4OJNA

Crystal structure of human muscle l-lactate dehydrogenase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
332
structure length
332
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of lactate dehydrogenase A (LDHA) in apo, ternary and inhibitor-bound forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase A chain
total genus 108
structure length 332
sequence length 332
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ojnA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ojnA02
3WGIA 3M2TA 3EAGA 3HSKA 1ZSVA 3M1AA 1NFQA 3MCVA 2CZCA 2H6EA 1IZ0A 4I1IA 4WKGA 1BG6A 5HRUA 1K3TA 1LRKA 1NPYA 1HT0A 3E8XA 2E6UX 3PIDA 1PJSA 5JSFA 3I3OA 1U4OA 1XLTA 4JBHA 4NHEA 5U1PA 1EVIA 1JVSA 4OJNA 3BMQB 3JYLA 4ZHSA 4R16A 3A4VA 4MVJG 5KJEA 3WGTA 2VZ9A 2Q2QA 2ZB7A 5KVSA 1U3WA 5TIIA 1U5CA 1NTOA 2TMGA 3NT4A 5GZ6A 1DPGA 2NSDA 3F46A 1LDYA 1F14A 3IQDB 2CDAA 5H81A 4CQLB 3VDQA 3A28A 4Z3DA 2DU8A 4NJMB 5K9ZA 1O8CA 1WAMA 3ZWMA 3GT0A 3WWYA 3EZLA 5CPBA 4DMLA 1P33A 4KTVE 3RU7A 1P74A 2VT2A 5EMHA 5A04A 4MJLA 3RU9A 4I5EA 4HNHA 2Q2VA 3UICA 2FY8A 3KYCB 2Q1SA 3GAFA 3K2EA 4CM1A 4UUNA 4DTIA 5FEUA 3GFBA 4IJUA 1N7GA 1CJCA 1DFHA 3DMTA 2VCYA 4S1VA 3T4XA 3K9QO 3CSDA 3AY3A 1EBFA 4FJ0A 4NG5A 2R00C 1PJBA 3HJAA 5JDCC 4A0SA 4OMUA 3TPCA 4BOYA 1VL0A 4XX0A 5H82A 5THQA 3VPHA 2VNSA 1NNUA 3K92A 1XKQA 4PLCA 5TSDA 3WYCA 7MDHA 2X86A 5TC4A 1HSOA 1ONNA 4LVUA 4B7XA 1O95A 4LCJA 2GUGA 4J9UE 5BT9A 4M1QA 1MC5A 3K2BA 1J0XO 3PHJA 4D79A 4CLHA 2J3HA 1H5QA 3U4HA 4GWGA 3PDUA 3LLSA 5A06A 4BKRA 3AI1A 3IKTA 2LDXA 1QG6A 2NU9A 5C7IO 1HE2A 2HQ1A 2QZZA 5A5FA 2FR8A 2RAFA 1R15A 2JKVA 2P9CA 3P7MA 5IXSA 4PLPA 2WE8A 3KYBA 2O4CA 1BW9B 1LUAA 1YBVA 2Y66A 4RVFA 2X8LA 3MTJA 4WEOA 4MP3A 2O3TA 3T7EA 3GMDA 2CDBA 4UVDA 4RQTA 3BTSA 1U2DA 1Y5MA 3W6ZA 1YS4A 4L4XA 1NVGA 4Z0PA 4NNJA 1QYWA 2YY7A 4Y67A 3ZU2A 3BMOA 2C2XA 4NR0A 3V2UA 4EGFA 3ZW8A 4U6QA 3IIEA 3ZHBA 3WMWA 4A7PA 1C1DB 2IZZA 5DBGA 3RASA 1XQ1A 2O3RA 1SPXA 4DQVA 1Q0QA 2C82A 4NDNE 5JMWA 4BIIA 4BO0A 1JA9A 3FNEA 4BNIA 3HADA 4CM8B 1R0KA 3ICPA 1E3WB 2E37A 1E3EA 2O3UA 4BGVA 2WDZA 1NFFA 1DRVA 5CG2A 4ONEA 4E5PA 5AXCA 2BFOA 3RBXA 4AJ2A 2YQ5A 3AFNA 4BO1A 3WSWA 1NAHA 2IXAA 2OGUA 4WOJA 2JFFA 1NWHA 2VTEA 5AYVA 4Y6RA 3B1FA 3QHAA 3QVWA 1ZSNA 1I3LA 3EZYA 1HWYA 1I5RA 1WMAA 2A94A 1Z73A 4BNGA 4W4TA 1GYPA 4E13A 5ENDA 2B5WA 3DBRA 2VYND 1Q1NA 2DUWA 4BV9A 2D4AA 4UEOA 1XQ6A 5L7WA 4FPXA 1BVRA 1BDMA 2C0CA 2QX7A 1DRWA 1ONOA 1YQGA 3H3FA 4N54A 4YTEA 5EINA 3QJ5A 1OC4A 5TT0A 2GZ3A 3D5TA 5JDCA 3QVSA 3KSZO 4J7UA 4CQMB 3H8VA 2Y0CA 4WUVA 5IDYA 1DC4A 3MOGA 3U4CA 3RJ5A 2B4RO 3S2FA 4E2XA 1LDNA 2F1KA 2CD9A 3JQ6A 1D8AA 1GPJA 4U8GA 5C7LO 5CEFA 3I6QA 1E92A 4UUPA 4XB1A 4E3ZA 5ITVA 3DHYA 2ZYAA 3WYEA 2NTVA 4AJEA 3HE3A 2PH5A 4IIVA 2X0NA 2BFMA 3BHIA 4BNZA 3LK7A 5JCJA 3NUGA 4HP8A 2PLAA 4FN4A 3WOHA 3CTMA 3ZWPA 2P2SA 5JMPA 4R3WA 4GGOA 1LQTA 3GDFA 4IXTA 2WEKA 1B3RA 4CMJA 2JHFA 1ZK0A 1LDGA 3D0OA 1YGYA 1UXHA 1UDCA 5FF9A 2PA3A 4CUJA 2HK7A 4FCCA 1F0YA 2EKPA 3Q2IA 3QY9A 4TKMA 4TQGA 3WFIA 3ZWNA 4AJ4A 4BNJA 2UAGA 4OKIA 1Z7EA 3C1AA 3W4IA 1K89A 1SB8A 1J5PA 1FF9A 4WE3A 1ISHA 3SC4A 1PQUA 2XXBA 4IQ0A 4IINA 4E2WA 1KC3A 3C8MA 2ZJ1A 4NBWA 2R6JA 3ETEA 5AXDA 1E7QA 1I2CA 1CERA 4M54A 3WLEA 1KEPA 3VZQA 5JYEA 5JFOA 2Q1TA 1Y9EA 5A03A 3B70A 2DBVO 1XIVA 3GLQA 1E6WA 1WWKA 2W8ZA 2O7SA 1T24A 1VSVA 3BMNB 4DPMA 4MVJE 4HFRA 3AI3A 5ER9A 1GR0A 2Y99A 4PG7A 5IZCC 2WYVA 4FGSA 1M6WA 2VWHA 4G2NA 1R12A 4EITA 3G49A 1HLPA 3OJLA 4RF3A 3GAZA 4D7AA 3WGYA 2AE1A 1ENZA 1SMKA 3CIFA 4GPD1 5L4LA 1YO6A 1ZFNA 3ZDFA 4YJHB 1HYEA 4O5OA 2PZMA 1BMDA 1KY4A 4Z9FA 5AOVA 4HFMA 2E48A 3A9WA 1LEHA 5AVOA 3TOXA 1BDBA 1NQOA 1Z7BA 2O2SA 3EDMA 3QSGA 3HUDA 1CEQA 2EKLA 1WZIA 4IDBA 3T4EA 1WMBA 5B4VA 2VRCA 5C37A 1GZ6A 3C24A 2VT3A 3JQGA 1DRUA 2O4UX 3LC7O 2ZB8A 3DB2A 4R1TA 4XD2A 3DBHB 4N7RA 4BV8A 2NVUB 2AEJA 4YAKA 2PNFA 1BRMA 1T2DA 3JTMA 3AY6A 2VHWA 3Q1LA 2BI8A 3JD0A 2SCUA 1HYHA 5COQA 3OJEA 3QWAA 3R6DA 3BMCB 3I4FA 3TRIA 4CMIA 1ADFA 1BWSA 1DHRA 1MXHA 3GR6A 2AMFA 1BW9A 1H6DA 3ULKA 1F8GA 3DOJA 5CDUA 1V35A 4P22A 3L4BC 3FRJA 4R5HA 3WYBA 1ZO8A 3UAGA 3TZQA 3L77A 1GEGA 1PWZA 5B4UA 3TF5A 2JCXA 3F3SA 2B36A 4ALJA 3JQ9C 5DBFA 1Z6ZA 1YOVA 4PRKA 3BTVA 3OEWA 5B1YA 3ZNQA 5IN4A 4CODB 4I5FA 3DZFA 2NQ8A 1CYDA 3K30A 3KYDB 2HMVA 4Q3BA 1I30A 1XA0A 4O6VA 4RDHA 4YQZA 3WGQA 2DM6A 4JXKA 4WPGA 2YV1A 3GUCA 3RUCA 4N5LA 1Z82A 1DIHA 3ZU4A 4ZICA 1IHYA 1UR5A 1NAIA 3OA2A 2X9GA 1XSEA 3JQBA 2JCYA 4QEDA 4MKXA 2QRLA 3JQAD 5GY7A 5U9CA 1R4NB 2QYSA 5L95A 2I6TA 1EK5A 3L07A 1VM6A 3AUSA 3OETA 1TA4A 4BO4A 3HDJA 3LC2O 3WIEA 5DCWA 4OOEA 3WGHA 2HRZA 4CMAA 3GG9A 3WX0A 3ETGA 3WNVA 3UOGA 1X7HA 3ANLA 1YOVB 3B1JA 2YV2A 5GMOA 2ZTVA 2GF2A 4KMSA 4QSMA 3NEPX 3E82A 3L4SO 4KP7A 4M87A 4KWHA 3V2HA 3F1KA 2DBRA 3FN4A 3KO8A 5A02A 3LF1A 1YBMA 1V6AA 1JU9A 4Z9XA 3U9LA 1C0PA 4FS3A 5I7EA 1LDMA 5DOVA 1EVZA 1Y1PA 1KOLA 1PGJA 5JNLA 3BIOA 3L6OO 3AOEA 1P1JA 4KWIA 1E1MA 1EZ4A 3UUWA 4PRLA 4OO3A 4UULA 5DCYA 2B5VA 3DTTA 3RJ9A 1HYGA 4YYZA 1V9LA 2NWQA 2NTNA 4GVXA 4WLVA 4A2CA 3EVTA 3SC6A 3GHYA 1QP8A 2X23A 3ADOA 5G0SA 2GYYA 2NVUA 3OHSX 1YDEA 