4OJTA

Helicobacter pylori mtan complexed with s-ribosylhomocysteine and adenine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
231
structure length
231
Chain Sequence
MGQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Helicobacter pylori MTAN enzyme reveal specific interactions between S-adenosylhomocysteine and the 5'-alkylthio binding subsite.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords MTA/SAH nucleosidase
total genus 88
structure length 231
sequence length 231
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ojtA00
3OPVA 4M3NA 1OTYA 1PW7A 2A8YA 3GB9A 1U1EA 4LZWA 2ON6A 1Z5NA 1PR0A 1JDZA 3EUEA 4GLJA 4I2VA 3MB8A 4YO8A 1PK7A 1PR4A 1Z5PA 4DA0A 5F7OA 4D8XA 1G2OA 3DDOA 4LKRA 2A0XA 3E9ZA 1YQQA 1OV6A 4L5AA 1ZL2A 1A9QA 1PKEA 1RXSA 2OC4A 3FWPA 3LGSA 3O6VA 4GLFA 2OXFA 1ECPA 1YQUA 2XRFA 4QFBA 4L5YA 5F7ZA 1K9SA 4WKPA 1JDUA 4WKBA 5B7PA 1Z37A 3MMSA 3EUFA 2QPLA 4R2XA 4X24A 3ONVA 4F2WA 3OZDA 3E9RA 2AI1A 4RJ2A 4YMLA 4D9HA 1Y6RA 4F3KA 4BMYA 1B8NA 3P0EA 4OF4A 5B7GA 4DAEA 4QATA 3INYA 1Z34A 4WKCA 3FB1A 1V45E 4ECEA 5CXSA 4G8JA 3K8QA 4M1EA 4TXNA 4F2PA 4TS3A 1ODLA 4JWTA 4MCHA 1ULBA 3OOHA 3NM5A 1OTXA 5CCDA 1PK9A 1A69A 1T8WA 1RSZA 3OF3A 4G41A 1U1FA 1A9RA 4OEHA 1RR6A 1T8RA 3KVYA 4E1VA 3IEXA 3TL6A 1CB0A 3KHSA 4H1TA 3OZBA 1A9TA 4GKAA 4L0MA 2HSWA 1Z33A 5EFOA 1SD2A 3UT6A 1LVUA 4PR3A 1Z35A 1NC1A 3PHBE 1NC3A 1T8SA 4PNPA 1N3IA 1JDSA 3BJEA 3O4VA 5B7QA 1Y1SA 5F78A 3LA8A 1RXUA 3KU4A 3UAWA 1Z39A 3DP9A 2AI3A 1JYSA 3UAYA 1Y1RA 1WTAA 3PNSA 1I80A 1ULAA 3PNPA 4KN5A 3UAXA 3U40A 4LNHA 1VFNA 3GGSA 4OY3A 2OC9A 3IOMA 4DA6A 3KUKA 5CYFA 1V2HE 1SQ6A 4F1WA 4TXMA 3P0FA 1JP7A 3FNQA 4L5CA 4TTAA 2I4TA 3FUCA 1V41E 4DANA 1K3FA 5CCEA 1Q1GA 3EEIA 5ETJA 1RCTE 1SJ9A 1PR2A 1ZOSA 4TYMA 1Y1TA 1Y6QA 1XE3A 5F76A 1JDTA 4MARA 5EPUA 4G89A 3C74A 4R31A 5JPCA 2ISCA 3F8WA 4GMHA 1U1DA 1Z38A 1TGYA 5F7JA 3UAVA 4NY1A 1QE5A 2QTTA 4EARA 1M73E 4D8VA 1CG6A 5FAKA 1PR6A 4QAQA 1OUMA 4DA7A 1SD1A 3BSFA 4DA8A 3DPSA 4D98A 4OGKA 1LX7A 4MCIA 1ODJA 5B7NA 1ODIA 4NSNA 4D8YA 4TXHA 2I8AA 1RYZA 1RT9A 3FAZA 1B8OA 1JE1A 1JE0A 1A9SA 4DABA 5EUBA 1TGVA 2Q7OE 5IU6A 1VHJA 4BN0A 4L6IA 1JDVA 2IQ5A 1RXYA 1ODKA 3T94A 4TXJA 4YJKA 1PF7E 5CYGA 5IFKA 2A0YA 2PGAA 1Z36A 5K1ZA 4DAOA 1FXUA 3NM4A 4K6OA 2BSXA 5F73A 1U1GA 3EMVA 5C80A 3OZCA 1LV8A 3DJFA 3OOEA 3FOWA 4TTIA 1TCUA 4P54A 4IP0A 3OZEA 1PR1A 4QARA 3UAZA 4LNAA 4F3CA 2HRDA 4TXLA 1PWYE 2AI2A 3KVRA 1YBFA 1OVGA 1V3QE 1YR3A 2RJ3A 4DARA 1V48A 3KVVA 4U2KA 3NBQA 1A9OA 3NM6B 4LDNA 4R2WA 3ODGA 4QASA 3PHCA 2QDKA 4BMZA 1JPVA 1T8YA 1T0UA 4OJTA 2P4SA 4QEZA 4WKOA 5F7XA 2GUWA 4UC0A 3K8OE 1OU4A 3QPBA 4JOSA 4OGLA 2HN9A 1RFGE 3E0QA 5KB3A 1RXCA 3BL6A 1K27A 2B94A 1C3XA 2QTGA 1PR5A 4M7WA 4FFSA 1Z5OA 4NS1A 5F77A 5I3CA 2OECA 4YNBA 1V4NA 4EB8A 3DF9A 2QSUA 1A9PA 3SCZA 1PBNA 3BGSA 1VMKA 4JP5A 5DK6A 5CXQA 1VHWA 1TD1A 1Y1QA 3OCCA 1NW4A 1TCVA 4TS9A 2HWUA 2H8GA 4TTJA 1U1CA 2AC7A 4BMXA 4WKNA 3LBAA 2A0WA 3D1VA 1YRYE 3ENZA
