4OJDH

Crystal structure of a c-terminally truncated trimeric ectodomain of the c. elegans fusion protein eff-1 g260a/d321e/d322e mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
477
structure length
444
Chain Sequence
RAEPPHCSKTPIVRAQTSQNAMGMQMQFSIGLHTAVCFRLYSLLHTIRLEKLEHHHPITQRYTFGIPEVHASCICECDATSSTCTAESHQFTACPEDETSSCYRTFFPNQTPIGCSEDDIPKLCCDVRFKPYKNMTFLAVKLEQPTTYATFVYAAYDFVNGYWVEKDKTKIRSQLDGGTQDRHLDQKRRISLAVTAGARASHQLETGMYFSRTSNGGETEELRMQPLNEITDNNFDRLGWYRMDDSGHFHVNNGVVKMEEIHKAKVKNCKEQTYKSILSANHYMPGHFNLTRPLEVIKPWIQSARIFDSSLRQAVVTHAEGTNLQISIHLESQNLVFFHNASRIRDFSGSIIVDSKSNRLFNLTVYEASGKIDGSVKMSTGFGSDTIHTFTAYVSDLHASNRSMIIPLPAIVGQGARAICLRADSMADIDKICHVIEYFESPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EFF-1A
publication title Structural basis of eukaryotic cell-cell fusion
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Membrane protein
total genus 98
structure length 444
sequence length 477
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ojdH03
2.60.98.60 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein; domain 1 4ojdH01
4OJEH 4OJDH 4OJCA
chains in the Genus database with same CATH superfamily
4J3OH 5B7EA 4PM1A 2YEVB 4QT5B 4OLWH 3ZHNA 4YFDB 4KJYA 4P06A 1CL7L 4HUXA 2XVKA 3MCKA 5CFHA 2CQVA 5GS2H 4FNSA 1IT9H 5CLWA 1WG3A 2ZF8A 4GUOA 4XBEL 1HN1A 4I88A 3D34A 3BKCH 4HX1B 2D31A 2BINA 5I0ZA 5EO9A 2Q7YA 3MV8D 1R46A 4M5ZH 1UOVA 3CBRA 3KYKL 3IMSA 2GJ6A 2H41A 1LE9B 4XPGH 1JZGA 1Q94B 2R7EA 4KUCD 2IFGA 4N22A 4OF7A 3W39A 4R26L 4WEUD 2HJKA 4NGHH 5I74C 1YC8A 2MNJB 4NXKA 3AZUA 1DVFD 1B2WH 4OUUB 5T1JA 5ESQB 1XIWC 1VAHA 2XTSA 1H6UA 4YWGH 4B9KC 1M9SA 1S4IA 3T6VA 2E9IA 3SBQA 3ROOA 2ZXDA 3TZVB 4E41E 1GZHC 3QDHA 2D73A 3QWQB 2JJSA 1PZSA 1TJHH 4MMXC 1DLHA 2P7TB 4RGNE 5EC1B 2OTPA 4PGCB 4NAJA 1XH3B 4FQJH 2CM5A 2FUTA 3NCEB 5HGBB 3L3KB 3T3PE 5HP5A 1JIBA 3QIWA 4ZMVA 4LVHC 4WK2B 1OLZA 3U7WL 2A2QT 4PLOB 3O6FB 2R8SH 4LSSH 4UNVA 3BW9A 2ICEC 1XGUA 3Q13A 2BC4B 3IRCA 4HUCA 3MN8A 1YEEL 4OZHB 5JW5A 5FOJA 2F7RA 3QQ9D 3T6XA 1YPZF 1QZ1A 2JKWA 2XCMC 4IW4C 1B6DA 2ZUSA 3QUHA 2CR0A 5AW6B 4BSWA 3SOBL 1J88A 2C9RA 3NMEA 2VR6A 4LCUA 3I9AA 4QHLB 3WJMA 3LRHA 2A6DA 4EI5C 3L54A 4J4PD 5B3JE 3W9EB 3WI9A 3V0WL 4BA0A 5AOZA 1G9MC 4E5XB 4F1SA 5KAQF 3DTXA 1LP9E 2NQCA 3W37A 1MDAA 3DX4A 15C8L 4KO7A 3WEBA 2A5UA 3PWJA 3T0WA 4QO1A 1A7OL 3RYMA 5IKCB 3L4CA 4PJBE 3FMGH 4JPQA 4ZPTA 2WLKA 2P45B 4KRPD 1A9BA 4H2AA 1AP2B 4OZ4A 4TOYH 1JBJA 2LLNA 5AVUB 5B7MA 5EU4A 1KZQA 2FIRT 4Z3EA 5JIIA 5C3TA 3WEAA 3DX8B 5JPNA 1U8MB 3DX9A 5KVGL 1MI5D 5C09B 1P5UB 4X8CA 2DPKA 4XMTA 1EJ8A 3WXVH 2DQUH 1IBYA 1NAKL 1E40A 1WBXA 1RPUA 3ZZSA 1RPKA 2X3AA 3MC0A 5DRNB 1R3HB 5FO2A 2XPGA 5I1CH 3CX2A 3H9HA 1P7HL 5IW6A 3SD2A 1I1YA 2ESVB 2EH7L 2VQ1B 4P05A 4BJLA 3ZYOA 3GBNL 1L3NA 4G8FA 5D7KE 3SDCD 4RAHA 2RD0A 4LBEB 1S7QA 4NHCL 4X6DE 4Y16B 1ZKAA 5AD0A 2A6KB 2EDQA 2K1MA 2Y25A 1NTDA 5PCYA 4OF3A 1RL1A 4IIQB 7PCYA 2B8OT 2CO6A 1IJ9A 3OWRA 3BPCA 5EO1B 3RJDA 5L4FA 3EYSH 4OQTA 4YGVB 3EGXB 3L13A 4P9MH 1WCBB 2E9GA 1NAMB 3ZN6A 4MAYB 5I76A 1UXMA 3UAFA 2FECI 1UADC 2OQJB 2WLJA 5DVMA 1ZEAH 1KENL 2WNWA 2WZ6A 4KK5D 4AQAB 1SDDA 4ODVH 3AUWB 4I5BB 1FNLA 2R2HA 3E8VA 4X6EA 3FQRB 3WUWB 4DN3L 3NBNA 2WUBH 2GIXA 3NH7L 2XFXA 3OAUL 3W82A 2Y07L 1C9SA 1DBML 3D39B 3K81A 3AT9A 4YC2B 5LKNA 1L7TH 1BECA 3BRFA 3DETC 3O6ML 4U0RC 4YBLC 1G7HA 2IANB 3ARGC 2R4SL 1FBIL 1BJ1H 4QRRB 3SYQA 4X4MA 5CGYD 1INEH 1BOGA 4LCCC 1Z0NA 3L7EB 5D7HA 4MA3A 2XG4B 1UWEL 5FW6A 3WDIA 4K23L 1UM6H 4JFPB 5FHAL 4B96A 4CKVX 2D7MA 3HG1E 5CKGA 3SD5A 3OJDB 3HHSB 1KJ2B 4FQHA 4WZ9A 2OL3L 2XN9A 1OGSA 2DMHA 1D5XB 2P80D 3UZVA 2NXZB 1OY3B 3TN0B 3WS3A 2R0KH 5TQ2L 5IFAH 4ZT1A 2C1PA 3JV6A 1EXGA 4XVUD 3NIDB 3WYRA 4D0BA 4EQ2A 3GSNA 1CGWA 1BM3H 1ZTXE 1IBHA 3NTCH 3GNML 2A9CA 3INUL 1YEWA 3WE1A 1LEIB 2NXYD 1SQMA 1T21A 2F54D 2IADB 4ODTH 5DJZA 3VFPB 4DP9X 3P4NA 5E1GA 3V5HB 4NZUL 4HC1A 1Y0LA 4WO4D 4JZNB 5EBMA 1PFOA 2X2HA 4UZGA 1W2KT 4GINA 4MD0A 3VMPA 1IEHA 3RFZB 1J86A 1XGZA 3LEVH 1XB3A 1JTOA 2EADA 2R2BA 6PCYA 1W6WA 3FYEB 1UM4L 4FMKA 1DJZA 1G7LA 3K2UL 3TFBA 1UACL 3V7AE 2XKSA 1DQQB 4JHAH 3WMPA 5BV7C 1P4UA 1S9VB 2XT1B 3KNBB 3FHEA 2V2TA 3U1SL 5BXFA 4KZDL 1ETZB 2PW1A 5ETUB 4QWWC 3MOBH 3GRBA 4A7SA 2VXTL 4MJ4A 2IGLA 1NMBL 1R5IA 4PRBB 4L0ZA 3IB4A 4C54A 2KYIA 2VUYA 4JHBA 3BGMA 2ZWYA 4PJDE 3FB7B 4X4ZA 3P54A 3D0AA 3ZPDA 2HFFB 1JF1B 1SUJA 2WXOA 4A1RA 2R1YB 5I8KH 4NZJA 2OPCA 3LV3B 2E8YA 3MGOA 5C0CD 3O11A 1S46A 3SKOB 5CP3A 1RUAH 3KW8A 5DURB 5E08H 1EX0A 2VLJD 4OJCA 2DW5A 2ZYHA 1ZT4A 3OJMB 1Q72H 2UWEB 3JVGC 1NGQL 1SHWA 5KBPA 2G30A 3PWVB 1NGPH 1DQMH 2WXPA 4NI3A 4WNQB 5E94B 4A7QA 2AK1L 3DUSB 4FNLH 4P5MB 3KGUA 4E9TA 2XIDA 3PWLA 4XBPA 4ZQKB 4K0OA 2GYSA 3BYYA 1BVLA 3EDEA 4YHKH 5JXEA 2VIRB 5LCVA 3RGBA 3NJJA 1WFJA 4FQCH 4UOW1 1T3FA 4JM2D 2AKRB 3S3BB 3WFHB 3ATAA 2V5SA 1AQHA 4M6OH 3ILQC 1HKLL 4NOFA 3HG3A 1N67A 5TK2A 4AG4H 5D7JB 3T2LA 5EEZA 1GKEA 1PDKB 4G8IB 3H55A 3MJ9A 4HWNA 5BCAA 1MAML 1L0XA 4Z1PA 1A9EB 1G1OA 3L9RB 3RWGA 1Z9MA 3ATDA 1ZLSH 4M8VA 4PLJD 4YHZL 2VGLM 1IKNC 3Q3GA 3VWKA 4A38A 3RIKA 5GGTH 4D3CL 1NGZB 1U42A 2GK0B 4NN5B 4BCYA 5JPMC 2NZ9D 5GZOA 4JVUA 1A6ZB 4OF0A 2W65B 1MFBH 1N64L 