA 1FWXA 4GW1B 4GMSH 3PREA 4W9DC 4K7PH 3S37H 3O2WL 5J6GA 1N59A 4Z76B 1ZTMA 5HGAA 4PBWD 1IBYA 2JKXA 3C6LA 2GBVA 3TO4C 1Q8MA 1YNKL 3T0DA 1O5PA 3CZSA 3EYSH 2Y72A 3VWJC 1PU0A 5B39A 1E9OA 1VENA 5F96H 5TH2A 4HCGA 3L81A 4GW5B 4L48A 4PB0L 4I18A 4JPSA 1B90A 2VWEE 3MGAA 3VD2A 2BS71 2JB5L 3DSNB 1WFMA 2UWEF 5TFSH 2YA2A 1LNUB 3WI9A 3WIIL 1JPTH 2O61B 2EDNA 1F3DH 4DVBA 1M6UA 3OM3B 4OM0L 5DVLA 1R9FA 1YJDC 3Q8BA 1U8JB 4PJXE 1X5XA 1WTLA 3MFFB 2O5ZL 5B1AB 5CEXA 5LGHL 1JHTB 2IAAC 4JMXA 4TMPA 3SZKC 5FAAA 4YFEA 4BZ1A 2UZYA 4WU5A 1IM9D 1XEUA 3TTSA 4HOXA 2Q2LA 3C60A 1OY3B 4P2OD 2FIRT 3LXAA 1FE8H 2E9WA 5D2NB 3H53A 5D6CA 2OSLA 2GBAA 2XIDA 1R46A 4W1TA 4XNUL 5I1AB 3NABH 4J4PA 4ZSOB 4AQEB 3BSZL 4LZKA 4M62H 1BMWA 3DRTB 2QTEA 4Z9KB 1YNTF 2Z91A 4N0FA 4NQDB 4K15A 4NPKA 5AYTA 3F6LA 4KKPA 2HAZA 1HEHC 3H3PL 2CO7A 3C09C 2VDKB 2SEBA 1GW6A 4OUOA 2AITA 2DYPD 4XZ4A 4IKNA 3SO3C 2NUPA 1T03H 1IE4A 1WH0A 2H3NA 3PL6D 5GZOD 3U1SL 5IHUL 1NCUA 4ZO6A 5BRPA 1N4XH 5HHXL 5E4AA 3GMPB 4PTUA 4ZUWA 3O8XA 2VR8A 4XWOC 1EAPA 1KTLB 1A6PA 4OZFB 1UKQA 4NQQA 4P5TD 2B15A 4A7VA 3VSQA 2R9HD 1SQ2N 1I3RB 3EJTA 2BWIA 3STLB 4W9HC 3PP3H 4EDWH 5AG8A 3QXTA 3TH2T 3WAJA 3UBXA 3Q8CA 2QSQA 4HOZA 2GJRA 2VDOH 4GSXA 1G43A 4L5FL 2N1TE 2EIZB 3LKQA 5G5DB 1BP3B 5TQ0H 4WJKB 1QSEB 2P43B 2NTSP 4Y8DC 1E9QA 1OLZA 2W65A 2BK8A 2O26U 2OYKA 3V4PL 1OEZW 5LQBL 1B4JH 3EH4B 4L8DA 1L4IA 3MBWA 1QBML 3NGBC 4L29A 4M43H 4P5MB 5FHBH 3STBA 4JFFE 2V9QA 3KYAA 2JKRM 4NCC2 5SWSA 3DV4B 3SY0A 3DROB 5CJXC 2YHGA 3T3PB 3L1EA 2C3WA 3D39A 4F8TA 2Z7UA 3IJHA 4FZ8L 4N1HB 5IW1B 4QRSA 3VGBA 3QAZB 4YSQA 4UILL 2WUBH 3VXSE 4A2LA 2I9LB 1U3HB 5GRJH 7TAAA 2ARJQ 4FTVA 3OB8A 3PNWA 3VA6A 1S7RA 1CPUA 3NSCA 5HVGB 2G60L 2IGLA 2QADC 1JJUA 5FGBC 2V2XA 3DJZA 3QA3A 4L2LA 1GYWA 5DD6B 1WCBA 