chains in the Genus database with same CATH superfamily
1X8LA 1WL8A 1ZZGA 2DERA 4DG8A 4CEIB 1N92A 1L5MA 2OZKA 3KRTA 3AF4A 3TD2A 1EA7A 5A4AA 1ADGA 2NVWA 1ZGJA 3DMTC 4NZOA 3MJHA 5KNDA 2FSVA 3F67A 4FIDA 1U1EA 4BX8A 1BVRA 1QAOA 2REXB 1SHTX 2OOSA 2C2MA 3GVXA 1GQYA 4DMHA 4TKMA 3H19A 3AVXA 1IHXA 3C3DA 5I7VA 5EFZA 1YZHA 1DAEA 1KOFA 1TU4A 2IRWA 3JWIA 4ISBA 1W4LA 3MGBA 3WKEA 2WF9A 3JAWB 2IUUA 3L77A 4YS6A 2JATA 3NTUA 1E89A 2PUCA 2DHDA 3N8HA 3VBEA 1G60A 1QR6A 1BIFA 2R79A 1HMYA 1WAMA 1VI2A 2IIPA 3TAXA 3V4LA 5IHPA 1W25A 5DN6D 3VC7A 3WL8A 1ZCBA 4BJ1A 2PKQP 2V9PA 1DX9A 1KHTA 1U90A 3NVKI 1JWAB 2WZBA 4G5YA 3P9KA 4QD3A 4ARCA 2CYAA 5J2TF 5LDDC 3OX1A 5HQ3B 2TMYA 3GRPA 4N82A 1Q3TA 1P4HA 1X87A 1D4AA 3NHMA 4V0RA 4Q3CA 1FJXA 4J0FA 2R1TA 4OHWA 5AVKA 3U9TA 4RIIA 3AHDA 4YIHA 4AP5A 5CLJA 2D59A 4NHEA 1Q12A 4TZTA 2C8LA 2GCIA 4UM9D 4AN1A 3TECE 3E9DA 4K88A 3GD7A 1PUXA 4BMOB 1T29A 3GQBA 3HP7A 4M76B 4RVHA 1F7VA 1SUAA 4AROA 3E4CA 3UHFA 2YJGA 3IYLW 2PRSA 1AMOA 4L5BA 1ACLA 1Q7TA 2FMUA 2I4LA 3PXDA 3G1WA 3CF0A 3DR5A 2J59A 4NYJR 4WKPA 4PBTA 3R76A 5L3VA 1P1FA 4UUQA 3ER9A 1SCBA 1ECLA 4DDVA 3LDHA 3UWSA 1UDBA 2ODWA 2FV8A 3RF7A 2WAXA 3EPRA 3LJKA 4MKRA 1KP9A 1XEWX 2QPLA 1AB5A 5IN4A 2H4HA 3E18A 3FCUB 3BJIC 3KQVA 1YRWA 3NJRA 3EWNA 2EBWA 4FE7A 4D6XA 5DO9A 2GM5A 4FYHA 2O7VA 5J58A 4KO4S 3OUUA 1IWBB 5FHQA 2XH8A 1WSAA 3I04A 5ESRA 3T5AA 3H5IA 2AE1A 2CEKA 4YLGA 1SPBS 2DE0X 1MABB 1UJ5A 4P0TA 2VYCA 4C0XA 2WT8A 3L8YA 3UUGA 5ITWA 4G63A 5ELXA 3F6PA 5K6RA 8ABPA 4S1PA 2LXNA 4XGRA 5DLPA 3QKIA 3A6FA 1S1CA 3AVPA 3L7IA 3ILSA 4XUDA 2FFAA 1US8A 2WLSA 4HS4A 4RD6A 5HCNA 2CWWA 5JISA 1QIEA 2Y1XA 2YVLA 3VKHA 3QVVA 1DAFA 3AL0C 2OZPA 1PT5A 2XDWA 3FROA 4FFNA 3TW8A 4E08A 4YUYA 2X42A 5L3ZA 4XX0A 1ONOA 4TWJA 2DUMA 1O5OA 3CRRA 3VH1A 5IYZB 2II6A 1II8A 1KEVA 3RRBA 3VYVA 2VP4A 2H9YA 2DBRA 1AHIA 1W5EA 3TNFA 2BRUA 2XNDD 1O2DA 1VLQA 1PV4A 4G5HA 3TZBA 1ZXXA 2GCPA 4GF5A 4FKBA 2G3YA 3FVRA 3FJYA 4Q0MA 2BISA 4GU5A 4QRHA 4US1R 5G0WA 1JBKA 3G2OA 1ISMA 3WXBA 4WK4B 1BCRA 2JFWA 2ZB4A 2ZRFA 3Q5EA 3FVWA 1XNHA 4K9QA 2H1OA 2L82A 1HDEA 1GEEA 4V1CI 3PHGA 3QXCA 2YNMD 5GJVC 1MBZA 3L7DA 3TVYA 4BB5A 1TVMA 1Y8RA 4HY3A 3EYAA 1NMYA 1UBEA 2EFJA 3ZVRA 3A1EA 3N3AC 3LUAA 4BO4A 1A9RA 5CPBA 4BBJA 3E3MA 5FFNA 2GX6A 4UHHA 4UE6A 4EGAA 4ZJYA 3N58A 2NU6A 4ENQA 4AQ7A 3K73O 5AK6A 3ZWKA 5BN4A 2Z6AA 1NRIA 4QUAA 5D3KA 2BUBA 3SC3A 1E6UA 3SI7A 1HTTA 3FYDA 1BE0A 2J3IA 3OZBA 3Q6IA 4RNCA 1Q14A 4OIMA 3UV3A 1R37A 2VUUA 4JOQA 1WSDA 3ZCRA 4F4JA 2E4VA 4P0QB 4KPUA 2DAPA 1LQTA 1NZDA 2HSWA 3L0BA 4JIGA 3RSFA 3UJ8A 3V1KA 2MYPA 1JU3A 