3OMLA 5HS6A 1GFSA 2P9EA 4BO7A 2X58A 1DIRA 5BNFA 5A3VA 4JK3A 1Q2XA 3H9QA 3D4OA 3RKRA 5TS3A 3KM0A 1LJ8A 2C5EA 1KEVA 3VDRA 4FQ8A 1SB9A 1H93A 4YEDA 3AM5A 3GDOA 4XJSA 2EW8A 4YJHA 3U3XA 1C1XB 2EWMA 3E9MA 4ALLA 3GK3A 1FMCA 4E31A 2A4KA 3PPIA 4Z3KA 3AJRA 1N5DA 1ISFA 1R16A 3WR5A 5AXBA 2XOXA 1O0SA 1UXJA 3DDNA 3S2EA 4DQXA 4XGIA 1QRRA 3S1LA 3VAZA 4NK4A 5L7YA 8ADHA 4CM9A 3ITKA 1WDMA 1KBZA 3VZPA 2V6FA 2OO5A 4ILKA 4ALIA 5IZ4A 4P4NA 2GGSA 5ICMA 4MIEA 4R3NA 3IP1A 3ZN2A 3ZZNA 3NJ4A 4RQUA 1EE2A 3ONEA 5T6BA 3CKYA 1PJ2A 2ZQYA 4II2A 4TRRA 4QECA 4FB5A 4FOSA 5L53A 1LBEA 1UH5A 4NK5A 3K31A 1LLCA 4QTZA 4YAIA 1LDBA 5JBIA 2VHZA 1CQIA 1SEPA 4M55A 1UXKA 3WGZA 2I9PA 1CRWG 3ROPA 1E7WA 4GMFA 4CLDA 3SJ7A 4DREA 5F3RA 4GSKA 4RV9A 3QVTA 2PKRA 3I9JA 4E32A 1H9BA 3MJVA 3GQVA 4XDYA 1FK8A 3VVBA 4A27A 3PHGA 4B7UA 5JY1A 4CJXA 2P5YA 4YJFB 1MG5A 5THKA 3RWBA 1Y8RB 4DA9A 4E5YA 1AUPA 2CVQA 3CE6A 1DAPA 4L73A 4MIYA 2O3SA 4RCVA 3PWZA 3G1TA 5KWEA 1RM5A 1IL0A 4BNMA 4G5HA 4ZQFA 3PHLA 3KOUA 5CDSA 2IYOA 2IZ1A 2NUAA 4DC0A 5IDQA 2OOSA 1GQ2A 2C54A 4GVLA 4B4UA 4CLOA 4B8WA 1PS9A 3VTFA 4PZEA 3WS7A 2GR9A 2HLPA 4NFHA 4D3DA 3PWSA 3TDKA 3LSYA 4LSMA 1HKUA 3BHMA 3ZCXA 4FBGA 2QRKA 3OQ1A 4HADA 4YAGA 3O9ZA 1X1TA 4I9NA 1D7OA 2CVZA 4XB2A 4Z0TA 5T67A 1MG0A 2V65A 5L4NA 1T4DA 3TN7A 1KETA 2HMUA 2B4QA 2J3JA 4NPCA 3I52A 4NBTA 1F8FA 1OBFO 3U62A 4UVHA 2VQ3A 2Z1MA 4BKUA 4BGEA 1WP4A 3SXPA 2EJWA 2X5OA 1K0UA 2GLXA 1OAAA 4F45A 1Q0LA 5EESA 4D42A 2Q45A 1VC2A 1UXIA 3FTNA 4IQGA 4RVDA 1DO8A 2FPGA 5KCZA 2C59A 3GUYA 4PN3A 1MFPA 2HAEA 2G1UA 4ZQGA 4J3FA 2RHRA 2YHIA 2DBZA 4U0JA 1EE9A 1VJ1A 4K9DA 4BUCA 5MGBA 2I66A 3HHPA 1YBAA 5L3ZA 3JQ7B 1OZAA 1ZH8A 1KC1A 3NTOA 1U3VA 1MLDA 2X0JA 4CMIB 1A4UA 1LSJA 1C3VA 5B37A 3AY7A 4EJMA 3UW3A 5I7SA 2X9NA 3AFMA 1UZMA 3GNQA 1PS8A 1C1DA 3L0DA 1LC0A 2W2KB 3BMQA 4IDAA 3GGGA 3DBHA 1E3JA 3RQSA 3GC6A 2BF7A 2ZB3A 3JQGB 1ULSA 2HMTA 1C0KA 2HO5A 3RFTA 2PR2A 1MB4A 1YQXA 5K6AC 3OJ0A 2RCYA 4XGNA 1PS0A 3B1KA 4RPLA 2RHCA 4GGPA 3NTRA 2Q50A 2QHXA 1VI2A 4BO6A 2D1YA 4EUEA 4ND5A 3LYLA 4PLGA 3AI2A 2W4QA 1A5ZA 4MOWA 4E2YA 1QYDA 4IGEA 5ILOA 3QWFA 3G3EA 1JTVA 1M76A 2AA3A 2Y93A 3DZIA 3O26A 4J2HA 4WASA 5DCUA 1GYQA 3RVDA 4XYBA 1XG5A 3DZGA 3O8QB 1I3NA 1VKOA 3N74A 4A03A 3DBLB 3PIIA 2UVDA 2FSVA 3KXDA 2PKQO 4NQZA 3CXRA 2FN7A 1RKXA 1UAGA 2DFDA 3DQPA 3QP9A 3S8MA 1JLLA 4NBRA 2YV3A 2DPHA 2OBYA 1VRWA 1W8DA 1YB4A 4PLVA 3RUDA 1N9GB 5L51A 4FFNA 1ZJYA 4ALKA 3ZHYA 1PR9A 3HDQA 1C0IA 4CV0A 1YKFA 3LU1A 3HG7A 4GH5A 3ZV3A 4J6FA 1TEHA 1V0JA 5DF1A 2D0IA 1HDYA 1TXGA 3DZKA 3R0IA 3U5TA 5G0VA 2O48X 3OP4A 2BGKA 1GU7A 2DFVA 3H9EO 1PJCA 4MVJI 5HTOA 4BNUA 4YT4A 4R1NA 5F1KA 4NU6A 1RYEA 1DC5A 5JW6A 3FPCA 1K6IA 2YDYA 1N92A 1H6AA 1XYGA 3WBFA 4IQ8A 1Y6JA 3OIGA 5F5NA 1U4SA 3G0OA 4W9NA 1PIWA 3JQFC 4DYVA 4I5GA 4GWKA 2Q2WA 3JQBC 2VYVA 4LMPA 3I1JA 4LN1A 4M49A 4WNCA 4FFMA 3RC2A 3TWOA 3WNQA 2EGGA 3GHHA 4YPOA 4RGBA 3C1TA 4YT2A 3OH8A 3DBVO 3OEYA 2WSBA 4CQLA 4AICA 1E7MA 2VRBA 2WYWA 3V1YA 4JNKA 1KVTA 3TL3A 4FIZA 4PGFA 1T2AA 3NTQA 5EQFA 3ZWWA 5FI5A 4UUMA 3F4LA 4K28A 1A71A 1GQQA 2XXJA 4CM4B 5G4LA 3RAJA 4U5QA 3QVXA 1X1EA 1ADGA 4PZCA 4RPKA 5G2OA 4DRYA 1LA2A 3BHJA 4TRMA 1YL6A 2VN8A 3GY0A 4PG4A 4RJTA 3NT2A 3MJCA 5JYDA 5BR7A 3PZRA 4CQMA 4AFNA 4D3SA 2I76A 1ENOA 1HTBA 3RC9A 3F9IA 1T1RA 4YBZA 3INTA 3K5PA 4BO5A 1GDHA 6LDHA 2BKAA 3DBRB 2VZ0A 4EEXA 1HLDA 4NBVA 4INAA 3LT0A 4J16A 4W82A 3CZRA 4HX5A 2UDPA 3JD1A 3RBZA 5HA5A 4PLYA 1A72A 4WCFB 3C7CB 3ASUA 4GX0A 2W2LD 3HFGA 4W99A 3JYPA 3NRCA 1E1LA 5EJ2A 3WQRA 1WVGA 3MEQA 3GZNA 3VH2A 2GSDA 1QSGA 2IXBA 2B83A 4YJDA 4BNXA 1E77A 1P1RA 4CM6A 4BMNA 5I8WA 1LX6A 4I5DA 5BQFA 4P38A 2AHRA 3I9OA 5TJHA 5A1TA 4A5OA 3SLKA 4RVUA 2J6IA 3DOOA 3PLNA 2D2IA 2Q1WA 3A14A 4CUZA 3X2EA 3W4KA 2B35A 1ZXBA 4IM7A 1R4MB 4J2OA 4BKPA 2P91A 1P1HA 3UCFA 3IKVA 3IUSA 1DC6A 4KUGA 2BHLA 4UAGA 3ST7A 4TVOA 5F1PA 1NHWA 1XEAA 1EQUA 5A05A 3VZSA 2J8ZA 4R69A 5JAMA 2DTXA 3ZWYA 1N1GA 3D3WB 1YB5A 1K2WA 3BMOB 1DJNA 1D1TA 1A27A 2PY6A 2X9VA 5AXAA 1LLDA 1K5HA 4B3IA 4CMEC 2HU2A 3LDHA 4J0EA 1EDOA 2IE0A 4EEZA 2JFHA 2EV9A 4YWJA 1LLUA 4ND1A 4E6PA 2TMDA 2WE7A 4YRDA 2E4AA 1KIFA 2ZATA 3FPLA 4PVDA 4D44A 3JQAB 1KERA 2XAAA 4B4WA 1P77A 3RCBA 2NM0A 3U09A 3KZVA 3FBGA 1I32A 4BGUA 5A5EA 2PK3A 3VC7A 5IJZA 4CV3A 3I9MA 2EP7A 2RH4A 2JD0A 2Y67A 3TFQA 4L75A 3H2SA 1FDSA 3E48A 2HJSA 1DFIA 2EERA 2IZ0A 5JXWA 4J1NA 1BXKA 3PHIA 1YL7A 2DPGA 3D3EA 3CMMA 1T4BA 1QYXA 2WD8A 3HQ4O 4Q3EA 1PSDA 5A9RA 4JROA 2VNAA 1OMOA 4GQAA 1O6ZA 3AUUA 1DSSG 1Z45A 1ZZEA 4N18A 1KVQA 1PJ4A 1LNQA 2BELA 4CMCA 1U3TA 1GUFA 4AJKA 1P1KA 4LMRA 4JP3A 1CETA 3F4BA 3KUXA 3QLJA 4M8SA 4HXYA 1NQ5A 2F00A 3IAHA 1UDBA 3PI7A 1TT5A 2X5JO 1U8XX 4FFOA 4OAQA 2EIHA 1P0FA 3KSUA 1IY8A 1LI4A 3VKUA 3IUPA 1T2EA 1GUYA 1QLHA 2V6BA 2EXXA 1IYZA 3PDJA 3D3WA 4ND3A 4WJZA 3NDJA 4EJ6A 1YXMA 4BO2A 2JCVA 4E5KA 1UP4A 3KETA 2FZEA 1H2BA 1ENPA 4NJMA 4OSPA 4L4SA 3PYMA 5DT9A 4WCFC 3VHRA 3I83A 1EFKA 1PGPA 1GADO 2V6GA 1V8BA 1N7HA 1I8TA 1SC6A 3DAFA 4L8VA 1P1FA 5EN4A 4QQRA 3UHAA 1IPFA 4TRJA 4E4YA 1UP6A 5A9SB 4NZ9A 4J91A 3UCEA 4LVCA 3DAPA 3JYOA 1EBUA 4BB5A 4AJ1A 3CMCO 1ORRA 3B6ZA 1PQWA 