4RISL 4AIEA 1XCTB 2IPTL 3KEDA 4V2BA 5L2KD 2XXFA 5TF0A 1N0XL 5TQ2L 1R5VA 2GW5A 4PGEA 5JLZB 1T20B 4OF8A 3N44F 4HJJH 2BIHA 2G30A 2ZXEB 1SLUA 2CNZA 3P11H 2AK1H 4M00A 4ZAKA 4DVRL 2LLLA 4MJ6A 4IRZH 2EE0A 1J8SA 2YEQA 3LQAL 4MTMA 4Q9BA 4AM0Q 5EC1A 5LNDA 5GJTH 2R1XB 5DHVA 1ZGLA 4UU9B 1PLAA 4WHTB 1H15B 4N20A 5DJDA 1SDYA 3BX7C 3IXTB 4YXKL 4P59L 2G75A 2RMNA 1I1FB 1IM9B 1QYGL 1FLRH 1GKEA 4GSQA 4K9JA 3FO2A 1BECA 4HZLB 2V5YA 3EH5B 2LT9A 1CFVH 3RDTB 3BUTA 3BPOB 1HI6B 4H5SA 4X5QA 4YBLC 5IMLA 2DWYA 3NACH 5IBLC 1X4YA 2BSCA 4N87A 2DZEA 3FB7B 5CS7A 1MRFH 1U58A 1NDMA 2QPEB 3BH4A 1WAAA 3BRGC 4NRXB 3RA7H 5DCCA 2DN7A 1IC7L 2G3NA 4AMWA 3MRCA 2NW2A 2CJTA 1E28B 2WQAA 3DUSA 3VWKA 3QNXA 5CZVH 4J8RA 4S0TD 2DYPB 4TL4A 1CBVH 1K4CB 2Q9OA 1MCLA 3GK8L 5EIQA 1WT5A 1TSRA 4YIQB 3MO1A 3MLSH 2NSMA 4JFDD 3MYJB 1NCCH 3D18B 2EAEA 4LCYB 2I24N 5C2UB 3VXTB 2J5WA 4ENZA 3KCPB 1KDIA 5C0BA 5ERWB 2NW3A 2Y6SD 2ZXCA 4L9LC 2DEXX 3I6SA 1DVZA 3I6GB 2HPTA 4FD0A 2YXMA 5D96B 3PP4L 2OQJB 5I1EL 4N2AA 4F24A 4YHML 5DJYA 3W0WD 2BVOA 5I1KH 3EGSB 4JPIA 3T6QC 5DHDA 3VRLF 3BVWA 4FFYL 4BJLA 2PR9A 3ZZSA 1U8OB 3LS4H 4AL8H 4ZPTA 1CLVA 1LILA 5TDOB 1BZ7A 4P5RA 4YEEA 1WBYA 4GG6F 3KWUA 4M1GH 2BX5A 2Z8WC 3TJPA 2YMTA 2AXHA 3L3IB 2OP4L 5FM4A 3VQLA 1P6FA 4PV1C 4AQ8C 5KAQG 1XB6A 3O3EB 4X7SH 2WZ0A 4XMTA 4LSSH 2VXVL 1F11A 2XQYK 3J2PA 1W15A 3TT3H 35C8L 4X6BB 2YXWA 4ZSOE 4YX2H 5ACZB 1FV1B 2N01B 3K2IA 3E3QC 1CGUA 3E8VA 4NQDE 2AJZA 3KGUA 2O30A 4GXVL 4WV1B 1SFDA 5CO1A 4IKLA 1CLOH 4DKEL 4HETA 2DOCA 4F1ZA 1SXSA 1MAJA 1OQXA 5L2KB 2XN2A 4C83A 1Z5YD 4A68A 1J8RA 2Y25A 3O9WC 1X5MA 4XHJD 4DCQA 3HN5A 4LP8A 4ILDA 2QKIC 1VADB 3JWNC 1IGYB 3GLAA 4XN9A 4UT6H 3KLSA 3CLEH 4HD9A 5ALBH 1LO3L 3HMWL 4K3EH 1R5WA 1YA5A 3BIKA 3PV6A 4IGBB 5CSGA 3O6ML 2R29A 3RVUC 