2ZPTX 3AFOA 3EEQA 3G9ZA 4MMXB 1NMQA 2WTXA 4MV1A 1MJGM 5IH3A 3X2SA 3KXLA 1Y37A 1TCCA 2YS6A 3N0VA 3EGOA 4UVEA 3VR3A 4FOOA 2AOTA 4GUAA 3MK31 1ADFA 3DFFA 4AZSA 2R6R1 4QU9A 5CT5A 2V7GA 1Y8AA 4PTYA 2RHDA 5EQFA 2DTEA 1YJBA 2KJQA 3VU1A 2ZIZA 3L0DA 5BUCA 3VRHA 4W4TA 2Q21A 4X3CA 4LV8B 4EGQA 3O95A 3L0PA 4MP6A 3ENNA 1XJ5A 4G9EA 4R1LA 2QMUA 4G25A 4G0QA 4AJOA 3G49A 2HO4A 4IUCS 1UOQA 1YU6A 2J41A 3UJPA 1EP2B 1W4RA 4V3CA 5LB4A 3K71B 1K7XB 1WTAA 4AP6A 5JS1A 3GLQA 1PL6A 4U3JA 2VHTA 4GBED 2HAEA 5AOCA 1Z2EA 1E1CB 3DJYA 3D43A 4BTVA 1GHTA 4B9EA 1FP2A 1LPPA 1OSNA 3GPCA 3O1JC 3OBIA 1QOQB 4JIMA 3I2YX 1NATA 2C9BA 2CHGA 2HB6A 3I4FA 3UHOA 4C9BA 1GA6A 2NU8B 5K05A 3CCFA 3M81A 1ONPA 5FEMA 3W2TA 1H23A 5HG0A 3PNLA 1DRJA 3FFBA 4NP6A 5TPWA 2PMCA 1NVVQ 1FSPA 2XDYA 4ZMSA 5AVTA 2M6KA 3SQOA 1P2VA 3I76A 1QIIA 3EGXA 5JH7A 1V2HE 2YJ5A 3E05A 3O38A 5IYZF 2JK0A 3QE3A 1AF4A 1RYNA 3AUFA 2FMFA 1H85A 1U7OA 1CZLA 3H99A 1PE0A 3C4QA 3H4TA 4TTAA 5FLEX 5ITVA 2IH4A 1I2MA 1V6CA 3KOOA 3SLGA 1L4LA 3TKAA 4B6QA 1ECCA 2YIJA 1N9ZA 3CX8A 3T06B 1X7DA 5HTOA 1E7MA 2Z3WA 5KSWB 1BSVA 4YPVA 4MWBA 4HUTA 1GT91 1EK0A 3F9CA 1FU4A 3C98A 2IE0A 3MTBA 3ADCA 4QYSA 4B3TB 3WLRA 1RHRA 1WP4A 2R7NA 4RVSA 2BGKA 1W47A 4X8LA 4UAUA 4D92A 1KAMA 1R8XA 2RHHA 2ZSJA 3JZDA 4R2LA 5LIRA 4K9RA 2B6NA 3HGQA 1C7JA 2A5LA 3OLZA 3Q3CA 4AJ2A 4DV7B 5L3SA 4Z9FA 2AJLI 1JPUA 4H4EA 3OPNA 5AJTA 2XJ4A 3AR2A 4O2BF 1D4FA 3O8NA 4F8JA 3I5YA 1NLZA 4YMVA 4F3TA 4P3PA 1F60A 2ONJA 3B6MA 4BXOB 2A92A 1S2MA 1T34A 2OHOA 2PX6A 2UZ1B 3M5PA 3R0QA 4V03A 1C4XA 5EP2A 4O4HF 1QM5A 2XQVA 4HNGA 5KTMA 2NWQA 2VRWA 1SZPA 3GEBA 5GWXA 3CVYA 3L05A 1XCGB 3ABRB 3AYXB 4NFLA 1TYEB 2UYCA 2H0AA 3N8IA 4K9PA 4B48A 2X5XA 3DDNA 1O94A 2HV8A 2WWGA 2DZDA 2O1SA 3NFRA 3PRHA 1EMDA 4P3OA 2A4MA 1Y8CA 3GG9A 1L1QA 2VFAA 2QTFA 5T8KC 5CURA 1WMEA 3DVQX 2VOEA 3LNTA 5F7JA 4CIBA 4WOJA 1KC3A 4PTZA 4O4LF 1D2HA 1ULZA 1E0KA 1Z6AA 2R00A 4PNZA 4B3DA 4ZQIA 4JDUA 3O31A 5DTJA 7GPBA 2G6TA 5IMBA 1DC4A 1JZTA 1IMOA 1T9KA 2IV7A 1YC5A 2OZEA 4MKHA 3F49S 2EGUA 2EGHA 4FVTA 2X0FA 2XWQA 5CT6A 2VJYA 2C78A 3UXYA 1K6XA 3EIOA 4MI9A 4ZWNA 5IVIA 1MC8A 2OQRA 4OGKA 4YRRA 1OFUA 4TM7A 2YVUA 1Y0BA 2R5WA 2ZRMA 1CVLA 1D9XA 2NXCA 2Q6TA 4IWNA 3GLIE 1TJPB 5B7PA 4A8HA 5E38A 1BHO1 3C3WA 2FZKA 3LQ2A 4Y30A 1F4VA 3HGTA 4NCKA 5IAGA 1BGXT 2EFHB 2Q1SA 1E9EA 5CLGA 1MQSA 2UZ4A 2HZ7A 3PD0A 4Q21A 2Z3VA 2ORED 2V7EA 1YHYA 3HBAA 4BP9A 2MDTA 1PFYA 1YTUA 4Q05A 1KYYA 3NC4A 4F9FA 4RO0A 5L8VA 5FO0A 1E2LA 1TMKA 1MJGA 2CCJA 4ZCPA 1KEZA 2V45A 3OP1A 3KPVA 3PE6A 1JLLA 4CT4B 3CNLA 5JW6A 5F21A 1UL1X 4UDXX 2IP4A 1IY1A 3IJ5A 3PJEA 3GROA 4XCQA 1AHHA 1YOVB 3DVLA 1NI4B 3GFBA 5DGDA 1CY2A 1XQ1A 3N2IA 4MPDA 2GBIA 4H60A 4H7PA 2Q62A 3H8WA 1QOPB 1PWEA 1S7CA 1RXYA 3FMOB 4HNSA 1CUIA 5GV7A 4D0SA 4NI5A 2PGXA 3UOGA 