4OJDH

Crystal structure of a c-terminally truncated trimeric ectodomain of the c. elegans fusion protein eff-1 g260a/d321e/d322e mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
477
structure length
444
Chain Sequence
RAEPPHCSKTPIVRAQTSQNAMGMQMQFSIGLHTAVCFRLYSLLHTIRLEKLEHHHPITQRYTFGIPEVHASCICECDATSSTCTAESHQFTACPEDETSSCYRTFFPNQTPIGCSEDDIPKLCCDVRFKPYKNMTFLAVKLEQPTTYATFVYAAYDFVNGYWVEKDKTKIRSQLDGGTQDRHLDQKRRISLAVTAGARASHQLETGMYFSRTSNGGETEELRMQPLNEITDNNFDRLGWYRMDDSGHFHVNNGVVKMEEIHKAKVKNCKEQTYKSILSANHYMPGHFNLTRPLEVIKPWIQSARIFDSSLRQAVVTHAEGTNLQISIHLESQNLVFFHNASRIRDFSGSIIVDSKSNRLFNLTVYEASGKIDGSVKMSTGFGSDTIHTFTAYVSDLHASNRSMIIPLPAIVGQGARAICLRADSMADIDKICHVIEYFESPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of eukaryotic cell-cell fusion
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Membrane protein
molecule keywords EFF-1A
total genus 98
structure length 444
sequence length 477
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ojdH03
2.60.98.60 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein; domain 1 4ojdH01
4OJCA 4OJDH 4OJEH
chains in the Genus database with same CATH superfamily
5E8DL 2AJ3B 3BKYL 1HXMA 1Q0XH 4PJGB 4PJDE 3K71B 2HPTA 4JN2B 4L8BB 2DWEB 3ULSB 5BUPA 4I3SL 5AW8B 3O4LE 3ZE2F 5CZXC 1JWUA 4U1NB 2JCCA 1CF8H 2ZUUA 2IGFL 3ZN6A 1UB6B 3OWRA 2EVIA 3TF7C 5INCA 3BFQG 4R90H 4U6TA 4JY5H 5C6TL 1S7RB 1P2CB 4M6OH 5AYTA 4S10A 3GXDA 3ATBA 1PZDA 1RK0A 3GSUA 5HY9A 5KBDA 2V33A 4OF8A 5GQBA 3BX7C 3WIHL 5DJDB 5JOEA 4QHNB 5IKCB 3ESVF 5FYLH 4EN3D 3QR2A 2WXOA 1TFPA 2EXSA 3NZHL 5BRZE 1IGJB 2A9CA 2EUZA 1JERA 4XWGH 1XVSA 4Z8FL 5D1XA 4KGLA 4R0LA 1ZCRA 3P4OB 3FRUA 4AITA 1URIA 3K0YA 3L13A 5F9OL 2NNXA 3NFPB 5A2LH 1L0YA 3VQLA 1DQKA 4PGCB 3IPFA 4ALAH 5TFSH 2IADB 3EDEA 4IBQA 4GEIA 3S34L 1Z9MA 3CD4A 3MNDA 3RFZC 3HC0B 5A3IC 1IGYB 1LXMA 1H6TA 3V52H 3GKWH 3DJSA 4GAJL 4OCXL 3C5XA 1KC5L 2EXWC 5D1ZC 5ADPH 5TDPB 3DO7B 3FU9A 4HEME 4K9EL 1OGTB 3UO8B 1A9EA 3WJMB 2YD0A 4N9GA 4C4KT 4QXGL 3FQ1A 4MYWB 2CO7A 2YGNA 3OJDA 5HVGB 3S3SA 1KWGA 3BH8B 3V4VA 2VN4A 1GJUA 3F04A 1WFUA 2DQDH 1T6BX 2RMNA 4R26H 2H45A 5HDQL 4C57C 5KAQG 2CO4A 1BZ8A 2EDKA 3L3HB 1LO2H 4MQXD 1ETZA 1LO4L 5IMKA 3VYPA 4PRDA 2J25A 1F4YL 2ATPA 2V9QA 4PYGA 2Q7YA 4NJ9H 4X7FC 1A6PA 5CSGA 4IM8A 5EN2B 2Z4TA 4QOKE 1GS6X 4GXVH 4A2MA 4S1QL 4GKLA 4MD4A 3KNBB 3QO0A 3TNNA 3WFCL 1KJMA 2ZNXA 3RX5A 3FFCD 3WTTA 2XQ0A 3FT1A 1BWWA 5DLML 1R33A 2MNUA 2E9JA 3CN2A 3T77B 8FABA 4P5TC 2NMSA 3TV8A 2X2HA 2PP7A 3WTUA 5K1VA 4X6DB 4ISVA 4HHAB 3X1NA 3TTSA 2VXQL 1G84A 3CXDL 3POHA 3L7FA 4I5BA 1S7VB 2WWKT 4TLTA 1U3NA 3DX0A 4EE2A 1A4CA 1SXCA 1T1ZB 2XTJE 4BSWB 1XB8A 4PJBF 4Z7AA 4AJYV 3A4EA 4H8PA 3FKUS 5E0QA 3PIQB 4X42A 3WTVA 5HD8D 1TZAA 3WS6A 4S2SA 5H8DA 3MNMA 4GMSL 1I4FB 2GK0A 3GXNA 4OF5A 5DJZB 3HRZC 3ZQWA 5AENA 2DY2A 4L9LB 1S7UB 1WUZA 5D2NC 4Y5VC 3ZXAC 4MZ2A 5SWZD 4KWUA 2YN5A 1NBZB 4QHPA 4F7MA 3WI9A 1OTTC 3VWJD 2X1QA 4XB3A 5FDWB 5ECGA 3NABL 4D8PA 1XF4A 5HHOE 4FXLA 4W4OA 1PKQE 3O6KL 5KG9A 2V5MA 3D25B 1D9KD 3H7BA 3MV8E 2PTTB 4XP5H 5BJTB 1BMZA 1PLBA 3LJ3A 4OGYH 3BPOC 2EYTA 1OAKL 1G9NC 4JHWH 1KZYA 3W11D 4WHCA 3NJJA 4XGZA 1DBML 2E3VA 2QQQA 3BZFB 4EVNB 3A6OA 1XGQA 3OF6D 1G0XA 4NZFA 4XX5A 2VDPH 3LMJH 1AD0A 4LCWD 2EIMB 4GY4A 4MCMA 4GB9A 3SGKA 3MJ7B 4FQCH 1DVFA 2YWYA 2A6IA 4A6YL 4E9QA 3CXHK 3BO8A 4WSGA 4PJDA 4P2QE 3T0VA 3T65A 4PJ9A 3Q1EA 5DA0B 1MVUB 2P5PA 2EDJA 1UCBL 4POYA 2DW5A 1UEYA 1YEEL 2VMCA 4E41D 3MOBH 1HI6A 4OCYL 1QSEB 3BP5A 3IMVA 1DCEA 3GO1H 3W0WD 1IU1A 1JHTA 4BFKA 4UNVA 1ZTXL 2G75A 5EU6D 1AHWA 4MLSA 3TVMA 4KNTA 4XVOA 2G2NA 3BQUC 3EHBD 4PJBB 2NZ1A 4B53A 4W9DC 4HIJB 4IEFB 3ESUF 3QNXB 2CCVA 4XNYH 1JGEB 1U6AL 2CKNA 2N59A 3B8YA 3MV7D 3MV7A 4IRJC 5ERWB 5IK3A 5B39B 3FTXA 1UUSA 3NIFF 3VI3E 1J5OL 3EZJB 4LVNB 1T89C 3SDYL 4YNYB 3UIYA 3MXWH 3QZOA 4QRSA 1NEUA 4Z0XA 4F8PA 4E0RB 2E4FA 3ARBB 2GKIA 4FN0A 1GAFL 1ZLEA 3PE9A 3IXTB 1HWWA 1AGEA 1GCFA 1UWEL 3BAEL 3IN0A 1L7TH 3Q2VA 2ADGA 3WLWD 3QIUA 3K72A 5DTFB 3GKWL 5FM4A 2ESVB 2BWQA 1E5YA 3QCVL 3IDIA 4PRDB 1RUPL 3RB7A 2LV4A 3PJLA 1EA9C 1X5HA 1UTDA 1ACYL 5IGXL 5D7LA 1WD8A 1D7CA 3MRIB 2APTA 2PCPB 4JE0A 5BV7H 2DMKA 1C5CL 1R34A 1CGVA 3B3BA 3OKKA 4MHHI 2MCG1 1ZA6B 2NY3B 3FT2A 3MJ6A 4P46D 3O3EB 1IAIH 5D93C 4AC4A 4M48L 5ICZA 5AZEL 4MXQC 4JKKA 3BKYH 3O11B 1MW0A 5D7EA 4JFDE 3FUNA 4FFVC 1R4XA 3V4UL 3BKJL 1U8QA 3BGAA 3U46B 1JV2A 4M1DH 4PGDB 3FTZA 2YEQA 5T1DL 3VXSE 1H8NA 1IAIM 3GLDA 3MLVH 4XTRD 5GRYA 4FA8A 1G7LA 1HVXA 5TTRA 5JW5A 1OSPL 3O8XC 3I02A 1GZQA 1HWHB 2JJSA 3VI3B 4AXWA 3X1FA 4AVKA 3SY6A 2J57A 3FZUC 2FH6A 1QEWA 5D1XB 5DMYA 5CGTA 3SE9H 1RQ5A 4PRAB 1GY2A 2UVFA 3TN0B 3VFUB 3X13A 2P8LB 3CZEA 1RZJL 3AZUA 4IKKA 4JHBA 5HHNB 2XLLA 3WIHH 1FNEA 3KGSA 3PXLA 1XHHA 4CSZA 2YD5A 5E4EC 5FGCB 1NZRA 2CRMA 3EBIA 2XDHA 1A4KB 2C3VB 4S1DC 3ZZ1A 2A4ZA 4QIRA 2VDKL 2ZYRA 4YHOL 4MSWB 4NQVA 5AVRB 1PG7X 1VPOL 4ALAL 5FWQA 4P5MA 2F08A 1KB5H 1KJ2H 3QHTC 4XCFL 5E5UB 4ZDHA 3TP4A 5I76A 4IU2B 4OD1L 5J3HD 2NDGA 4F9PC 5HI3D 5C09A 1TIUA 5I19L 4OV5A 1XD1A 4KNSA 1DQVA 3F8UB 3IXAA 2OSLB 2BHYA 3SDXF 4XP5L 4XB8A 1FRGH 4HS8L 1SJXA 5DFTA 1LEGB 3QQ4A 1QEWB 1WRFA 4L37A 4L4TB 3K6OA 4KZ0A 5KSAB 3IAPA 2YEZA 