6TAAA 5JOFB 4RMUA 1QFOA 1ADWA 1DE4A 1QLEL 1RIUH 1YPZE 2WBJB 3MLUH 4XNZC 4ZMZA 4YZFE 4PR5B 3SKJL 2VDQB 2Y1AA 3O4LB 3AXHA 3FN0H 5F9JB 5KJ4A 3BEVB 3LH2H 4Z7VB 1D7DA 1W9XA 2YJQA 4YE4L 1HHGA 3MLVL 3PQYA 2O4EA 3HC3L 3ESNA 3RUGF 2DYPA 5JZ7D 1PKQE 5BUAA 2N1TE 4Y5XA 5GHWL 2F1EA 2F58L 1E50A 1DQDL 1OWWA 5EMYA 3WDJA 3AQYA 2JJTC 3MDJA 4LGRB 3MRNB 2IF7A 1UWXH 4W6XB 4U1GC 1NPUA 4EDWH 2FTAA 4X4YA 1T7ZA 1CICD 3QFDB 4MJJA 3T4YB 3VG0H 1BFSA 2EKJA 1PGRB 3EOAB 2VE6A 4PGEA 1OP4A 3NCJH 4GLRH 2BVEA 1WAEA 3KXFB 3PGDB 1JXFA 1P2CA 2XI9A 3T1FA 1ACYH 3VXUA 1OGAB 5AZ2L 1VGEL 4HCFA 3FB6B 4OVVA 3KPSE 3CLFH 4OZGA 3V0FA 5BO0D 4HPOL 2QQLH 2DWSA 1JFHA 2G3NA 3BJ91 3C5ZC 4UAOC 5CBEA 3QPXH 3VVVA 3BRGC 2D8KA 3GKZA 5GXBB 5FOBA 2NNFA 4OZHF 2JCWA 1T04A 4LOUC 3EDKA 4N2NA 5CEXA 1E42A 1NKGA 4NO3B 4TUKH 3VXMA 3QWNA 5CINL 5K93A 2NDFA 2XU9A 2XTJB 4XGZA 1H9DA 4R4FL 2E7HA 2X3CA 1A5FH 5KVEL 2XACC 4HIPA 2CM6A 3KEHA 5FM5O 1QLRA 2PXYB 1E8XA 1UYWH 3NIFE 4F37F 4GI9A 2AABH 5KOMC 2ICWJ 4D7PA 1TJGL 1TLMA 4L3CB 3QO0A 3LPGA 2FX7H 5CEZL 2R0ZL 3GRWL 5DEFB 1X7TA 4GW4A 2QGEA 2QMJA 1TJIH 3K2MC 5A2IH 4YO0B 1BIIB 4QGYA 2EO9A 5A16B 4A39A 3QBTB 1K4CA 1QFUL 2JJWA 3IDYC 3HG0A 2EJ1A 4QEGA 4YHPA 3AT0A 5A2FA 1Q9LB 2MPAH 1KG0B 1CF8H 1CGSH 1ZIAA 2A0LD 3CFJB 3O0RL 2FHCA 2PPEA 3O41B 3ZDZE 1FVEB 4S1SL 3GZOA 4OLEA 1D9KC 5L0QC 1MCBA 1JPSH 5E9DB 3ZZLA 4EUPH 3MODH 2ITFA 3IFLL 4IGBA 4KKNA 3PV7A 2GCYA 4I89A 4K5LA 3OWEA 3CVBA 5C0RL 3SGKA 3HS8A 2E6QA 3ZL1A 5KBDA 4WU7B 3CTTA 3PYCA 4FNRA 2BIQA 5J1AB 1CN4A 2AAVA 3SCMB 1G9NL 2WN2A 3QDGB 5C07B 3ZE0B 3VB9A 3TO4D 4B50A 2PWEA 3ZHLA 1OV8A 3P40A 2IAMC 4QHUA 5E5MB 4RMWA 35C8H 3IJ7A 3MA9H 1FYTD 2NW2A 4OLYL 1YQ2A 5JW3H 5HVHC 1H3TA 2AXWA 3P4LA 2J55A 4OIAA 5F7WC 2P4AB 4GOSA 5D71H 5MI0B 4G1MB 3GI8L 3DGGB 3GBML 1Q1PA 2VDKH 4XN5A 4O9HL 2NOYA 2WYIA 1K5NB 4IOSA 4JY6A 4ZTEA 5IESL 3FU3A 3HNVH 1MLBA 5C0JA 1T4KA 1SF3A 3MRCA 1JPGA 4GP4B 4QI3A 3TWCL 3CZJA 1FZMA 4FQIH 3ILPB 2J1YA 5GJSH 1VF5C 1MRCH 1MVUB 2GSIB 3FSZA 6PAZA 2FSEB 1JHKL 3OZLA 4YHML 2QPDB 1GYWA 1QI4A 3ENEA 3NJLA 1BQ5A 3EUUA 5C0BD 5BQ7B 1E3ZA 1QSEE 4A2FA 3UJTL 3ZTCC 4W6YB 4BD4A 3U6RB 3TBYA 3FBKA 1MCQA 3M1BA 4HV8B 2NY4B 1XGPA 1KYFA 1Q9KB 4XE5B 3IXAA 4YOKA 4P3DA 2YRBA 5KOVC 3JTSB 3UZEA 2QGCA 3A0OA 1J8HA 2FO4B 3FB8B 4GRWE 2XWZA 1MY7A 2GEQA 2DQDL 1H5BB 3UJIL 1GGCL 3CFDB 4XC1H 5DHVB 1CG9B 4BYHA 3C6LB 3NIDF 4IBYA 1BF8A 2YLHA 4GRWH 1TCRB 4YLQT 3RA7H 5JIMA 3AB0B 5IHLB 2AJYL 1CU4H 2B2XH 3KPQA 3ZTNL 4BFBD 4PGJA 1QFWM 4YDVA 1OE2A 3RAJL 3QRFM 2FR4A 4P04A 3ARBC 3REVB 1SEQH 1JZ4A 1HDMB 2AK4D 3BIBX 3RLSA 3WIHA 3O2WH 3KPRE 4Y2OA 1ZDSA 3U36A 4JFTA 4KTGA 5JO5A 3VFNB 1CLYH 4HETA 3K1KC 1SM3H 3CFCH 2ZTBA 5I1IL 4Q14A 1TQTA 1WA0X 4NUMA 3SHSA 1EDYA 3QXTA 3SDXB 1N0LA 1R19A 4KI5D 1G43A 1CFVL 3QG6A 3GGWB 5DC2A 3TOPA 5GISL 5CJXA 4HWEL 3MCLH 2NX5A 1VPOH 3FUKA 2XVLA 4H5SA 1QABA 2AANA 3LMJL 1R5WA 2J8HA 2A74B 1A7BA 1YMMD 3HMXL 4HKXA 4XAKD 5IQMA 5ESVA 3CG8A 1BPLB 3G9VA 4HS6A 4YSSA 1SF5A 1SJHB 2FB4H 4LASL 4UIMA 1NFDF 3CXHK 4JQXA 3BGFC 3DOSA 3SZ6A 2OA9A 3G5VA 1IM9A 4AM0A 2ZWNA 3IU3A 4EN3B 3ZZQA 5B1CA 4ADGA 3T2PA 2IPUG 4RNRA 1JVKA 4X4XB 1YUHA 4J2XA 5I18H 4MJIA 5IB2B 5FYKD 2WBKA 2HG5A 2J44A 1TF4A 2DH2A 4G6FD 4LRIA 1E4WL 1MCJA 4NZTH 3LTVA 5DVPA 1QEWA 4LLWA 3CZEA 5G5DA 3O2DH 5FLUA 4TTGA 4MZ3A 3T0EA 3A4EA 2VZOA 3DKHA 3NGBB 2DQHH 5KVDH 4J39A 1L7IH 4AVKA 1XD0A 4GIOA 4TKWA 2WY3B 3MACL 1M71A 2JIXB 4C83B 5IOPA 1FNEB 1RJZB 2P47B 1OTTD 5IR1A 1OTSC 4L4TA 4TQEH 2QHRH 4FG6D 3A6OA 2WWKO 4PJXB 3UTSE 1KBBA 2I24N 4GRMB 2VRQA 2NUPB 4LPYA 1LILA 2BSDA 5EF1A 2YAHA 3RWHB 1UC6A 2DIEA 2I27N 4M3JA 2EVFA 2FJGA 3LKPB 4GBXB 3BT2L 3Q1EA 5KSVB 1KEGH 2NY0D 3IJSA 1RULL 3L3OC 1UXSA 4GI8A 4HIEB 1VFBB 3NFSH 4BFRA 4J28A 3OXSB 3MJ7A 2H32B 4Z7OB 3ULVL 4AKQA 2V2XB 4GAYA 3F7LA 4U1LB 1AQ8A 3WFBL 5AUMB 4APQB 2X4RA 3MROB 3SDYL 4CKQA 2OJEB 3VD7A 1IV8A 4K9EH 4O4YH 3QORC 4EZLA 1U8QB 2P5WA 1NCAL 3BWUF 1LNUA 3X11A 2PTVA 1KWGA 5DHEA 2FIKB 4JFQB 3SJVE 4HS3A 3VFMB 2EDRA 1X9QA 2QV4A 2JELL 4MNGB 1HHHA 1I8LA 2R0LL 4Y1AA 1UD4A 5H37H 3OAWA 2BW5A 4ZUSA 3HRZC 2BNRE 3H4FA 5D6CA 1T1YA 2BLFA 4WV1A 5CIPB 4Z7VF 2WQWA 3ULUE 1FA4A 3WJLC 3OKEB 4RQQB 4DKDC 1AJ7H 1A6WL 1IC5H 3TYFB 3ZT5A 2HLEB 1KTLA 4AIZB 3MGAA 4B3VA 2BRQA 1SJVA 3SE4C 3ULUH 2YARA 3U83A 3G5WA 5HHMD 3LZFH 4ANKA 2I07B 2DJ4A 3VXSE 3VGBA 4QY8B 3EDFA 3K6DA 1AFVH 3VSVA 2FYYB 1QRND 4XVTL 3ISYA 4E5XG 1GA2A 3K1DA 5I8EA 1FV1B 3C8KA 4QXTA 1MWAB 2WLYA 1Y6NR 1QTYT 2R9HC 1HXYB 3LEYH 1OPGH 3PHQA 4JGUA 4N24A 1U58B 4JFDE 4WFFD 5E1HB 3IDGB 3LSOA 1F58H 1SEBA 4KVNH 2HWZL 3F64A 3AXLB 2DYRB 2PP9A 2Y1ZA 1AHMA 4BM7A 3NPSB 3JWDH 4OGXH 4PLKC 3OPZL 4APXB 5DD3L 3RDTC 4MNQE 1RZKC 3G3LA 3ZL4H 4AQEA 4BZ1A 3QIBB 5K1NA 1CDBA 1BZEA 3BQUB 4KK9D 3A5VA 3BH4A 4GKNA 3TNMA 4X5PA 3WELA 4FG0A 2AHIA 5HYJE 3L1FA 3I6KA 4H0LC 1V7NH 1IFGA 2OW6A 1I85A 1PCXA 3GHPA 2Y5QA 4X7TB 1WA1X 4QTIH 3TBVB 4FP8H 4M1GH 4NQDE 2DZEA 2DIJA 4CUCA 4UBDD 5HBBA 3ARTA 5EU3B 4LLQB 3MLYH 3THML 1GIGH 3D18A 2QKIA 3ZKNC 2X44D 4KHTL 2NCMA 1BAFL 4E9WA 1HFUA 3NUKA 1AO7E 1QSVA 3SYOA 2Y69B 1FH5L 3STBA 3U9UA 3HFML 5GRJH 2O6EA 3DPBA 2B1OA 4ELME 2UY7B 3BZFB 1I9RH 4QT5A 1JGDB 1OHQA 4X7SL 3P2BA 4K2UH 1MN4A 2F18A 4FXKB 4AIXA 