4S1WA 1CVIA 5ED4A 4FDMA 2BBWA 4M0KA 5CP8A 2C03A 1Z4OA 1UP7A 2O2ZA 3VC3A 1XXHA 3KL4A 1HDIA 4A1OA 1PJ8A 3H1TA 1X7XB 5FWXA 3BJZA 2Q3FA 4TVBA 5DN6A 1RQRA 2WA1A 4MGHA 5JO9A 1R6VA 4UFOA 2VH5R 2BGGA 1EZZA 1WCXA 3RUFA 2Q2QA 2ATCA 3IE0A 2ZRHA 5K1ZA 2AUNA 3CEAA 3ZC3A 4NV3A 1Q2XA 1CF4A 4J2HA 1RFLA 4ZA2A 5K2OA 1JNXX 2P2YA 1CU1A 3ZY3A 1W2HA 5KNCH 5KSZA 4RKFA 3MJSA 3V2GA 2JBWA 1KSJA 5C37A 4N8DA 4BVKA 4IF4A 4IDAA 1KORA 1P9RA 1X8XA 3CLRC 2B98A 2OXEA 1NV9A 3G8YA 3KQSA 3KKMA 1JR3E 2CXHA 4FUTA 4HFNA 5COAA 4DIUA 4EWLA 2A0FA 5TF0A 1LZKA 2ZR9A 4UCXA 4DUYB 4LRXA 2I2FA 3RIGA 4F60A 1J2RA 3JAKB 2FZLA 1FY2A 3G85A 4W7SA 2AN5A 5DBFA 2A58A 1W30A 1ZRHA 4TWBA 3KM0A 1ZO8A 2CDNA 3QY0A 3K6JA 2ZBVA 3LYAA 3LWZA 3RDPA 4WBXC 3M6XA 4FFLA 4P34A 3TUIC 3H6KA 5J5VA 3UATA 2B83A 3PC6A 1S3FA 4RY2A 3SHFA 2I67A 3WSVA 4Z2YA 5LU9A 4LJLA 2J45A 4ER0A 2C4MA 1ZUD1 2I2AA 3V34A 1PWYE 1UWKA 4EHFA 1H3FA 1NRXA 1QC5B 1H0SA 5EJ8A 1OMOA 3V8MA 3AVUA 1NL3A 3D0QA 3UQYS 2YWJA 2MMGA 2FR0A 4NPHA 4X1KA 2MSCB 3FRJA 3TZQA 3VGPA 6GPBA 4J75A 4JQYA 3F9IA 3JX9A 1JHYA 1M3SA 1KL7A 1W75A 1DC5A 2C7BA 1TAGA 3CF4A 2EG9A 1NOKA 3L4JA 1EJ0A 1L8QA 1OZ0A 1JF8A 3DEHA 4L6AA 1FRNA 4U2KA 5B4VA 3PEEA 4CL2A 1ZMRA 1AN0A 3PUKA 3IESA 4KXWA 5FFFA 1YE3A 3H4MA 1U2TA 3OZWA 3QUTA 3UH1A 4B76A 2C95A 1YVDA 2RH4A 4BHTA 4RQAA 3X0DA 2ZSKA 5H83A 3W8NA 4R2WA 1K9VF 4GWLA 1IXRC 2XMSA 2FPKA 3D6HA 3CEJA 4AUMA 1RWKA 2FVYA 2PLAA 4JBYA 4EI9A 5CBKA 2I1VB 1T1RA 2BFAA 4L51A 4OHMA 2NUBA 1K7SN 1UJNA 3C5WP 2QY9A 1G8MA 1GPUA 3L7KA 3N8KA 5DPMA 3V8BA 2I7DA 3BVPA 1K92A 4A8TA 4CM9D 4BCCA 2JLVA 4CKBA 1Q7RA 1XCMA 2QSYA 1PJSA 2CLDX 2FN7A 4G5OA 2P35A 4PYLA 4NAUA 3BK7A 5AOAA 3RVPA 5A3QA 3W8RA 5EC8A 4ID9A 2XYHA 1QMGA 1NXQA 2ANCA 2V5VA 3CYFA 4LDQA 3RKSA 1B23P 1DG9A 4ZEVA 3DAHA 3X1JA 1VL2A 3VPBA 1FK8A 3NTVA 1PTKA 3AFHA 5FV7A 4ER6A 5C7IO 1W2GA 1DBWA 2CMGA 3ABOB 4JT2A 1DZIA 2LCFA 4M88A 2IGTA 3L7JA 2K5UA 1EU1A 1C3XA 4C01A 2QTGA 1RP1A 3UMSA 1G41A 2QYOA 2ZIFA 4U7GA 5JY1A 3DYBA 3PXUA 4DFDA 3QIVA 3ETNA 4GL2A 4Q4HB 2HA3A 2OB2A 4MI1A 1ORTA 1WV0A 1LLQA 1O9HA 1U7DA 1SCJA 2ZBPA 3KKLA 3OZAA 3RT1A 3A2KA 4JB2A 1T9ZA 3D7LA 4EB6A 1XRNA 3ZIAD 3L0OA 5ADHA 1XZFA 3AB7A 3QITA 3AJAA 1LI7A 4PQEA 2G25A 4V2UA 3MJEA 3EOAI 1BWRA 2IBMA 2X0KA 4DDKA 3F98A 1J23A 2JK1A 2OBLA 2W71A 2Y27A 4GZMA 4P38A 3B60A 4XJVA 1BU5A 2PXCA 3QF4A 3RU7A 2XF8A 4G8CA 4ARZA 4CKEB 4E12A 4Z2AA 1TD1A 5HBGA 3USES 4O4HB 4NPAA 5KNLA 4H16A 5E2AA 1MG0A 2XTJA 2O23A 1QG2A 3N1UA 2NV6A 2O1WA 3S3TA 3QTLA 4AI6A 1EJ2A 2NZWA 4DR6B 1N78A 5E3JA 1Q7GA 4UAVA 4BJ3A 3BTUA 1FLDA 2NUAA 5DI9A 2WKRA 3HZRA 1Z16A 3LBAA 3OE5A 1QVRA 1VCIA 4HGRA 4OI4A 4Q9AA 3SJZA 1M0WA 1RRFA 2VF2A 3N75A 4UCFA 1VIYA 3OPVA 3W9YA 1EVQA 1W2WB 1B43A 2XUHA 3UYKA 3ZS9A 3KQYA 4TN1A 4RK7A 4QGGA 2O8DA 3GCWA 4MWEA 1XQ6A 3KEGA 