1BXAA 1ZSHA 3ULSA 1QVOA 4OZIA 5TPWL 2XWCA 4UIMB 2JKLA 3HZVB 4PD4J 5L2JA 1QSEE 4F7TB 1HAUA 3T4AC 4PH8A 3IGFA 3MREB 4ZXBB 3VXRB 5FDWA 5IGXL 3Q3GB 3M1BA 4RX4D 2D7MA 2X89D 2XPGB 2PCFB 2OI9C 3DDFA 3V95A 3ZTNH 1ET5A 4F33B 1BX2A 1M1XA 4N1EA 1XZ0B 3OSKA 4JRYA 4ANKA 1JHKH 1VPOH 5DD3H 5DK2B 3MLVH 5I8EA 3UMNA 4U7MA 4JG1L 4MS8D 5J1AA 5IQNA 2P7TB 3ULUC 1WHOA 2YARA 3HMXH 1B0WA 5ID1B 3NMEA 4YWGH 1SMAA 1MIEH 3ARGA 1G9EA 4K71B 3EO1B 4DH2A 3JYCA 4LT7A 4NZRH 4RCAA 3SYQA 1IBZA 1ADQL 4RMRA 1O9VA 1F8TL 1S7VA 1XWVA 1IAIL 3MLTA 5D7KE 1HYSD 5TE4H 2R59A 3S37X 4NO5A 1T1YA 1AMXA 1OAYL 4RMQA 4PS8A 1HQ4B 1J1OH 4DJMA 1ZA3A 2CDEA 5D72L 1AZRA 3GSVB 1WEJL 4YDMA 4HIXL 2FIKA 1E5AA 4N1CA 4PJXA 5EWIL 2C1PA 2TAAA 5ADOL 4IYKA 1NSNL 3KGSA 4LCUA 2AK4D 3S3SA 5F6HI 4HXAH 1H9DA 2Y0SA 2D03L 4KI5E 5D5MB 1A3LH 3WHXA 4NC1E 3IF1A 1HL9A 2OTUB 4YFLF 4ZOEA 3T0AA 2AQQA 5J1TC 1CFSB 4X9GA 4XNZC 2VUOA 1J1PH 2ZUWA 5I74B 2YEZA 2IH1B 3H2WA 1RJLA 4UTCA 1KJ3L 4DEUA 4YXHH 5C0GB 3IDXL 1NBZA 4M6OL 3GPSA 2K6YA 3D9AH 4Q6YA 2D2CC 1IGJA 3C08H 4Q4IA 4AZ8B 2LHAA 3T04D 3V4VL 2K78A 1E7VA 2W1NA 4Q9QH 5F9DC 3N1GC 3IVKB 2O6FA 4EVNA 1E4XH 1UA3A 1LEKB 4OAWB 5GGVY 2NDFA 1B6UA 4ADIA 1MIMH 2XCMC 5C09A 4HC1H 4AE1A 2XPZA 4OH2A 5E8OA 3FFCD 5J7CC 1RMFL 3OKDA 4YSSA 5I0VA 5F93C 1MPAL 2WZPA 1TJXA 1AGBA 5D7LB 4PPTA 3LEXA 4HALA 4DK5A 4FQ2L 2C1OA 1AFVH 4GFTB 3FMGL 4JM2F 4HV8B 1JF1A 5B3JE 3NAAH 2AQNA 4PRID 4PVNA 1IL1A 4X7FC 3KPNA 3P4NB 4UV7H 4LLQB 3CVBA 4DN4L 1V5JA 4HKXA 4JZJB 3AB0C 3ZRFC 4L1LA 2DL9A 3REWB 3RVWC 2XOTA 5TGBB 1UXSA 3O11A 2FCBA 3AABA 5DD5H 1X4XA 4HFUL 2WXLA 2ZNXA 2VXTH 2GK0A 1C5BH 3KAAA 2ADJB 1G84A 1NOAA 3D69A 3MGTB 4JFFA 3WS6A 5AB0A 3AQXA 2APTA 1CXEA 2E59A 3BP6B 3V9CA 1P84K 4QRQA 1T1XA 4PJEB 1YEDA 1M42A 2WTRA 3EIFA 3HBZA 5D7EA 