4FJ1A 2I67A 2Q4BA 4AJLA 3FCOA 3IP3A 4UVEA 3ZWOA 1RPNA 1SBYA 3I9KA 4TKLA 4B3JA 4GL4A 5KIAA 4GLLA 4U0KA 1U2GA 4ESOA 2J5QA 5C3MA 3WICA 3ON5A 4YDRA 1EK6A 3TZ6A 1P0CA 4DWVA 3S2IA 2J5KA 4RPJA 5DZSA 5CDYA 3RUAA 5TX7A 5DP2A 4AJIA 4I8XA 4CUKA 1EEHA 3GNSA 3P5SA 3FNGA 4LW8A 3GNTA 3SX2A 1NX6A 2OP0A 5JC8A 1C14A 1DB3A 3ROQA 3PJFA 1E7YA 2X5KO 1Q7CA 4WLOA 4IDFA 5F5LA 1GYRA 2HUNA 3VH1A 2D3TA 1GL3A 3BTOA 5TQVA 3KV3O 4E2ZA 5T64A 1DBVO 1U7HA 5B4TA 5KVVA 1OI7A 4IJKA 3EYWA 4FFRA 4ZN6A 3DMTC 4URFA 1L7DA 3C7AA 1ZK4A 5BNIA 3PGXA 1YVEI 4IS2A 2D5CA 2C2YA 3L9WA 3JD3A 2JL1A 3Q3CA 4EZBA 3PYLA 1XDWA 4RVHA 3UCXA 5I9NA 3SEFA 1D4FA 1KVUA 3FBTA 4MVJA 4DIFA 4I9HA 3NGXA 2NNLD 3STHA 2FHSA 2Y1GA 3AOEC 2I65A 2GERA 3JQCA 1DLIA 1ZK2A 4TZTA 1TT5B 2CSUA 3O38A 4Q9NA 2BMAA 2PD3A 4AJJA 4ZGWA 2P4QA 2YW9A 2DLDA 3ZU5A 3E6AA 2GZ2A 1OOEA 2GNAA 4YJGA 1O94A 1Q0HA 1VJ0A 1ARZA 6ADHA 1DC3A 1S7CA 3WTCA 1HDXA 4XYGA 3LT4A 1A4IA 2ZJ0A 4Q3CA 1IB6A 4Z9YA 1LLQA 2Y1DA 3HN7A 3PLRA 3GEGA 4OL9A 3V1UA 4GMGA 2RH8A 4HNGA 1E1NA 1PZGA 2AG5A 4E12A 4FFPA 1ZKMA 4BO8A 1QMGA 2G5CA 1PGOA 5LCXA 3TOZA 4N5NA 1X0VA 1QXSA 1SOVA 4JJFA 5ADHA 4CR7A 4PVCA 2IDZA 1VLLA 1Y7TA 1YWGO 3UFXA 1FDVA 1FJHA 4OM8A 3FI9A 4JJIA 1D3AA 1UZNA 3OA0A 4FSHA 3ZHXA 1X13A 4DIBA 5KTKA 2G82A 3AOGA 3KBOA 3MOIA 2ZCVA 5KJ1A 2YUTA 1ZVMA 2AG8A 2Q99A 4G65A 3TZKA 4HKTA 4EYEA 1J6UA 1NPTO 4KTTE 3PXXA 4OGWA 5TT1A 3DONA 5IDWA 2JD2A 4R9RA 3S2GA 3WTBA 3PTZA 4MP8A 3NDIA 4MO2A 3TJRA 4J43A 2JFGA 2Y68A 1YDWA 2QZ9A 3GRPA 4XR9A 3VOSA 4FR5A 1VJTA 4B3HA 3JYQA 1MUUA 2P9GA 4H7PA 1UP7A 5DDIP 4XQ9A 4CLXA 5MDHA 3ZWBA 4JLWA 5I9LA 3P2YA 4WK6A 1KY5A 2VRCD 3DHNA 3I23A 4E21A 1GPDG 4QFCA 1LRJA 4YB8A 5KKAA 4GAEA 4HV4A 1AHIA 3KVOA 4P4LA 2HK8A 2FMUA 4MIOA 3NDRA 4BQRA 1B8UA 4ZU3A 2AEFA 3MJEA 4TMFA 2YHIB 1VE9A 2QG4A 3H9JA 3X2FA 1JWBB 5ICSA 3DFUA 4C7KA 2Q49A 3I9NA 1GZ4A 1G6KA 1TVEA 4CR6A 4RLSA 1YJQA 1LU9A 3C7DB 5CPFA 2H63A 1SEVA 2R2GA 3OM9A 9LDTA 5EQDA 3NYWA 4MPDA 4KQWA 4WLUA 4CLRB 2W98A 3PEFA 3BZUA 4IGFA 2VZ8A 3QWHA 4R9SA 2BFPA 2VTDA 1CDOA 2O3QA 4BKQA 5LC1A 3L6EA 4PG6A 3LT1A 3VKVA 2ILTA 1XU7A 4CM3A 2GCGA 4LISA 4ZRNA 4FC6A 2HMSA 1U3UA 3ANNA 4GLOA 4OQZA 4ND2A 3E5RA 1R66A 3QWIA 1B14A 2UV8A 2NU8A 4BNLA 2D59A 2GZ1A 3H65A 4MINA 2I5PO 3U4DA 4RPGA 4R41A 2E82A 3ZNNA 2GDZA 3GPIA 4J0FA 1EDZA 1JQBA 3AU9A 1NP3A 4BMSA 2PZLA 4RPHA 1DFGA 5KVQA 5JAQA 4PLTA 1ADBA 2GASA 1PJTA 3VTZA 3NJ8A 4D3FA 1B8VA 3DR3A 3RFXA 1BVUA 1BHSA 5G0TA 2EF1A 4IDGA 4YJGB 4YJFA 3T7CA 5GZ1A 4E33A 4WOKA 3NT5A 4RO0A 1B16A 1JN0A 1K6XA 3TSCA 3CUKA 1JVBA 1P3DA 5I7VA 3SVTA 2PZJA 4G81A 4TRNA 1VSUA 3D1LA 2RIRA 4OIMA 4U6SA 5G4KB 3MJ4A 3GVXA 5TF4A 1WW8A 3TFOA 3NKLA 3OQ6A 1E7RA 4XQCA 4B8ZA 1PL8A 3RIHA 4IS3A 3WFJA 5FWNA 4NBUA 8LDHA 4O59O 3H4VA 3PJEA 4XIJA 4ZQHA 2X22A 5KVCA 2DUUA 2BLLA 1K6JA 3UH1A 4R51A 4OXNA 1ADCA 4D0SA 1WXDA 3L6DA 1LXCA 2WWRA 1V3UA 4BNYA 3WJ7A 5I8ZA 4L4RA 3VPFA 3N58A 2CVOA 4O1MA 3GGPA 2BH9A 2C07A 4J1TA 4PG8A 3GFGA 1HE5A 2I3GA 3OECA 1GV1A 4QXMA 3UXYA 1NBOA 4IDDA 4UUOA 3H5AA 2FWMX 2OZPA 4MVJM 2QIOA 5KOIA 3TZHA 1AXEA 3ZHZA 1N2SA 2CFCA 4EDFA 5JAZA 3NX4A 1YJ8A 1G0NA 1C1XA 5DULA 4YAJA 5CFZA 1WNTA 3A06A 5J23A 1F06A 1XHLA 4ID9A 4E0BA 3MJTA 3G1UA 4WGGA 3V1TC 2CF6A 2JAPA 3E9QA 3WSVA 4P8RA 1T2FA 4YACA 1E1KA 2HRBA 2A92A 3V2GA 3HFSA 2C29D 1DJQA 1UZLA 2HSDA 3PZBA 4K6FA 4GSLA 1DIGA 2YYYA 4X54A 1ID1A 3GEMA 3IJRA 3N7UA 4KZPA 1IUKA 4M89A 4OKNA 4LRSB 3TL2A 1E3IA 2O50A 1J4AA 1DDOA 1I33A 1FDUA 2HK9A 2JD1A 3M1LA 4NH4A 2UUPA 1BSVA 3M2PA 2GN4A 3PHHA 4J1SA 2Y0DA 3IOYA 4WLEA 3JQ7A 3WBBA 2PKQP 3ZV5A 1ISMA 1LRLA 5ES3A 1AGNA 1Y81A 2VYVD 2OORA 5U4QA 1T2CA 3ZV4A 2O7QA 3EVNA 1ZCJA 3CINA 3COSA 2X4GA 1QKIA 1WLYA 5KNLA 3GN1A 2ET6A 3GVPA 5BNTA 2J3KA 4IBOA 2IEDA 3IS3A 4MVJF 5ILGA 4BB6A 3ONDA 3A1NA 1Y8QB 4XA8A 1M75A 4CMGA 3E03A 3LF2A 2AQIA 3QRWA 4J7CA 3K73O 4DYDA 2E49A 2WYUA 1MXFA 2J3IA 3JD2A 4ND4A 2VHXA 1MX3A 1ZK1A 4OSOA 4CMKA 4CMBA 1DAOA 1EVJA 3DZJA 3OICA 2QYTA 3F1LA 3HZZA 4LGVA 1SAYA 3GH3A 4DGSA 2NACA 3O4RA 4YRBA 4RZHA 1Q7GA 2DKNA 4DPKA 3BA1A 4GX1A 5L40A 3DHEA 2X0RA 1A9YA 4BQPA 1EUDA 1HXHA 2WJPA 2YQ4A 4UVIA 1PZFA 2PWZA 2ZTUA 4D41A 4WLNA 4F6LA 1W0CA 1GUZA 2PGJA 3JQDA 4J1QA 1I3KA 3NGLA 1UDAA 4WNIA 3W4JA 2PGDA 3ONFA 5EIOA 5L45A 1KS9A 3FWNA 1IZ9A 2DT5A 4MKZA 4YT5A 3JYNA 1M6HA 3PQEA 2ZYGA 3RI3A 2X0IA 5JLAA 3IJPA 1HRDA 5DOZA 1GCUA 4U7WA 2C7VA 3OQBA 1ISGA 4ZJUA 4M86A 1RM0A 3VPGA 3VH4A 1IE3A 4O0LA 2PZKA 4J4HA 2A35A 3D64A 4J49A 4DXHA 1Y8RA 4EI2A 5F21A 1KVRA 2B0JA 1ZMTA 3S55A 3BMCA 3PK0A 4QUKA 4QO7A 3WMXA 1VPDA 3U0BA 1G1AA 4YA6A 4ALNA 3I5MA 3ENNA 4PZDA 4NI5A 3PJGA 1V3TA 3P19A 4C7JA 2Z5LA 4PLWA 5C7OO 5CP8A 2FRDA 5HWSA 1Y5RA 3MJSA 4CPDA 1MGOA 1XCBA 1JKFA 2NQTA 5L4SA 4F6CA 3D4NA 3IC5A 9LDBA 4F46A 2O2YA 3H9UA 5TJ9A 4JJGA 1E6UA 3HN2A 1XGKA 3JCZA 4HFNA 2X1HA 2DTDA 3V8BA 4A10A 1RM4A 1GZ3A 1HDGO 1Z75A 2R00A 3KEQA 4CQMD 3SJUA 2DC1A 3HWRA 1MP0A 2DBQA 3H9GA 3DMYA 4E5NA 4IJVA 4I9UA 2B4TO 3WQQA 3H6KA 3GA0A 1OFGA 3G17A 2Q46A 3LZ6A 4A73A 3I6IA 2O3JA 2FR0A 2QW8A 1QYCA 2Y05A 4XRGA 1ML3A 1W6UA 4RF2A 5DBIA 4NFSA 3W1VA 1CWUA 1LQUA 2AE2A 4XR4A 1XU9A 1UJMA 1ZXLA 3DTYA 