4KWEA 1TYAE 3EG5A 4IXMA 2ODEA 5IBPA 3DVRX 2R47A 2Q2OA 4HQ6A 1Q92A 4LV5B 1X7WB 5TQJA 1KFCB 1LWOA 1ENPA 1QIGA 3C43A 1QCCA 2C4WA 1V7CA 1R6DA 2P67A 3DAOA 4KXXA 4WZZA 4EUNA 5LUAA 4JK3A 4PLWA 1GUZA 1ULTA 1W5BA 3VHLB 221PA 2DKNA 4D4MA 1NHWA 4LIPD 3LWBA 1IUOA 3LG2A 1PR4A 3AQ4A 3GBVA 1P9NA 2IGBA 5C7OO 3RC9A 1LB1B 3GCDA 3IBYA 1PIWA 2P40A 4X85A 2CVHA 3L84A 1VKNA 2VBGA 3L6CA 5DP2A 2ERCA 3OOSA 4DCJA 2RH8A 3R7FA 2PFSA 3EQ9A 3TZCA 3R75A 4E5MA 5MDHA 3HK2A 4F46A 3QWAA 2PLWA 2W98A 2GHIA 1R9NA 1MEEA 2I03A 3OZTA 1NKTA 4FINA 4YEDA 3D6NB 3AO0B 1NVDA 4PVCA 3QEBZ 3Q88A 4OQEA 4YVFA 3WGYA 4C6TA 4YRNA 2VSYA 3U7HB 1LNQA 2WU8A 2DEUA 1TJ5A 2QLLA 1IZ7A 3UMBA 4W5QA 4QJBA 5JAHA 3CT6A 3EZ7A 1Z6GA 1G5FA 2CB0A 4KZKA 2XCRB 5JSYA 4S0XA 5DLYA 4CCWA 2POCA 1QB7A 3JYQA 5C4GB 4F4UA 1BMTA 1JNYA 2DMRA 3F1LA 4CF3A 3DLAA 2ZIVB 1ZGAA 2BKAA 3AVQA 3HBMA 2CGEA 2WWRA 3ND5A 4B31A 1IHUA 1TPYA 2JAPA 4LY9A 1YA8A 3VAYA 4ZV9A 3QVWA 5FUWA 3TOZA 4YQFA 3U60B 3IR5A 4UU1A 2DU8A 1NBMD 1NJ1A 5I7HA 1BMFD 2CNWA 2VF4X 4I1IA 4MPRA 3UK6A 4Z4HA 2NU8A 4MQ4A 3ZV3A 2OGZA 2P9YA 2ZI7A 3FM9A 3OEEA 4E94A 1HYEA 5JU6A 3WLQA 1P19A 4LC0A 4BNDA 5HZKA 1CJTC 4BO7A 2OVBA 3NDIA 4JJFA 3PD1A 4YX9A 4PXAA 5KX5F 3NQ41 1HFEL 5SZJA 2I91A 4P22A 1T3ZA 1MO3A 2AS0A 3ESDA 4IS2A 5CNKA 3R9IA 1H4QA 1F12A 4ZYUA 3NHUA 2QA5A 4GW3A 2PT9A 5BQPA 3VSAA 1U8ZA 4Z5XA 5IN5A 3OPXA 1T35A 1NF3A 2R6GA 3GY0A 4Q4AB 4LYEA 2BDTA 4HZUA 1KY4A 4KJZA 3OQNA 3C15C 3W05A 2C1ZA 5KBYA 2JJ1A 3B9QA 4BUCA 4WL0A 5JAZA 5FCDA 1WXDA 2CJFA 3LD9A 2P2ZA 1P17A 1XTIA 3NTXA 1N9GB 4OQQA 1FFWA 1G5PA 1TUEA 2WSSD 2YXLA 1RKXA 5HKLA 3ZGXA 1U0NA 2VDOB 4KQEA 4RELA 3F46A 3DMRA 4NEGA 5BR1A 4QUJA 3QI2A 4MUFA 4F2PA 4JGGA 1WHSA 4TS3A 2GXAA 2XV1A 3KJZA 3ED1A 2WU1A 3NOOA 4M89A 1K6JA 4CFZA 2C82A 2WP0A 1CEEA 3MIIA 1Y4UA 2F1HA 3DFMA 5G1OA 1Z62A 3OQ1A 4YLEA 3LPNA 2Q1XA 2J6BA 2ST1A 1DOZA 3AEUA 3AI3A 3JALA 1Z8NA 4JSTA 1XJWA 1XHFA 2QW1A 4K9MA 3RFVA 2W7TA 3RVLA 4HF7A 4LRWA 3D2LA 3LBIA 4URXR 5DXAA 1QGUA 2G83A 3O8RA 3TXYA 2HOQA 1Z8DA 5HK9A 1NW5A 1IBKB 4FDLA 1B14A 2NO6A 4YWHA 3IBSA 5BYBA 1Y8RB 3TLBA 2C29D 2F62A 2HHJA 3O90A 3CEPB 3L46A 3UHPA 3BQMB 1QP8A 4OB7A 1KERA 4IH4A 2O8DB 1JDJA 4QBHA 4CMIB 1TUGA 1UJCA 2Y77A 3EDCA 1M2OA 1XDSA 1XZPA 1N2HA 3BXXA 3K94A 4HXGA 2XRYA 4RLHA 1WUTA 1NF9A 1C9NA 1E2DA 1I1NA 1M2NA 2YN2A 3QYPA 2DBYA 1ID8A 1I8TA 1CPYA 3QU5A 4R8LA 2ODNA 4N3GA 1LVUA 2XMRA 3A6PC 4GXQA 1CY8A 4KK3A 2ZVDA 1KZHA 4D9JA 2VKTA 3URKA 2BEKA 1SUBA 3FFTA 1D5WA 1NF2A 2C20A 2YWXA 3KAJA 3I2JA 3STYA 1HEUA 1T4BA 3BSSA 3ORQA 4BRUA 3P9RA 2WIDA 4URVR 3HKBB 5SICE 2HW8A 3TF5A 2HK7A 1I6LA 1E96A 2OKGA 2R86A 3QPDA 3OI7A 5A4FS 1W0KA 2J4FA 2AI3A 1E4YA 1VSVA 2WM9B 1MO2A 4YP6A 4X20B 2ZDQA 4D3DA 1FLAA 3VX4A 3IEIA 1IJFA 1M75A 1UC8A 5AW5A 2XADA 5GQSA 1N7IA 3DHEA 4XGKA 