3FU8A 1JHLH 4M43H 1UXWB 1TNNA 1HILB 3DIDA 3G5VB 4MNQB 5G5DB 4DVBA 3EW3B 3T0DA 2V2WA 3IJSB 1TEYA 3LMJL 2FBRA 3MRNA 4AL8H 4L0YA 5D9SA 5DRNB 5MP6L 3MRJB 2O26U 3K1DA 5H2BB 2DF3A 5DF0A 3JTTA 4KOCA 4UQBA 5DVMA 1KB3A 4XO3A 4YSSA 1AJ7H 4F3FB 1JG9A 3O6ML 2V0AA 4CC0A 1JS4A 1P5VA 3PV6B 1UXSB 4NM4H 3PABB 3RDTA 1BV8A 1V3MA 3Q8EA 3STLA 1YEJH 3FCBA 5AVWB 3AWFA 1QBAA 4LHQB 3VRLE 1K8DB 2GCYB 2DQCL 3KS0J 3MJWA 3PDGA 5E8PA 5GISH 1GKEA 1B0WA 4J8RB 4K7PX 1N2RB 1A7OL 2IEPA 3QIWD 4Y2DD 2WHVA 2BNQE 5H94A 4F7TA 4KV5E 1WTLA 4YEFA 1GYUA 5DMGD 1OZTG 1C5BL 1DQQA 2QKIC 3OKOB 4FQIL 2MFNA 1J5CA 1F1GA 1LWRA 4N3TA 5D72H 2E9IA 5E9DB 1AVAA 3COOA 3UO1H 2XN9E 3L4CA 4OLUH 2IQAA 3ZU8A 4B0MB 5JIHA 3IJEA 3QRFM 3N0AA 3SYAA 3ARED 2X0UA 5IB3A 1SJHB 4OAWB 3VFUA 3MNWB 5C08E 2ED7A 3PGDA 4PMFA 5C0DA 3Q8AA 4RZKA 3SIKA 2JKRM 1BXAA 2WLLA 1E4HA 2FGZA 1T4KB 4XCEB 1F6LL 3GFUA 5IB4A 5A1AA 5CHNB 4KNQA 3N1PC 4JCLA 1AD0B 2JJUA 1FAIH 4Y4KB 1LQSR 4NC1C 1J8HD 1E28A 1YECL 5JQ6H 4YDLB 1IBDA 1SOXA 4I2XB 4Z7UF 2ESVE 2VLJB 4OLVH 4MD5A 5EF2A 3OAZK 2J3SA 3ASOB 1I1FB 1WFJA 4L1LA 3VXQB 4NFCA 5MEQB 3F7KA 3FN3A 4G9FD 4HG4J 2G3MA 3O0RH 1SYSB 4NN7C 3REVA 3VXUD 3BWZA 2XZQH 3MLTA 3VFTA 4E9WA 4LCUB 2HN7B 4JKWA 4A6YH 4ABUA 4FRWA 3DVNB 5IFAH 1AOZA 5SV3A 4H8WH 2WIMA 3KD4A 3TYFA 2PW1A 2VXTL 2X40A 1WWAX 1MCOH 5D70H 3SDAC 1SYVB 1IAOB 2P5WD 3HPJB 4ZQKB 3M1OA 4F9LA 5I1IL 1S9VA 5C0IA 4DW2H 4PYHA 3MRNB 4NQCE 5DDHA 2IQ9H 4O2CB 3EBHA 3WNIA 2J43A 3BT2H 1I8KA 3U4BL 1JXDA 2BC4A 1MY7A 4YK4C 5ICXB 5HHME 3J2PA 4U3XA 5IBUG 3QZWB 4IYKA 4N8VB 1ZPUA 2OMXB 4H40A 5EOTB 5T33H 4KK9C 4PGEA 1BQLL 1T7ZA 5B3SB 5DO2C 4G8AC 2D4FA 4HH9A 3BN9D 1S9WB 4JRXD 3F7PC 1IKNA 3VGBA 1EDHA 5MEQA 3MMEA 3QJRB 5D7LE 2N01B 2Z6FA 1YYLH 3WEXB 4EN2A 1OCZB 2CBPA 3MBWA 5I76B 3HAEA 4P0DA 1IGIH 4ZUSA 2DIJA 1RZQA 2BS71 1E27A 4AX3A 3FUKA 5EBLA 1L6PA 4QXUL 4FQQB 4JM2F 3GM8A 1FYTE 3DYOA 1QPPA 4G3YH 5H94B 4F7TB 1KIRA 3L5HA 4TNEA 1UWEH 3L81A 3L9RA 3VRIB 1IV8A 3QIWB 4LSVH 4WNJA 4MA3B 4HIEA 5GGVY 3DBXA 3RVVC 3HHRB 3EJCA 4HMDA 2NOYA 4IU3A 1VGEL 5D5ME 1KXVA 4JLRA 3UACA 5I19H 5I1LA 2WBJA 3WKML 4XBPB 4X5QA 3EDFA 3G6DL 2VDQL 1ODAA 4N2HA 3C5ZA 3RWHB 4A7QA 3VSQA 4PVBA 1TXKA 1EHLH 3Q5OA 2R8SL 1FFQA 4ADJA 3HI5L 4LP4A 5DUML 5IR1A 3TO2B 4ZO6A 5D96C 3TBWA 1RUKH 1ZSHA 3GWJA 1AC6A 5I1DA 3BVUA 1ED3B 3T4YB 1QFUH 3CFDA 1X5GA 5KVMC 3OMNB 3I9AA 4EI5A 3BCFA 2V5SA 5DURD 3CSYA 3ZTJG 3BAKA 4FFZH 1P5UB 1ZHNB 1VFAA 4PS7A 1BF8A 5DVOA 4IRZA 3OLEA 1EJFA 3PDDA 4I0KA 5IBTH 5AVUB 1NIDA 3NSXA 4TNFA 1WA0X 1YJDC 4F2MB 2AXJA 4G8GD 3FSVA 5B4MD 3MRFB 4XH2B 2HCZX 4UCFA 3D1MC 3FYIB 4IU3B 4OLEA 5KOMC 5E2TL 2DWDA 3I75A 3ENEA 2OYPA 2G0KA 1OSPH 1JZFA 2IFFH 1I82A 3RWCA 2E27L 1T3FB 4GNKB 2OL3B 2BSSB 4UQDA 3OB0H 5BPPA 5FB8A 3VRJB 4Y5YC 2Q10A 3QCTL 4G9DB 4RMVA 4FXKC 1JPSL 2ZX7A 3GSVB 1J8RA 3UBXG 3E2HC 4MCZA 1EXGA 1TTCA 4LHUD 4KXCA 5DVNA 2FHCA 1MIEL 4GS7B 4H2AA 1RZ7H 1SXAA 2Q76B 4JRXB 4R9HA 1DUYB 4LP8A 4GXFA 3ARVA 4PJ8D 4GLRI 5SV4A 1NC4A 4RX4D 1NC4D 1YHPA 3DX1A 2ZWLT 4R0LB 3C60A 1JAEA 1ECYA 1FZMA 2Y5QA 1EGJA 3QIUD 5ACZA 5JLZA 3PHAA 4PLKC 4CUCA 1AI1H 3PG2A 3SJVE 4NKIH 5F7KC 5CEXB 5JPMC 2BCKA 3EYVB 4PJ7F 5DUPH 3VI4B 4LEOB 3SKNA 2NY6B 2DMCA 3UPCA 3MGAA 3R06B 4OVVA 1ZGLP 4KKQA 1ZEAL 3T1FB 2WIIB 1YECH 4H26B 3Q7JA 1S78C 4H20L 1F2XK 3WKNA 4NZTH 1U3YA 1S7XB 3GIVA 1IAMA 3F6IA 4YDVB 4G6JL 4APXB 2GBTA 3C5JA 3O41B 4QO1B 4PWHA 4MS6A 2Q87A 1NCOA 5TDNA 4ZFZB 2YWZA 5FUZH 3TJEH 1CQKA 2YGOA 3LKPB 4YR6A 2ZG2A 4IBTA 3LRKA 1B3JA 4P06A 2IC2A 4L3FA 3PY9A 3Q2WA 2SEBB 2AQNA 1JPFB 4ZUUB 5KJ4A 3Q01A 3L4XA 1IM3D 2DJUA 2KLTA 5F7AA 4XMUA 4NJAH 1CT8B 3RTLA 1TZ8A 1MCKA 5TDOA 1N5YH 1NLBL 2C3XA 5GISL 3GK8L 3OWEA 1QNZL 5K9OA 3ZSSA 1OTSC 3HZMA 3GMRA 1NCDL 4NWUL 2ENQA 5IHUH 1M05A 2D7NA 2LTQB 2WLNA 2GTZB 1NGXA 3L3KA 5E9DD 3LD8C 4LDCA 1PX8A 2AHIA 3K6DA 2MJWA 2XN9A 5JHLH 3H7LA 4NO0B 1BF5A 2OZNA 3PDOB 1ZJAA 4TL4A 2RACA 3DBXB 1YEKL 1ZPLA 2QQLH 4OLUL 5AZUA 1RJLB 3SDXB 3V7AE 3D87B 3PHOB 3UJIL 1YYMH 3CFBA 1EDQA 2E75C 2ZXCA 1AHKA 3KEDA 4LASH 3VI4F 4NUMA 15C8H 3SJVA 1XTLA 3SOBL 4WWID 3BUPA 3A22A 4ODHH 4WWKD 1NCUA 5D2NE 4HCFA 1Q94A 4JG1H 1BBDL 1R3JA 3WHE1 2EKJA 5DK2A 3V4VB 3RNKA 3WCYA 2EUXA 2V7HB 2FB4H 5BRQA 3HZMB 1FZKB 3EJZD 4WW2F 3RNQA 3S37X 1NC4B 1N0LA 4NB7A 3O3DA 3WJMA 1J9SA 4AJVA 5AVZB 1QPXA 2MCMA 3VWKA 3EADA 3QDJA 4DZ8B 4EUPH 1E4KC 2NNAB 2XY1A 4JFYB 3ZYZA 1JZGA 4I89A 2AAVA 4NWTL 2JMRA 4EDXB 4CGTA 1PCSA 4WUUE 2WTPA 5G4MA 3OHMB 8PAZA 5I6LA 1KEGH 2WOBA 4XN2A 3NIDF 1HHKB 4PJXB 5F6IC 4G42A 5JIIA 3AXLB 1RFDL 4L4TD 4G8IB 4NIYE 4RRPM 4NN5B 2NT1A 4V1DB 5D70L 1L7IL 1NMAH 2JLLA 4U4IA 3IJ9A 2YAFA 1ZHLA 3U9PH 4QO1A 5CD5C 3NIGF 4N1CA 2GITB 5SWZE 3KBPA 5E2WH 3TNMA 5KW9H 3CQPA 3LNEA 3BAIA 1WPCA 4JFZH 1UXLA 3RWFB 4PWIA 2VDNL 4EKXA 4YHPA 4NQVB 4ODSL 3T6VA 4MJ6A 3VG0L 4JZJB 1B4RA 1T2QL 4ELDA 5GJSH 4JM2B 4U1KA 3V5KB 4U2YA 3GHPA 3QCTH 1G7JB 3JUYA 5D7SL 3MV11 3US1A 4P2RE 4AI7A 4JVUA 4BDVB 3WN6A 1BJMA 2QELA 3GNML 4ATTA 2BZDA 1QOKA 4TYUA 5E9DE 3G3LA 5AVQB 1DBBL 3B9AA 1S3RA 5C0NC 3DK2A 2JWYA 2ED6A 1Q90A 3V0VB 4GMTL 2L7EA 3MHZA 2V8MA 5DEGA 1MCHA 5C08B 3UTQA 1JZ6A 4FG0A 2EIJB 3PWPE 1IZKA 1KYFA 4L9LA 8FABB 1JMXA 4JY4B 4K3EL 3UTOA 2VM4A 5DZOA 3WEMA 