4HX1A 4DP6X 5C0EB 2ENQA 3UTTB 2ATPB 1XZ0A 1A6UL 4UV4H 3DX6B 3SQOL 4PUBH 3K6FA 1Q94A 3MFFB 1CC3A 2B39A 2YEQA 2VDPH 2BPBA 2YAFA 3HMWH 4XNXL 1CVSC 2PWGA 1PLBA 4NWTH 3MRKA 2YN5A 3X1FA 4DO4A 3MRMA 3T0DA 3ZE0F 4MS8D 1HT6A 1ED3B 3JWNC 4OUUA 1T2QL 4QHNB 5ESQA 1KGIA 4W6WB 2PWDA 5DZOA 1A1NB 3NACL 4EO5A 1USZA 2P5ED 4YNYB 3TZVA 3FU7B 5DGRA 1C8QA 3VXRA 4IBVA 1G6RA 2ZCHH 3CZLA 4OFKA 3F65A 3GTTA 5EC1A 2P7TA 1CJYA 3AM8C 1NGYB 5FS5A 3BSHA 4YDLC 4ABVA 4PGCA 5SX4I 5KYXB 1XH3A 2ADJB 3PPEA 5HGBA 4HZLB 3L3KA 5KS9E 1XL6A 4M1CD 5EU5B 3RDJA 2YD0A 1EVUA 2BFVH 4OF6A 3VRIB 4U1HB 5A2KH 3O6FA 4CSTA 3QEHB 1WZ1L 2MOVA 2BC4A 4G6KL 3AQDA 4D9LL 2RR3A 4IK6A 4UDUA 4XI5C 3M8OH 4OZHA 4ANXA 3FUFA 3MXVL 3WJJC 5JA9A 2CKBL 3OSKA 1L3WA 5JHDE 4U6YB 5ITBL 3MCYA 1EZLA 1ZT7B 3ES6B 4QHLA 5E2TH 2UVEA 2ZKYA 2V5RA 3MTRA 4HOWA 3WN6A 3W9EA 1DO5A 3VYNA 4AUJA 4GFTB 4X83A 2IV8A 4ODSH 1QSFE 4E5XA 1YNTF 2PNDA 1CTNA 4HMEA 5CJBA 2B59B 4K3EL 3O4OB 4HCRL 1NFDE 4IRZL 2NXYB 2OZ4A 4K8RC 5I1DB 5IKCA 1JUFB 4ALAC 3QQNA 4M7LT 1O6SB 4NQVB 1AP2A 4Q6IC 4TUOB 5D7IB 2W0KA 3QAQA 3GIZL 1P5VB 4OIIL 3DX8A 1U8MA 3FJTA 2Z3FA 2YD7A 3G5XB 5C09A 2PPFA 1P5UA 1AMXA 3MAWA 4MLIA 1H8NA 5JMOC 3SE6A 2J4WL 2AMUA 4ZNEE 5K9QI 1OAZH 2WXHA 3GXUB 4NPJA 1OAXL 3M07A 3RVUC 1SOXA 4OFPA 5DRNA 1R3HA 1S7VB 5HDBB 2OCJA 3UXFA 3P3RA 1T1WB 1A0QL 1G94A 4DQOL 4PS3A 4G8GD 1XCXA 3HI5H 2VLKD 2VQ1A 3ARFC 4G82A 3SDXF 4AITA 4HUWB 4U3CA 4G1EB 1DANT 4JY4A 4NC0B 3IJHA 4LBEA 3NSYA 1MCPL 2YAPA 4XP6H 4Y16A 5FECB 1JNHB 5DUJA 2A6KA 4PJHE 5F1KC 3VE0B 5I74B 3MBED 3VFGH 4LDLB 5C0CB 4DF9A 1KXTA 4GKOA 4IIQA 1CF1A 5IUSA 4X8XA 4PCSA 5EO1A 5FYJL 1XTLA 4YGVA 3WD5H 3EGXA 1IC7H 1WCBA 3S8GB 1NAMA 4OCWH 4MAYA 2V8MA 3HB3C 4Y1TA 2OQJA 4WWKD 3HE7D 4G5ZH 4UT6L 4Y4FD 4AQAA 4GAGH 1KTRL 4MMXB 4I5BA 3HG4A 3FQRA 2VDOH 1MZZA 2D2CC 1UGNA 2VR9A 3WKYA 4AYEC 2UXGA 4JRYB 3UC0A 2EUWA 3R7RA 4PMEA 4LVHB 4EIGB 3D39A 2P3YA 5BRZE 4GAJH 2Y7MA 3HA0A 3AT8A 4Y89A 3W0WD 1T2XA 4PW3A 2ZOKB 5DQ9A 3UAEA 2IANA 4Y1SA 1BJ1J 2NY2C 1BFVH 4PJXF 4QRRA 5BV7L 4FKHA 5HHOB 3E8UH 4R96B 3LX9A 1SVBA 3F6IA 3L7EA 4ZMNA 2XG4A 5IVNA 4EI5B 4L2LA 5KWYC 4JFPA 3GK8H 3OJDA 3HHSA 3GDBA 1KJ2A 4Z7OF 1D5XA 5D2LB 1PZCA 5LXVA 3FQWB 3TN0A 4QHKJ 2DI8A 4LXFA 3G6JB 1I7TB 4NO0B 1J10A 4PB9H 3OKDA 2XLLA 1NUFA 1E2WA 4MZRA 4ORZC 4DETA 4YPGB 4N0UB 1HH9A 4RIRB 4KUCF 4B7LA 3O8XC 3NSXA 2GI0A 2IMMA 1P84J 2Z35B 3EBHA 4XC3H 4O2EB 5A2AA 3POHA 5JR1L 3VFPA 3OD3A 5D9SB 5H35B 3V5HA 1KCVH 1HAWA 4JZNA 1R0AH 5F1SA 2WYZA 3CSGA 5K9QG 5K1VA 4O02H 5DHDA 3QFJB 3RFZA 2QADB 1FVCB 1KB5L 2QL1A 3R8BB 5J6HB 2XWJB 3TJPA 5EA0H 2GFBA 2G3XA 4Z7UB 4HLEA 1JYXA 1HL5A 1XQ4A 2R69H 2MOGA 1DQQA 4AYMC 3TA3D 1VFUA 1N70A 3KNBA 2VW4A 2B1AH 5DQDH 5KVFL 1AZVA 1LK3L 1ETZA 2EIZB 3ECVA 4XVJH 4JO2H 5ETUA 4X8JB 1UFGA 3FQXB 3MOQA 3OXRB 4P23D 1PX3A 4N2OA 4DW2H 3ASOB 1INDL 4C56D 2N0KA 2R83A 4KFZC 4PRBA 2Y6SD 1TYRA 3BPLC 3WL9B 3HS9A 3HS0B 4PJ5B 1Q0EA 3FB7A 4YBQD 1ROCA 2HFFA 4K07A 1JF1A 3TC9A 2J6EA 4EAEA 2R1YA 4R90L 4TNGA 2HT4D 3LV3A 3LOWA 1X6NA 4KHXL 5ID1A 1KY7A 2YPVH 5DT1H 4FYSA 1K6QL 1N5AB 2VR4A 4OFDA 4ZUVB 3RVVC 4XOCA 2UWEA 3EJQA 4IDJH 3KVQA 2J1ZA 2VXQL 2HFTA 3PCYA 4U0RB 3PWVA 1JNLH 1DJGA 1PVHA 2K3HA 5DZVA 4WNQA 4YBLB 3V4UL 1JZ5A 3ARGB 4GMSH 3ATFA 1KJ3L 3D4YA 5E94A 2DMGA 2HJLB 1QRKA 1N0XH 3DUSA 3HKZA 4P5MA 2LW3A 5FYJU 3AG3B 3JBG7 3MRLB 3OGCB 5C08E 4ZQKA 4LCCB 2VIRA 3L7FB 1T0OA 4OAWB 5DZLA 3FCTB 2YGPA 3WFHA 2AKRA 3LKOB 1A7PL 2MNWA 2V3FA 4DVRH 5D7JA 3G6DL 4Y5YC 4B0MB 1PDKA 4G8IA 1RAMA 4O58H 3B2VL 1NCDH 4BQ8A 3TYGL 1A9EA 3QZPA 2C9PA 2PMZA 3L9RA 5DA4A 3LS5L 4YHLL 3JWOC 2WVSA 1OE1A 2E7MA 3NQIA 3CVHL 4MYPA 1R24B 1CR9H 2WYHA 3D0VB 1NGZA 5E03A 1EBPA 2GK0A 3ARED 1Y7VA 1E6OH 4NQCD 4B60A 2ZD0A 3LIZL 3GEWB 3V4VL 2AGJL 1JFQH 1A6ZA 1INQB 2W65A 3NJIA 1OGTB 3DYOA 5JOFA 4FFVC 3OJ2C 2WBJA 5GRUL 4YX2H 1NCCH 5E0FA 4K3HA 4PR5A 4WK4B 2BSSB 5DC0A 3O4LA 2F19L 4HALA 4MYWB 1FYTB 3BEVA 4MXWH 2B4CC 3MRQB 5DO2C 3ZTEA 4Z7VA 2DQGH 1IBZA 1FLTX 1WFNA 1MCRA 2IMNA 3QRBA 5KBLA 4O2CB 2Z93B 4HT1L 1CE1H 4Q58C 3RY5A 4N2HA 4ICXA 4P2OD 4WGWB 3MRNA 4Z7AA 2WMPB 3MRJB 4OFVA 3ZDYB 3CH1A 3O3DB 4I3SL 3RTQD 4KQ0A 1RP8A 3QFDA 3SIKA 3IF1B 3T4YA 3LKQB 3EOAA 5C0BB 1KDIA 1T83C 2YQ3A 4XNBA 5DFWH 1O9VA 2XSKA 3KXFA 4YH6A 3PGDA 5IHZB 4DIXA 2J21A 1BQKA 1F6FB 4BELD 1OGAA 4N25A 4R83A 1IBFA 3KW7A 3WS6A 4XOBA 3FB6A 2Z1PA 4MS6A 4HEPG 5KTEH 2O5YL 3QNYA 5T33L 1M53A 2BOCB 2Y06L 2G5RA 4HDIB 4W1TA 3DIFA 4BWUA 1HE8A 1PD1A 1YEKL 3APFA 1JI2A 1FGVL 2FWLB 3B34A 5AQ0A 3MFGB 1U8LB 4KPHH 3SSGA 2XA8L 1BZQK 3QH3B 2UVFA 4DO5A 4KXCA 4BFJA 3BKMH 4AEFA 2Z31C 1PLAA 1TYJA 4KBPA 1A4BA 3D8MA 1JTPA 4KRNA 2AI0H 3O9WD 1MSPA 2K7QA 3BKCL 1T66C 3ARDC 3DV4B 3QXVA 2BNUB 3KCWA 1RIHH 5IB5B 2PXYA 3WTTA 4N0FB 1TJMA 5DHMC 4XPGL 1OAQH 4L3CA 1I3GL 2G4GA 2QZQA 3GHBL 2A9ML 4G43B 1EK3A 2ZYRA 5D7IF 1UEMA 4MKTA 4QAWA 5DEFA 1CTMA 4NGHL 4LSUH 3V6FB 3A4DA 3BEWB 3SDAD 1SBSH 1XCQB 3AWEA 3S34L 1BIIA 3CK0H 2BCKB 5AOIA 3PS6A 3DSFH 2VOTA 2OS7A 5E9AA 2ZUQC 3PWNB 3ZYJA 5A16A 2BW4A 3E7JA 4YWGL 3RIAF 2VW6A 3KD4A 5C7ZA 5FGCE 5SV3A 1Q9LA 1WV7T 4QYOB 1KG0A 2VZ3A 3CFJA 3AROA 1YMMB 1QLFB 2MFNA 3C87A 1FVEA 2XKNB 1CDGA 4ZDHB 3GSRA 3PGFL 4JCWA 1HHJB 4RA3A 4HF5L 5E9DA 