2PTGA 4HY3A 4AJNA 4F3YA 3O03A 4OXKA 2X6TA 4RZIA 3ZI0A 1O89A 1YRLA 4JBGA 2VHVA 2LDBA 3TZCA 3KRTA 4S3MA 1R0SA 1U28A 4H3VA 4N5MA 2BFAA 4RLHA 3VZRA 4EW6A 3F47A 4ROSA 1RWBA 1NXQA 4EBFA 3PFWO 4MVJH 2A9FA 2ZKLA 4GX2A 4KDEA 3PGJA 2YFHA 2HDHA 4O63O 2FOIA 5JPIA 3FD8A 4CM9D 2G0TA 4BNHA 2HJRA 5CDGA 3QWBA 1H0KA 1U5AA 5CDTA 3NV9A 2W90A 1YL5A 3QV1A 4Q3NA 5COBA 4DQUA 1CQJA 1I01A 3INRA 1B7GO 3FWZA 4TSKA 4BKOA 1AXGA 4DL9A 5AQ1A 3OBBA 4R54A 1VKNA 3GVIA 4KUHA 3FR7A 1FXSA 1A7KA 3WB9A 2GN6A 3QVOA 4Q3AA 4CLOB 2WD7A 1DXYA 1P44A 1Y9AA 3PFFA 4DUPA 1LSSA 3WGOA 2OBNA 3JQ8A 3ROKA 2DAPA 3VH3A 4CM4A 5A9TA 5LDHA 3GN2A 4AL4A 2CY0A 4AJOA 2ZQZA 1ISIA 1SOWA 3F5QA 3LC1O 3PP8A 4JP2A 2HMWA 4HUJA 2FR1A 3UF0A 5TNXA 2FZWA 1ZEJA 1LDEA 1PR3A 2ZK7A 5JY6A 1JKJA 4LRTB 3SBOA 1IOLA 1L7EA 2EHDA 4P4GA 4XQGA 4IPTA 2I99A 3JQ8B 3AK4A 3HDYA 2WD7B 3KHUA 3Q0EA 4R5MA 4DLLA 3GG2A 1GD1O 3OSUA 1F12A 1HZZA 2PFGA 3KB6A 4TVBA 1HSZA 2Q3EA 4B4VA 4EUFA 2NVBA 1C0LA 2BGLA 4EJ0A 1PJ3A 4RVGA 1DLJA 1R4NA 3HDHA 1Z74A 1DIBA 2EGHA 2XPCA 1B15A 3DAGA 4Y98A 5K6AA 2ZIZA 4JIGA 4MDHA 3L4BA 3FF4A 1NVMB 3KEOA 5JC1A 4PIVA 2ZTMA 2PD4A 3OF2A 2VOJA 5T8KC 3ANMA 3W8DA 4CLRA 1H6BA 4PFJA 4OXYA 3ZW9A 5BSHA 1T25A 4ZD6A 2YHUA 1CIVA 1NASA 4TROA 1I2ZA 3I4CA 3KYDA 4CL8A 3PQDA 1V3VA 2QRJA 2FPIA 2V6MA 2WM3A 3DXFA 5IFLA 5KKCA 3OJOA 3ZWCA 1PZHA 1HL3A 3ZU3A 4II3A 4DLAA 1E7SA 3KTDA 2OHXA 3P2OA 5L7TA 3RC7A 4FJ2A 1I0ZA 4BMVA 1I2BA 3FTPA 3OJFA 5EPOA 3DO5A 5T8KA 4DIOA 1DIAA 4J9VA 5HS4A 2Y1EA 3D4PA 2FP4A 1HETA 3CPSA 1X0XA 4CM8A 4J7XA 4K1LA 4XQEA 4AJHA 3ICCA 2Q1UA 1KYQA 1PJLA 1BXZA 2CNBA 3LVFO 4L0QA 4CM7A 1ZNQO 4NFYA 1TI7A 4BL5A 1ZUD1 1WZEA 3GDGA 3BYZA 4FC7A 4BNFA 5BSFA 3WIDA 1KVSA 4CL3A 3UGKA 5CEEA 2JAHA 2NU7A 4W7IA 1P45A 4IUYA 4QX6A 5LDGA 1DOHA 3ETDA 5JCJD 3H5NA 3RUEA 5CEJA 3EUWA 1GEEA 1J49A 2G17A 5G0WA 3RD5A 2VHYA 3G79A 1U9JA 2B37A 2W2KA 1GV0A 3EK2A 4Y6SA 2YDXA 2HCTA 4MVJD 3JQFA 4WEQA 4B7CA 4GKVA 1ONPA 4HWKA 4IXWA 5HBRA 2VWPA 7ADHA 1P31A 1QYVA 1CF2O 3BTUA 4WECA 3Q11A 3ENKA 4BNTA 1ZJZA 4QFDA 4YXFA 2GPTA 4QO8A 1UAYA 1H9AA 1B2LA 2OUIA 4JN6B 5EERA 5DN9A 1PL7A 4LCEA 3ADPA 3FNFA 2XF8A 3RFVA 4E30A 1WDKA 4NMHA 1B8PA 2GO1A 4W7HA 1TT7A 1ISJA 4BO9A 4WCDA 2IODA 3E1KA 2OMEA 1M67A 3DEYX 2BI7A 3U4IA 1AE1A 5CG1A 5H83A 4TZKA 3M6IA 4K26A 2AQ8A 3BMNA 5T5QA 1EUCA 5IN5A 1W4ZA 4RF5A 3INGA 1I3MA 1EVYA 2WMDA 2BD0A 4J4BA 4W9NC 3ZWXA 2AQHA 4L76A 2J5RA 4MP6A 3E9NA 3QA9A 4PLFA 3OFSA 4LSWA 3DZBA 1PX0A 3W8FA 5ER6A 1H94A 4MKRA 5FI3A 1HE4A 2PH3A 2VWGA 4YRAA 2C7GA 3LT2A 1N1EA 1IPEA 2VOEA 1Y8QA 1QORA 2Q4EA 5IG2A 2EG9A 1G0OA 1H2HA 3W6UA 1FDWA 3DOCA 1GCOA 4ZQBA 4IMRA 3GVHA 2V7PA 4IDEA 2IYPA 3DZHA 4D46A 1KEUA 3WQSB 1F17A 3MTGA 1OC2A 1VL8A 2DVMA 2C5AA 3WG9A 2D5AA 3MWDB 3Q9NA 2CMDA 3JSAA 4AVYA 3RUHA 4KDFA 3Q9UA 5CHEA 3RROA 3VPXA 4BNNA 3WGGA 5FYDA 4RORA 5T57A 3CH6A 4RVSA 4A26A 1BTOA 2YZ7A 1AHHA 2WTBA 2ZYDA 4ALMA 3WJAA 4UREA 2OL4A 3EC7A 1E0DA 1SCUA 2RBEA 2FSSA 1EQ2A 2Y1OA 4CMHA 4H16A 2O23A 3KSDO 2B69A 5IAAA 2EKQA 3AM3A 3ITDA 1JKIA 1Q7BA 1IHXA 5JDIC 1HF3A 1GTMA 4DLBA 5IF3A 4YCAA 3F5SA 5I9MA 1ULUA 4UEKA 1NYTA 1QV6A 3H3JA 5IZCA 1P1IA 3GZ4A 1QLJA 2H1SA 1ZBQA 4Q3DA 4DMMA 1ENYA 1JW9B 2ZB4A 2D8AA 5JCXA 4R68A 4NIMA 4IZHA 4IIUA 1UUFA 1EMDA 2ZCUA 1BXGB 2POQX 4BVAA 3TQHA 3AUTA 4L74A 5A9SA 1MC4A 3ABIA 3HB5X 1JWAB 2BRUA 3AU8A 3C85A 5JS6A 5DP1A 5JO9A 2P68A 4XJTA 4FFLA 1HEUA 1LC3A 2EP5A 3GEDA 4JQCA 4BS9A 1AN9A 4CV1A 4YT8A 1TB4A 1YONA 3DFZA 3UKOA 3RC1A 2GRAA 4CM5A 1E3SA 4OH1A 1NM5A 4ZVVA 1DHTA 1SO8A 3BAZA 4PLZA 1FDTA 3PYXA 4NJOA 1NQAO 2BGMA 3MZ0A 4CMEA 5GZ3A 4YAEA 1I10A 3GGOA 2HKIA 5TGDA 4Q39A 1LTHR 3JD4A 4UVGA 1QR6A 3HB4X 1SNYA 2NADA 4FD3A 4FW8A 3GPDG 2G76A 2QQ5A 3IMFA 5G4KA 3UN1A 3GRKA 1IULA 3EHEA 4RL6A 5TLSA 2DTEA 1MFZA 5HM8A 1NWCA 3WWZA 1EFLA 3HNPA 5B12A 4J4TA 4PG5A 2Y1CA 4KOAA 3GOHA 1N8KA 3LQFA 3R3JA 3JQEA 1LSOA 3I9LA 1HDRA 4H15A 2PV7A 3PQFA 3Q6IA 3DC2A 1UXGA 1YH3A 2YJZA 3V5NA 4DBZA 3GVCA 4XYEA 3UVEA 3FNHA 3RSHA 5CAEA 3AM4A 4JGBA 4XIYA 4XRRA 2AW5A 3KLMX 1X14A 4J90A 1D1SA 2Z95A 2CUKA 2CDCA 4OOFA 4DVJA 3E5MA 4BNKA 4NU5A 3QQPA 3EMKA 5BSEA 1E3LA 4Z6KA 1PWXA 2VUTA 4LK3A 3D5QA 3PJDA 3K96A 3Q2KA 4XKJA 1T1SA 1X7DA 2IEBA 3D7LA 1VL6A 1HE3A 4GKBA 4IY1A 4W6ZA 2P5UA 3JQAA 2W2LA 1ZK3A 3TNLA 1BGVA 1PJQA 1JAXA 3CZMA 2I3AA 4GI2A 3GF4A 4E5MA 1RM3A 4JCOA 3E18A 3ROMA 4HFJA 3IL2A 1A9ZA 2NLOA 1RJWA 1HDCA 5I7FA 2OFPA 5JDIA 3FR8A 4XCVA 4YVFA 3ZWVA 2Z1NA 3F6YA 1A7AA 2AQKA 3OIFA 4B79A 4D43A 4GX5A 3RUFA 1X7GA 3ZNOA 2ZTLA 2H5LA 4BNVA 4FDAA 2AXQA 4JX8A 4JBIA 1EUZA 4AJPA 4XGKA 3FSRA 4GBJA 3ZWAA 1ZMOA 4D0RA 4Y8VA 1NR7A 2IRWA 4XWYA 1U8FO 3ZGYA 1WDLA 3QW2A 3R3SA 2GD1O 5ITWA 1HDOA 1W73A 4Z0HO 1E6EA 4C4OA 4I08A 2EEZA 3B20A 3BXXA 5F1OA 2PGLA 4XYLA 1KEWA 2GN8A 4HBGA 5A4DA 5EL0A 1GQYA 4IDCA 1E3WA 1ZSYA 4YR9A 2NV6A 3AUAA 3JV7A 5G0UA 3AW9A 1NFRA 1ZIDA 1PTJA 4FOOA 4CR8A 4WLFA 3C1OA 2EW2A 3GMSA 1XWFA 4DBVO 3ORFA 1MA0A 1ZW1A 1YQDA 1GAEO 1L1FA 1M66A 4TWRA 2H9IA 5FFFA 4B4OA 4K6CA 1PU2A 1I36A 4R1UA 1GY8A 2VUUA 3PRJA 5DNAA 3EW7A 1S6YA 5BSGA 1P9LA 3VVCA 5IXYA 4L9RA 4R01A 4BHTA 1YB1A 3ZH2A 1B0AA 1U1IA 4XDZA 1JAYA 4BO3A 