4WWKC 1J8HA 2CM5A 2MHAB 1JN6A 1ZIAA 2A1WH 2QR0A 4KGJA 4OTXL 2FZ3B 4LESA 1ZEAH 1UATA 1P6FA 3TEXA 3U9UA 1CFTB 5SX4H 2X05A 1YEIH 1T0MA 2X9XA 4AIXA 2FEEI 1T1ZA 4BM7A 4TTGA 1T6WA 4KRPD 3L3IA 3ETBJ 1TQWA 3B2XA 4J8RA 3ZZSA 1ZVYA 2X4SB 2AVFA 4UQ2B 4K8RH 3MRIA 4MCYA 1SFDA 4WKZB 3UXFA 1KY7A 5BO1L 3IBOA 5CEYA 5CM1A 5C07A 2W9DH 3T77A 1C1EL 1F90H 1NCAL 3D85D 1D7FA 4FFZL 5C0CD 5K5YA 3LTVA 1H3UA 1T5WA 4P23D 1BQRA 4JQVA 2RBLA 3GSWB 5E9AA 4AGQA 3EGXA 1DVXA 1BEYH 3L4YA 1CYWA 1H3PH 5EU7E 5F21B 2EICA 2BSDA 3SQBA 2H1PL 1BM3H 2MHAA 4X5PA 5BZDB 3IJYA 2IFFL 5IEHA 5DA4A 4GAGL 2YAHA 2LU4A 4V2BA 3RFRA 3O4OB 4L3ED 3HZVA 5D7IF 1W6WA 3HNVH 4M5TA 3D3VE 5HDBE 1KUMA 2Z91B 3SZ6A 2EO7A 4GXUM 3DX6A 4WUKL 4IJ3C 4EN3C 2FX9H 2XX1A 1IC5L 3NESA 4IRSC 5DHYB 3MV7B 1OCRB 3P2DA 1QAWA 4TPRL 1LJMA 2ZONA 1T89A 1LK2A 1M7IB 1YEKH 3NH7H 1PNDA 2BNRE 5IV2B 4JK0D 4G7VH 4CU8A 3K2MC 2D2OA 3EYOA 3F84A 1GGUA 4U1KB 2LQRA 4NKMB 1Q0YH 2OR9H 3X1EA 2PWHA 1IAKA 15C8L 3SOBH 1E6OL 4OLWH 4ZMLA 3FUHA 2WKOF 4FLOA 4D0DA 3CCHB 1P4IH 3X12A 3P9LA 1OSEA 4HUNB 1C7SA 1U41A 4GI8A 4WEBL 1BLIA 3CFCH 1A3LH 2VLJE 1FVDB 4M8RA 3V0WL 2VDMB 4IKIA 5I8CA 2CLRB 4YUEH 1JK8A 5D2LA 1F1AA 5AAMC 3TT1L 4AGMA 4V11A 4Z78B 3AREB 3R4RA 2ATKA 4JFFA 5EU7C 1XZ0A 3JWDH 3EOTL 2NY5C 2VDQB 3B7TA 1JGLH 3ARSA 3NCFB 2JKSA 3O3AA 4J4PC 5GGTA 4J6RH 4H5SB 3O81A 4Y1TA 3KH3A 4X6CB 2NY1C 1ZS8A 4MNQA 4IMLB 1PEZA 4KO7A 4JO8A 4MAUH 4MMYA 3V0FA 35C8H 1JVLA 5E00B 4I3GA 1FCCA 5E1AB 2B20A 1OF0A 1UOLA 4K7FB 4DGIL 5GS0C 3ULVF 3JYCA 3FBQA 3MLTB 4HGWB 4Y2DB 2YJLA 3N3EA 1YNKH 2O6DA 1J87A 1CF8L 1MDTA 3CC5A 4PJGF 4FNPA 2WXLA 2VJXA 4FS0A 3RDTD 3MV8A 2MTAA 3MUUA 3VWKC 3BMWA 3GK8H 5T5FH 1ZLUK 1NPUA 2I07A 3QUKA 1JI1A 4AY0A 1NCNA 4I13B 2YAPA 1CS6A 5ICXA 2OK0H 4C56A 2QHLA 3P0VL 1WZMA 4OFIA 1OM3L 2ODHA 5CU5A 4G7SB 1CFMA 2GBUA 4WIQA 1HU8A 4PBWD 3BVWA 2CA3A 4NPJA 2AJXH 1IBBA 1XF2B 3ABZA 2NZ9C 3AM8C 1UXWA 4KHXL 2YQ3A 3QFGA 4R3SB 3F00A 1X5LA 2BVQA 2XZAH 4YPGA 4C83A 1SQ2N 2CDGA 2K0RA 1M71A 3UABA 2WYTA 3HUJE 3VFOA 2WP3O 3RVVD 4LCCB 1NGWA 4D0CB 4K94C 3HE6D 1TJXA 2J2ZB 4ORGB 4BK4A 3G5YA 4L8SC 2ZOLA 1N5AA 3E9UA 1TG8A 3CVBA 4IDJH 4ZFOB 5ALCH 1NMCB 4N5UA 1RP9A 4CILA 3RX7A 3T9WA 4F7CA 3VFGH 3U7YH 1N64H 5DJCB 3ES6A 1TETL 5E03A 2VKWA 2XTLA 3QPQC 4NWTH 4Z7IA 4BYHA 4EBQL 1O5DT 3GBNL 1MDAA 2NY0B 3FFDA 1BBJA 1XX9C 2GCYA 3LNHA 1RV6X 3LSOA 4LPYA 2ITFA 2QQNH 2IH9A 2FX8L 2F54A 2CDGB 5FDYA 4YL9A 3S36H 4HV8B 2BVQB 2VABB 2ICWB 5IEHB 3UZEA 1F90L 1NCAH 2YBRA 4TMPA 3WIFB 1FFNA 1NC2D 4XE5B 1L7IH 1NMBL 1GCYA 4PS3A 1UJ3C 3ZTDC 3MLYH 4U1LA 5D7JC 4LOUD 2CRIA 2FAUA 3ULUD 2Q2LA 3CFJB 1ID2A 1BG9A 1NH6A 1GGIL 3ARPA 3DX3A 3K6NA 1UWXH 1FZMB 4NCC1 2DWYA 4G8EA 1R46A 4K4KA 4XMTA 2LABA 1UB5A 4BFFA 2XN1A 4GBXA 4BWUA 2UZPA 4LLDB 4EN3B 4HDIB 2WPGA 3CCHA 5FK9B 5D1XC 3ZHDA 5DU7A 1SDDB 2JB6A 1L9RA 3F58L 1PX3A 4M9OA 3HJEA 1QFHA 2K8MA 4YSDA 2Q8AL 3ARQA 5FO7A 3LPPA 4MVBD 4OFDA 3ZUCA 1SRDA 4WFGD 1CN4A 1ZT4A 1E28B 4JDVA 2DKUA 3LHPL 3RY6C 3GSXB 3BP7B 2EDNA 4PJCA 4HISA 4XT1C 3VD0A 4IBLT 4M61B 5F1SA 4WY7H 2QADC 2QV2A 4K9EH 1J9RA 2O5ZL 4LVOC 4E9SA 1WIUA 4PJFB 4KMLB 5C08D 1PS3A 4JHWL 5ACZB 4PRAA 5I5MA 3HPLA 1Q1JL 1JVOA 5TQ2L 4GUQA 4MMXC 4YWGH 2OSWA 1KN2H 4LLMB 5LG6A 1BFOB 3LRSB 5HDOA 2DQDL 2JQAA 4DVRH 1WBYB 5LJYH 2HJLA 1KV7A 3MRRA 1AR1D 4F24A 2YN3A 2WXHA 5FKAA 1KB9K 1PX4A 3AXIA 3HUJF 3X1BA 1HCZA 2WKGA 1TTRA 3GSVA 3MR9A 3QZNA 3U6XA 4DQAA 2CD0A 4ZS6C 1F13A 4HF5L 1OSZA 4HUXA 3DRTB 4YSQA 1WFMA 4MAUL 3GHEL 3SDCB 3EGSA 4F27A 1XTMA 1U8HB 2H5UA 4MZ3A 4G7QB 4DGIH 2JKWA 4ZTPH 3VB8A 3Q5YA 3FQRB 4QRRB 4GRWH 5I74C 5KYXA 3PNWB 1A8JH 1ZTXH 1B0GB 3T4AB 3US0A 1I85A 3FO2B 5EU6B 2XCMC 4AV5A 5ETUB 3EJSA 1YNTA 5H35B 4B97A 2JK5B 5E8OB 2LGNA 2EVGA 4HLEA 5C0GA 3UPRA 1FL3A 1J8KA 1YZZA 1EFXB 4YSCA 3WNKA 4GAGH 1JNHA 1OCWL 3CZJA 4HJSA 1S7XA 2IAND 4XHQA 1HINH 4HZAA 1A14L 4XMPH 1SJEA 4NKOA 4K5OA 1Q4NX 2RFXB 2W38A 1OM3H 5E8EA 1EERB 5DC2A 4J8QA 2D03H 4HWEH 4MWFA 1OSZB 3HNTL 3CVHB 4U1GB 2A9MH 4NN7B 1IM9A 3W1ZA 1W6LA 2F8IA 2GEEA 4LE8A 5LXGL 1A4AA 1MZYA 3ZIYA 5LQBL 4UM9A 5HHOA 2DQMA 4EMZA 4XBPA 4ENEC 5DJXB 3VXMD 3FOLB 1G7HB 2X4TB 1OCCB 4M3HA 2AQ3A 4F2EA 2HG5A 3FU0A 2P80A 3PGCB 5SX4I 2AJ3A 3IGAB 3LVEA 2YK1H 5AAPA 3FS9A 2VM3A 1KBGL 3CFCL 4AGLA 4N0UB 5JHLA 3SZKC 4OFPA 5GRVK 3V0WH 1MIML 3SE4A 2DWXA 2Q3XA 2QFRA 2ROYA 1NFDE 2F19L 4UDUB 1ZT4B 5FOBB 3M07A 1MFAL 4GSRA 3QI9D 4PM1A 1IAII 1WFNA 4Y4FD 5F7UA 5I1HH 5JHAA 4IIZA 4ZX4A 1TETH 4FTVD 3C60C 1U8CA 3K5RA 2BVEA 3LEXA 1QUNA 2DEYX 2OJEA 4MA8L 3MRFA 2VRAA 1IARB 3C6SA 5BRZA 3NFSL 4KKNA 2W5PA 2F54E 1FNGB 1KGXA 5LGHL 5EUOB 1B4TA 1XF5B 3GJEB 4KHTL 5BZZA 4K55A 1E65A 3DMMC 3L54A 1IGJA 2Q8BH 3ARFB 4UQIM 2Y1YA 5CEZD 1G1YA 4G1EA 4MNHB 5DK0A 4OD2A 3F05A 1TVBA 1S7QB 2E7HA 4H4NA 5HI5D 2BP0B 1SF3A 5B3JF 1VF5C 4XP9L 4GRMB 3HG1E 1F6AA 1R3KB 3AU1A 4N8CL 3V6BR 3RTQD 1OEZW 4OQTA 2G4GA 2Z8VC 3QIBC 3QQXA 3SDAD 1GGIH 5MEPA 5DJAA 1KCBA 4P2RB 5C0CE 1CFVL 4IOIA 4G1MB 3NIFE 3VI3F 3H55A 3II1A 3NGBB 1LHZA 5J6HA 2WQVA 3VO0A 4YSRA 2AXGB 4BFOA 5GSRB 4EAEA 5BW7C 5T1MB 5E6ID 3MXWL 4Q9RL 5KG9B 2XTSA 3QQDB 3P3RA 3O3UN 2Z93A 3AROA 4JN2A 2X6VA 4WO0A 3QJHB 1U8NA 3QORB 3P9MA 4KHXH 4XCFH 3SB3A 3B7YA 4G8IA 5CJXC 3NP4A 