4TLKA 3BAEH 3EYVB 1K8DB 1A6VH 43C9B 2OMYB 4XNZB 1OARH 4K71B 1OSPH 2DWTA 2WXRA 2UXVA 3RVTD 3WHXB 4HPHA 2QMKA 2NPLX 4XZ4A 4WU7A 4YZWA 4WI0B 5J1AA 3E3QE 2E7LA 5CEZD 3SCMA 4F7MB 3VMOA 2AQRA 3QDGA 5C07A 4M48H 5CN1A 4G9FB 2A9AA 4B9YA 4CN6A 3FFCB 4OI7A 1WAAE 2JTDA 1SDYA 4L1HA 5E5MA 3M86A 1J9QA 1IFHH 2YXMA 4DEUA 4HG4K 3MV8E 4IOFC 4X42A 1ZHKB 3DGGA 1K5NA 3EDJA 3AY4A 5I0XA 3ILPA 3FMGL 3L17A 1T1XB 1BAGA 1Q4NX 2JSFA 4JM4H 1MVUA 4NNYB 2FSEA 2K78A 2E6PA 1UGKA 3A23A 2X28A 4J12A 4QXVA 2PCFB 2HFGH 3II3A 2YBRA 5BQ7A 1DBJH 3R18A 1BQRA 4XPAH 2QGBA 2ODHA 5E5UB 1ZVSB 4DFHA 4MBRA 3GWJA 1UJ3C 3BCDA 2Q86B 2VN5A 2X6BA 3U6RA 2IH3B 1QSZA 4FQXC 5C6PB 4HV8A 3BAXA 2DF3A 3T6ZA 1Q9KA 1LDSA 4FS0A 3RKDD 1E27B 1YJDC 1RK1B 5E51A 3RGHA 2VR7A 3JTSA 3HHMA 1FNSH 1X9LA 2FO4A 3FB8A 1ACZA 3EF4A 2GY5A 1H5BA 4ESKA 5CD5C 3B3BA 2MJWA 4HEPA 3G6JF 1AGBB 4NDMB 3CFDA 3POCA 5DHVA 3VA2C 1E43A 2Z92B 5CLYA 2HUEA 1VADB 1CG9A 3U0WH 3C6LA 5F1NB 4OGAC 1WITA 5KBKA 3B9DA 1TCRA 3CSTA 3QUZC 4HCIA 4NKIH 4RMSA 4ZXBC 1V3KA 1X9RA 3S4SB 2NZ1A 3IAGC 2C3HA 1D6VL 5KSAD 3KYOB 3REVA 3FCBA 1HDMA 3IDYB 3CXDH 3RWEB 2YSSB 4JFZH 3VFNA 5CP7B 4PV8A 2NSQA 3D2UB 2EH8L 4ZOBA 5HHMB 3BKJL 2PP8A 3D85D 3GSNH 3LJ3A 4QJ3B 3CDGB 1JYVA 2WUBL 1RFDH 3VGAC 4D9RD 4Z7UF 3SDXA 2UV3A 4L5FL 5D96B 1WD8A 3GGWA 4FQQB 1L7TL 2BP3A 4HC1H 4LVOC 3C75A 2A74A 4P3CL 1CD1B 4P5TB 5INDB 3QEGH 3MLRH 4YFLF 6FABL 4XVOA 1SJHA 4Q9RH 3ECQA 1IU1A 4XPTH 4XWOD 2Q7AA 5JQIB 5I19L 2XZAH 4M93C 2YPLB 5DJ6B 4FTVB 4CGUB 4EN3A 5FM4A 1CQYA 1HILB 5I1EH 4X4XA 5GS0D 1UM6L 1JE6A 1F1AA 1EBAA 5I6OA 5IB2A 1NPNA 3H6JA 1T5XA 2MTAA 3O2VH 4LSVH 2HB0A 3I02B 1H0DB 5D2NC 3RB5A 3NCCB 2K0RA 1J9SA 2AQTA 4U3SB 1LEGB 1H19A 1YNLH 4YSQA 3L6FB 3EHBC 3QEQD 1QYGH 4PGDB 1UZ8B 4C4KT 2JIXA 2Y23A 4Q0XH 1ZPLA 1FNEA 1RJZA 4C83A 5JW4R 4XO3A 4PJXA 5AYTA 4GRMA 2MRYA 4J3XA 3WNMA 2NUPA 3C60B 3FKUS 5IWLC 3RWHA 2UXTA 4ODTL 3LRSA 5IMMB 3OLDA 1BEYH 1I1FA 2A99A 3LKPA 4GBXA 3H9YA 5KSVA 4WHCA 2OXHB 1KELH 3VYOA 4HIEA 3A24A 1VFBA 1VERA 3FO1A 4P59H 3OXSA 3LEVL 4UB0L 4XVSL 3UPRA 3LVTA 1IGTB 1NL0H 4XOAA 2V2XA 3IPBA 2C5DC 2X4PB 4U1LA 1T6WA 3W57A 1GHFL 3MRRB 4X6CA 5AUMA 5L7XL 3A3YB 4APQA 1JMXA 3MROA 3RZWA 3H3BC 4CN4A 1YSOA 2BSRB 1BBJB 2WPGA 2IH8A 2CD0A 1XZWA 4PJGE 1TKWB 1EJOL 1U8QA 1CXIA 4PJ7B 3V5DB 5I28A 4ENZA 4JFYB 3LXCA 3QJZA 4N0YH 2Q87A 3D08A 1LM8V 2FIKA 1QHPA 4JFQA 1HYRC 1PZ5B 1GOGA 1XBDA 2ARJB 3ARBB 3JT0A 3MJ9H 2YMXH 4LNRB 2F8IA 4MNHB 4WENB 3VFMA 3VI4B 3X3FH 1ITBB 1DYZA 3WLWC 4MNGA 4BFGA 2CZNA 3FQ2A 3RE0A 2VUKA 5I8KL 1NM4A 3FCSB 4LFHG 2GC4C 4OB5H 2CCLA 2WOYA 4NCC2 3CSFA 2EVHA 5CIPA 5E08L 3ALXA 3GSUB 1LO2H 1TQWA 3IGLA 5IB3B 3OKEA 4RQQA 1RZJH 4PVBA 4JS7A 1Q72L 2VLRB 3H3PH 3ULVD 2FE0A 2YXWA 1PEZA 3CQFA 9PCYA 4ZFFB 1GS7A 5LGHH 1Y07A 1DQML 3ZTDC 4H0IA 2O5NA 3EOYG 3ZDYF 2I07A 2DQJL 1LWJA 1FORL 4QY8A 5JXAL 2FYYA 2CCWA 5D7SL 4PRID 5DZNA 1QTPA 2Y2YA 4LNVA 1FV1A 3N1QC 2BWQA 4XMLL 1MWAA 4G42B 2LV4A 1TQCC 1UCBL 1OCZB 1ZLVK 4EI6B 1U58A 1S6NA 4G59C 1YZZA 3IDGA 4J4PA 4JO3H 2CBTA 1KSRA 1UJTA 4Y2DC 1GXEA 3H9SD 4JHVA 3AXLA 2WB7A 1ACCA 3PP4H 3TPUB 1U8OB 2NNAB 1ZLSL 1DVUA 1YCSA 3QZMA 2FX8H 5DF0A 2J3SA 3QULB 4PJCE 3QIBA 1NBZB 3BQUA 3W56A 4JZJB 4PJFE 5CJOH 4OLVL 3RL1B 3VXME 4NJAH 1AGEB 1SOSA 2KC0A 3SN6N 2VN7A 3JQOB 4HJ1A 4X7TA 5EEWA 3MLUL 3BSZA 3TBVA 2E75C 3AS3A 3LRKA 3BDYH 3PABB 4YFLI 4XO5A 3VWJD 2ZX5A 4F5CA 3LH2L 4PGBB 3M1CA 5EU3A 4JREC 4LLQA 3HMXA 3GSQB 3LRGA 4H8WH 4FFYH 4G8GB 2W0FB 3BWAB 2OMWB 1RUKH 1MFVA 3P9MB 4NAMA 1TMCB 1EO8H 2DY2A 2UY7A 3BZFA 4P57B 1JGDA 3V4PL 4F8QA 5IVXB 4GY4A 1UKSA 5F3BB 3V8CA 3VG0L 4ONOA 3V6OA 3MBEB 4FXKA 5SWQB 2VDNH 1GJIA 5C0EA 4EBQH 2AQPA 5F8QC 3UTTA 2ATPA 3ORJA 1ILSA 5K9OB 1JPTL 1QWUA 3DX6A 4G7QB 3DI3B 3MFFA 3N1GC 1SHSA 2Z65C 1YY8B 3B2MA 3CLFL 1AANA 4L1TA 2QQLL 4UINH 1OAYH 4JG9A 4HS8H 4GRLD 1AE6L 4IBZA 4Y4FB 3UGEA 1WS7A 4ALAL 3MJ6A 2JVUA 2PR4H 1ED3A 3F7PC 5D4HA 4QHNA 4CBPA 2APWA 5B22A 1FI8C 2EIKB 1A1NA 3EG9B 4LRNH 1A1MB 3FU7A 5IGXL 4HGMA 1A5FL 3MV7D 2VDMB 2LU4A 2Q7NA 5HHNA 1HCYA 2X5PA 4WI5A 1NGYA 2WXKA 1DQKA 4N6QA 5KYXA 4XMVA 3S3PA 1HQRB 1KGYE 2ADJA 4HZLA 3PP3H 4N2CA 1CLOH 1KYOK 3V8OA 2ATAA 4J3BA 3N85H 4U1HA 2F5AL 4AQ8A 3QEHA 2MCMA 5LXGH 2J1WA 2XZZA 5TGBB 3RNQB 3N0AA 2KZ1B 4AGMA 3KDPB 4CU7A 1A3ZA 4MXVF 4HJGB 4U6YA 1AI1L 1ZT7A 3ES6A 5CZVH 5IIEB 4BSVB 3N0PB 3RDTB 3UERA 4M61A 3F01A 3KWWB 4F3FB 2QTVA 2RHEA 3NSDA 3D07A 3V0VA 3B7RL 5ERWB 4H44C 3MODL 2B59A 3DBXB 4TUJB 1NIEA 1IX2A 4KK8C 3KMDA 5D5ME 5I1DA 2ZOTA 1JUFA 3VFSB 2IAAC 4NC2B 5KYYB 1O6SA 4NQVA 4ORGB 4TUOA 2VWEE 5D7IA 2GEEA 4YVNA 1P5VA 3OKOB 4C58B 5F9OH 3LXBA 1TFHA 4DKFH 4FJZA 4F7PB 1M9WA 3C08H 3G5XA 4JANB 3NSJA 4WNJA 3EH4B 3KR3H 4CVZB 1FGNL 1HNGA 1THCA 3HAEB 4DGUA 1S5IH 2BNQB 4CSPA 5C2UB 4NC1C 5A3IC 3WTWA 2ZSVB 4MAUH 3QJRB 1ORQB 4PWIA 3TA3B 2ZPKL 3FT0A 1EAQA 2NY7H 1K2DB 5CFAA 2NY6C 1I8AA 4K7PY 4RWHA 4XP5L 2M8XA 4KJPC 4C57C 3MRPB 2IGFH 3P11L 4FQIL 3UFIA 5F7HA 1VKXB 4P4RB 4G8EB 1EZVY 1UOKA 3ALPA 3L16A 4HUWA 5EH1A 4G1EA 1MRCL 3ZJAA 3WIHH 5FCUH 4P9HC 5TTRA 3WTVA 5A2LH 5FECA 2H1XA 1JNHA 4B3EA 3WAJA 1DN0B 2X6AA 2VJ8A 3VE0A 5ISZD 3FU0A 4MWFB 1MAKA 3HI6H 5C0CA 4R5XA 4DKEH 3K6NA 5DD1H 5CCHE 2DQTH 4OQ1A 3QUXD 1TG8A 