1FNNA 3I2IA 4RIFA 2HSZA 3NEAA 3NIFB 4QOSA 1TA9A 2BFOA 4ZT2A 4AKTA 1FYWA 2ZREA 4LNHA 2GO7A 1CIJA 3GIWA 4OIFA 1AQYA 2EBHX 2QJTA 3BEOA 4KH0A 4PAWA 2ZBQA 1KJYA 1JILA 2V54A 1Y82A 3UCFA 3FPEA 4KN8A 2CMDA 1E9AA 2A57A 4EA9A 2O7NA 3UF0A 2ZE8A 3W2EA 2OCPA 2JANA 5EUQB 4DMRA 2O0KA 2XTMA 4I50B 3P9YA 3M70A 5TMBA 1TM1E 4RULA 2CBZA 2FSSA 2GA9A 1O5IA 3GGJA 3JQAD 4N3AA 1DAGA 3BA6A 2VVTA 4OOEA 1TB4A 2WNIA 2I1QA 2D1QA 1H4VB 3BG5A 4PLHA 4HVAA 1P61B 4JJZA 1I10A 1U9YA 4LGMA 4BOYA 5KS2A 2VT7A 2VJMB 4GR4A 5DEOA 3W6PA 1B41A 2V7BA 2QAJA 2Y6VA 4IUBS 1TEHA 4IV5A 4MQ5A 3R8CA 4BZXA 5JQWA 1IJEA 2QVYX 1VPTA 4BLUA 2B1QA 1BXKA 1BKYA 1BHSA 1F6WA 2EATA 4N5NA 2INGX 5CFNA 5LQDA 3PFWO 4YJ3A 1FB5A 4OK6A 4ZGBA 1DBRA 3N2GB 1Y9JA 1LXCA 1TQ4A 1LQUA 2PFKA 3A9SA 3OM1A 2AIRA 4HH1A 3KUCA 1G64A 2F1JA 1NNLA 1VPDA 3KKKA 4JL8A 5DBIA 5IK2A 1U3VA 4C14A 2PMWB 4IMPA 4INAA 3I09A 4D9FA 1GRRA 1K7YA 1NYRA 1RRVA 4FGSA 4JJIA 5FBQB 2G67A 4RPJA 1TF5A 2GN1A 1GAXA 3ETEA 3V97A 3EYWA 2R11A 1WQ4A 3HY4A 4MMZB 1D2RA 5D6OA 5TQ2B 3O4IA 4Q1DA 5IM5A 4G89A 2YMQA 1F3LA 2JCYA 4HYTA 3Q10A 4MUXA 1KQNA 2I76A 1BH2A 4FHEA 3DULA 1UBRS 3G0OA 3UA4A 1CIPA 3AGPA 3HB4X 3ONDA 2V4MA 4NJMB 4MR9B 1J9ZA 1K98A 3NB0A 4G0XA 1Z38A 4II2A 4RTLA 1YVPA 5CVVA 1XTVA 1E9RA 3IUNA 3NP7A 3QLUA 3UOWA 3VDXA 4E2ZA 3C8MA 2D7CA 1CUDA 4K6KA 4I8DA 2Q1TA 2XJ9A 3UWOA 3B1ZA 3L0ZA 2VP9A 3FCXA 1QIHA 3ZCVA 4ZV4A 1KQOA 2GPJA 3QW2A 4AZTA 1CERA 4XW2A 5IULC 4F2HA 5SZIA 1JFFB 3R4CA 4UM8B 5ALXA 4P4GA 2WVGA 1Y33E 4L7QA 4NJEA 4CJXA 5HRUA 3WWZA 5AVZA 1RYBA 4JWKA 3OIVA 1JVNA 2WINI 3O8OA 2R1UA 4FTWA 1ZM7A 3KT3A 2R6HA 5IJWA 1MLDA 1JAHA 3QZUA 2X0NA 4LI3X 1OILA 1X2BA 3CPSA 4NSNA 3K1AA 3C8DA 5CG1A 4EG6A 1BWQA 3RAGA 5BYKA 4NMLA 4IXTA 3K53A 5LBIA 4GPD1 1KE2A 3PEYA 4EMBA 3BJMA 2P4QA 1FSFA 4ZRDA 2WIAA 4QUIA 4LX8A 5B1EA 4U9HS 1DDOA 5DLDA 1PQPA 4KXFB 3TEMA 1P2GA 3OQHA 2IU3A 5EIHA 2L2QA 5H3HA 3BK2A 2FWNA 5GP1A 1T0JB 3G2IA 1RQ7A 2R8XA 4HHEA 2LCIA 2WF6A 1SIBE 1TYDE 1V11A 3T7EA 2XMZA 3ZWWA 1FJGB 3UB4A 2MJLA 3A1FA 1OKKD 3HNPA 3GBSA 3C7TA 3LUHA 3LU1A 3OOWA 1SVIA 4C6SA 3F6RA 4WEOA 1YMQA 3IP1A 4GP7A 4HK4A 4CG0A 4KZPA 2FGKA 1GOTA 1E3MA 2HWKA 1JDVA 3LUDA 1R5JA 3I3OA 1X38A 3R6TA 4EK9A 3AHEA 2QI9F 4CCYB 3GC6A 5IVDA 4C4SA 2JFGA 4BLVA 5ABPA 5M34A 1UDAA 4QWWA 1GA4A 1GTG1 2EQBA 2ZITA 3HL0A 2JBAA 4YH1A 4J7CA 3IAXA 3U7QB 1VE9A 4DE5A 1WBDA 2QR5A 3IT3A 1M2KA 4QZVA 2NMVA 4O3FA 1XKXA 4S3MA 3QUBA 4O02B 3OZUA 3A8TA 2CFOA 1Q17A 1C1YA 1JBQA 1J33A 1ORVA 1VCMA 3G59A 5FPPA 1B26A 3VTZA 4WLVA 1ANKA 5ECDA 3SEAA 4CTJA 2XQIA 2R7LA 4YJHB 4BWGA 2FAXA 4BV2A 4EPWA 2VTBB 1W48A 3PFNA 1SVNA 1IN8A 4MHOA 5I3ZA 3GUUA 2IBTA 3GIDA 5CW1A 1D8AA 4LYGA 2ZJ8A 4TLAA 5CCBA 2YXNA 4O25A 4PZZA 2XTAA 4H3KB 5HYVA 2GDZA 4PYKA 3TIFA 1RABA 4N39A 3DQZA 2GB4A 1UJMA 3DLIA 1FRVA 4GPTA 