4GI6A 2X89A 4X99B 2MTPA 3D5OF 3R06A 2JNZA 3ULVE 1RJYA 4OGXL 4XXCA 2FVNA 4ZS6D 4DOHB 3SPVA 4LLQB 5F7EL 3TBYB 1GA2A 1G5AA 1TTAA 3UBGA 3RWCB 3NCXA 4WU5A 3H2PA 3TBWB 3IETB 2XWTA 4GQPH 4C56E 4YXKL 4JRFA 1ACYH 1PF3A 2BJMH 4QF1A 4Q8BA 2GT9A 1FNAA 3FT0A 1C12A 2K7PA 1USQA 1FZKA 1XIWD 2F54B 1ZTMA 2EKSB 4HIIB 3GJFK 3WEAA 1R0AH 1KJVB 1J8SA 3V6ZB 1K2DB 2J56A 4KMQA 5I1KH 2FO4B 5IOKA 1QRNE 5T3ZD 1BM7A 3N55A 1M1XA 3MJ8B 4H0LC 4JFEE 2J88L 3MRBA 3U7WH 3V0HA 3NIDE 3L3IB 3OLIA 4H8HA 4QOKB 2A99A 5DHMC 4PJAE 4GYBA 4IBWA 2RCSL 5DS1A 4WWOA 3VB9A 4ERSH 1NMBH 2HJKA 1FP5A 1RZ8A 3O8XB 3LNGA 4KK5C 4UQ9A 3NDZE 3R0MA 4LDEB 3WFBH 1BIIB 5DWPA 4LKCA 1DBKH 5IQNA 2G2RB 5JHDE 3SCMD 3LYRA 2XQYK 1FCGA 3FK3A 3QULA 5C2BL 3CZUB 4UTBA 4U1HA 2BSTB 3TO4D 4BKLA 5F89B 1XO8A 1WT5A 1X7SA 4O00A 5CCJA 1OLZA 3MNZB 3MLWL 4KX7A 4OLYL 2PCFB 3UTZB 2F61A 4XVSL 5JO5B 1JCVA 2XIDA 1GGCH 6CGTA 4CVUA 4B9FA 3ESPA 2XUWA 1VPOH 3H42H 3NIFB 1P1ZA 1MI5D 4AQEA 3PWVB 2VSMB 3MFFB 2D7QA 4JUTA 3NT0A 3G08A 3GEFA 3LHPH 3MUJA 4HS3A 4QWWC 2HJFB 3QDGE 1QABA 1ACXA 3TCTA 2OTWA 1MCJA 1C5DB 4L3CA 2R39A 4E2OA 2DTSA 2OZ4H 4J2XA 1EANA 2B3IA 1Q1JH 5CWSB 1HHIA 4LARL 1KN2L 3TFKD 1P5UC 3LKSB 4PGDA 3ECUA 4JZNB 4JO3H 5MP6H 4PP2B 3K4AA 4X0KB 1GS8A 3VFNA 1AGFB 4CVXB 4GAAA 4M1CC 5IWLC 1WWWX 4PTTA 1XR8A 4P05A 1LWJA 5CSZB 2Y5TB 4EDXA 5AAWC 4DP0X 1JFHA 1IQDA 3BVNA 2WCPA 3HG2A 4OCSH 3HI1A 4OFQA 4M3JA 4HKXA 4NT6A 5GGSA 3FHQA 1RMFL 5LGHH 5K1JA 3PWVA 1K3IA 3ATFA 3U4BH 3BSZA 5EMYA 2V7HA 4P23A 1PZUB 2Y1VA 5EN3A 2P5WB 5LNDA 4MWFB 2M1KA 2DJ4A 3TPKA 1E5ZA 3N42F 1X9UA 4HJTA 5CSBA 3WNJA 4MJ4A 3B5TA 4TUKH 3V6OA 1N8ZB 3NN8B 3H3KA 5EEYA 4AQAA 4JZNA 2ZPKH 1L5GA 1JZDC 1A14H 2VN6A 4XMPL 1J48A 5E4AA 3FU7B 3CK0H 4KKAD 5KSAC 5F1OB 3L08A 3E1ZA 4OU3A 3D48R 3QJOA 4KJPD 4LEBA 4HGKC 3HN5A 1QLEH 2F0CA 5FECB 3WKPA 5I1GH 5GZNA 2EEDA 3MRDB 3QG6B 2CO7B 4HUUA 4U3CA 3B9KD 1CDHA 1JNNL 5GGUA 1HSAA 2ITCB 1OAUL 2I26N 3MTRA 3EF4A 5FWRA 5K9OB 1NKOA 2XRAL 2X4QA 4P2RD 3RIKA 1YC8A 5C71A 2ATAA 4JY4A 3DHPA 1WJ3A 4I18B 2EADA 1EHNA 4HFUL 2VCOA 4N0FB 4P4RB 1WG3A 2X9YA 3RPIA 5JA9A 4ODTL 3O0RL 3OJVC 4X5WA 4LSDA 2ICWI 3FCGA 4OM1L 4V2CB 4GPVA 3RGVD 3MREB 3OPZL 1ROCA 5EU5B 3VXTB 1EDYA 3TJPA 2A6IB 1UKQA 3CMOH 2VOTA 5MEND 1WIPA 3U48A 5FHAH 5MENA 1XDTT 5TQ0H 3NFSH 3HZ3A 5DC4B 3DARA 1MCEA 2OQJB 3BH9B 3KYOA 3Q3GA 1HSBB 4FTVB 4PR5A 4LRIC 1HCVA 3VE0B 1ETA1 2VQ1A 4ERSL 5K9QG 2XFGB 1N6QH 1A4KA 2C3VA 1GGBL 4P5TB 2QSTA 2R69A 4Q6YA 3KWWA 3RGVC 1LO3L 5JXAH 3CHSA 4HAFA 5CIPH 2YD8A 5AYUL 1T21B 4K0OA 3ZLQC 4PLOB 3BMVA 3B7SA 3U7AA 5DEFB 1IVTA 2R2CA 1D5XB 2WQAA 1TPXC 1L0PA 3BGMB 1YMMB 3GI9L 5I2IB 3SKOA 4XNDA 5KZCD 3CDGB 4NFBA 1ZLSH 5HGBA 1E5UI 1HHHB 1Z9PA 4WI0B 3SE8L 5KSAD 3RJOA 5KSAA 3TFKC 2TSAA 1XGRB 3OKDB 2PN5A 3H2WA 1FYTB 1YDPB 4IRJD 4OZHB 3D18B 4JFPA 1HYSC 5IF0A 5K9KB 1AI1L 4W93A 4AENB 2C34A 4RGNE 3OR6A 4MJ5B 5E2VH 2R29A 3EOYG 4I1PA 2BRRH 2OYMA 5IQMA 4FDWA 4OY9A 1AKJB 5B38B 3CSBA 4HWUA 5G4NA 4G71B 4TQIA 1T21A 2B1OA 2IPKA 4ZO9A 4Y9CA 3S3PA 2WNXA 1OOAA 4KKBD 5AD0A 5C8JA 5C0BA 4RGOH 1CFQA 1CTOA 4KY2A 4XOCA 4J27A 2AK4D 4M03A 4XXDB 3RL1B 4HUWB 1P7QA 4WJ5B 1HAUA 2DIEA 2VZTA 3KVPA 1N2RA 4OW6A 3FDWA 4QRRD 4JM0A 1GR7A 3B2UD 4BJLA 4Z1PA 3VQ1C 1UVQA 1UZ6E 3QUZD 1CL7H 3SDCD 2NCMA 5FUOH 1MJUL 1VZGA 4P4KD 1VJSA 1HH9A 2UXFA 4U1JA 3S7GA 3QCUL 2VQUA 2NCEA 4N0YH 1AXIB 5DZLA 4NQUA 5AKSA 1W72A 1KIPB 1EO8H 5AKTA 4FX5A 2OCFD 3LXCA 4XO8A 4HV8A 4XPBH 3QE5A 2JLPA 4JFXA 1QNZH 3BUBA 4NGHH 3D39A 4P57A 3TONA 2OULB 1D5BB 4NWUH 2O5YH 4GKZA 4IRZL 3ROOA 3VFRB 3VRIA 5A6IA 1P7QB 4WJ5A 1Y1DA 2DM3A 1JPSH 4B5EA 1HQRB 5C0BE 3RWJB 5I6NA 3IU3A 1J5HA 4UMGA 2JELL 2YMXL 1EFXA 3P54A 4JRYE 1A6UL 4IBUA 1AXTL 1KPRA 1U8JA 2OX5A 3KPQB 1OAZL 1XF4B 3HHMA 3LH9A 4FNTA 5E6ZA 4WHDA 2ZOTA 1YPZF 4NKDA 1Q8MA 1U58B 5J1AB 1VKXB 2NQDA 4DN4L 9PCYA 4HLZG 1NGWB 3MV01 4GQ9L 2GSGA 1AGBA 1W72B 1O7VA 3CPUA 3C87A 5LB1A 1ADQA 4EI6A 3GINA 4JG1L 5IIEB 1F58H 4C83B 4HD5A 4L8CA 3LDBB 3TZVD 2ZYHA 4NQDD 4NQDA 5FEBA 1A1OA 1NFKA 1BOGA 5BVJA 4G6FD 3D0AA 4JR9H 2Q20A 4P57B 1GHFH 2L4OA 4M61A 3ECVA 4NZTL 2JV6A 5T1LB 3WENA 2WXQA 4PJ5E 3CLFH 3E8VA 4N68A 2AEQL 3UL4A 4FABH 5GZOD 5HHXH 2ZTBA 3NJGA 5GZOA 4G1EB 1H3VA 4MNHA 4TRPH 4XR8C 1TJHH 4PH8A 2DB8A 2DLHA 4WGKA 3Q0HA 2WVTA 5GGRA 4Z7OB 1MKFA 3W11C 1UA3A 2FWOA 2YO3A 4HS6A 4BINA 4NZRL 1SMOA 2KYIA 4ZXBC 4FL4C 2XA3A 1OO2A 1ES0A 3MFGB 4IGBA 4ZQTA 1S3KL 4RAVB 2O61A 5C86A 2BP3A 4D0DB 1A2YA 1W9XA 2MPAH 4NJAL 3FUEA 4G83A 2VJ8A 2JIXD 3ESOA 2CHWA 4L8CB 1NLBH 4P5KA 5MERB 2VXQA 3BAWA 4R4FL 5HI5C 4IHOB 3RUGB 5J6GB 3FCUB 2N3JA 1B90A 1SDDA 4ZMAT 3UYOD 4R96B 4U6HB 1D5MA 1NAMH 3EFDH 4KI5C 3ULAB 4U1LB 1NCDH 5IQ7L 5DK0B 5IHUL 3CSGA 2OBGA 4PJ6A 1JTPA 3EOAA 1S7VA 3MBED 3K2KA 3C60B 3OL2A 3TN0A 3WFEH 2XQBH 2ARJB 1ERNA 1FIEA 3VU2A 3WTWA 1WBZA 3SDDA 2RA1A 5IF0B 5K9KA 2JJWA 3CK0L 1OGTA 2X3BA 1M71B 2IALA 2FD6H 3K72B 1V54B 2ZZUT 3CFEA 4JFTA 4PJ5A 3TEUA 2FNWA 3FTVA 3NSDA 3Q1SL 2P3YA 4ODHL 4MDRA 2ALAA 4MS8D 3HB3C 3MV9E 1RPKA 4JRYB 4R2GB 2JKJA 3KM2A 2V2XB 1TZGH 4ZFOA 3HMXL 5IFHL 1GKOA 3TESA 1YA5A 1TVHB 2OJZH 3BUQA 4Z3GA 2NYZA 1EZVY 2FB4L 1EBAA 3MRLB 1H0DB 4G2AA 4OIFA 5D7LD 4NQEE 3WIIL 3EJTA 1RZKH 5IHLB 1EUTA 4TOYH 