4XPHH 1N6QL 1I4FB 2HFGL 4OCXL 4M1CC 3ELQA 4I8DA 5T1DH 1TXKA 3LRLA 3VXSA 5LDUA 3O3UN 4YAQB 3FH5A 3Q1SH 5EU4A 4GW4A 1T0PB 2H41A 4PWFA 5LBGA 4YLCA 5DD0H 3HC2A 1I9IL 3MRNB 3EAKA 2BSSA 4CMHC 1M71A 4FXKC 3SKMB 1EVTC 4ELKB 3NRPA 2E27H 1AXIB 1SGKA 5FB8A 4R2GC 2MSPA 5JW4R 4WEMB 1YZZA 1KFAL 1Z9SB 3VG9C 1XXDC 3LAFA 2BERA 1MREH 1G0YR 1HHIB 3EOAB 3IB4A 1T5XB 1WA2X 3DO7A 3T0VA 4LEBA 4QTHB 4XWOD 3W81A 4KZEH 1AKJD 3D85A 1OGPA 1W80A 2MHAA 3IE9A 5EOQL 4AC4A 3SE3C 1HJBC 2NZ1A 5L8KB 1UTDA 1JOIA 2YMXH 3FF7A 3LQAC 3V6BR 2J1YA 2VH5L 4XN4A 3BP7A 5EO1A 2AK4B 2WCSA 2ZXBA 5E2VL 2MPAH 4M6ML 2J55A 1FVEA 3R8QA 4HZAA 2AC0A 3P3RA 3UADA 3VXRE 5KG9A 2AMUA 3G9AB 5IB2B 1TNNA 3VFMA 1J5CA 2UY7A 3RFZB 2QSTA 5CR1A 3PCYA 3LRSB 1Q9KB 3K8LA 5FGCB 4UB0H 1GOFA 1UD6A 1UB6B 2F5AL 3HKZA 3MLYH 3FU3A 3KVPA 1M57B 2CHXA 5T33H 4G7RB 1T7XA 4GW1A 1G1YA 5FR3A 4QYOB 4DAGL 1A6UL 2QPDB 3RJDA 1NFDF 4Z76A 2OMUB 2VWEC 2VLLA 1D2OA 1PPIA 3VD7A 1BQKA 3OMNB 1E6JL 4BM7A 4M03A 3VA2C 3CZEA 5J3HC 2DKMA 5T1KB 1NA8A 4OCWL 1OK0A 1RK1B 3U6RB 2YGNA 1KEMH 2A9NL 2WXQA 2A4EA 4GW5A 5K9JL 3HB3C 1A0QH 1X5ZA 4OGXH 1JZ2A 3DSNA 4TQPA 3P0YH 1LNUA 4LDLB 3WEXB 2CLZB 2O61A 1WWCA 3JTSB 1TETL 1RPKA 3DSFH 3SYOA 5EUKB 2YSSB 3Q2LA 4GQ9L 2GUOB 2Z8SA 1U8JA 5IJVA 4TUJB 4U1LB 2Y69B 3MFFA 1CDJA 2D7QA 4BKTC 2YWYA 4NM8L 2R1WA 1JHTA 3LN9A 3RDJA 3FCTB 4XP9L 1ZJBA 3EO9L 2A9MH 5IT2H 3BPNB 2Y2TA 3QWNA 1J11A 5D5ME 1MH5B 2Y5EA 3LTVA 2Y7SA 2DMGA 1DQTA 2Z7YA 5D2NA 2XRAL 1YLBB 2J56A 2Y5QA 4HUNB 5LLIC 3ZQWA 2ATPB 1SUJA 5I1AA 1ZDQA 4ZSOA 4AQEA 2QQNH 3V6OE 2DDQH 3DRTA 1MJ8L 1BEXA 4F15C 2JK5B 2DJMA 4RSVA 2FLRT 4N0CC 4NQDA 3RBSA 4XH2B 3TCXA 1PZUB 1DJZA 3BQVA 2EEAA 3N9GH 2RA1A 4PP1C 1SJEB 3B8SA 4FF9A 4XB7A 4E9YA 2B1AL 3E7JA 2YPLD 2BNQB 3K72B 5DYOB 4JGNA 3HG4A 2Y23A 