4DIOA 3STWA 4E30A 3K9GA 2JI7A 1WXEA 4TTTS 5BNZA 2RAPA 3Q9NA 1GY8A 2CKDA 3DJFA 4DLWA 1X3LA 5G4KA 3MWEB 1YS4A 2XE4A 4IX9A 4TTIA 2VYFA 3TVDA 3Q7RA 4G9BA 5I45A 3LZCA 2UZ0A 2RC5A 5JWOA 5FOUA 5IVKA 3SX0A 1FX0B 3DAPA 2BGRA 2Q3BA 3HFRA 2V9ZA 3JD0A 3ZZTA 5LL6P 2HCJB 3BULA 4GMFA 2ZQZA 4LNAA 5FO1A 5NULA 4NXMB 4X7BA 1L5GB 1E3QA 2Q0XA 2IOHA 3IAM1 1JHZA 4OV6B 4AZ0A 5EJ7A 5HQTA 3H5TA 4XARA 3F2VA 1RIFA 1HG0A 3UJDA 4B6OA 1IEXA 3A9UA 4UVGA 2CZCA 1KTVA 3RVKA 1YDWA 2AFHE 4CR7A 2R9VA 3A0UA 2CK3A 3V5NA 4LZPA 4TN5A 3ZV5A 2DX7A 1H9CA 1GSAA 4DIEA 2LCQA 4ZGGA 4M21A 1MQ9A 3RSCA 3UK7A 3VTFA 2RGAA 2J9GA 5EIWA 5DSZA 1KJJA 4Q3OA 1QKJA 4ABTA 3IMGA 1JHPA 2A2ZA 2I71A 2UVDA 3NAQA 4HC4A 4J0IA 2PRYA 5H7XA 2OBXA 1FJ2A 3IFSA 5DI3A 4CDRA 4DMMA 2WTNA 1RW4A 3KHKA 1CQZA 1W44A 2P9CA 2QX9A 4JU8A 3PTLA 3GP5A 2BL4A 3B8HA 4BMZA 1AKTA 1DAHA 4F7DA 1PGQA 5JJBA 4AN0A 5KYVA 3EB9A 4OJTA 1JQ3A 1KVRA 3QHQA 4OHBA 4P08A 2F9MA 1Z7YA 5ENDA 5F7XA 5A9TA 1PJRA 4PC2A 5EOVA 1HSZA 1OBCA 2NX2A 1VBKA 1ZMXA 4Y2RA 4B8YA 1TMGE 3IKJA 5HKAA 4OGLA 3MWKA 2Q9UA 4MRMA 5JVDB 3GRVA 2OFPA 3GJTA 2OEPA 2D5BA 3KT0A 3ND8A 1E1RD 2YN4A 2IX3A 5DGCA 1JKXA 3PEUA 3IH5A 1E0JA 4D26A 3CLSC 1KFBB 2DHQA 4L2IB 2B94A 1U0OC 5C8DA 2JCBA 2BH2A 3N3BC 1B74A 1R7RA 3ZKAA 5SZHB 1AZSC 2BTEA 2IU4A 1I01A 1A7AA 3U4HA 2J7KA 4BQSA 1V37A 1IDN1 5J23A 3OE7D 4MQEA 5AI5A 3QBJA 3MILA 5KAMA 3WB9A 3ZEIA 1DO8A 2K2WA 3LDFA 2FI1A 2PYZA 2I4IA 2I62A 1GGVA 3HZOA 3TLZA 5KNBD 2IPNA 3P20A 4NATA 1MXFA 2ZXFA 2JF0A 3GLHA 1YFZA 1I36A 4MWCA 4JASB 3CF2A 4IEEA 3DT8A 1X1QA 5CK5A 2VWGA 3WE7A 5JC1A 1L7QA 4UKDA 4LYYA 5BT9A 2QD4A 3GGCA 5JD6A 5GADl 3DTNA 3U4GA 1M67A 2P75A 2V5UA 1MOSA 3UANA 4FIZA 1CEXA 3IAAA 3H7AA 4AJIA 5IAOA 4UQOA 1L8LA 4MIEA 4FW8A 4I81A 2Y1OA 3R74A 5LR6A 3UMMA 2YW9A 5HNKA 5LNK6 3U4QA 1KF0A 5JXHA 3JQFC 2HPVA 3TTVA 4WEQA 1JA1A 4RFSB 3L1VA 5JATA 2J30A 3R3VA 4DIDA 3H42B 4NBNA 3DHYA 5LP6B 3QLTA 4IIHA 1H2YA 2I6TA 2I2BA 4C06A 4A0FA 2Q4BA 3H83A 3HCFA 2I55A 4M0LA 3GLKA 3HXOA 5DYWA 5JE8A 2WWTA 3ZNOA 3DZDA 2W90A 1DJLA 3WQRA 5TS2A 3S2UA 1G55A 5COQA 1IK6A 3CWZA 2JL1A 3OJ0A 3IQEA 4FBMA 2QOEA 4LI0A 2Q6KA 4P82A 3V32A 1IVSA 3CUKA 3IGFA 4B17A 2YOHA 3WNCA 4GLJA 4KSCA 2EX1A 1ETHA 1CBUA 1ONSA 1VJ0A 2COEA 3T15A 1C81A 4YAGA 1QU2A 3EIXA 2IPAB 3HM9A 3MTJA 4NZZA 1RI2A 4X3OA 1ZW6A 2WIBA 4JDPA 5G40A 3B7GA 4ALMA 2WHXA 3ZK7A 1TEZA 4B82A 1X1DA 3NOXA 1AO3A 5T3YA 1DG1G 1UM9B 1K7FB 3G2JA 4KRGA 5KPJA 3OKPA 3TRHA 4BX3A 5KWIA 2PRZA 2QE7A 2B3DA 2V65A 3KBOA 4K6CA 4F97A 2NZUG 1HQYE 1JHDA 3AKDA 4TYWA 2JFHA 4CTMA 3FXAA 3JARB 2Q99A 2O1XA 3DVSX 3WLOA 2FEOA 4QSMA 3HN7A 2AN9A 4GSKA 3SJUA 3T3DA 1KA9H 3NRCA 1IU9A 4M38A 1IBSA 5I9IA 3GLFB 2V1UA 3Q6NA 4P53A 3BRWA 3L1IA 2YJ4A 2DETA 2YBDA 1GVHA 1VE1A 4KBGA 1JIKA 3NBUA 1LF5A 2PZGA 4E2WA 1UOEA 1Z74A 