2R83A 4GKNA 4XVUD 3E2HB 2A6DB 1RP8A 1GSMA 2YA1A 2YAOA 2XT1B 5E7FA 1R47A 3PABA 1ADWA 1FG2A 1SVZA 4NRXB 3LKRB 5DZJA 2PR4L 5TE6L 2E7LA 3CFKB 1VFOA 5I24A 1SUJA 3T8MA 3GT6A 3FF8A 4FI8A 2ZWNA 4QI3A 2L04A 1KSRA 43CAB 4QLRA 2W9DL 4L23A 4UTBL 1DBAL 2HAZA 3CMOL 5E7BA 4P59L 2YXVA 1PFOA 2PR9A 3OMIB 5AKRA 4F58H 3E3QC 1ND0B 3STBA 3K71A 5J11B 2F1BA 3VFSA 3LIZA 3SE4C 2EIEA 3KDMB 3ZKQD 4XC3H 2ZKHH 4JFZL 1EEYB 1DJXA 2V5YA 4JUSA 4FQXC 4HD9A 5AALA 4HBQA 3A21A 2D7TL 2E0PA 5DYOA 1MFNA 4ZX6A 3PL6D 4Z7VF 4PJ7A 1KJ3H 4MQTB 3VUAA 1QI4A 3ES6B 4PS4L 4N90D 2KC0A 4IRZH 3POCA 1DUZB 3KPPA 1IC7H 1NAKL 3EO0B 1C16B 3LIZH 1GZPB 3D25A 3ZSTA 1FZOA 4U6XA 2O4EA 4JFQB 1NCBL 4EOWL 4WHYH 5B38A 1JUFB 1RH8A 5IB1A 5CWSA 2EDMA 2IAMC 3L1OL 3LZQA 5C09D 5I23A 3LPGA 4PRPB 4CU7A 1BVNP 1QASA 3QQDA 1HHJA 2ENYA 5AW2B 1K4CA 3MV7E 4ZFOL 3H9YA 1BECA 1P4IL 4NUPA 1B9ZA 1Z3RA 4FADA 1BQHB 4RSYA 2VN7A 1P1ZB 1OD9A 2G60L 4LSTH 3V4LA 3WSQL 4DP5X 1OAXH 1PY9A 1T1XB 3NJLA 4PWJA 1GYWA 3ZUNC 1XSJA 2H8PA 4M6NH 2BIIA 5DO8A 2HLEB 3LD8B 4JR9L 2IVFC 3K8KA 4MB1A 4XCYB 4Z76A 5L88L 3FN0H 5IT2H 2VE6B 2PXYB 3CDYA 3KW7A 4HZLB 1OWRM 1AR2A 4K3DH 4RGOL 5F7DB 4A2EA 4EXPX 1UYWH 3EOBB 5EZLA 4MDIB 1DLHA 3QUMB 4P3DA 3RA7H 5ICZB 3MKKA 1XIWA 5JIQA 1JUFA 2DDQH 2P8PA 1GL4B 1RK0B 4PY7A 3PYCA 3SGKC 4TVPL 4UBDD 2R0LL 1XCQA 3EJUA 4K73A 4WW1B 4HC1A 4RRPG 4WO4D 3LV3B 4C4BA 1H3PL 2KLSA 3TYGL 3BP4A 4N0YL 1I1AB 1T2JA 4AQEB 4OB5H 1FDLH 3IU4H 3QXVA 4WK2B 3D9AL 4Z9KB 3VM5A 5JYMA 3KYMB 1RJLA 4B9ZA 3GXFA 1F4XL 2OS7A 3HC4L 2AJZA 3UAJC 5J89A 3L48A 4ATWA 5AG8A 1WIOA 2GC7C 2ICCA 3QS2A 2O5YL 2CGZA 1EEQA 3I6KB 2E47A 3KLLA 2BNUB 3MAWA 2J4WH 4LQFH 3ARGC 4N5EC 3MNWA 4J3OG 4XAWL 5A2KH 4BQ6A 5AEAA 4NUJA 1IC5H 3CHXA 1ONQB 3KLKA 3IFNL 4UM8A 2XWTB 1MFDL 2Z4QB 2EDLA 4B9GA 3IKKA 3BSZH 5GGTH 1T7YA 1CDCA 1EUUA 2Y5TA 1D9KC 4L3EE 4PS8A 3LN4A 3BYYA 3SPVB 3G5WA 1QKZH 4FHKA 4WUUD 5JO5A 2FCBA 5JR1H 3Q1SH 2G3XA 1S9KC 1E6OH 43C9A 2QTVA 3HB3B 3CX2A 2GHZA 2WUBL 3ABKB 2I60L 3B3IA 4ZS7L 2OLDA 4AE0A 5E70A 3KZ8A 1AXSA 3NEXA 3ULVH 1SJVA 1TMCB 3ARZA 1X7TA 2VR6A 2NXYC 4GT7A 1LILA 4DIXA 5HI4C 5DMJB 2A5UA 2IPUK 4PLJC 4BA0A 1QBLH 1YPZA 3B83A 1FA4A 3TT1H 3HLAB 3O9WB 4WU7B 3I6KA 1KJVA 5IVXE 1T20B 4NQEB 2CUIA 2OTWB 5MI0C 1PZCA 1N59B 4I48A 3OZ9H 4FLHA 2GITA 3NN8A 3T5WA 3FCSA 2YUWA 4AEFA 3VAEA 3RAJH 3GRWA 5IW1A 5KJRH 2YZ8A 4BK5C 3RVWC 4PHXA 4V1DD 2CLVB 4L4VE 4TVPD 4ODVH 2X6BA 5IG7B 3I6GB 4ZW7A 1XF1A 4HC1L 1G7JA 1DL7H 2YD9A 5DRWA 4S1DD 1CVRA 5HHNA 2DQEL 4ZW3A 2ZNWA 1F5WA 3IDYC 1NUDA 4EO5A 2K45A 3RB5A 5DJ8A 3VFWA 1GYVA 3CU7A 4DQOL 3WV0A 3I6LE 5FX3A 2AXWA 1YLBB 5L8KB 2CIIB 1ACZA 2QZQA 2CHZA 1NAML 2VLKA 3EFDL 1TO4A 4PCYA 3RNQB 4X4YA 4TNWK 3ZT6A 1CR9H 3P69A 5T1MA 5JOFB 1MFBL 1L9PA 5AWNL 4IDLA 3IGLA 2JH2A 3RFZA 4KV5F 3GZOA 2EDRA 2X9ZA 2ZP0T 4G9DA 4RFNC 2APVA 2X3CA 4Q6IB 3B56A 1MUJA 2F1EA 4WO4B 2FDBP 4X98A 2CAKA 4U1HB 2CE6A 3RLSA 4FAAB 1F00I 1JYXA 2CCWA 3L2MA 1XH0A 2WXJA 3QWOB 2K6YA 2Q8AH 5IM7B 2YEVB 1BMGA 4LIQE 4BCXA 2DTMH 1VFUA 1HXYB 1PYWA 3L1OH 4YE0A 1ZHLB 2YQ2A 5FGBC 4L3CB 5B1JC 1BPLB 1O6SB 2P42B 1A1NB 2UYLB 2W0FB 2PXYD 1LD9B 3OF6A 1LE9A 1BCIA 2NYYC 2RALA 3BSHA 3MRHA 4IDJL 5I1DB 3RWDB 3LN4B 4M6NL 5E4OA 5DQ9A 2F5AL 1JGDB 4IJ3B 5AUMB 5KYWB 2BSTA 4PLJD 1JZEA 2C7UB 3HBQA 4MNGE 4NRYB 4W68A 1QA9A 4U1SB 3N50A 1ZWIA 3MRMB 5CUSH 3WIHA 3UTZA 2PLTA 2R2EA 2PR4H 2LVEA 4X50A 1SLUA 1W8EA 4P99A 4BFGA 1WD9A 4MMXB 4MJID 5CZKA 3HLAA 3O9WA 1B2WL 5KVDH 2BSCA 5D8JH 4ZTPL 1H8OA 3JV6B 4GSUA 1PVHA 2R0LH 5HVWA 4YHNA 4F58L 4GG6A 2DQIL 1XGYH 4JHAH 3IU3B 2MPVA 3FRPA 4JFDB 1SPDA 3B43A 4MQSB 2AEPH 3JT0A 1CGTA 3D9AH 5ID0B 4YDJA 2A74B 3DBSA 4JZOB 1NAMA 4KJQC 4PJAA 4C4UA 4LCWE 2G75B 3HC4H 2PCFA 5AUMA 2Z65C 5DQ9B 2C1PB 4ONFH 5EU6E 2L7QA 4AGNA 4NZUL 4GO9A 4F2ME 3DROA 2FL5B 3SDDD 2PF6A 3DUSB 3NP3A 4XN5A 4TUJB 2YRLA 3GPSA 1BD2A 4KJWD 4PJ8A 5JLZB 1O9VA 4E41A 1KC5H 4Y4KC 5K93A 2EVJA 5LQBH 4PJ5D 1FHGA 1HE7A 2XWJB 5DK2B 4HX1A 2XKUA 4U2ZA 3QJVB 4R7VA 2X4RB 2O5NA 4YDMA 4LIQH 3GJFA 1JZIA 2O5ZH 5LGJB 3TM6A 3MRCB 4Y9GA 3Q13A 4JM2D 4WJKB 4BH7B 1LM8V 1F11A 1T7WA 1TEGA 3FT4B 5DJ0B 5TQ2H 3RI5K 5IBUB 3E7JA 2EDDA 1LO0L 3PJSA 4NJ9L 1WO2A 2Y2WA 1WGVA 2BMKA 2HLAB 4OZIB 4HJ0C 1X6LA 3I50H 4G82A 4KKCC 5GGSY 5HJDA 5BMFL 4UI2A 1T80A 2FBOJ 3V79C 4RMSA 5HYSG 3RUGA 1E4WH 1CDBA 1FYTD 4IRJB 1TCRA 1H19A 2B9AA 5KJRL 1A1MA 1INDH 2X12A 4W9IC 1NFDB 2DPKA 1P5UA 1ZHNA 3B4NA 3T3PB 1XCTB 3BKCH 3L1EA 5LBVA 2C9PA 2DJMA 4ELMA 5GZNC 4WHTB 5EU4B 3ZKMD 1YMMA 1JPEA 4PEEA 4J3VA 4PIBA 1CVSC 3MOQA 1SVCP 1R3LB 1PFCA 1X5YA 1FDLL 1G6RL 4O58L 2EYTB 2YFNA 1TITA 4HWBA 2EILB 2GW5A 3ILQD 4KQ3L 3O2WL 4KRPC 2CLRA 3MRQA 4P46C 5MHSD 2XVKA 2XICA 3RVUC 3KH4A 3PJSB 2A9NH 2BWIA 2LU7A 2APXA 4GMSH 1G94A 1HKLH 2J12B 1AR1C 4FI7A 4CMMA 1L0XA 1U2CA 3BP7A 4PJCB 3ZE1E 1NWPA 1HKFA 4OF6A 4ZPTA 4CNIA 4XBEH 5GS0H 5KAQF 4KXZI 3RWEB 1N67A 2K9FB 1U92B 1HZHL 1KCSL 2AZUA 5DJ2A 3MBXH 2YMOA 4E42B 1DJYA 5MENB 2SODB 1WEJH 3ISYA 3S3BB 4IBVA 4OGYL 3H85A 3DXAE 4Y5XB 2FO8A 5ELIA 5IFJA 3U4EB 1N0LB 3L2NA 4PG9B 4BFJA 2IV9A 1W8NA 4YDIH 2J8UA 5D1XE 3CHRA 3FB7B 3VD7A 1GYCA 2FT8A 3CDZA 4Y2DC 3RPIB 3DGGA 1U8KA 2EC9T 4KJPC 4EI5B 5LCVL 1PDKB 2YMTA 1X6NA 4BE6A 1WAPA 5F7WC 1N8ZA 