1WFIA 2HSIA 4C56D 5CWSB 1ZTXL 1ZS2A 2B0SL 1OF2B 3VFUB 1TJIH 3GMPA 4BFJA 5D7LE 3DLQR 3ABGA 5JORB 2V5RA 1LO4L 1MCWW 1PLGH 1KTLA 4XN7A 4OZFA 5E2VH 4BD4A 2J72A 3NJNA 1I3RA 3STLA 4EIBA 3MCG1 4NGHH 5KOMC 2GSIB 3VDBA 4GSDH 4DTGL 4NBXB 2VXQA 3X17A 4FL4C 1W0VB 4FI8A 4XVTH 5JYMA 1QHPA 4G1EB 4S10A 2EIZA 3BGFB 4GAJL 2HVJB 5G5DA 4B7LA 3ULVH 4PLKD 1QSEA 4ODSH 2EH7L 2YLHA 3PWJB 4YHOL 3KPLB 2Q7YB 4YHZH 3SEPA 4HWEL 2XVBA 2R23B 4P5MA 4QTIH 5KJ7E 2H32B 4MJJA 5MEOB 3DV4A 4OBSA 3DROA 2A38A 5KBPA 1RKRA 1J9QA 2WY3B 1XCXA 5CEZD 2VDQB 1T89A 3K1DA 2PPAA 2BHFA 2WBJB 4PJEE 5IW1A 3V10A 3PF2A 3EHBD 2FBJL 4X9YA 2DTML 2MNJB 5E7BA 2IPUG 2I9LA 2DRUA 2R69L 1U3HA 1SUHA 1ASOA 2XZCL 1QSFB 3B6SB 5DD6A 2WWKT 3PLYA 1XCTA 1N68A 2GBUA 1BOGB 3JV6B 3QEQB 2C4FU 1KOAA 4OIIL 5JLZA 1T20A 5DWPA 2OMXB 1II4E 5LGKA 1EEQA 1FDLH 3O9WD 4TF4A 1G6RH 5FW6A 3ENEA 5GS1C 2VUKA 1TLMA 3LDBB 5DEJA 4HLJA 5HI4D 3CHRA 4LSVL 4KJQD 4MMZC 3SBQA 2CJUL 2VXSH 2R1XA 1TZGH 3BO8B 2Y07L 3LIZH 4WHTA 1H15A 2AK4E 5AZUA 5GRYA 5B1CA 2QFRA 4DO6A 4WUUD 3WEMA 1OF0A 3INOA 1UWEL 1IM9A 2VDML 3VYPA 4I1PA 2FATL 5EEUA 3NJGA 3RDTA 4UI2A 1HI6A 1QFWL 4P9MH 5JZ7C 2V9RA 1E6OH 3DWTA 2GABA 5E0QA 5IR1A 4ODVH 5FGCE 2Y5TB 3FB7A 5I1GL 4IKKA 4YZFF 2ERJC 4FXLA 4LXFA 2WNGA 1CBJA 2WLHA 2NY4D 5IOKA 4D9LL 1E28A 3Q0HA 4Y5VB 3C2SA 4KVCL 2DYPA 5CN3A 1K4CA 5IQ7H 3SD5A 4YIQA 4HQQH 2WZAA 1HILB 3P9WB 3MYJA 3D18A 3PL6A 1XAUA 1QG3A 4QXGL 4FMFA 4MAYD 4ZD3L 4LCYA 1THAA 3NPZB 3VXTA 2EDOA 5ERWA 5DS1A 3S8FB 1BW8A 3I6GA 1J5OL 1RY7B 3CH8A 5L6YL 2OQJA 1EGJL 1CVRA 4RRPG 5E5UB 5BUPA 4P9HL 1TTRA 3EGSA 5ISZD 2VQTA 4RWHA 3FT3B 3ZDZB 2DLHA 1U8OA 1Q72L 4TLUA 3BT2L 5TDOA 1BEYH 2Q8AH 4BFRA 2QZQA 4POYA 4AGOA 4D0DB 5JXAL 3QJUB 2F5BH 1VACB 4RETB 3L3IA 4P4KC 4Z1PA 4KFMA 1TQUA 1T0NA 4OIBA 3O3EA 