5FFLA 5JPNC 2EC9U 3X17A 2O61B 4OTXL 1XIWA 1IEAA 1X4ZA 3GMLB 1WWBX 3QJSB 4M3KB 2N0MA 4V1DD 1GZHA 4Q74A 1AS8A 2LE9A 4MMXA 2FJSA 4YDLB 4Y4HC 2OLDA 2XBTA 1TVBB 3RY6A 4JRYA 3ERXA 5KSBB 2BH0A 3TESA 4XC1L 2BSED 4N2EA 4BIKA 4U4BA 4KMTH 5EOTB 3MBWB 3VQ2C 1BYNA 4HWBH 2OMXB 2ZOKA 4OF5A 4PB0H 3RA7L 4HK3N 4NLHA 1CU4L 2B2XL 2XQBL 1ZA3B 4GXUN 3RY4A 5FFOA 5HHOA 4NM8L 1F11B 5GZNA 4L4TE 1HS6A 2RJMA 2P52A 2BY1A 3O2WL 3BE1L 2F53B 5FYJD 3B2XA 1CLYL 3ULAB 4XHJC 4EI5A 3CFCL 3DTDA 2WOBA 5LBSA 3IJYB 4FX5A 4L05A 3KM1A 4U0QB 1Q90A 5D2LA 1YEIH 1PU0A 3FQWA 3WY4A 4DOHE 5BVJB 2RH0A 1PQZB 3G6JA 1I7TA 4NO0A 3U2IA 1A7NL 4DEWA 3N40P 3B9KD 2Z8RA 4CDGC 4DKAA 4YIQB 4KFMA 4EXPX 4YPGA 2X1QA 2YUZA 1PD6A 4N0UA 2BIOA 4RIRA 1E9QB 2EE3A 2A9DA 3KHQA 1HWHB 4HXAL 4N85A 4F15B 4QJ4B 2X53A 2Z35A 5D9SA 4UMSA 2X6MA 3CFNA 1IGIH 3VI4F 2IVFC 5H35A 5IROD 1URZA 1WBZA 5I18L 4M4RB 2AAAA 2K9UA 3CH8A 4N6RB 4QWWD 3UG3A 1MCFA 3WMSA 1CXFA 3QFJA 4NZTL 1U33A 1Z3GL 1FVCA 4WI7A 4WW1B 1UG9A 3RTQB 1EGJL 2XWJA 3O2DL 5DRXB 5J6HA 4MXQD 2ZOOA 4Z7UA 1NBVH 2ZXAA 3T0AA 2GB2A 3ARFB 4UT9A 4XODA 5F7NC 4Y1AE 4NENB 5D4JA 1N59B 5KVDL 3WY2A 4P4KB 5DWPA 3LKNB 2C4FU 2EIZA 4F27A 1WP6A 3CNKA 4TQEL 1XTMA 4X8JA 1JGVH 2QHRL 3FQXA 4A2MA 2AK4E 2RAMA 4RGNC 5LNGA 4PJ5A 4F58H 4F33B 3BH9B 3JWOL 4JFFE 5I0WA 2P8MB 3ESPA 3CU1A 3QP3A 4JRXD 4AEEA 3FOMB 3FU6A 1U8JB 3NFSL 3IDNB 1KGCD 4KI5E 4CU6A 5H4ZA 3H2PA 3MJGX 1MNUL 2W88A 5DK0B 5ECJE 4ZUVA 3SY6A 1N5AA 1XMWA 3O9WB 4XAKE 3D87B 3RIFF 3ARSA 3MNMA 3AG2B 2GBTA 4JQVA 4BHUI 3L4ZA 4JFED 4O4YL 3P02A 1U3NA 4HBCH 4TSAH 3K6IA 1F5WA 2A9NH 5LN4A 4YLCA 2W0PA 3OB8A 2RBLA 5D1XC 1II4E 3ARGA 1V10A 4L3ED 5D1QC 2HJLA 5FUCC 4QNPF 4LAQH 5DEGB 3K5RA 2DKUA 3MRLA 3OGCA 3LVEA 4KQ3L 4RMQA 3SDAB 1PIGA 4LCCA 2HN7B 4BINA 3CHXA 3L7FA 5T3XH 4OAWA 4R97B 3FCTA 3LH9A 2NRDA 1UUNA 3F7VB 1AYOA 3GZPA 5AB2A 3LKOA 4XN4A 5IJDC 4AIOA 2DLFL 2WLZA 3NESA 4DZBB 3ZHKA 4UTBA 3U79A 4PJ8C 4PJEB 2DM4A 2QSCH 2FQGA 1IAIH 3Q48A 1IC5L 1YVLA 2C9AA 1NEPA 4L4VA 2AP2A 3HOGA 1JZ6A 2NY5H 3ULUL 2WQUA 2KMWA 3LZFL 1HJCA 3A6CH 1JRHL 3CHPA 1NLBH 4PWJA 1R24A 4M4PA 4YS4A 1TSRA 2OMNA 3D0VA 3MZGB 1AFVL 2BXZA 1RUQH 3QXAB 2XQYK 4HAKA 1MRDH 1ZJBA 1INQA 4K73A 1OGTA 1X4YA 2O5XH 1JDAA 4TRPL 2CGZA 2BSSA 4M5YL 5C0IB 4Z7NE 5ABZA 2YAMA 1DBKH 2FWUA 3MQIA 3MRQA 3O6KH 3VJ6B 1A4KB 4BZYA 2B1HH 3DX7B 4LU5L 4KVNL 5D1ZC 3BAYA 4BEIA 1XD1A 4AUUA 1Q0YH 5T1LB 2XXGA 4O2CA 1JZJA 2Z93A 3VXPB 2XZQL 4LPCA 4TVSa 1CFMA 2WCSA 5HJ3B 4LL1A 2WMPA 3MRJA 4OLUL 3ZL4L 5DJDB 3O3DA 1OZUA 1G6VK 4QTFA 2X2JA 1KV7A 3IF1A 5HPMB 3C5ZD 4HSAC 2BIIA 3LKQA 1ANUA 1QW8A 1UH3A 3FT2B 3T77B 4AYBA 4B97A 5EZOL 5I1HH 1X7QB 1NDMB 3VXRE 1RURH 4FKKA 5E2UH 4FP8L 1OP3K 5FWRA 2CPCA 1Y6KR 1M6UA 4M1GL 4NFCA 5CEYB 4AW4A 2X0VA 5HDQH 2BOCA 4OSUL 1IGMH 3MLYL 4HDIA 1F6AB 5L9DH 1G6RH 1FN4A 3NSCA 4K5MA 2M83A 2YFNA 4C55A 3ULSB 1U8LA 3JVGA 3QH3A 3S4SG 3L9BA 1GW6A 1M57B 5GRJL 4FFZA 4XX1E 2AXGB 1BAWA 1I9RL 3NIGB 1E6JH 1IGFH 5J12C 3P9LB 5CF3A 2PTTB 3OX8B 4P5RA 3FUIA 3RPKA 3DV4A 2ZXBA 5IB5A 2BNUA 3O45B 3QYCA 5K9KB 2VL4A 4LEBA 4N0FA 4RWYH 4WFFE 4XMPL 5F72S 5HHQB 3IJ8A 3LHPH 5KSAB 1L5GB 5EIIB 4PY8J 5AVXB 1WO2A 5TPWH 1JK8A 1B0GB 4G43A 2VDPL 1TZIB 3B1TA 3RIAK 3BGAA 3V6ZB 3X1BA 3MLXH 1J5HA 2ADFH 4L8BB 1IRAY 1QOKA 2W38A 3BEWA 5FDWB 3A6BL 4KZ0A 4QAMB 3X1NA 3BCFA 1E4HA 2BCKA 3BIAX 3BPOB 1X5FA 3PWNA 3MUHL 3TXAA 1IKNA 2OZ4H 4MD5B 1CBVH 1C7TA 1JF5A 1MXDA 5BO1L 5DTFB 2VXVH 3LCYA 3T6WA 1U8PB 1WSST 1MLCB 4QYOA 2ZCHL 3W81A 2FNWA 2VQUA 2VN4A 4J3OD 1XVSA 4ZTPH 2XKNA 4L23A 5E2VL 4CSSA 1CI5A 1HHJA 4KV5E 2X7LB 3EYVA 1K8DA 1UT9A 1W6LA 2CGYA 2OMYA 3NRFA 4OIBA 43C9A 2Y7OA 2YA1A 3CFMA 3IEAA 4KQ4L 1YJDL 1WT5C 5E6RB 5KUMA 3MO1B 3B56A 2VXQA 3WHXA 3ZX1A 1M4KA 3CZNA 5I6XB 1VHPA 5I26A 3REWB 4QRQB 3Q6GL 3T1WA 4WI0A 2W9DH 4F80A 4F7MA 2ATKB 3ARWA 4G9FA 3FFCA 1WPCA 5EOCH 2EVIA 1HEZB 1XF2B 4LCWB 4HJTA 1PG7H 1FE8L 1X4XA 5E2TL 4LDOB 4XN8A 1OGPA 2CJSA 3KAAA 1OLLA 2KUTA 2OMVB 4QOKD 4RFOL 1PCSA 3FT1A 2OBGA 4ODSL 4TN9A 1ZHKA 1F4WH 4GKLA 3RI5K 5J8OA 5JIPA 5HJBA 3F5WB 3S35L 2VXSH 4Z0BH 3I3EA 1XAUA 5EULV 5KSBF 3KYAA 1T1XA 2P24B 4X5XB 4IOIB 1NAMH 4NNYA 2H1LM 3IJ9A 5LAXB 4KKCC 2PCFA 1B3IA 3SGKC 1UB6B 1UT2A 5HJGA 2VM4A 2P5EE 4Y5VC 1ZVSA 1OM3L 2Y72A 4OFYD 2Q86A 4Y2LA 1BD2B 1OAZL 4X98B 3C09C 4PBVC 2IH3A 3UC0H 2IANE 3DOIA 4H8UA 1BGXH 2TRHA 2Z31B 1NZRA 4QRRE 2EIJB 2W07B 5ANHA 3NJGA 1E27A 1NBYB 3PP3K 4X9BA 1RK1A 1VESA 3ARDB 5A1AA 2GJZB 2LLGA 4YSPA 2J8UF 3HI5L 3MUZ1 2YIHA 4MQXD 4FF9A 4PJAE 5D7LD 2A38A 5F6IC 2GW5A 5L2KD 4GUPB 2ZF9A 4ODWB 1KPVB 4NDMA 4M8UA 1AGBA 1DJWA 4XP6L 5E00B 5E95B 5F9WB 3ROLB 2JCCB 2LTQB 2Z92A 2ARJQ 1VADA 3VFGL 3KYKH 4ENEC 4HSCX 4I0PD 3ASWA 5HI3D 1IGJB 1QZNA 1GC1C 3ABLB 3QDMD 4I77L 3HLKA 2CNYA 2V9TA 2Y4SA 3S4SA 4DGIH 4R26H 1E9OB 1IC7L 1FPTH 4UTCA 2ZUQB 4WAFA 1AR1C 3KYOA 2AQ1A 2C9VA 4BHUA 2IPKA 4D0CB 2YSSA 1H15B 3AG4B 1PJ9A 5CP7A 2O93L 3D2UA 3ZK0A 1T2JA 5AKSA 3V0DA 2GABA 1IC4L 4BE6A 3V0IA 3CDGA 3DIVA 4DGWC 2QSQA 4FULA 4QNPE 3TJHC 1MCOH 3APDA 3N2JA 4FQQA 4P2RB 3QCUH 3WFZA 3GQFA 4GAJL 4PRHB 2WKOF 4LCVA 5DVOA 1RJYB 4WI4A 4ONFH 3U82B 3SGJC 3VGEA 3K6SB 4P5TA 5INDA 4AIEA 1W15A 4MCZB 3U7WH 3T3MB 1LLAA 5I6KA 1M1XB 5CBAB 1KLUB 1WFOA 