1QI3A 3I84A 4AYGA 1LP9A 4JFOA 4NQDB 4XVUC 5F7FA 5IQ9B 4QHKI 5IP4A 1A4JA 2VRKA 3WNOA 4RNRA 5KUKA 4YXLH 1CU4H 3C8HA 3GZQA 2QEJA 2P5ED 5HVHB 1IIIA 5I1KL 1PU0A 4Z0XB 2FT6A 1DVYA 1V3LA 4MXVE 4BGDA 1CE1L 2J88H 3CUPB 4Z7UE 5I6XC 1FL3B 4Y9BA 4YHYC 2HPOA 1B2WH 2HN7A 5KVDL 4R4ND 3QA3B 1RU9H 4WW2B 2ZF9A 3CBRA 5IB2A 2DLGA 4GBXB 3BRFA 4AV0A 4Y2DA 4XNYL 3BXNA 3X3GL 4C59B 3S88L 1LNUA 2YAQA 4K7PH 2YUVA 3VFRA 5H37A 1CDGA 2OI9B 2NXYD 1JVKA 1N5AB 4MNQE 1QFOA 1OF2B 4CJ0A 5JMRA 1XCWA 4JFHD 1JRHI 1QBML 2OCJA 4IOFC 1RK1B 1YQVL 3SD5A 2GTWB 5AD0B 4YE4H 3X14B 1S9XA 4QGTA 3U0TB 1LK2B 4EF3A 2IFGA 3LZNA 1IBYA 1CBJA 1DN0A 4OJYA 4UOZA 4NZUH 1E7UA 3DK0A 4XVSH 4M6ML 3UTQB 1CZ8L 3S35X 4L4TA 1ZD6A 3AY2A 3D3VD 4ONHA 3I9IA 4IK6A 2HYMA 2WW8A 1FZJB 1T2XA 4QYOB 3OV6A 3O2DH 1XF2A 1N10A 4GRLD 1THAA 4WRLA 2XWBA 2ZT9C 5BQ7B 4P5TA 3P11L 1EPFA 1WBXB 2EXTA 3BEVB 3UAJD 1MELA 4OF0A 4BSJA 4GQRA 5FYKU 3DRTA 5LCVA 3AS3A 4ZNEA 2XZZA 4OZGA 4BXSV 3IBEA 4XNUL 3ARGD 3T09A 4H5SA 3QH3A 4ZPVB 4Y9EA 1JYWA 4X9GA 2H7WA 4ZSOA 4G6KH 1LO0H 4ODUA 4XN7A 4TULH 5L9DL 3UC0A 1G9NL 3QHZL 1XT5A 3HC3L 4GS7C 3AREA 3DX2A 4APQB 5T8IA 2XU9A 5CUSL 1MAKA 2Y06L 4D7PA 4LSRL 2Y7OA 2R7EB 2OMXA 5HYSB 1F42A 4B9CA 4HEMA 1XGRA 5I75C 2WBXA 1MXGA 1WAAE 2C9SA 4NUGL 1T04B 5HHMD 1LEIB 1ED3A 4JJ5A 3NZ8A 2X2IA 1OGAB 3GSXA 2ZXAA 1BPVA 5E8EB 1WFTA 2HKAA 1PPIA 3MODL 6FABH 4IOSA 3RIAK 5IR1B 2NUPA 4URKA 1SJHA 2HLFC 3G6JA 5HHMB 5T3XE 1NCCL 1T7XA 5ISZE 4KQ3H 3SKUD 1MCQA 4O02B 5DHYA 3IFPA 3ZRCC 2BVOA 5DHVH 2G0LA 1KB5B 4J6IA 2QVMA 3O8XD 3QXAA 4APQD 4N5ED 5DVKA 4ZX5A 3ZDXE 4M5ZH 1FG9C 2AJZB 1Q94B 1DJSA 1AY1H 3OKNB 5C07D 4UOQA 4L1SA 1RERA 4UTAL 4OZ4B 3LHAA 3QWRD 3X3FL 3ZGIA 1I3VA 4HBCH 1HZHH 3OGOE 3PWNA 4FQXA 4LL9A 4UT7H 4MRBA 3RZCA 3IJ7A 3UPAA 3ARYA 2J73A 3IMSA 2XSKA 3TBTB 3W2DH 5GRXG 6TAAA 1FRGL 3O2DA 3G5YB 4GIOA 1AQKL 2ZICA 4M7JH 3ZDWA 2Q0ZX 3GTTA 3NZUA 2F6AA 4E9VA 4NO2A 3LPWA 5HJ3A 1CCZA 1OAUH 4MZIA 1URLA 1YEGL 4R7LA 4M7KL 3PGFL 4H1LA 3QFDA 4MD0A 1MJ7H 2X2UA 4HIQA 2GHWB 4M5YH 2QT6A 4AYSA 2GUYA 5BS0B 2KI6A 4JFSA 3P0GB 4ABQA 2C4XA 4M3KB 4WTXA 4X5XA 1S7WA 4I0PD 4MB3A 2H3KA 4ILDA 3G5XB 5CBAB 5D71H 1NEZG 1CU4L 1F6AB 3CQFA 1THCA 2R59A 3U2HA 2YOAA 3FO1B 5A2CA 4WV1A 4ZAKB 2BS8A 1RPQA 1FV1B 2V37A 4RFOL 3QORD 4POZC 3FU5A 3D07A 5JPNB 4ZFGH 5IEKB 1JZ2A 3OD3A 5IKCA 2H3XC 4NENA 3NPSB 5JHMA 4ODUB 4M1GL 2EXYC 3ARFC 3QXDA 3EYFB 2P8PB 3MPCA 1IT9L 3KPSA 5KVFH 1UJ3B 1N6QL 1G1CA 3OR7A 3NACL 2E9BA 4WO4A 1HL4A 1G6RH 4O58H 3CN4A 1LO3H 1IGTB 2ZOKA 1WCBB 4DEPB 3GRWH 2VLJD 4P2OA 3OAUH 1WZKA 6PAZA 3CFJA 3QHFH 2XZCH 1RZFL 1HHKA 3D30A 1CBVH 2H26A 5T3ZE 4K94L 1YUKB 3U2SB 3QZBA 3QFJD 3CTTA 4Y5YA 4G6MH 1IFHL 1V8HA 1ACCA 2R23B 5I71B 2O93L 1DTUA 1J9TA 1NGXB 2YQBA 3S4SB 3K2UH 4A1RA 5KYUA 3C6SB 2VDOH 3M1BA 3U30C 3KPRB 3TNMB 2XPYA 3DGGB 3HIZA 3MRPB 3N85H 3QNYB 1CYGA 3O2DL 5JQ6L 4Y1SA 5I17A 3QDME 3VA2C 2WV3A 1BQ5A 1WYJA 4LAQH 4OLVL 3QH3B 3DPBA 1BJ1H 2BRRL 2IDTA 5IROA 4A37A 4JM2A 3V5KA 3KPTA 2G2PA 1UM5L 3DWTA 1UURA 4DPRA 1PZBA 4KXBA 2BK8A 1PLGH 1FG2B 1ORSA 2XZQL 3P2BA 3I74A 2EVFA 4X6EA 3NQIA 3JTBA 4YHKL 4XWOD 3FAWA 4YHNB 3K74B 3Q6GH 1F4HA 1IUZA 4PV9A 2HUHA 4X8CA 1H5BC 5GSRA 4QPEA 4HHAA 4X6DA 4Z3TA 3T4AA 5AW5B 1CE1H 2AI0H 3KGRA 4LLAA 4FP8H 1ZIBA 5MI0B 5F3BA 3RNKB 4PY8J 4NX0A 5HDLA 1PZAA 2CJTA 4YIQB 3VVWA 4OSUH 2OMYB 1WH0A 4Z7QE 5IREA 2EH7H 3SDCA 1WLGA 1B6DA 5F8QC 3GQFA 1HHGA 4A66A 3ILDA 3WUZA 4XPBL 2UZXB 5K33A 4Q9BA 1KJ2A 3RG1C 1MAML 1BZ7B 4X6FA 5T5NG 4LCWB 5D4IA 3WY1A 3FNKA 1UD3A 1CLOL 2BNRD 1WFIA 1G4MA 2WSPA 2YD1A 1LD9A 3N9GH 3O0LA 5AYUH 4ZG1A 3DETD 3LQMA 2ATPB 4F1SA 5J56B 1OOWA 4FHBD 2DKMA 4LLVB 3CNKA 4P49A 2JKLA 4BKTC 3BZ5A 3BIBX 1QSEE 2XG4B 1OQXA 3D69B 4PUBL 4D8PB 2JELH 1SM3L 1F86A 2YMXH 3DGCR 5LN4A 2EUVA 5KTEL 4LSVL 4JL1A 3SE8H 1CZ8H 4WDIA 2G3ZA 3EYSL 1LP9F 5I1JL 5E2UL 2R56L 2IIJA 1KTRL 2F58L 3ILEA 1HHIB 3JWNG 5F96L 1ORQB 4B9YA 2XVLA 4YZFE 4GIPD 3LV3A 4XMKH 2NNRA 4L4VD 2JCWA 4PGZA 1UT2A 2ZXEB 3IDJA 3OKYA 4XN4A 3TFBA 3U6RA 5ANMA 4D3CL 4ETQA 4E36A 2FYYA 1WBYA 1S78D 2HG5B 4G7YL 4PJ9B 1KDJA 2WBJD 3EKCA 4GOSA 2ZKYA 4HCRA 1OP9A 3K80A 3NGBC 1A1NA 1AZRA 2UYLA 3LRGA 4U6VH 3CHPA 1J0HA 4RMWA 2HVBA 1MHEA 3A67L 3DLQR 4GP8B 3WMQA 3IVKA 4ABWA 4WHTA 3UTTB 4HWBL 1U42A 4G6KL 1KEMH 4YGAB 1KCUH 1TJHL 1FN4A 3I3BA 2H6PA 4KDVA 2Z31A 3FTSA 5DHVA 2VWEC 4G5AA 5F88A 4X7CC 4NKMA 1DEEB 3D08A 4BHUI 4JKNA 3RWFA 1E50A 1CL7L 1Z1WA 4NZRH 4OD2B 2NYKA 3QC5X 4DGYH 2LAGB 3U0WH 1D2OA 1S3KH 2BXZA 4PJXE 2X7LA 4JHZA 3UCRA 1BDYA 1HHJB 4Z0BH 3B7RL 3PAZA 4NSKA 1JWSB 3WD5H 7FABH 5EEZA 1EO8L 3QDMD 2IH3A 2NZ9D 4FCHA 3DMMB 3GXMA 4MJIA 2K78A 2E8ZA 4X4YB 2GY5A 2WY3B 1G0DA 4AW7A 4S1SH 4UV4L 1T83A 4BH7A 4RQQB 1YO4A 3BO8B 5IQ7H 2VDKB 3CJJA 3ZE1F 4TSBL 3EIFA 4K23H 3I2CL 4K9JA 5TJWK 2P7TB 2H9GA 3QHFL 1NDGA 3V9CA 4X5RA 2UWEE 3TNNB 2ENPA 1Z5LB 1J1OH 2R1WA 1EO7A 4FXGA 1TQCB 3FQTB 4NHCL 4PJAB 4XCNB 5E5RB 4QR7A 1FFTB 3P73B 4UOW1 3ZHNA 4MJ6B 3CLEH 3BW9A 3GSWA 5F89A 4RA0C 1CXHA 1RHHB 3T6QC 3K7UA 3X3FH 3FQWB 3DSFL 2VJ0A 3W0WE 4TUJA 1M6OB 4YSEA 3A4AA 3DUSA 4UQCA 3MJ9A 1M6UA 2VDOL 4MQ7A 2PCPA 5K1NA 3DX8A 4TLKA 2WLKA 1OARL 2CBOA 3KPRE 4QCIA 1VHPA 3M7OA 3JWNE 2VC2H 3MLRH 4HETA 4JREC 3WYRA 4M7JL 