3TC9A 1HH9B 2HKFH 1A7OL 2FJSA 5SV3A 3MLXH 1UD5A 1YN7B 3WGUB 4AGNA 5ACZA 3DDGA 3N55A 1FV1A 5AVQB 4WEUD 4UT9L 4ZODA 2H6OA 3EYVB 4WV1A 2D7NA 4I3GA 4L3CB 4H20L 4RDQG 4W9EC 1KCBA 2BSEA 5KVDL 2BNQE 3BDBA 1OD7A 5CKAA 1NICA 1BSIA 3L7EB 2E76C 5L2KA 1DJWA 4YLBA 5GGUA 4QXUH 1J87A 5JR1H 4R8WL 1DO6A 4W93A 1HAWA 1PD1A 2QL1A 4KX8A 1C7SA 5I30L 3ZTEA 1PNDA 1VADA 1KTKE 1IGYA 2XTJD 1RZ7L 3KM2A 4QJ5B 4I0PD 3QUHA 3WTVA 4NBYB 1G0DA 1KC5L 4JCLA 2J4WH 4MD0B 4IGBA 2BSDA 2BDNH 2Z3FA 1RZKH 4UIMA 4HGWB 2V5SA 4WUUB 3HZVA 4PIRF 4F7TA 3F7YB 1GZPB 3GMOB 3WY3A 4J3OF 2DJ4A 1ILUA 4ZXBA 3VXRA 3Q3GA 1U3HC 2FQFA 5ESQB 3TEUA 1RUMH 4QWWC 5SWZB 2R0KH 1MCOL 2C7FA 2V5MA 4M3JA 4F33A 4B53A 1XZ0A 1CZ8H 1KB3A 1DANU 1GGIL 4FQ1H 5DK2A 5CJQL 1Q38A 2P7TA 4H0HB 4IOFD 3U4BH 5E99H 4M02A 5ID1A 3WYRA 4KKZA 5LJYH 3AU1B 2K6ZA 2GTQA 1QSFE 2R39A 3EO1A 1EXHA 1YDPB 4ZQKB 5I73C 1TYJA 1QRKA 3HPLB 3KGRA 3QEQE 5GRUL 3TV3H 2IH3A 1QFHA 2VN6A 4F9PC 4KNSA 1ZWIB 2Z64C 2XUWA 2OM5A 3GC3A 1WAAF 1NBVH 1HQ4A 1IEAB 4HKBB 4NHCL 4KI5C 2PYEE 1IV8A 3NVQA 3RDTC 2W38A 5C3LD 2G4EA 4MXQC 3KJ6H 4OLEA 4AGMA 5HHVL 1F4AA 4Z7IA 3GSVA 1UH2A 2PPFA 1XGZA 4V33A 2ZOTA 3NA9H 4PB9L 5C3IA 4LSQL 5E03A 1OPGH 1OSPH 5D5MA 5H4YA 2V7NB 1TU2B 2OTUA 3M17B 1YECH 1CFSA 1RP9A 5C0IB 2UUDK 4Z0XB 4PJCB 2WW8A 1NLDL 4P2RB 2IH1A 3BLBA 3AT8A 4H26B 6FABH 1LP9B 3DX9B 1MHCB 4OIAA 3LN4B 5B7FA 1FCCA 4JQVA 1SYSB 4ZTOH 3V6OA 1L0YA 3ML8A 4K7FB 1IGML 5KSBB 5LCVL 3CFCH 3QRGH 4U1KB 2MQCA 4YBQD 2WO3B 4AZ8A 4LDCA 3U6XA 3IVKA 4JPWL 2NNCA 3QZMA 4H8VA 5CINL 3UJTL 3FQUB 5I16B 2Q3XA 4OAWA 2NMSA 1LEKA 4HIHB 3GZPA 1H8LA 1X9LA 1X6NA 3QQ9C 4N8VB 3FHQA 2N59A 3QORB 2AEPH 3F84A 1V3LA 1HCYA 2D7PA 5C0JB 3LEVH 1E2ZA 3A67L 1KYOJ 4I3RL 4OJFH 4I0PB 5D7LA 1CDBA 1R33A 4GMSL 4LU5L 2VXUL 4CADB 1UA6H