4I18B 3H9SB 1UA6L 4L4JA 2IAMA 2YPLA 5DJ6A 1QFWL 4FTVA 4MSWB 5KZCB 1KPUB 2OXGA 1MFUA 2FYVA 1HILA 4ANVA 2VLKE 1N26A 2YD8A 5GGVL 3GK8L 1F97A 3HE6C 3QQ4B 2A77H 3FAXA 2WAQA 1V55B 3F58L 3IN2A 2YXVA 4JL1A 2IWFA 3I02A 2EABA 2EXWC 4AGOA 1H0DA 3V0WH 4YSEA 5KN5B 43CAB 5E1AB 3ARXA 4TXVB 3GHEL 3L6FA 3UH8A 4PGDA 5KVGE 4JEGB 3VTMA 1UZ8A 2J6EH 3VSQA 4PSPA 2GBVA 3C2AL 3VWJB 3E9TA 3L95B 2UWEE 1HCFX 2ZG3A 1BF5A 4M6NL 2OTWA 1JCKA 3C60A 4XC3L 3SGDI 1UJ3B 2GY7B 1KCKA 3BVNB 5IMMA 3W5MA 4ZUWA 4K94C 2APVA 3S3JA 3DXAB 2OXHA 1R0AL 2ZCLL 3CMGA 3QORD 3DURB 4O02L 2KLSA 3T4AC 4XB8A 1OIOA 3MUY1 3UAJC 4GT7A 1LDPL 5EA0L 2ZYIA 2JJUA 3HJEA 1RSYA 1YEJL 4OCRH 5E5RB 4ZAKD 4IBUA 3DECA 3GB7B 4PJEF 1PX4A 1U3HB 2X4PA 2G5BB 3W0WE 4LRIC 5FF6A 3MRRA 3T6QC 4OV6F 1PLCA 2B1AL 2EH7H 4QRPB 2UX7A 2YA0A 1E5AA 1BBJA 2BSRA 3F04A 3T0EC 1E2VA 3GBNH 4QHMB 1TKWA 1S7TB 1PY0A 4PJ7A 3N6YA 3V5DA 4BQ9A 2HTLD 4ODHL 1J1PH 4JFYA 4DW2L 3QT2A 1MCCA 2VSKB 3LNEA 2RALA 1PZ5A 2ARJA 3SO5A 3ARBA 4MNHA 4LNRA 3VI4A 5SX4H 5J4MA 3SPVB 1MIEL 2A1WL 5JUEL 5DMYA 3FCSA 4BKTC 3BFOA 1U8HB 1F3DH 2BM3A 1AC0A 2VYRE 2GTQA 3TH2T 3GSUA 4EF3A 3LS4L 5IB3A 5BUPA 4S0HA 2VLRA 4IDJL 4DN3H 4YAQB 3CN0A 4ERSL 4ZFFA 4WCYH 5HDLA 4LVOB 4KY1L 2ROXA 2Y07H 4X0KB 1OZTG 2UYLB 4OLZH 3VDCA 1N4XL 2APXA 4GMSL 3GJFK 1DBMH 5E6YA 5I75B 3LXUX 3S2AA 3UG4A 2CAKA 1N18A 1NCBL 3NZHH 2AEOA 2W9LA 4H1LB 1K9TA 3SYAA 4UQAA 3WO4B 1YNKH 4DP8X 4G42A 5DC4B 5EV7A 3B2DC 5J0BA 5E1IA 4FJYA 4EI6A 3UJJL 4I8DA 4ZS7H 4DVRL 4TNFA 1K3IA 1Y18B 4K23H 1I8LC 4H26A 4I87A 4O58L 5FHAH 5HGHB 2CIIB 3TPUA 1VZIA 1BYOA 1BX2B 1U8OA 2NNAA 3FRUB 2X0UA 2OL3H 3DX1A 4C56E 2G3ZA 3EHBB 3HAEG 4OZIF 3VYPA 4D7BA 3NIGF 4GG6B 1CR9L 1H3GA 1LMKA 3QULA 5TQ2H 2ICWB 4ZO9A 3UO1L 1NBZA 4EEEA 1ZK5A 4JZJA 3VDBA 4YK4C 3RL1A 5GSVA 1JFQL 3MA7B 1AGEA 4L1SA 5DJ0B 3L2LA 3LIUA 4P48A 2P8LB 3GNMH 3INUH 3GS0A 3BD3A 3N41F 4YX2L 2QQQA 3QWRA 3NRQA 4S0SD 3R7QA 2ZQKA 4FADA 2W91A 3PABA 1OPOA 1JAEA 4PGBA 1WZAA 1F56A 2YS4A 1NEZG 2B5IC 3KJ6H 3LZNA 4XN2A 4D8PB 5F3HB 2F5BH 3GSQA 1CXLA 5TQ0L 1QMUA 5DUBB 2ED7A 4G8GA 1RUML 2W0FA 4JFSA 4FD0A 2Q2LA 3BWAA 4ODXB 2OMWA 4B9FA 1TTFA 3P9MA 5KJRL 1G0YR 4NS0A 3G08B 4JG5A 2ZJSL 5JHLA 5IVXA 2E7CA 4P57A 1I3VA 3T04D 3GSXB 1DQIA 1FNHA 5F3BA 3D06A 4KZDH 4P2QB 4YUEL 3MBEA 1MFEH 5SWQA 4ZFGH 2QDVA 1AZBA 1ZE3C 1NMBH 3ZU8A 2DB8A 3UG5A 1OTUC 1FQ9C 2BIPA 2DLIA 5K9OA 1AGCB 3KLDA 4XN1A 3QVAA 4PIRF 1UD6A 1YY8A 4ATWA 5IFHH 3B4NA 5K39B 4BWTA 3VH8B 2C8NA 4I9XA 1JHLL 4A7VA 2OMBA 1PG7W 1Z6JT 2E27L 1JWUB 3RPBA 2DLHA 2J8UE 2XXMB 4KPHL 5E1QA 4N20A 3VX1A 3G5ZB 5F6HI 4JKPH 1OAKH 2QKIC 3LYRA 4H8QA 3UX9B 5F0MB 3SE4A 3PLYA 4NQCE 3K80A 1F2XK 3EG9A 1A1MA 1F86A 2AI0L 4CNIB 2C26A 2XN0A 2WZPA 2AJUH 5C86A 1X5MA 4JQIA 1XR9B 1HQRA 1L9NA 5DJYB 3X3GH 4Y9CA 1AHWC 4R4NC 5I1KL 3WY1A 4KJWC 1ZANL 4LSUL 4UI2A 4Y2DB 1HOEA 5TGBA 3RNQA 2FEEI 5HVGB 1WJ3A 2NY1D 3CK0L 1HKLH 3DSFL 4HJGA 1E3XA 4P9HL 5B3NA 4HQQH 1MAMH 4PD4K 5IIEA 3BKYH 3RDTA 4BSVA 3LKSB 3KWWA 4GQ9H 3MMEB 1JN6A 4F3FA 3B9KB 4OR1A 5GS3A 4YHZH 1S5HB 2WP3T 1DVYA 3CDCA 4FA6A 3EW3B 5BS0D 1HCVA 4OI9A 3FCUB 5ERWA 5EUOE 4HXBH 4XE0A 1FO0B 3BAEL 1WWAX 3DBXA 4FMFA 4RDQF 4TUJA 4TULH 4D3CH 3HPLB 3X2QB 1EAOA 3IE4A 4XMKL 3C2SA 5KYYA 1J0IA 3D52A 4ORGA 3RVUD 1XGQB 4XXWA 2JCCF 1X5GA 1SFHA 3OKOA 3MV01 1A25A 3FHQA 2EDTA 4JO8A 5FGBC 3SKJH 4F7PA 3GUTB 3FO9B 4HMDA 4GYBA 5C0ND 2QZ5A 4A7GA 2V8LA 3OKNB 4CVZA 2F08A 3HAEA 3MLVH 5ENWB 2BNQA 5I15H 1DP0A 3NSFA 2Y9RT 3N42B 3N50A 2ZSVA 4HFUL 3ULVF 4MMZC 3F3HA 1ORQA 3TA3A 1IFHL 2ED8A 4F93B 5B1KA 2F58H 1U8CB 1DQDH 3FT4B 1TJXA 2F6AA 4IRJB 2W9EH 4WEBL 5DEJA 4W81A 3QS3A 2WQSA 3TCXA 3MRPA 1DSYA 1YEHL 1J0KA 1VKXA 4OQTL 4G8EA 5E2JA 1X5LA 3HB3D 2WLIB 3BN9C 3JV0A 1EPFA 3EYQC 3BWZA 3QJUB 5JQ6L 1DN0A 5AZ2H 4LQ1A 3ZHFA 4MWFA 3RGVD 4Z0XB 1AKJB 4NCC1 1HEJC 1EA9C 3T3MF 3IGKA 1B3JA 1LO0L 3K7UA 2O61A 1HXMB 1MF2L 2CG9X 4DZ8B 3JUYA 1XMEB 1P5UC 2VRKA 3GMLA 1M6OB 3KJ4C 3U7YL 2BSCA 5KVEE 1RLBA 2WN3A 4PRNB 2CO3A 4WHYG 3E38A 3ALWA 5AVWB 3VXTB 2X88A 3H7BB 3ILDA 5KVEH 2VH5L 1TVBA 4U4IA 1IQWL 5KSBA 2XA3A 5GGUB 2VN3A 5ALBL 5EOTA 3V6BR 3MBWA 5LDUA 1JZDC 3V0HA 5I0YA 2OMXA 4CA4A 3VU2A 1BDYA 1TJGH 1WGOA 4NKIL 4CVUA 1ZA3A 1RZIB 3ZKXB 1RZGB 1T89A 2IBZY 3GRWH 4MB4A 5IHWA 1TDQA 3ETSA 3NCWA 2IALB 1JTTA 3CLEH 4GT0A 4IIQC 3UYOD 3CXDL 3A47A 2F53A 4JFZL 1MWOA 4ABQA 3D3VD 1IM3D 5ABDE 3QI9C 3MOAH 1RU9L 3GSNL 1QFUH 2Q20A 1QSED 4LMQI 3BAIA 3IDXL 1RHHB 1RFDL 1XL4A 3ZYIA 4J3VA 3IJYA 1MW2A 2QPUA 4K3DL 3LQAH 1AVAA 4AH2A 1PQZA 3VD9A 3RG1C 4YHIB 4HC1L 4Q6IA 1JJUA 1G7JB 2MCAA 1S78C 4N90E 4YIQA 3WKML 4AW7A 5ADPL 3QEGL 5L4MA 1L9RA 4X6CE 1QASA 2Z7ZA 4YC2C 2VLME 1E9QA 1FIEA 2Q3XA 4LL4A 1FAIL 1JMZA 3US9A 2WZ0A 5AZEL 3DYMA 1P4IL 5AKTA 1LO4L 5IQ9B 3EYOB 3WGVB 5I1EL 1ZSHA 2LABA 4HJJH 1BQLH 4M4RA 2ITCB 4N6RA 1FZKB 2K7PA 1JRHI 2NY6B 4L9LB 5GGRY 4WW1A 3BP4B 4OLYH 4Y88A 3VDAA 3W3BA 5DRXA 4M1DL 3ARFA 2VUOA 1UQSA 1OP5K 1ZVHA 4NENA 3GBMH 3KPRD 3HZMB 1N59A 1IL1B 4O9HH 2CIKB 2H8PB 4P4KA 2V33A 3LKNA 4PY7B 2RCSH 2K8MA 1BZ7B 4RAUB 3EJCA 4NAQA 1MG2C 4B0MM 2CDGB 1JHKH 5T1KD 4YHMH 1PNDA 5J3HC 2M2DA 2VDLB 4F33A 5A7BA 3BH9A 2UZPA 1YN6B 1THAA 2X2UA 3UJTH 1KELL 1SHXA 4KKZA 4KJQC 3FOMA 1U8JA 1BZDA 