3DMMA 3TA3D 1SEBA 4AZUA 2OJZL 3C09B 2VDLH 5I8EB 5GS1A 1KCWA 3DV6B 4OM0H 2CLZB 2P45B 2FJFA 1GHFL 4JQVC 1QA9B 3GJFB 4BBWA 1PLGL 1TU2B 2H3NA 1DJIA 4F8OA 4JL2A 3QUGA 1S7TA 4MAYD 5FYKL 2F74B 1DBJL 3VSTA 3J07A 5IY5B 2RB8A 3QJXA 4NO0A 1IM9D 4APQC 4OCLC 1A7NL 3QQ3A 2W07B 4U1IA 4ZW5A 1FNLA 2Z4QA 1VADA 1FLRL 4JM2C 1HDMA 4N2CA 4PW4A 3RYMA 3LRHA 4JO1L 4F1ZA 1T1WA 1FH2A 2JVUA 4UINL 3FTGA 2X9WA 1M6OA 4AZ8B 4L8DB 5AQ0A 5C09E 4UILH 1RJZA 2XYCA 3WUWG 5D4QA 4DZBB 3GSOB 1IL1B 1O6TA 2MPAL 1IQDB 1BQSA 3R8BB 4BRVA 4UIKL 4ESKA 2BWDA 2EH7L 5GRUH 3AB0B 4R4FH 3ZE0F 5HGBB 4EXKA 2BFVH 1P7KA 1CXLA 3VXPA 1FORH 4KUCD 5GS1B 4DHLA 3UTPD 1KXVC 2IH1B 3U9WA 3QWQB 4TQ8A 3OAUL 4F8LA 5ISZB 2HWZH 3MGTB 5IVXA 2ZXQA 1P4LB 4M56A 4G9FE 5IHBA 1YPZE 1QMUA 3MRQB 3TF4A 4AQ1A 3SKJH 4DO5A 5E9DA 2BVPA 5IMOA 1E40A 1UM6L 3ZDXF 4FA7B 2ADJA 3ATAA 3L1GA 4X4ZA 1IFHH 1WZAA 2W0LA 4XPTH 4XNAA 4AIZB 5EO1A 1SGKA 1M7DA 4EOWH 4Z7WB 1K3ZA 3BLPX 4HS3B 4Y16A 1BBDH 3S36X 3EXJA 3S5YA 4HFWB 5D1QB 2F58H 5JA8B 1M7XA 1HT6A 5TGBA 2HZHA 3AT8A 4FYRA 1SOSA 2A4EA 1MCDA 3N40P 4MXVF 3BQUD 2A9DA 3KPRD 4XHJD 4R8WL 4JKLA 2DLFL 2QZ5A 1OM9A 1MLCB 4PN6A 5ES4B 1RZKL 3F6LA 3E8UL 2DV6A 4R7NB 1CL7I 3ISWA 3QEQE 3WXVH 2FWSA 1BOYA 1XL4A 3FCTB 4RGMB 4QRPB 2H0FA 4M93C 2UZIH 3QS3A 1DN0B 3QUYC 1EEZA 1U8CB 5BZDA 2MEJB 3FFCB 1OHQA 2H1LM 2LTQC 1RZ8B 4X6CE 4PCKA 2PW1B 2FJFB 1I8MB 2IOIA 3S96B 2DQJH 3LY6A 4FQPA 1CE6B 1HZLA 4M6OL 3QBTB 4JFWA 2FK9A 4RBPH 2IXQA 2EIDA 2QADB 2R7EA 2VDNH 2AMGA 2DJSA 2UX7A 3QXAB 1PY4A 2C1OB 4UTAA 3SJVD 1JYNA 3IU4L 1YSOA 4FQHB 2ADFL 1MNUL 4JQIL 1HQ4A 3IJ8A 4WSKA 3LH8A 3T2LA 4YO0A 2DIAA 3NZHH 5J57B 3CZFB 1UZ8A 2WNKA 2W88A 4WHYG 3FU7A 3N9GL 4QRQB 3I3EA 4C58B 4YPGB 3QVAA 3ZDXB 3CVCA 4EDWH 4Y2LA 3HZKB 3QZMA 1ZWIB 1ZGLM 1MCCA 3CDCA 1NAKH 5IB4B 1E27B 1MG3C 1J1OL 1CICC 5L4IA 3V52L 4O5LL 3T6XA 1ZVNA 1K85A 3F6JA 2R0ZH 3VQMA 3K6FA 5KTEH 5HYSA 4CADA 3UERA 2V3EA 4Z78A 3DSFH 2XHNA 5J12B 1M53A 1MHPL 2NY4C 3FB7A 2DQFB 3X13B 4MA3A 4ONHB 4YSOA 4YC2B 3QW9A 1J0ZA 1DVZA 2VL5A 2M8XA 4I1NB 4JLRB 1YEIL 3ZGHA 5I1LB 3UTSB 1UOVA 1SNRA 3E9TA 3NZSA 4WGVB 4UQEA 3VACA 3ZTCC 1ID5I 2VW7A 4BEIA 2CDEA 4HLJA 5JNYB 1XH3A 2CRZA 2CXKA 1RUAL 3I85A 3UADA 3FAXA 3S5LB 4HGWA 1GTNA 1IAOA 5F9DC 3SPCA 2NYYD 2MIZA 3L4VA 4P9ML 2YKKA 4MSWA 1MY5A 4GXVL 1UA7A 4ES8A 3UGEA 4G70B 4N2OA 3ZR6A 5E8PB 2CNZA 1NJ9B 2E5EA 4CMMB 1A6AB 3I9PA 5ICYB 1OE1A 3DOSB 2D9QB 1MFVA 2H2PC 5F93C 1MZZA 3KXFB 3KPMA 3P4MA 3L45A 1I8IA 2XKNB 3OKKB 4R4NC 4TUOA 1MAJA 2P48B 1OGSA 3WY2A 2HJLB 3MRRB 5B7MA 3QZWA 4N8VA 4PGEB 3WO4B 2HKFH 5KBNC 3U36B 3LNDA 3MLSH 2F5BL 3BQUB 2HX9A 2A74C 5FM5M 7TAAA 2HMID 2ARJA 3HPLB 1QACA 2IH1A 4O02H 1JOIA 5EZJB 2AABH 4BQBA 2L3BA 3DXAD 3IJSA 4OVUA 4OBSA 2DN7A 1LEIA 4H1LG 1OK8A 3LEYL 1USZA 5F1NB 3VXRA 2BFVL 1LMIA 1CYXA 1SHSA 3CC1A 4OBRA 3U0TA 2ZG1A 5DD6A 2BSSA 4WUKH 2C9QA 2X1XR 3FHAA 3UGXA 1FFPA 3IGFA 3D8MA 5I74B 5HHVL 3CN3A 12E8H 2X6MA 1MCSA 3CVDA 3P40A 5T3ZL 3T71A 3CH8A 1E8XA 1OTSD 4Y19B 3P4MB 5JIDA 5D1ZI 5EUOF 1GOHA 5LGYA 1KB5A 4OGAC 2I24N 3CLEL 4OLWL 1TZIB 3BVDB 3CUPA 3N04A 5ITFB 2VDMH 2YD2A 1UKTA 4WEBH 1QKZL 4JMXA 4YMPA 1WBXA 3IE4A 1DBMH 1GIGL 2WLIA 1LYQA 5C0CA 2VE6A 4JPIA 3EDKA 1UXMA 4FQXD 4UTCA 5D6CA 5ICUA 5CCGE 4R2GD 2R1YA 3LZOA 5EBMB 3EOTH 1K2DA 4PJFE 1OZUA 1OW0C 5EG6C 2XPZA 2DLFH 3D3VB 5HDBB 2F53E 4N0CC 4J6RL 2NY1B 5HJ3B 5IHZA 2WD0A 3L1FA 1EAOA 1LK3H 5GRWA 3OZ9L 4CMHC 1UCBH 3QDGB 2VW4A 3OKEB 3WNMA 1DBJH 4U1JB 3MNVA 3NMEA 3M17B 5KJ7E 2C1OA 2X09A 2B08A 3CFMA 2HVKB 4KKCD 4GUPA 4J3TA 3NZ8B 4N2BA 5D9SB 5E95B 3IGUA 1RJYB 5F7BA 2HFGL 1R3HA 2PO6C 3ECQA 4HC1H 1G6RB 4OCNC 5CBAA 1DL7L 1LVEA 2MSPA 1LDPL 3X11B 3SODB 1NFDF 1RHFA 4QRQA 3QDMA 1XGYL 3HAEB 4JHAL 3VGAC 1V10A 2VDPB 4GH7B 3ML8A 2BY0A 4GKZB 4KVCL 4D0CA 2DH2A 1V55B 3KJ4C 4O02A 1AHWB 2BIPA 1EHXA 1MNUH 4JQIH 5LWYH 1H0DA 4QXWA 3U6XS 4WI5A 2E86A 1U4EA 4I0PC 1BW8A 3WEBA 3GSNH 4LF3A 5ACLA 2V3FA 4XNBA 2QTEA 2E7CA 5I6MA 2VDOB 4EDWL 1B0RA 3HG1B 2R4SL 4GT0A 4ZNEE 2XA8H 2C8NA 2QKIB 3TBTA 5KANG 4ZTEA 3J7HA 2H47C 1TZHB 4WO4C 5TGBB 4NFDA 1KGYE 3ZMNA 3MA7A 4OIIH 4LEXL 3GEWB 2CKBL 2W8CA 1S7QA 1KG0B 1T04A 3KVDD 1YUHB 4ZYKB 3SPJA 2BW4A 2Y07H 2ERJB 2AFNA 4KI5D 3DMMD 3NRPA 4QHNA 4H8UA 3LEXB 3DHJA 1NJ9A 5DJDA 3JV0A 4PCTA 4DERA 2IANA 3WLWC 4ZOEA 1RK1A 2EEAA 3IDYB 4ORZC 1COBA 3E8UH 3OXSA 1A0QL 4HHWA 4KZEL 1Q9WA 3V4UH 1MHCB 3IE9A 3AS0A 2ZXDA 4N0CD 4RAVA 3S36L 3UTTD 4A2LA 4Z7NB 5CCHE 3UEQA 1F4WL 5DFVC 3IVKB 2DQTH 3BFWA 3ARWA 4JG0H 5HSFA 1XH1A 4LSUH 2QHRH 2EIZB 3LKOB 5EIIB 5CFHA 3GTNA 3H7BB 2EDTA 2JB5L 4E0RA 1G0YR 1UASA 3UAEA 3H3PL 2IDSA 5EUKA 2WWMD 2C3WA 4N28A 1N68A 1RIUL 5JW5B 2AEPL 4DTGH 2IBGA 4X5LA 3GHBL 3OSVA 5KS9B 3AUWB 3GXPA 2AXHA 3SGJA 2E6PA 3MCG1 3D4ZA 3AMKA 1NCJA 4M7ZC 4GG8A 5JPMB 3BESR 3LEVL 5AB9A 3FQUA 3AS2A 5CEZE 1A3RH 4IBZA 5EN2A 3NBNA 4K7PY 5T3ZH 3FRUB 2DQ6A 4XBEL 2LFGA 2WVVB 4HUVB 3CFUA 2YGQA 1QSEA 3BP5B 3K2IA 2VLRB 5JORB 3PAUA 3DRQA 1TQBC 5C7ZA 3APNA 3SOTA 2W65A 2AF2A 1HS6A 1X44A 1YJDL 3NCYP 4YDVA 3UBFA 1VB9A 3DX7B 1FH5L 2YKLL 3TBSB 2B5IC 5CINL 1NPJA 3TWCH 2CIKB 2C9XA 3L3OB 4Q56A 4AENA 1ZTXE 2VDRH 4UWQB 2COVD 2QLVB 5ITBL 1KYOJ 2R2HA 3LNFA 4YXHL 4U05A 4AL8L 1WAAA 1JZ7A 1Z3GL 4AV4A 