4RDIA 4OQYA 3EGOA 2NVWA 5JO0A 4IZIA 2PD6A 2NTJA 1NVTA 2JHGA 3U49A 5KJ6A 2Y1FA 4BGIA 3FHLA 3H7AA 3EY4A 4UEJA 4R1SA 4MVJP 4Y6PA 4XYMA 4R4JA 3RBVA 4ITUA 1PGQA 5A3JA 1SZJG 1HZJA 4EUHA 1PGNA 1TLTA 2OP1A 1B26A 1PL6A 4IMPA 4ZA2A 2OXIA 4ZQEA 4DC1A 3WDSA 1NPDA 4AG3A 5JAIA 3AWDA 5JE8A 3K8ZA 2VUSA 2Y0EA 3DWFA 1DEHA 1MV8A 1NQTA 3JQ9A 2X7HA 4XZ3A 1XELA 2DQ4A 3ASVA 5ENVA 3WXBA 4D45A 1H6CA 1XR3A 3C3XA 1QV7A 4CLEA 5COAA 2P4HX 1PZEA 1O9BA 2NU6A 3DL2A 1WPQA 1ZEMA 3H5RA 4BNWA 5K0ZA 2JJYA 3LLVA 2FPPA 3KLPX 2AEMA 3QE3A 5L9AA 5KJFA 1JDJA 3IDSA 4OHUA 3K6JA 4PLHA 3ZNPA 4DPLA 3NAQA 1O5IA 3KYCA 4ZRMA 4Y9DA 4KUEA 3R1IA 1E5LA 3H2ZA 2UUOA 4XEHA 2UYYA 3L9XA 1HDZA 1R4MA 1X15A 5C5IA 2C20A 4OYRA 3OIDA 4IJWA 3RUIA 3RKUA 2EJVA 1N9GA 4CV2A 1RYDA 2YFQA 1R6DA 2CF5A 3PWKA 1M2WA 1U7TA 1R0LA 3W8EA 3VPSA 5TRTA 1NHGA 3ZV6A 3MWEB 1NR1A 3SLGA 2GN9A 1PEDA 3GZNB 4KQXA 1LSUA 4QT0A 4RF4A 5IDXA 3PVZA 1YE3A 1R37A 3DBLA 2VYNA 3O8QA 3QIVA 3WLFA 1BXGA 1T26A 1E5QA 1B3BA 3CEAA 1PQPA 4FGWA 5KJCA 4YQYA 4WCFA 1I24A 4PCVA 2VWQA
chains in the Genus database with same CATH superfamily
1IMJA 4YXWD 3OO1A 4HYEA 3EAGA 4ITVA 1CR6A 1S2OA 4R9UC 3TQOA 3C3EA 3RUPA 1MVNA 3B2EA 3E9EA 4E07A 1H5NA 2HFJA 2HA3A 2I9KA 5E4JA 1BG6A 1K3TA 1LRKA 1WEHA 1ZD1A 2PGXA 4UBJA 5BRJA 1HT0A 1PJZA 2MYUA 2P30A 2XE7A 1TU3A 3CUUA 3U81A 4H0NA 5U1PA 4RHTA 2B99A 5DTMA 3DKVA 1VHWA 3EY9A 1GGJA 5ECYA 3VSEA 5KQSA 3TRKA 2Z8ZA 5K6RA 5K1ZA 3MWKA 3N6XA 1YQEA 4G24A 1A3CA 1DNPA 4G63A 4R16A 5DXJA 5C80A 4Q82A 1UBJS 5KJEA 2QLBA 3WKCA 1Z56C 2VZ9A 1II0A 3VU8A 3RRFA 5KVSA 5TIIA 1JHZA 4P33A 1NTOA 5HMMA 5GZ6A 1E1DA 1NKTA 1V11A 2J4CA 2K2WA 4G23A 1DPGA 3KKNA 1LPOA 2TECE 3FM9A 3C43A 5ESXA 1LDYA 3M6XA 3OE7A 4R2XA 4EAQA 4OLHA 2WHXA 1QK5A 2QQEA 2WNHA 1JIIA 1AQIA 2J4FA 5KYWB 3O75A 1AHNA 3RAEC 4LZWA 5F2NA 3VDQA 4D97A 3GFSA 3A28A 1DPFA 3LG2A 3ZDEA 4CN9A 3BM5A 1SUBA 4NJMB 1EJ0A 3K1ZA 4FGLA 4II7A 4BBPA 3FVTA 4QJIA 4LHYA 2QJRA 3QFTA 2OCPA 1DDGA 2XMGA 3HYRA 3WWYA 4C0SA 1WB9A 4ITRC 1VI5A 4ZIRB 3V1NA 4NWIA 2JBWA 2QRMA 3RU7A 3L93A 1QG0A 3GLRA 5A04A 2I1QA 4MR9B 4MJLA 4I5EA 1JAIA 4MI9A 3GYBA 3KYCB 2Q1SA 4OLAA 3A70A 4W9RA 3K2EA 2BGTA 1FNBA 5AVRA 4DTIA 5FEUA 5EKXA 4Q4JA 4DB2A 2RHJA 2AJDA 1JXAA 5B7GA 3BWCA 3ESBA 2RMKA 1M8KA 2VCYA 3QFSA 4PFQA 1JT2A 5I7UA 1WB4A 3HLTA 3IQEA 3PXCX 2YJTD 1PHPA 4QRIA 3M33A 3OQNA 2HBRA 4UM9D 1RJ9B 1NP7A 4NG5A 5FBVB 3E5HA 5AJVB 4BOYA 3TPCA 3CF0A 4GR9A 4XX0A 3L7MA 1ULHA 2NZXA 2YZ2A 3K92A 5TSDA 3WYCA 1GGFA 1ZGCA 1FLDA 5TC4A 1CBUA 2HFKA 4JT9A 2DG2A 1HSOA 3AL2A 3ONWA 4B7XA 4BLWA 4OGFA 2GCPA 3F8WA 4J9UE 3LGXA 4X84A 3CN7A 3WGKA 4QJ5A 4HUQA 4PX3A 1TYBE 4YLYA 1F2VA 1T5BA 3OM1A 5EI5A 3GBSA 2Y0PA 1CDDA 1DP4A 4XWTA 5AP9A 4DKXA 4BFVA 3ELYA 3X1MA 1ELOA 5MN4A 3PUXA 3W7AA 2XE6A 2QZZA 4DLUA 4HX9A 3VO9A 2BEWA 3D3JA 5C8YF 2UYCA 4MA4A 1HBJA 4QQ8A 1R15A 2P9CA 2QXYA 2NQ2C 3WNDA 3ZZTA 2AYYA 1Y5LA 4P3OA 2X8LA 3IDZA 3MMPA 4G97A 2ZSJA 1GTRA 3ANXA 1N6RA 3NBKA 4UU1A 2WFLA 2CDBA 5JRZA 1CRQA 4TXMA 4Q02A 4RQTA 4B40A 3DA8A 3MUNA 5AW9A 1DAMA 3F98A 2R4UA 3A37A 1NDUA 1DV1A 1IZ7A 4Z0PA 4B84A 1QVWA 1X8KA 2OQ2A 3BMOA 4KIGA 3HCBA 1V1JA 4D25A 4EGFA 2HRQA 3ZW8A 4DLZA 1WCIB 4BFWA 3KIPA 2RGAA 4NMXB 2QTFA 5DBGA 4GBMA 3RASA 3U7EB 1JEQB 3PXEA 2WHEA 4TKVA 4RJ2A 1J2EA 2PXCA 4DLNA 1SPXA 1G2QA 3DKIA 3FUCA 1Q0QA 1F2UA 1T5IA 2B8NA 2C82A 5FNZA 4PONA 5JMWA 4XJXA 3KQUA 3UH0A 3R5HA 1OV6A 1POWA 2ZYUX 4OUKX 3QEMB 4LJRA 1AKUA 3NP7A 1JMVA 3AF4A 3G0DA 3QMPA 1OZ0A 3TGWA 1R0KA 4A4DA 1E3WB 4U5XA 4ENVA 1Z2AA 4WZAA 1FS5A 1LPAB 4B5KA 2ZRIA 3GJYA 3USES 2JJQA 3IP8A 1PUXA 2XA1A 3DLCA 5B6JA 1QH9A 2YQ5A 4KO3S 2WZCA 3UW1A 2OGUA 1CNEA 3ENZA 2QX8A 1CUHA 3O4IA 1CR2A 3F5MA 3P9QA 4DCNA 3CUVA 3PD7A 3CLRD 4EA6A 3NBXX 4Y6RA 5DEIA 4EUKA 2O8EB 4IIEA 3LDFA 4R7TA 3QVWA 5ED0A 1I3LA 2DT8A 5HFJA 1C7ZA 1SG6A 4KQ9A 4XAQA 1QDEA 1WMAA 3WZLA 3HL0A 2G36A 4AO7A 4W4TA 3IB6A 4GUDA 3DBRA 1LWOA 1NDQA 1CJSA 5CX4A 1W5AA 3B6JA 3GRUA 3IO3A 3RNLA 1KMHB 1O9GA 4UEOA 2O8BB 4FPXA 2ZBDA 4G2TA 3S2ZA 5KYYB 3T1VA 2C0CA 2QX7A 3OLVA 1DRWA 1ONOA 3H3FA 4N3GA 4R2KA 1OT3A 2J3QA 5C1PA 4LXUA 2I1WA 2X0DA 2GZ3A 5J4LA 5J2UF 5JDCA 4MVYA 4CQMB 3E35A 2YXPX 3AJDA 1RWXA 1ZRSA 3R3XA 2PUJA 2QVZX 5IDYA 1UPXA 2ZIEA 4W1QA 2CGEA 4X1IB 3CVJA 1LDNA 3DFMA 1M8GA 3IPAA 3PPVA 5CEFA 4CEJB 5C7LO 1U0TA 3AV3A 3NAGA 3RT9A 4P7JA 5LUBA 3VISA 4BRWA 1WHTA 1SK9A 2IZ6A 1LNSA 3RT7A 3WDKA 2ZRDA 3UQYS 4ZI2A 4MCIA 3KOZA 4BNZA 3FTDA 1C9KA 1DQNA 4Y2UA 3NUGA 2BTEA 5AW5A 4JXZA 1ILWA 1TEVA 2PLAA 2WDPA 1T5TA 1V2HE 3DJYA 4WBNA 1O0CA 3NBFA 1SXJC 4R3WA 2HJHA 3FZYA 1DL5A 3GDFA 2AVDA 5D6OA 2Q29A 3TAXA 5AJTA 1D2CA 3DEJA 3G9QA 3LHIA 1GPH1 1UKZA 2CBXA 1KDPA 2JHFA 2ZSHA 4P5DA 3H13A 3LQ2A 5DHTA 3D81A 1J0EA 4UKDA 2HK7A 2JF0A 2PXXA 1P2FA 4CUJA 3DE6X 4FCCA 1C4XA 4NZYA 4YCSA 4MHTA 3UG7A 2N75A 1V95A 4JDUA 2QTZA 1GFWA 1RP7A 4LY0A 4XTCS 2JGDB 5IKOA 4D0NA 2MSCB 3BQ9A 3C1AA 4P3XA 1K89A 3IT2A 1FRVA 3EVBA 4O4HA 4O4IA 5JADA 1T1IA 3REOA 1B74A 5MFZA 4LX8A 4I6JA 4M8LA 4C43A 1KYIA 2R96A 4IP0A 2F43B 1FFXB 2XXBA 1RFLA 4IINA 1KC3A 1Z0ZA 4I1OA 4EHJA 5EIWA 4NBWA 2EEPA 3PD1A 1E7QA 1BCRB 1GVNB 1EE1A 4V0KA 4L8GA 1ZW6A 