3IDNA 1X5ZA 2VABB 1T22B 4FLSA 4P59L 5EIIG 2D7TH 2N4IA 4OJAA 3S37H 3PFUA 2UZXB 5DK0A 1NC2B 1GCFA 5PAZA 3CVDA 3BVXA 3GKWL 4X7FC 2H9GB 4Y4HB 4NI6A 3NEOA 5AVSB 2PO6C 4FNUA 4HVBA 2VO5A 5LCVL 3FAWA 1OCRB 4BGDA 1VZGA 1MWAH 3UTPD 4YR6B 3KGTA 3UJIH 1GGCH 4GG6F 1UZ6E 4P2AA 4A6YB 3FSAA 3PL6D 1Q0XL 3DI2B 5DEGA 3MJ9L 2YMXL 4Y2NA 2LVCA 1IBGL 2G9HA 2EO7A 3IFPA 3SDAA 2HN7A 4QR7A 1VEPA 5T3ZE 1TOXA 3VFVA 1D5ZB 4OB5L 3F7VA 5KJ7E 1ZAGA 4QRTB 2X87A 4DZBA 1D5BB 4WW2B 4H0GA 4PJEA 4ZS6C 3MUGB 2J5WA 1RZJL 5T3ZH 4H25B 3H3PL 4NYLB 3B5HA 4RGMB 5EF2A 3DMMC 4FFVD 4TQPA 3TASA 1FRGL 3BSZH 3SDDB 5CILL 4RH4A 1I7ZB 3FQUB 3L5JA 3K91A 2UUDK 4HWEH 3NCFB 2LAGB 4O00A 4K55A 1MJ7L 3QR0A 1YO4A 3HMXH 2K4WA 1P1VA 4NQTA 3BD5A 3QXAA 3NJXA 1J11A 3NJHA 3Q1SH 1I8IB 2QVMA 3QQDA 1UKQA 4LSRH 2ZICA 5C0IA 3S88H 3VJ6A 1N10A 1KIQB 1A4KA 4JO3L 5C0GB 3DX7A 4U6HB 3SJVD 4BRVA 5IF0B 4YHNA 5T1LA 1TZGL 1NANI 3EF7A 4UQ3B 2N7SA 5FWQA 3VXPA 5FB8B 3D4ZA 3AQZA 2Y1VA 3MRGB 2EEFA 5HJ3A 2BNRD 1P7QD 4E41B 4GI6A 5DJDA 1J8KA 1H8OA 4ZMOA 3ULUD 3VQ1C 4C4BA 3LZPA 2O26U 2DJSA 4RGNB 5HPMA 2E9BA 2GSMB 1GSKA 5DFTA 3BWUC 1FVDB 1RCYA 3T77A 3FT2A 6CGTA 4GXUM 1UM5H 3T3PB 1X7QA 1NDMA 4RDQG 2NY3D 2YWZA 4YEFA 3K5SA 4IRSB 4QRAA 1NC4B 4FYRA 5CEYA 1CFTA 3ULVE 3KEDA 4PJIF 2WBJC 4DEPB 1V05A 1F6AA 2OCCB 4CMMA 3RZCC 2LFGA 5IEKB 1CLVA 5E8NB 4H2CA 1MFAL 1CD9B 5DMKB 1DDHA 3E1F1 3ULSA 2NR6D 2NUTB 3GFUA 2VC2L 2ADGB 3WFBH 2AXGA 3AC0A 4Q97A 2AQ3A 5E6ID 5ICYB 3GSOB 4PRIE 1ZDQA 2FECL 5D1XB 3P9LA 3SDYH 4F9LC 5D1QB 1MJJB 4OV5B 2PTTA 3OX8A 4NM4L 1T7VA 1LP9B 4I0PB 1WISA 4WK0B 3O45A 3FH5A 1FDLH 5K9KA 2BMKB 2Z8SA 1NLDH 1ZT1A 4U1NB 4MNQD 4PQXA 5KSAA 1L5GA 5EIIA 1DLFL 4JLRB 1PLGH 1B0GA 2JELH 5F7DB 2IWGA 4UINL 2R56L 1O7DE 2DQ6A 2XIBA 2ZUVA 3WS6C 4HS8L 1EFXD 1CUOA 2ZKHH 4PJ8B 3V6ZA 1DVTA 1H9VA 4L8BA 3ZO0A 4H8VA 5CKAA 5HYJD 5FO8B 5FDWA 3OZKA 5TDPB 2PR4L 3TPKA 4IHOB 1N6UA 2OYPA 1PD0A 3FF7A 4NQDD 4MD5A 3EGDA 4WUUD 3O3BB 3NQKA 3D7PA 1BZOA 5DTFA 1U8PA 2GJJA 3FSVA 1AO7D 3KE0A 2CJUH 1TIUA 4JPKL 4JW3A 1IARB 5AAWA 3D0LB 1CLOL 4JFOA 2PXYC 3N85L 2Y6TE 1CLCA 3CFIC 4RX4D 4XP1L 3MO1A 2BVPA 4G7SB 1YEDB 5LXGL 4WWID 5D1ZB 3REWA 4I85A 3WEOA 5HXMA 1AIZA 2FL5A 2ATKA 1MJ8H 4GKSB 3TS8A 1V54B 5EOCJ 2XJLA 1HEZA 2H0PA 4XNMB 2HWZH 2L7QA 2MCPH 1XF2A 4LCWA 5DZAA 1TTAA 1GC1L 1NBQA 3BI9X 3QPKA 5B4MD 2VJXA 2CLZB 3OPZH 3FUMA 1NFIB 2XWCA 3ZE1E 3F5WA 5E4IA 2A3TA 4PRPE 5GGSY 4KH9A 4FQXD 3U9PH 4EOWH 1QHOA 4IOIA 4X5XA 1G5AA 5F9OL 1FFRA 3CDZB 3C08L 3Q44A 4JRYE 3I3BA 2VR3A 1UB6A 3N06B 2MKLC 4TTDD 3OLEA 2N01B 1BD2A 4X98A 3MV7E 4KHTH 3SBWC 4MJ6B 5AAMC 1GGYA 3Q9PA 3I2CL 2Z31A 3VCLB 2YAOA 3RFRA 2F7OA 5J12B 2W07A 3SKMB 4JAMB 5HHOE 4ZNCD 5B39B 5ID0B 3QDJD 3HG1B 1NBYA 3QUZD 3ARDA 4IIZA 2GJZA 5I82A 5HDOA 5BRPA 2OP4L 4X7SH 3UIZA 5JHDD 1QWHA 5MI0C 1GGBH 4GUPA 1W8NA 4ODWA 4JDEA 2D4FA 1KPVA 3GLZA 3WIHL 5E00A 4D0DB 2CO2A 3ROLA 2ZUWA 1JDCA 4QKXB 1A6UH 4U33A 2GUYA 4Z3HA 5HHVH 3SQOH 5JIDA 1BZ9B 1IGJA 4DKEL 2X6VA 1G9MH 5LBSH 2DQTL 5HHPB 3N1FC 1GRWA 1E9OA 1FHGA 1T1ZB 2JI3A 5I6MA 2NCEA 4H1LG 2FWOB 3RVWC 3JV5A 1TU2B 3OMAB 4D0CA 2FT8A 1H15A 1X5IA 3HPJB 3H56A 2EEAA 3LQZB 1NCOA 2GTZB 3B43A 1ZK9A 3S6CA 4BCZA 2YD9A 2NY4C 2X38A 3AUVA 3NACH 3HBZA 5ICZB 3EJUA 4AJ0A 5MERB 2CBMA 3SEPA 2C7FA 4XXCC 1RVFH 3KBHE 4A04A 3QFJE 5E7FA 4P2RA 5DHYB 1G4RA 4KTDH 1BG1A 4PRHA 2ZKMX 4XMXA 1WH0A 4P46D 1RJYA 1H5BC 5EFIB 4L1LA 1N7MH 4PB0L 4WJKB 1NOFA 2D03L 4MCZA 4DP2X 1A3RL 3N9GH 1M1XA 5CBAA 4FFWC 3C6LC 1KLUA 2GITB 4I18A 2CRZA 4QF1B 1WZ1H 4Y4KC 3H9SA 2X4UB 4PJDB 2D3VA 4MSWA 1EO7A 4YDZA 5EORL 3V2AR 1NKOA 3MXVH 3UDWA 4S10A 4TSCH 5DVNA 5ITBH 1ESOA 3BMVA 1DQVA 4PJ5E 1RK0B 3QQ4A 3V52L 2PETA 4B7IA 3WFDL 2V7NB 3Q2CA 1FL3B 1JS4A 4F2EA 1YEIL 3S5YA 2B0SH 5AVTB 1ZHLB 4E9LA 5IREA 1WF5A 4L8CB 1KBPA 4B5EA 2OZNA 2XDHA 2PCPB 5CJ5A 4R7NA 5E1AA 4HCRH 4Z3GA 2OJZL 1TETH 1UKTA 2XWXA 3OKKB 4OCLC 3BUQA 4ABWA 4XCFH 4HEMA 3ZSSA 1KCRH 1KTCA 1WD9A 3OB0H 3TIEB 5IHUL 3VWJA 3E9UA 3GD1C 4YDKH 2A74C 3KM2A 3OVUB 3GIZH 4MDIB 4OIIH 4V1DE 4Y5VB 4B53A 5KEZA 3V55A 1UJ3A 3C09B 4WDIB 3K3QA 2XZCL 3ZXAC 4V11A 3DXAA 2PPDA 3LN5B 3F12A 2J4WH 4OJEH 1N3NB 4EN3C 3DURA 4R0LB 2DD8H 4KK6C 1JV5B 4KKPA 1NBVL 1AXTH 3QS2A 4WW2F 1IGCL 3GB7A 4J3OF 1U3HA 5GJTH 3VH8G 2G5BA 5F6IB 1A0QH 3T08A 3ZBMA 2Q5BA 4UQIM 4MX7B 4QRPA 4XBGB 3WIAA 4ATTA 4QHMA 1G9EA 3PWPD 3DJTA 1JGVL 1S7TA 2VMJA 3QXDB 2L7EA 1AD9B 1SRDA 3PAYA 3FSWA 4L4VE 3X1GA 4ZXBA 1XEUA 1MCPH 5FYJE 4WI8A 5ICXB 3M7FB 2X05A 1AR1B 3LQAC 1YPZB 3SPVA 3QUYB 1I82A 3DUUB 4MRBA 1F3DJ 2AEPH 1U8HA 3KPMB 4ONGH 1Z7JA 2Y5EA 2OSLB 4JG0H 4XCYB 3DO3A 3P77B 1G1KA 1PKQB 5CCGE 3B7UX 2PCYA 1Z9NA 4YAQA 4S0TD 3VO0A 2FD6H 5EUKB 4D9QE 3ZVVA 2A9NL 3W5NA 4X0KA 4RLDA 2UYLA 5HYQB 3UGXA 5EO0B 4Z78B 5AKVA 2W94A 1J5DA 1D5MB 4BDVB 3ZE2E 4LAQL 1L9PA 4C4UA 5MENA 3WO3B 4H1LA 4YE0A 3FT3B 2NY1B 4JPIB 2BCMA 4HH9B 5T3XL 3T3PF 5JYLA 5BV7H 1I1AD 2Q3ZA 2I9TB 3KPSB 2L3BA 1DVFC 3HZYB 1TPXB 4AYID 4BZ1L 1AS7A 2VAAB 1Y18A 1J5OL 4PI2A 2QSCL 5D2NA 2CIIA 5AOMA 3B2UD 1BX2A 2C1OB 2H0JA 3FRUA 2YOCA 2FJHB 2G5UA 3ARZA 4W9EC 1CFBA 3GXPA 3A6CL 4K4KA 4JGNA 1YEGH 5IK3B 3DSNB 3LY6A 4GG6A 5B3JF 2PYED 4OLXH 2ZNWA 2EAEA 4JRXE 2OI9C 1LP9F 1KGCE 2DWXA 3NIFB 3MA7A 1MNNA 