4Z5RB 2VTFA 1SY6H 1R6VA 4JM4H 3IJHA 5LCVH 1RUAH 3BH4A 1MCWW 1RZJC 2VLMD 3P4OA 4E9LA 4PVLA 2WP3T 1DN2A 4OJEH 4RGMC 3QEQB 1QX1A 3D0VB 3CAFA 4OV6F 3WY4A 2BFGA 3I50L 3W39A 5HPMB 5DEZA 5J1TC 1YAZA 2X4SA 5F71A 5ABDE 5DJ8B 5ESQB 4CBPA 4ZMPA 4HUVA 4KY1H 2YRBA 1K5NA 3S8FB 3AB0C 2VMDA 5T3XH 4DGUA 1Z6JT 2RR3A 4IOFD 5B39A 1UVQB 2LLNA 5FGRA 4KROD 4L8SB 5M7QA 1F3JA 3WUWB 2VWEE 1RULL 2B59B 4JAMA 4R7DB 3VXNA 3MA9L 3GI8L 3HG5A 4N9GB 5DFVD 5JUEL 1IEAA 3VDBA 3NEEA 4UQ3A 5DSCA 3BPCA 4MA1C 2EH8L 2WSKA 3X3GH 3S88H 4HU2A 5J11C 2VB5A 1XGTB 4K7PL 4DH2A 3OMAB 4AMXA 2C4FU 5DQJB 4ZXBD 4ZFZA 1BXVA 1UH4A 3UO1L 3KYNA 5D7HA 4AM0A 1UWGH 3M46A 3BRGC 1YPZB 1Z0NA 4IIQA 3ZL4H 2HSIA 5ADOH 5LXGH 4WK4B 3T65B 3UG5A 5DMIH 12E8L 3DO7A 1Y07A 1J7VR 3BZDA 3BLKA 1F18A 4L48A 2VXVL 4F37F 1TTFA 2XV2A 1ZXKA 1A02N 2EACA 4MNGA 2FT7A 5JOPD 1NGQL 3QPKA 1KIUB 2CKBH 4K3JH 2VDML 3PCYA 1BP3B 1QEXA 4N9OB 3VMPA 4GQQA 3PWUA 2CJUL 4W6WB 4Z6AT 3GJEA 5IG7A 4YDKH 3B2VH 3D34A 4PWGA 3ESNA 2Z35A 5K59F 4P2OC 3KPSB 3KLSA 3NFNB 3PQYB 4MB5A 4JRXE 5IMKB 1G5GA 1MFCH 1OCOB 2VLRE 1A7BA 3EJRA 2PYEE 4L8BA 3E6FA 5JXED 5DRXA 2OMTA 4XNZC 4D9LL 1D5RA 3KVQA 1MFMA 3IDJB 4ETQB 3D05A 3AG3B 3TA3A 3NK3A 1BJ1J 1SBSL 3QO0B 1ETB1 2VSKB 5ALBH 3DTUB 1G1KA 4HPOL 2ZWKA 4OQTL 2NY6D 2WQXA 5I8EA 1R3HB 4PPTA 2DYPA 2DYPD 1AAJA 4N2DA 1S2EA 4JFDA 2OMZA 3FRPB 2YC1A 1AP2B 1DFBL 2AXFA 2WQ8A 1BEXA 2ADGB 2Y06H 4I3SH 5AW0B 4F5CE 3OX8B 5FHBL 3MDJA 1DSWA 2XTJC 3QNYA 2UUDH 4JN1H 4WCYL 4XX1G 5J9PB 4RLDA 2WXGA 2E7LC 3IJEB 3UP1A 4BKLB 1ZLWH 1HDMB 1UT9A 5HHOD 3V6FA 1Q1PA 4HK0A 5KN5B 2W0KA 3DXAA 1X7QB 2B8OT 3JV4A 4KVCH 4XPAH 2O30A 2Y4SA 2VZVA 5D6DA 4S0HA 4NT6B 3DJ9A 3GIZL 3TJHC 2Y6SD 4KTDL 4YHZL 1U33A 3GHBH 3OAWA 2OTUB 5B22A 4Z7WF 3H0TA 5H2BA 2O1AA 2R0KH 4A6YB 1BZ9A 5C0AA 1RUQL 5C0AD 5I71C 3AGVA 4LKXA 2W9EH 2X1OA 2X6UA 3NCWA 3SD2A 3U30B 4P5RA 5HJGA 3LH2H 3SPHA 4M5ZL 3W37A 5EO0A 5E23A 3EF7A 4DP1X 4FZEH 1X5KA 2VQ4A 4ANVA 2R4SH 4ZUSB 5FO2A 3UFIA 4ENZA 1KT2A 3BUDA 4FFWC 4YHLL 2Y36L 4JEGB 4D0BB 1IBHA 4LEXH 5EULV 4HG4K 5DURB 3VGDA 3G6DH 3BUYA 3Q2LA 1KACB 3QEUB 4X4XB 2X4NB 4F3FA 4QXGH 3BIAX 3SQOH 4HHGA 4HQQL 1AQKH 1C7TA 4PD4K 3ZHFA 4BIKA 4V33A 2F15A 1WC7B 4YHIB 4YXKH 4P04A 5DUMH 3WJJC 4JG9A 2BP8B 4O2FB 1D2PA 1KZQA 2BPBA 2BNQB 2ZE0A 5FM8A 2XQYA 4RDQG 4WI8A 4JO5A 5F7DA 4YDJB 1VAHA 4CGUB 3WGUB 3EJJX 1NFDA 1LO2L 4JM4L 1G1OA 3BZEB 2VL4A 3RTQA 4D9RD 3HUJA 4H13C 1PG7W 5D7KE 2OM5A 4L3EA 2Q86B 4NQXA 4K2UL 4HJ0D 3HC3H 2FEDD 1D5IH 1VRSA 4QJ4B 7PAZA 3FQXB 1N59A 3D2UA 4I48B 3WJJA 4ADIA 3WFCH 2VDNB 4LSRH 3MV8B 3O4OC 4H88H 4IU2A 2RCSH 4NNYA 3V4VL 3H9HB 5I0YA 3QPXL 1D5MB 4WEMB 1PZSA 3NIDB 4CMHB 3WFBL 3EH4B 3LPOA 1W0YT 4G42B 3LDBC 3D6GA 3ARBC 2ZYSA 2WXNA 4ETYA 3L3GA 4PJIA 5E94A 2FEDC 1QUPA 3RFZB 3ZZLA 4OKVA 5IB5B 1JP5A 3DUUA 3MO1A 4NRZB 1R5VB 4KH9A 2X87A 2JQMA 3O6FA 3RGVA 1KLFB 3O6FD 4BCYA 1A3RL 2Y7SA 1EHKB 2M2DA 4K94H 4LLUA 3ESMA 4PJHA 4AEHH 4UV7H 3LXUX 3NJFA 4UNIA 1MWAA 2HKHH 2UXGA 1MQKH 4YGVB 3HBGA 3ZDYB 4Y4HD 4I87A 5DUPL 2WN3A 1GC1C 1NIAA 2CO3A 2LW3A 4LU5H 5ECJE 3HS9A 1T0NB 1NGQH 1LP9B 4JFOB 4G6AC 4LKXB 4NNPL 2R29H 1TO5A 1Q9LA 3J8F7 2PWFA 4LAQL 3X2QB 1PZ2A 1K4CB 2CLZA 1WWBX 4WU7A 3TH2T 4NRXA 1UD4A 3NCMA 3TLRA 2FIKB 2CJ3A 3PGFH 3WFHB 4XH2A 1UH3A 4XMLL 5FUZL 1GVIA 1K5NB 1CWVA 1YG9A 1YN6A 4PRNA 3KLDA 3ZK0A 4KAQL 4B9IA 1EEUA 2AJVL 2OX5B 3KPQA 3N43F 5B3NA 1XMWA 1TFHA 4TQEH 4WJG3 2P5EB 1C08A 1Q72H 5E6IB 3MLUH 1UG9A 5SX5K 3M45A 5B8CA 2XI9A 3QUZA 4PJBA 3N41F 2J5WA 1TQBB 2WXPA 2WLLB 4KY1L 1DFBH 2EZ0C 4HUXB 4RFOH 1N5YL 4ACPA 2DZEA 4FE9A 4L1BA 2FSEA 5E6RB 4AC2A 2VM9A 2WMPA 4Y88A 1OTTD 1RULH 5JPNC 3DVFA 4YN3A 2EAEA 3ME0A 4M1GH 1TOXA 1YNTF 1KGWA 2B2XL 4L37B 5CKAA 2F8VA 4WFED 5JDSB 1XGPA 3HCVB 3U4EA 4PRIE 5E5LA 4KKBC 2H2PD 2YPLD 1B0IA 3DJTA 4TUKL 2YXWA 4W4OC 3RVWD 3WXWH 1U6AH 4HIHB 4XPAL 4J3UA 5E8OA 2Y23A 1BX2B 3L95B 4ABVA 4CN6A 3OSKA 1TKWA 3MX0A 2WUCL 3UOAB 1CGXA 2XOTA 1P1VA 2W0PA 1IE4A 4ZDHB 4X98B 4KQ4L 1RZFH 3ML9A 3SKMB 1RUQH 1KY6A 2W9EL 1KIUA 2ZWSA 4JDVB 1V7MH 4WI6A 4EIUA 3MGOA 2G5BA 4QRRE 5DMIL 2F7QA 4LMQI 1KBKA 4W70A 1CIDA 3FFCA 1R3IH 4JJHA 3HFMH 1NICA 2GAZB 4QKTA 5KSUB 2R69H 3UYPB 1I8UA 3VMNA 1T0PB 1WFOA 1FNSL 3FFOA 5FLVA 1JF1B 2ZQKA 1MF2L 4S0TD 3E3QE 3V5HA 1VEOA 2GI7A 1GW6A 3BUTA 4KK8D 4ZSOE 5CJQH 1JWMA 3SBWC 4PSRA 2XVBA 5I15L 4YDKL 3B2VL 1KBWA 2PABA 2PXYA 5SWQB 1MLBB 1PG7L 3FU3A 1Z9OA 3L17A 1MW1A 4J2QA 4ELKB 4N87A 1MFCL 2UZYB 3VXPB 1R24B 4L4VA 5TE7H 4B3VA 2CJSA 1DJZA 1CO1A 4KRMB 2OTPA 2CDFB 4GW5B 5I6OA 2DQUL 2WVUA 1E4JA 3QIWC 5ALBL 1H5BA 5AZEH 1G9MC 5IB3B 1XQ4A 1X9QA 2OR8A 5EPMB 1JK8B 5D2LB 1O75A 1KCUL 2C3GA 3LVTA 4Z7VA 3MBEB 2A6DA 5E6UB 5T1DH 1JF1A 1KPUA 3U0WL 4B7LA 3MU3A 3UP6A 2P47B 5F7NC 2XXFA 4TKWA 1ASPA 3Q6FB 4XP4L 5I82A 4TSCH 1CXEA 2UWEF 4PJEA 3ZKXB 2NTSP 5EF3A 1GZHC 3Q9QA 1TSRA 3T0EB 3VCLB 5JW3H 5B1AB 4U7MA 4X83A 3OKNA 5GJSL 2F7PA 5J7CC 1RZJH 3AWGA 1TYEB 3AU1B 3RTQC 4PJ5B 2K6WA 2FATH 4RVBA 4XPGH 1A9VA 3WNNA 1I8LC 4KRNA 4NKQB 2WZ0A 2AV1A 5DS8B 4NI3A 5DJXA 3JVGC 1U0QA 4ZMTA 1UQSB 3FH8A 4HEPG 3LH2L 1H3TA 4GMTH 1JF5A 2WO3B 1DEDA 4PRHA 4CADB 4ZMWA 1AR1B 3PPEA 1BIHA 2WCSA 5E5MA 3B34A 1HH6A 4FZEL 1JMZA 1KJ2L 2OFQA 3K91A 3PAYA 4F7EB