3TQCA 1KEPA 5K3EA 3FMVA 3LDGA 4URVR 4MMXB 2H65A 1M2NA 2VHQA 3O93A 1FTYA 3G8CA 1OH7A 3IULA 3IHLA 4GT1A 3MLEA 4UMDA 2QR3A 2XMPA 4ZOBA 3RFFA 4ARAA 1XIVA 1NSTA 4DV3B 2VBCA 1KSHA 3P0HA 1WWKA 3LAWA 1NVAA 2O7SA 1S2GA 4QU9A 1WZCA 2XUAA 1RFGE 1WKCA 2IYWA 4OXIA 1ZL0A 5BMVB 2PIDA 2W0MA 4Y2SA 4ARUA 2JZOA 3SF8A 4ZC1A 1CUJA 1T13A 5KCMA 5ER9A 4G1MB 3V32A 1IC6A 3FWPA 1SG9A 4P5PA 1R12A 4EITA 3G49A 3OJLA 1K75A 4ZVKA 1F5NA 4NBNA 1R4ZA 1CZLA 1T3TA 4B6JA 4JYCA 1ENZA 4GPD1 4DLPA 1EUQA 3OF3A 4NSNA 4JLKA 4MS4A 4BVEA 1ZFNA 2P90A 4ACBA 2X13A 4ZZ0A 1JEYA 4UQLA 5BW8A 3EFEA 1R27A 2DULA 1MHTA 2WLSA 3LV8A 3ER6A 1LY1A 4N3BA 3WFZA 2XUFA 1G5FA 2YVUA 1XAJA 2VVTA 2IEYA 2BEKA 4G1UC 5LM3A 2SCUB 3QSGA 3GFRA 4LJ5A 3HUDA 3RRYA 2EKLA 4IDBA 4U39A 3VVLA 5KTMA 4B3TB 4LPSA 1ZIPA 4MICA 3SZUA 4BFSA 3C5HA 3CUSA 3C24A 4I1SA 4ZKEA 3PC4A 4E22A 2VH1A 1G8FA 2O4UX 2XCQA 2ZB8A 3DB2A 4FYJA 3CX8A 4UHKA 1M8PA 4BECA 1ECCA 1KI4A 2JVKA 4YAKA 2PNFA 2GZDA 2RHGB 2IWHA 1QIKA 4UEQA 1Y63A 3NDBB 3IHWA 3VV3A 1EVQA 1FZQA 1QFSA 2R3SA 4MWZA 3JD0A 3FF1A 4JQZA 4R40A 2JAWA 1C8LA 5IM4A 3SYRA 3FSEA 2H0AA 2W8BA 1KYWA 1DHRA 3REFA 2VBGA 3KAPA 3CB4A 2DJ5A 3M83A 3RHTA 5JXHA 4ISBA 4MARA 2YV4A 4KK3A 1E94E 2GILA 4R5HA 3SG0A 3WYBA 3O74A 4DJTA 3SN6A 2Q5EA 4REQB 3UY4A 1LD3A 1GEGA 4X1KA 4WL0A 3B38A 1DQYA 2JCXA 3F3SA 4JB8A 3T7KA 4BBZA 2P2YA 4ZYVA 5B4UA 3DYBA 4X6XA 1BFKA 1N2OA 1Z6ZA 1PL0A 5JH7A 1Z4QA 5E7IA 1YQWA 1NMEA 3N8HA 2L18A 4B8YA 1NG1A 4Q1VA 4ZK6A 4FGUA 5B1YA 2QSYA 4I5FA 4KXLA 5JS1A 1HUQA 3A3OA 1ULZA 4G0OA 2GXQA 1XAIA 2ZR7A 4DJDC 3G0BA 3ZOKA 4YQZA 4PAOA 3WGQA 2ERXA 4ZZ2A 1MTOA 3UMBA 1NUHA 3GUCA 3RR2A 2J0QA 4N5LA 1Z82A 4MULA 1HG0A 3B3GA 1IHYA 2YN2A 2GRUA 2JB9A 2OFWA 3JX9A 4FNOA 4OK3A 3JYHA 3RIGA 3U6BA 3O7WA 1EXVA 4XVQA 3U7FB 2JCYA 3W6PA 1RBYA 4LJ7A 5JMTA 1Y4SA 1GRCA 3N76A 5GV7A 4YCBA 3JPYA 4CDNA 2I6TA 3G6KA 2DKFA 3LYAA 3TSOA 1QUFA 1OLUA 5BV8A 4L9SA 1KA9H 4BO4A 4O4HB 4FUTA 1P7ZA 2V96A 4K7JA 1L1RA 2P1DA 2IOFK 1E2JA 2W6CX 3LUHA 5AKGA 3BFVA 3UA4A 1HORA 5HW0A 1G1MA 1RQPA 3E0XA 1DX6A 1V1MB 2H18A 2H92A 4M0EA 1XMIA 2X0KA 1P72A 1DVRA 1J20A 3B1JA 2YV2A 5GMOA 1QKKA 4TLLB 5IMSA 3PUYA 2GF2A 4NXMB 2EDCA 4QSMA 3NEPX 1N2BA 4QQNA 4KP7A 2VJMB 4PWZA 1Z2EA 3T3GA 3FN4A 3SS7X 4TS3A 5HCUA 3LE8A 3X0DA 1JU9A 5ALFA 5AOCA 5T4EA 1OFIA 2ZYIA 4K9NA 3KZNA 4Q1AA 3M5CA 4WESA 3VR6D 2NPIA 3F7MA 2NAPA 1HOXA 1L4HA 3GRYA 1EH5A 5DOVA 2JLRA 1XTVA 3HB1A 1P1JA 2B9VA 3D8RA 4MI1A 4O29A 1DBSA 1E1MA 1RE1A 4I4CA 3OZCA 2PMDA 4HNUA 4OO3A 4UULA 4MVXA 1J06A 4WN9A 3DTTA 2IHNA 3FCCA 3RJ9A 1C9EA 2JARA 1UFRA 2K87A 3Q7QA 3KZMA 3ZYCA 4GVXA 2IIQA 2HGSA 5T41A 4BJHB 4RHFA 4WLVA 1QP8A 2X19A 1SU8A 2J85A 3ADOA 3EVDA 2GYYA 2AYZA 3B1VA 3L49A 3OJXA 1CQIB 4B2PA 5KQLA 3OOJA 2X58A 5A3VA 4FFDA 1AKYA 1PZXA 1HT3A 1Q2XA 3K0BA 1B1CA 4RVNA 3D4OA 4QODA 2ZJBA 1JDPA 3KM0A 4DLRA 4Q6BA 4TS9A 5SY9A 4CF6A 4BGDA 5AHRA 2E85A 1KRXA 3EPJA 1QJ4A 2C9MA 3PI6A 3G2JA 3MTQA 4ZT5A 3KELA 2CMFA 2OORC 1BO6A 3SOPA 3KV1A 2W6PA 4AJ9A 2VYFA 2ABWA 3I05A 4YJHA 1C1XB 1V7QA 3M7IA 5FA6A 3KT6A 5FTNA 1M1ZA 4MROA 1NF3A 5ADUS 3KQHA 5JD4A 2WJYA 3T7JA 4E2FA 5KX5A 4Z3KA 3AKYA 4JB3A 3TLEA 4HZUA 2XOXA 1O0SA 4AWAA 3DDNA 1AQLA 1K1EA 3S2EA 4DYHA 3IQIX 3IQWA 5FQOA 1NW3A 2F3SA 4OHBA 3ITKA 5TMPA 1VP3A 1KI9A 4EI9A 2VJDA 2FK8A 5B6PA 1D1PA 2ZUWA 3PFKA 2DFKB 1GAXA 4BVHA 1N7IA 3LHSA 4R3NA 4XFKA 3ZZNA 5C5CA 5DV9A 3VSBA 5K2OA 3GJRA 2IU3A 3C5VA 3C6KA 1EE2A 3ONEA 5HDQA 5H02A 1EX9A 1UF9A 2CZQA 3OTIA 3EPRA 3QVGB 5FUWA 1PJ2A 4RH1A 3FCUB 5BR4A 4HN2A 1M2VA 2UZIR 2ZSIA 1UPBA 4QECA 1YRYE 4UQOA 4BC1A 4BE7B 3KVNA 3N2EA 2VATA 1KSFX 4R05A 3S2SA 4Y9RA 3CCFA 2RGWA 5LOVF 3HPQA 1LDBA 2FPOA 1XWIA 1ZJJA 2J9GA 4URUR 4NG4A 4UU7A 1KFJB 2OHVA 1E2BA 1AKVA 2VHZA 1E6CA 3JASB 1SEPA 5LIPA 1W30A 3C1UA 3CKKA 1HLFA 3ROPA 1XTKA 1E7WA 4AYTA 3SJ7A 4PAGA 3RVBA 4TYWA 2PRSA 3L1KA 1Q1QA 3N2GB 5AW8A 1KFKB 2YOHA 3GQVA 1BN7A 2Q3BA 2CXOA 3PHGA 3QG5A 4QHYA 4QXRA 4JOSA 5CLQA 4AMGA 5JY1A 2Z2XA 3HZRA 1Y8RB 1XPJA 2RCNA 2V0CA 1Z88A 4OQQA 8OHMA 1D9ZA 2R47A 2JHAA 2V7QA 1DAPA 5CLJA 5LKRA 1CFZA 4MIYA 4HUTA 1YQUA 3MOSA 3FOAA 3VSCA 4CIVA 1I6MA 4RCVA 5HXAA 3HCWA 4JC8A 2C57A 3QPVA 3SI7A 1VE3A 2GLTA 1NOJA 4G5HA 3PHLA 5HK9A 1KSGA 4D4GA 3JVVA 1KE1A 3N8NA 5JJ5A 1ZAYA 4EG5A 3AP1A 2IZ1A 3R4VA 4Z86A 3ET5A 4DC0A 3LYUA 1JT9A 4JLAA 3CVVA 4S05A 3T1TA 4WERA 3RHZA 2PBRA 1R0XA 1B8OA 3A6HA 1M33A 1DBWA 3SHTA 4TL9A 3V6LA 4D3DA 3PWSA 1EBBA 3Q88A 4R7ZA 4UHDA 4YV0A 2OXTA 2YWJA 3MQFA 4MWTA 1ECGA 1E8NA 3GCXA 4XX0B 3ZY5A 4TLAA 3ZCXA 2OCAA 4QTYA 3IT0A 2Y4OA 3K71B 3FJ1A 4TTPA 2LTAA 3WLTA 4YAGA 3O9ZA 1X1TA 1E5VA 1D7OA 1Q1BA 4PAMA 4BAUA 3LLCA 2J9RA 3UJ3X 5BYBA 1L5VA 4LI3X 2OD9A 1YULA 3WK5A 3AHFA 1ZS9A 1BEZA 4X45A 3NM4A 4OQDA 3SD7A 3DVAB 2J3MA 3RIXA 1JEEA 2OOKA 4NBTA 2VEOA 1F8FA 2V0NA 4N1AA 1J1ZA 1EX1A 1WXFA 2CEKA 3KUUA 4UVHA 3QKSA 2H4JA 5EIFA 4BGEA 1Y3AA 4E09A 1OH5A 5BN4B 1OAAA 4B31A 4K9SA 2R4TA 4D42A 3FROA 3K20A 4RM3A 4F06A 2QSZA 4JBNA 4PYMA 2XA2A 1OGJA 3A1VA 3AUYA 2BSXA 4KXWA 2C96A 2OCBA 2D62A 1TE2A 2E6KA 4ZODA 2JGLA 4B46A 2HAEA 3DGFC 3TZEA 1ZQ9A 2G1UA 2GVZC 2HDOA 2RHRA 3E8SA 1UOPA 4OVKA 4TV9A 3PITA 5HX7A 