3R0MA 5DJ0A 5EDSA 1U8IB 4W9ZA 2P8LA 4UILH 4FMVA 4PJBF 5A2CA 3GXFA 2BIMA 3WNPA 4ZSOE 5JR1H 5GGRB 4FFZH 1DBKL 3QQ9C 4HHWA 3T4AB 2C9XA 4MD4B 4AVHA 5SWSB 4KNSA 4JFEE 4MVBD 4D8PA 5F3HA 1Q0YL 2F7PA 5DUBA 1WFUA 3MNVB 1KB5H 4J4PC 5LB1A 3TT1H 2JQAA 3L5HA 5FC9A 4RZKA 4EUPB 2NLJB 1B0RB 3QISA 3G08A 4N2BA 1HK6A 3EZ8A 3WHE0 3GSXA 2WXNA 3NPSC 1GYVA 3ZDZB 4A2LA 4FCHA 3VU1A 1LK3H 4P2QA 4FZEH 4EN2A 3T0VA 2RMNA 3DVNA 1J48A 2NNRA 4NRXB 3RGVB 3E2HB 1BXAA 2VQTA 5I1HL 1HSBB 2XV2A 4BKLB 2K8QA 1XR8B 3C5XA 3HCVB 5SX5H 3TVMD 1AGCA 2AQQA 4WKZA 1GS6X 5HDQL 4X6DF 1HNYA 4GP8B 4LK4A 1IGML 5L9DL 1QBAA 3VH8A 3BHBB 1M1SA 4DP5X 4CL7A 4KHXH 1JWUA 3LNIA 1FAKT 5IHHA 2AJSH 2VDKB 2IDTA 4HZ1A 4N2FA 5B38B 2OK0H 2PN5A 7FABL 4WU5B 3N40F 1E6JL 1L0QA 2VMFA 3GLDA 2VXQH 2JB5L 3FFCE 3QCVH 2GJ6D 5IBLC 2F8OA 3SDCC 4CNIA 3ATEA 4BFKA 1XXFC 3V4UH 1KJ3H 1XR9A 2EC8A 2Z7UA 4FXKC 1QW9A 3LHPL 5DJYA 3L3DB 4Y9BA 3KWVA 5TPWL 1F00I 4PVNA 1R47A 4MJ5B 1HE7A 3MLXL 2ADFL 4Y2DA 5KBMA 1QSEB 3JTTA 1A7PH 4YSAA 3DRTB 4KK5C 5I8CB 1E5BA 2OZ4L 2ZNXA 2WWOA 1GY2A 3B2VH 3G6AB 5FO7B 2H2SD 2VXVL 3TYGH 3LKSA 3MMEA 4HWZB 3QIWD 2WGXA 1G0XA 2DICA 4TSBL 3RL2B 2IJ0C 4YK4B 4DERA 2GQHA 1DUYB 2NYKA 4BXVA 4N5ED 5K1JA 5EIQA 1ASQA 3HPLA 5ACLA 3LIZH 3V4VH 4PG2C 2AGJH 3P1VA 1L9TA 3NA9L 1XGQA 4HJ0D 5CGYC 2B5IB 5GRUH 4YDNA 1SLVA 2P49B 5FYLL 3GUTA 3FO9A 2F19H 3U46B 4JPVL 1I7UB 2HH0H 3OKNA 3PG2A 4PP2A 5ENWA 3CPUA 4L3FA 1JNJA 3A22A 4HT1H 3X12B 4ZG1A 1U8CA 5DJCB 4IRJA 2BWIA 4N1CA 2KHAA 4XVUC 1U9KA 1MCIA 4Z0BL 1QA9B 4FXGC 5AB9A 1NAML 3O4OC 2WLIA 3Q43A 4PV9B 2NXYC 2RTTA 5I5IA 2I9LB 1WFMA 4Z0XA 1AKJA 1U2YA 3NCYP 2O5YH 5T33H 4LLUB 3QA3A 1UH2A 2Y06H 2Y7NA 4LLAA 5AEAA 1R1CA 2Z7YA 1HXMA 4H20H 3QIUB 1NH6A 4DZ8A 1FGVH 4PJDF 1BGXL 4U7MA 1H8SA 1CFNB 5I66B 1B4JH 1M6OA 4ZMQA 4MA1B 5C0DA 2CA3A 1ULVA 1UWGL 1C08B 3UGUA 2FSDA 1BVNP 2WIIB 4PRNA 3QUMB 4ZYKB 4DO6A 3VXTA 3BAWA 4Q7DA 3H7BA 3QG7H 2EDNA 1UOWA 5ILTH 4IK7A 1W8OA 1AHWB 1F4XH 4FQPA 4Y0GA 5GGUA 3ZUNC 4HUKB 4X0NA 1AQDA 4HIIB 1N2RB 4WI3A 5D4QA 3RU8L 5AB0A 1PAZA 1YN7B 3UTSB 1I3GH 2XHNA 1WLHA 3D6GA 2A9MH 2HT3D 2YO3A 3GHBH 1KJ2L 1RZIA 3IAQA 3L3IB 4DGIL 1RZGA 5AZUA 4DQAA 4QOKE 2A73B 1P53A 1FPTL 4RRPG 3EJYC 1ONQB 3RUGB 2IALA 4MB1A 1ID5I 3X1EA 1F4YH 1NMAL 2FEDD 3BQVA 1JGEB 3S34H 3O3EB 3KDMB 5CZXD 1OD7A 5CU5A 4I4WA 3BUTA 1FYHB 4LKXB 1I31A 4TNVK 5D1ZI 3ZSTA 5ADOH 4XRCB 4JHZA 1RHHA 3TH4T 4UDTB 3DHUA 5FX3A 4YN3A 2UY6B 3BIKB 1MCOL 2HVJB 2GAZA 3QCUL 1WYJA 4W9HC 3PGFH 4AYGA 2HRLA 4HF5H 4MCNA 4YHIA 5EU6A 1QBBA 3TT3L 4ONFL 1G7JA 3RY6C 2CMRH 4KTEL 4N2AA 5CO1A 2K6WA 3CZFB 2B14A 4LHUB 3SJVB 1AOZA 3AAZB 3NP3A 1LO3L 4IJ3C 1ZLWK 2XVGA 2XN9D 5IQ9A 3EYOA 4Q9QH 4MMZB 1CE6B 4FHJA 4FLOA 5DVLA 5GZNC 5DU7A 4YZFF 5D7LE 5I1GH 2ITCA 3JXAA 5L2KE 2CK0L 1FZKA 1K3ZA 2A77L 2BNRB 4L9LA 4M7LL 4FG2A 3EBGA 3BP4A 3EFFA 4PLJC 5GGSB 1KLFB 5HGAB 3ESVF 1FWXA 4GNKB 3HZMA 1M2VB 5H94B 1IL1A 3KL3A 4J5VA 2CIKA 2H8PA 4PY7A 3QDME 1HNFA 2NY3B 4NP4H 1BA9A 2J6EL 1BZ7A 2NZ9C 4RAUA 2EXYC 3TEXA 5L88L 2FHBA 3VTAA 1CBJA 3WMQA 3VXSB 4BFOA 2CDGA 4FYTA 1F6LL 5KW9L 4OIFA 2AJZB 5I1AB 2WSDA 1YN6A 4RSYA 5IUCA 4Z7WF 3KJ4B 1RMFH 3GT6A 2V6HA 3L3JB 4YXHL 1F18A 3MRIB 2VABA 1T22A 3HRPA 2BHUA 4JFDB 1EHNA 3PUCA 5E6IB 4OCRL 3MLWL 2UZXA 2VJ0A 1NC2A 1WCQA 2H9GA 1I3UA 2ITDB 4HGWB 2ZT9C 4Y4HA 5E4AA 2QADC 2SODB 2MOQA 3KCPB 4ZMWA 1CICC 5F97E 5EBGA 1EZSA 4MNQB 3AVEA 1XSOA 2VQ4A 1J1PL 2X9ZA 4AGQA 3T09A 1A3QA 5B1JC 4YSUA 3VFRB 2I69A 1EFXB 2CJ3A 1XSKA 1A3LH 3NIFF 4KXZH 4Z9KB 5DLML 5AWNH 1K85A 2WWMC 2ZXCA 1IB5A 2XBZA 3D5OF 5E8DH 3HS0C 2ZX7A 1D5ZA 1D6VH 3QI9B 4GG8B 3UTZB 3FXIC 4QRTA 4BKSC 1CGVA 1D5BA 5JIQA 1WRFA 3D25B 1KB9J 4L5FE 1VEMA 2EH8H 3F7QA 1HU8A 3MUGA 3R0NA 4LARL 1XH0A 2LT9A 1AO7B 4H25A 4NYLA 3BKJH 3NCBB 7TAAA 1GSMA 2WO4A 3S7GA 3K8MA 1DCLA 2YQGA 4WCYL 2OKMA 2HX8A 5I9QB 4ELMB 1DQTA 1LJMA 4XZUB 3SDDA 1XF5B 3I6SA 4L5FH 4OLZL 1I7ZA 3FQUA 4Z7QE 5JXED 4JQVC 2VDQL 5FGRA 5ANME 3ZDZF 1H3UA 3NZHL 4RRPA 5F7KC 4P3CH 4DK3A 1U4EA 1SHMA 4TS6A 1SMOA 5IVXE 6FABH 3GXTA 1JYWA 1YNKL 3QRGL 1R3IH 1JZ3A 1I8IA 1WQVT 2P28B 5I19H 1ETB1 3OAYH 1H3PL 1KYAA 3VI3F 5JHLH 4ZS7L 4NQXB 2CPUA 2WIMA 1KIQA 5C0GA 1M42A 3LXAA 4C47A 4U6HA 3IGAB 4TF4A 3VWKD 1NIDA 5JIHA 1ACXA 3JTBA 3BVUA 2ZAIA 1L0YA 3CHSA 4UQ3A 4AYDC 5FB8A 2MQ0A 5GZOD 1DR9A 1ZHNB 4LQFL 4QYAA 5DR5H 2HRHA 3G7TA 3MRGA 4EXKA 1AY1H 1XDTT 4E41A 4N1EA 2O5ZL 2COQA 5IMKB 4JHWH 4WNSA 1X5KA 2LU7A 5B39G 2X10A 4GQPH 1FVDA 4HMCA 1MREL 2VMEA 5AVZB 3QQ3B 4G80B 2DEWX 4IRSA 3FTGB 4LOVA 4OFYA 2DYPD 1NC4A 1ROWA 1CZ8L 1BV8A 1TVDA 1UATA 3CIAA 3IKCB 1YLBB 3TO4C 3KJ6L 3CX5K 3DVIA 5C0FB 1QACA 1QUPA 2BFGA 2F5BL 4H13C 5E8NA 4N9GB 4LP4A 2VDMH 3UZQB 5DD0L 5DMKA 4XVSH 2PO6B 3DC0A 4HISA 4UB0H 5JHDB 4JQIH 2NUTA 2EQDA 2ADGA 1GHFH 5L7XH 2J73A 5ICYA 1T5WB 1RZ8B 3GSOA 4NT6B 5D1XA 2YD1A 3VXUD 4KZCA 5D1QA 1MJJA 2DTSA 3SPCA 4OV5A 3LDBB 1J12A 5IW3A 1QSFB 1CGYA 1EJOH 1LP9A 4I0PA 1MFEL 4ZFGL 4ZD3L 2WO3B 3VM7A 5I73C 5TDOB 3DPDA 3R1GH 1D7BA 1NFDB 2V0AA 2BMKA 1SOQA 1OB1B 3IU4L 4GRWF 1E3FA 4N3TA 3CJJA 2VDRB 2OR9H 1DANU 4JLRA 4RBPH 4QXGL 4XO8A 3SE8L 2YPKB 5F7DA 3WBDA 4JN2B 1RZKH 4B9IA 5IFHL 2F1BA 1A02N 3VXMD 2AV7B 4PJ8A 3SE3C 1CDHA 3PXLA 1OK8A 5AW8B 5FO8A