2JLQA 4U0JA 1H2WA 4WT7A 3R6TA 4K9DA 5MGBA 3GEIA 3R8FA 1OLOA 2P9QA 1YBAA 3JQ7B 4EZEA 3U7GA 2QNIA 4CTOA 1W36B 1RJGA 2IA5A 3NTOA 3QE0A 1MLDA 4K0RA 4MQFA 4JT8A 4CMIB 3SR3A 2V7EA 1M1YE 3WGLA 4EB0A 5H7XA 4MLCA 1JGTA 5KDLA 4BRSA 1KU0A 3K9CA 3RTDA 3I53A 1ANKA 3U19A 3CKLA 3L0DA 3EB9A 3IE2A 3O0TA 4PC6A 3T3MB 3UJBA 3LDUA 3BMQA 2AFHB 2JIPA 1O87A 4IDAA 1E9RA 1ZIYA 3DBHA 3ICOA 3GMTA 4DEXA 1WV0A 4CZ2A 4U2BA 2BF7A 3LUKA 3JQGB 2CD7A 3DLHA 1VPWA 1ZOIA 2HMTA 3AMVA 2I7DA 1JFLA 1T4GA 3BN3A 3NANA 3RFTA 2QMOA 3UANA 4HO1X 4BFZA 1MB4A 1XQ9A 1M3SA 1YQXA 4N39A 5D86A 3TEFA 5BWOA 4W5OA 2HU5A 1BIFA 1PS0A 1P8AA 1R8SA 1CUDA 3B1KA 3HWWA 2RHCA 5M3BA 2IS4A 3L40A 3NTRA 2DUJA 4LECA 2Q50A 1SRQA 3FX2A 1MQAA 4QFBA 4I6GA 1SUAA 2DF8A 2XR1A 4ND5A 3LYLA 4MSUA 2FRXA 2W4QA 3AI2A 3TI9A 1PUJA 3UEOA 7AT1A 5JAOA 3A31A 3L4JA 4IGEA 4DBLE 3QWFA 3G3EA 2AA3A 3DZIA 3O26A 4J2HA 3B3FA 2BM0A 3A27A 3R4CA 4WASA 3MHTA 1HQDA 1XLVA 2PLWA 2V8BA 3L5KA 3DZGA 4MZXA 1VKOA 2I8CA 1Z07A 1WA5A 2FSVA 5CTJA 2QQGA 2H2IA 2J3LA 3KXDA 1W88A 3LQRA 3HCOA 4NQZA 2HHJA 3KFXA 1T9CA 1LB1B 2FN7A 3EGXA 3HBMA 1V25A 2F1JA 3Q5DA 4PGMA 5D5HA 5J43A 1X9IA 3C3CA 4DW8A 1VYUA 3QZUA 4ZAGA 4YP1A 1FRNA 1PD0A 3GAMA 2DPHA 2OBYA 5AM4A 4N5IX 3RANA 3VI4B 2ZFUA 1N9GB 4FFNA 3NC4A 4LF7B 4XPIB 3OU2A 4X85A 3H05A 2B21A 4ER3A 1PVOA 4HQKA 4CV0A 3FVVA 1EJ6A 3LU1A 1IHPA 2A14A 3EQ8A 5CVCA 1F2TB 3U44A 2ZSFA 3RE1A 5LP6F 5F9FA 1RYBA 4OLJA 2QKYA 1WLSA 2V9PA 2WJIA 4LKOA 3R0IA 1WMFA 3CLUC 3F4KA 5HP4A 4HX2A 3OP4A 2OR3A 1GU7A 1ACJA 3EGEA 1TMGE 4FEYA 5FWYB 3IAUA 4D9IA 5IBRA 1XMQB 1FXWA 2VP4A 3I5XA 4F7DA 4FMCF 1RYEA 1DC5A 2EZUA 2BBOA 2X8JB 3FG9A 1VQ1A 3AF5A 4EGQA 4H1UA 3KR9A 2ZRKA 1KXJA 1H6AA 1OAKA 3FZGA 2WTNA 3WBFA 4IQ8A 1LVGA 1USGA 2OCDA 4I9FA 5CVEA 1DBQA 3G0OA 4ZI7A 4I5GA 1POXA 2YWRA 2DCMA 2VYVA 3NXKA 3QFRA 3DDOA 2VJQA 3H6HA 4FFMA 4LN1A 1TZCA 4MUIA 2JA2A 2IUTA 4WNCA 2EGGA 3EQZA 3GHHA 4YPOA 2GM3A 4R6XA 5INTA 3EDCA 5T4HA 1OFHA 3DBVO 4B3MB 3OEYA 2WSBA 2ZI4A 4CQLA 4N9QA 4AICA 2VRBA 2H9AA 2HADA 1FLNA 3V1YA 1IWOA 4KVAA 2R8EA 1G66A 5C31A 5TXGA 2VBIA 2XTZA 4C88A 1NX9A 1OHHA 4K28A 3U2QA 3ZXXA 5KQPA 2I78A 3QMWA 9ATCA 3OPYA 4CM4B 4PBTA 2AFIA 4NCNA 3RAJA 1X1EA 1ADGA 2GJSA 3G7UA 4O4LF 5G2OA 2GTIA 2QE7A 4OMDA 1E2MA 4CRWB 2VN8A 4TM7A 3GY0A 5DRYA 1NDHA 4J0GA 2HO4A 2WFAA 2FB9A 2ZEJA 4QBHA 1WCWA 2QBYB 4D4KA 4I7EA 4TTTS 4B34A 1TYZA 2GEFA 3HCPA 2Q3DA 2RI1A 4Y0VA 4PRYA 3B8EA 2C1EA 2D6FA 1EA7A 4YBZA 1NMZA 1PE0A 2AKEA 1FEZA 2FMKA 4LZJA 5I47A 4O3FA 1RLOA 4BTVA 4C2UA 5JSHA 4Z51A 2BKAA 3EIWA 2N46A 1XPRA 1CUGA 4EEXA 3PDHA 1HLDA 4J16A 4LUCA 5DM2A 3VNRA 5BP7A 2FU5C 3CZRA 5EHZA 2OTCA 1DS6A 2M6RA 3TNDA 4PLYA 1A72A 2P4UA 4WCFB 1VP9A 2BKVA 4GX0A 2AOUB 2I03A 2FEOA 3SXUA 2QD5A 3TKAA 2FEPA 3HFGA 4HGQA 1MC1A 3IIMA 4IX1A 4PZYA 4WFQA 4C6SA 3I2FA 1HNXB 1IWBB 1F8XA 1NLYA 1M34A 1TJYA 5TMBA 2DRIA 4XD7A 1YQTA 5DK6A 2V45A 4RTMA 3CR7A 2GSDA 1QSGA 1ZUNB 2IXBA 4IEEA 4QLBA 5M29A 5AVVA 1E32A 1FP1D 3KQMA 4YJDA 3WNCA 1I9GA 4BDSA 4BNXA 1F8UA 1LX6A 1XLTC 2ILVA 3O8DA 3TB4A 4N0PA 1N8NA 4R6WA 4NJEA 3W9YA 4CIBA 1XVVA 1APBA 1BA3A 1TA0A 2BP7A 2QPOA 4L8WB 4DLKA 2J6IA 4V1CI 3DOOA 4LWQA 2D2IA 2VC2B 4Q5IA 1U3CA 2C7BA 2WMNB 4CUZA 2P1ZA 3W4KA 1SGWA 4L07A 4OQPA 2VJPA 1R4MB 4TTAA 2FQXA 2OWDA 5ELXA 2MYTA 2XUDA 3VRHA 3WL4A 4C05A 1JHOA 3T3HA 4C7OA 1W96A 4JLUA 2BHLA 1T8TA 3AFGA 2QTHA 5PNTA 1FC0A 1EQUA 1TLFA 2LE0A 2QNBA 2EP8A 3KUCA 5F3DA 2C2MA 2DTXA 3G2LA 1XTIA 4PE5B 1I7DA 2ZJ2A 3D3WB 2ZUDA 2QTVA 4G37A 3QNWA 4WNAA 3NYQA 1DJNA 1O03A 1W93A 5KU7A 2I6FA 1NW9B 1JKXA 2MHCA 3HPRA 2GAOA 3K9LA 2Q7DA 1U0NA 4EF6A 4PF1A 2IITA 1N3BA 2I8AA 4N0QA 5JLJA 4JELA 3LDHA 2ICAA 1EDOA 5CNIA 2JFHA 4R71A 2FVXA 3E7WA 3EEIA 1LLUA 1I80A 4H3SA 1YJAA 1LK0A 2JLYA 4FYYA 3YASA 1KIFA 1NVBA 1TU4A 3FPLA 2JFBA 1V2GA 5FOTA 3IP9A 3JQAB 2I3BA 4C5BA 2ZJ7A 4RE5A 3R7NA 4ZCIA 4L3VA 4B4WA 5DISB 4DSUA 3U09A 3RCBA 3TRDA 3KZVA 1I32A 2PK3A 5EUBA 2PX0A 4C0LA 5IJZA 1W85B 2IZ5A 4TLBA 3FOEC 3CPJB 3SCZA 4NZZA 2RH4A 3KTAB 4EY3A 2HIAA 1UK9A 1VBMA 4CCYB 1AGXA 5A3QA 4OFWA 2DPGA 2PX8A 1T4BA 3W34A 4H77A 1JR3D 1N78A 2I2DA 3BMXA 2FN4A 2FNAA 4Q3EA 1PSDA 1P3JA 4A0QA 2HJWA 1QAOA 3JU3A 1L8AA 4JROA 3V8VA 2PH1A 2J9YB 1X1CA 1RWWA 3AJ8A 4QXOA 3VI3B 2G7MC 1X87A 1O6ZA 1ZZEA 4MRRA 3VAYA 4G5RA 4AIIA 1U3TA 1GA4A 2G04A 3VOAA 1ODTC 1KF0A 1P1KA 1QZTA 2D7CA 3HNOA 5EJGA 3UJHA 1UQRA 3QLJA 4BP8A 2QE6A 4HXYA 1JBKA 1NQ5A 2V7BA 3QUSA 1UDBA 4Q9IA 1TT5A 4HGNA 4UTZA 4WD3A 4WH0A 4EHIA 2OCGA 2XUZA 3KSUA 5BVHB 1LI4A 1GSIA 2NSJA 4YQEA 5IKPA 4I55B 4NCXA 2E0IA 3DPSA 2A84A 1O4WA 5FEMA 4ODIA 3HACA 3D3WA 1M7BA 2AFHE 3OEHA 3PDJA 4ND3A 3QYAA 4NYIR 4WDQA 3U4MA 4RC9A 1OXSC 3FFBA 3WYAA 1YXMA 4X3OA 3ZWKA 4DWOA 3DDHA 4M37A 3ZR4B 2SKEA 1Z5GA 3A1UA 1VGVA 4GVPA 2ZIVB 2YY6A 1OX4B 1YF3A 1BDIA 1LFDB 1G4AE 4RZXA 3GLHB 3FPFA 4OGGA 1Z3IX 2WB4A 4QKQA 4INOA 5KYXA 2HJGA 3T3IA 4TL8A 1G20E 2XMSA 3PYMA 3MMZA 3R23A 5ALMA 3I83A 3EH1A 4PR3A 2XQKA 4KU4A 5EQTA 1PGPA 2H2WA 4FHZA 4DMUB 3ADDA 3DV0A 4PINA 4B3BA 3DAFA 5HMLA 2ZPUA 2YINC 4QQRA 1IPFA 1GR1A 5BQOA 2G5TA 4FR0A 3IPRA 4NZ9A 3ZZUA 3UCEA 4LVCA 5CK4A 2EHJA 2E55A 3L01A 4RKFA 4HNQA 4O2BF 1UPUA 4YRRA 2PAAA 3UJ9A 4AJ1A 4BB5A 4WJKB 5B36A 2X4IA 2EFJA 1OH6A 3PE3A 1MT3A 2I67A 2Q4BA 2Z3ZA 3C3KA 3IP3A 3KT0A 2CNWD 5CYOA 1N6OA 4KO4S 5FI0B 2PKEA 5C4GB 3NKVA 1RC0A 1Z9BA 5CTAA 1B1AA 1P75A 3I9KA 1PNOA 2D2XA 4TKLA 3RYFB 3B13B 2FEXA 4BZQA 1B00A 2M32A 2O8DA 3U31A 2VL7A 3S99A 2VHUA 3U3RA 3HRIA 5DHQA 4FKZA 3DDZX 3C6MA 4EPXA 1MIOB 1N3IA 1Z17A 4I46A 1AA6A 4LBVA 4QDXA 3FDXA 4U8HA 5DZSA 2EL9A 5DSTA 5E9AA 3CCCA 4AJIA 2A9VA 1YUNA 1DC8A 1J0BA 2C58A 2HPZA 1IUNA 1YU9A 1Z2NX 5CT9A 5JZSA 3PC2A 4RLFA 1U2DC 3GNTA 4OJYA 4Y1EA 4DIMA 2OP0A 1U7OA 1EHCA 3GLGA 1CV2A 2PMWB 1G5IA 3FGZA 1BS1A 3ORQA 3W0LB 1E7YA 3GJ0A 2X2PA 4TMVA 4YXWA 1C7QA 2UUBB 1Q7CA 3CPEA 4CKBB 4QDZA 1XXLA 3WLNA 1M7HA 1C1HA 5BNWA 3TX6A 2ECOA 2DGDA 2HUNA 1HURA 3SDBA 3KLBA 3BTOA 4E2ZA 4DWJA 4KZKA 1FXUA 1LJUA 2QG9A 2BEUB 4JQOA 5B4TA 5KVVA 2ODWA 1E2KA 3LP5A 3P26A 3UT5B 1OREA 1Z4LA 1B6RA 4UTXA 3RSOA 1HK7A 3ECCA 1NI5A 5BN1A 3U1BA 1QR2A 3OTHA 4RBNA 4C78A 1RDFA 5KYXB 4OAOA 3OD5A 1L7DA 4LDZA 3KSMA 2AD1A 3OESA 1NVVR 4R2MA 2V5AA 4DILA 3LGAA 4D9MA 3A1CA 1O2DA 1R7RA 3J81A 1L4BA 1REQB 5HOEA 1FXWF 1RYYA 1XDWA 2WA2A 4IVPA 4JAVC 4OF4A 5FOWA 1MCZA 2IBMA 4UNPA 3NRBA 3SEAA 3SC2A 1GNSA 4I9HA 3ZGOA 5BMOA 4RCYA 3STHA 2FHSA 2ZI3A 2C5FA 3AOEC 4NV3A 2QN1A 1DLIA 3TVTA 3Q8LA 1M9NA 1TT5B 5F1YA 1P9RA 2KMLA 4ZVLA 4LYAA 3REGA 4Q9NA 5JCZA 1S0UA 4BVLA 2WABA 2P4QA 4E88A 3AETB 1W0JD 5E1DA 3I5UA 2NO0A 4EJFA 1OOEA 4BUJA 5CD9A 4RDXA 1OYOA 3GLFE 1XCGB 3HZOA 4PIMA 4NMMA 6ADHA 5AKEA 1AS0A 1HDXA 3D6VA 4XYGA 4ARSA 4RHCA 2Z30A 3X1JA 2ZJ0A 121PA 3IVAA 4GNKA 3UV6A 3KQNA 2D7DA 4HAXA 1N3LA 2DUMA 3MFYA 1PJAA 2XNDA 1YR2A 3GJ4A 3NVDA 2E21A 1UFVA 1NLZA 1BE0A 2IPAB 2ZIGA 1KZYC 4MRAA 4LYDA 4MRNA 4D57A 2AG5A 1A7JA 2TRSB 3NM5A 4E12A 1H1DA 2PBFA 1YUBA 2BONA 2ODPA 2OZVA 1SCKA 2HTFA 1AKMA 1Q21A 3AG5A 4WXHA 5JG7A 1QMGA 4KK4A 3KQWA 3ZQUA 1M54A 1PGOA 1SIOA 1B8NA 2PLRA 3DJFA 3GD5A 2I2CA 2R1VA 2WFMA 4I4NA 4MB0A 4Y9UA 5EE9A 4U7GA 2A9RA 3KKMA 1SOVA 1KPGA 3SHQA 2B6HA 3MB5A 1PDVA 4JB2A 3TUIC 4CKXA 1T3SA 2IDZA 3LPNA 3UFXA 1HM5A 2AUNA 3SS8A 2LXNA 2Q3LA 4H1WA 2O8CB 1D3AA 1UZNA 1MW9X 4C6RA 5J5VA 3N3AC 5JJKA 1FBNA 3MOIA 3RSQA 4HL6A 2ATIA 4HLNA 4MV7A 4R1OA 1CB0A 4D4IA 4G1BA 1D8TA 1DKPA 3JWGA 4OQEA 3TZKA 3N7TA 4RABA 4HKTA 2CXQA 3MERA 3TO5A 3NVKI 3OTGA 1MAAA 3D4BA 4KTTE 4YS6A 3PXXA 4MGKR 3DONA 1J97A 2VP5A 1RRKA 4RVOA 1T4CA 5DGCA 4GOND 5IDWA 3S2GA 4PTZA 4ZT4A 3WI7A 1D5WA 3EFOB 1X80B 3WTBA 5J47A 4PZ9A 1WPRA 5KINB 5KTRA 3G7NA 1Y1TA 2NT3A 3J7TA 1R88A 1NP6A 1S02A 3DGEC 3KKQA 3L8MA 3ZWDA 2VQ6A 1Q20A 4BWFB 1SHJA 4XQ9A 5KAMA 1URPA 1QFJA 4TLCA 4F7WA 5MDHA 1QM5A 1G8KA 4JLWA 5I9LA 3IBGA 4B44A 5K0NA 5KREA 2A2ZA 5P21A 3WL8A 4E21A 3DO6A 5KKAA 2VI5A 3DLBA 1GPAA 4JJAA 4QHTA 3G0CA 3KLNA 5EXPA 4HV4A 1V8ZA 2IHBA 2IX9A 3KVOA 3OPMA 4P4LA 3CLUD 4PX2A 3SY8A 1W2GA 2GD0A 3NDRA 4BQRA 4C0QC 4ZU3A 4E7OA 4X62B 3VNVA 3MJEA 1FRFS 2IOQA 3DXYA 1SKQA 3AW8A 2Q49A 1T8SA 2WJJA 4W8OA 2QAGC 2V3WA 2BGUA 3GLTA 4ZO6A 1M34B 1NA5A 3MPUA 2G06A 2Y9PB 4POOA 2RG1A 2YXEA 1A76A 2B1RA 3B3JA 2ZDHA 4IIBA 4PTLA 2O2GA 3THYA 1FSPA 1BN6A 1EUDB 1EJ2A 1SEVA 1XQWA 2B9EA 2I34A 3H1FA 1SKYE 1J24A 3Q41A 4PNZA 5EQDA 9LDTA 1QANA 1XDGA 1XDSA 3M1IA 1D6NA 3PEFA 4IJMA 4PO1A 2WWWA 4D9GA 1X39A 4Y2HA 1ODCA 2QD1A 2WYOA 5AOAA 3A11A 3ISTA 2JBHA 3QVKA 5LC1A 3LW7A 1LF0A 3HC7A 1N2XA 3LT1A 3PR2B 4UBMA 3KUKA 3PBKA 3TKYA 3EIHA 5CVVA 2AC4A 1SULA 4ZRNA 1C4OA 2ZE7A 2HMSA 1U2QA 5KTTA 1YFLA 2YL2A 1UM9A 4MQ5A 4X3CA 4AD8A 2QBYA 4EFMA 4FFVA 3F0TA 1JQDA 4N01A 1R66A 4CIXA 2IBSA 1OZHA 2UV8A 2JC3A 1THZA 3KCQA 4HDOB 1BWRA 1E2QA 1XB2A 1FE8A 3ODPA 4YI5A 4BNLA 3U4DA 1E63A 1QDUA 4KQJA 4MW5A 4YMIA 4Y3UA 4UJ3A 2AFIB 1DOZA 3AXTA 1XWWA 3EQ6A 3O94A 4ZVOA 3ZNNA 5JBQA 2GDZA 1A88A 1JQBA 3A6LA 3AU9A 3HXKA 5LBTA 3KBBA 1NXSA 1ZUHA 2PZLA 1Q3TA 4RPHA 1TO6A 2YNMC 1CHNA 5KVQA 3FSGA 4D3YA 1XNRB 1ADBA 4CG2A 4E5DA 1HI9A 3IT3A 2BZSA 3VYSB 4D3FA 3HR8A 3ZXSA 3TOSA 1Q3KA 5DVZA 4BFXA 2QW0X 1IIBA 3B3AA 3ME5A 4OQNA 4LXYA 4DNXA 1IUPA 5FOVA 3V3TA 3TIXB 1G21E 2G07A 3CH7A 5H0IA 1K6XA 3TSCA 1MRSA 1JVBA 1P3DA 3UKJA 1RAEA 3ZLBA 3HM9A 1XZJA 3PGA1 4ARIA 1X7YA 4G81A 4JL5A 3OHMA 3P9NA 4OIMA 2GTPA 4U6SA 4L7VA 3MJ4A 1L6IA 3L6UA 1CQJB 1HYBA 4LOIA 3VR5D 4L27A 4X8LA 3ZGNA 4ACAA 1RXWA 1PTJC 1QP0A 1E7RA 1IDN1 2Q5LA 3GUUA 3O8NA 3Q85A 2IXGA 4P98A 4XQCA 3BK1A 3JASA 2ZYVX 3BQNB 1HEYA 3L7KA 1JNYA 2FUEA 4IS3A 4F4DA 2E5LB 2NU7B 2Z58A 3IEXA 3TX2A 5FWNA 2QRVA 1YNSA 2GBIA 2I4OA 1YRAA 4JP8A 2C94A 3KKPA 4ZVUA 4KFTA 2EWVA 2AFRA 2Q1YA 3BEOA 4I2VA 2IQ5A 1OI4A 2A0KA 2BLLA 1F2TA 4QYWA 3UH1A 3U44B 2DB3A 4Y6OA 1WXDA 4HPJB 3AV0B 4MR8A 1MHPA 1JG7A 3VDXA 5KSOA 1WS6A 4NENA 2DLNA 1YTLA 1W5SA 3VPFA 1C9DB 1FFCA 3WJ7A 3N58A 4XWOA 1PFYA 3GGPA 3BRQA 4PG8A 4YDQA 1M2OB 3FSJX 4MK4A 5DNEA 3LX4A 4GMHA 2I3GA 4JC5A 1RRCA 4LIPD 3V7NA 1A95A 4EB3A 3ZXYA 3O8OA 5EMLA 1NBOA 2HHCA 2WM8A 4IDDA 5JNWA 3X2SA 5H8WA 3QPDA 3FJOA 2H07A 1U81A 5KQMA 1GQSA 2D2VA 5I45A 2J3DA 4P2BA 3V7YA 4D9HA 3BE4A 2OZPA 5CH3A 4RACA 3ZIDA 1AXEA 3ZHZA 4N5DA 3I2KA 5HFAA 4DY6A 1EDBA 3P20A 5JAZA 3JAWA 2ZIWB 4N8EA 2O0LA 3PFCA 1C1XA 721PA 2G71A 2GEDA 4K8RB