4A27A 5CDGA 2PWYA 5DHUA 5IKEA 5CIYA 4P3YA 1CNFA 5CYPA 1FTNA 4OGGA 3KLPX 5CVDA 1E7SA 3TSAA 1MRZA 2X13A 2XHEA 2BLNA 2ZJFA 2JAXA 3L93A 2ZJ2A 3M3HA 3KEFA 1I2ZA 4JBNA 4M55A 3W4JA 5DISB 4E33A 4AQYB 1IQRA 1MAAA 1PAUA 4FI3C 4Q12A 3ELWA 5CBPA 2DT8A 4NABA 1ZUNA 4TV9F 5E7MA 1RDFA 3SBEA 3EVTA 2WUVA 3RLIA 3UV6A 2V6GA 3DBRB 4NMXB 2EARA 2W5UA 2YZKA 1N3BA 2W6JD 1NNI1 2ZYGA 4CQMA 1LK0A 2ZUFA 1KO4A 1YL6A 2VF8A 2AD5A 5G4KB 1MFZA 4XB6B 4EA8A 4RTKA 3QELB 4EO7A 2W6CX 3LUPA 1GFZA 3JY6A 4GYKA 2IP1A 2FMXA 2IYFA 1JHVA 4EW2A 3K2QA 3TWOA 4K9OA 1S3IA 4O33A 4ZODA 3UUFA 3JPWA 4D9HA 2CNDA 3VPHA 1UFRA 2ZI9A 4EA7A 3H0KA 3CGWA 4IKPA 3VYRB 2HA4A 1V47A 4C7OB 2IPLA 1CDOA 2BFEB 3G6WA 1ZVMA 1X7GA 3SF0A 5KKNB 2VHYA 5AUOB 2ZDHA 4WXEA 3VVMA 2DT5A 4GS5A 2OCYC 3RJZA 1WTCA 1CRPA 4ZT6A 2IWHA 4C05A 4KPEC 1W36B 2GILA 3E7FA 4RVDA 3WYGA 2W6QA 3JARA 1H66A 2IXGA 3KJGA 4OHRA 4LMAA 3EY4A 3FTEA 2BHLA 3JQGB 2H9IA 3G1UA 3S8MA 1J2TA 2EG5A 5I9TA 1OIVA 4EZEA 4CLRB 4FT2A 1SB8A 2JEZA 1EA5A 1JFFA 4MCHA 3F7TA 4CM1A 2QDXA 3W04A 2IUTA 1SC1A 1QRUA 1RZUA 2O3RA 3B3AA 1YBVA 4A73A 1EFUA 1JEYA 3R7LA 1TF2A 4NE2A 5K0JA 2OCAA 2XMCA 2J09A 4YT5A 3NBFA 1TMYA 4RA9A 4YV0A 3QFCA 1Q3HA 3F90A 4EI8A 3F6BX 2YHIB 1BX1A 3VR2D 2YFQA 3PCXA 3JRNA 4WFJA 3SLRA 2Q5QA 3L02A 4B3HA 2QRHA 5HUQA 3I3SR 2GT1A 1IWOA 4Q3KA 4EBFA 4Q3BA 5J47A 2J5KA 3I12A 4I9FA 5IC4A 2ZB8A 4CKYA 2WE8A 1IRIA 4E1VA 3TPCA 3VKUA 5JI3E 1W4CA 1G3IA 1TAUA 5E2BA 2IEYA 5IANA 2REBA 3GH1A 2NV0A 1C50A 2C97A 1WZ2A 3L07A 1VRCA 1NAHA 3BMNA 3UYLA 1EVJA 4WCFC 4Z0NA 3ESAA 4MDEA 1VYTA 4GOKA 1UEIA 4KDEA 2BCGY 3DE4X 1LLDA 1SCQA 2OR3A 4RTOA 4ABYA 3M4ZA 4MVJD 4EHDA 1SMKA 1QH8A 3IPYA 1PUIA 5FTJA 3VZRA 1KQPA 1NLMA 2P5SA 2GMWA 3G1TA 4CCYA 2KS6A 2WR8A 1T10A 4ZZ1A 1CUJA 4NS4A 5HQ3A 3GMIA 1E79D 3NHRA 2UYOA 3KXIA 4HEJA 1NMSA 1KJNA 1SCAA 3BMXA 1RWVA 5BOSB 2QWXA 3HO1A 2E1RA 2EVWX 1KYIA 2ECKA 4BKRA 4R71A 4FGUA 1PU2A 5K8LA 3ZHYA 1KI1A 2AMJA 1NXVA 4JXXA 3DFUA 3HP1A 4B34A 3BRSA 2C0QA 2H4ZA 1DKNA 5I7FA 2GKSA 1Q1EA 2BDUA 5IJ9B 2YIVX 1OFVA 4N6NA 2QTHA 3WO1A 1O97C 1N8TA 4C0JA 1XNJA 1GPDG 1OTHA 5JZBA 4BNKA 2A59A 1B2RA 4WDRA 2G5PA 4BO6A 5CHEA 4WGFA 4QXAA 3T35A 3UNXA 2JJMA 1IOZA 3NKLA 2Q1UA 3QLUC 1OWOA 3I23A 4YMWA 4QYTA 1R0KA 1M8FA 2XOXA 4FMCB 1I2DA 4M0DA 1P9OA 4M9CA 5EJ2A 1SCDA 4H1WA 3EQ8A 3B89A 4MK4A 2PKWA 3CSSA 3OIDA 4LNUB 3ULKA 5GVSA 4L5CA 3II6X 3BD9A 4YRDA 3SMVA 3KQMA 3V8VA 2C5LA 4N0QA 5JV5A 4RHEA 3I62A 1T6XA 1QH0A 3QOWA 4G81A 4ND6A 3CW9A 4YCJA 3UGTA 4B8WA 1TKBA 2AMYA 4F91B 2QXUA 2X6RA 4FR5A 1UMDB 1E0DA 1T6NA 4ZANA 4NC9A 1DRWA 1BEEA 2A88A 3VKGA 4EY4A 1E60A 3NAZA 2ZE5A 1OLUB 5C8YA 3UC9A 1RKBA 4PO9A 1E8NA 3RGWS 3S7TA 1NE2A 2UVPB 1UAYA 1XZKA 5ERYA 1M6VA 4BNVA 2OXCA 4DMLA 3ACDA 4TYMA 4WZBA 1MQ8B 2H2FA 4GZLA 1MX9A 1FYVA 1K8QA 1OFUX 1GNPA 2AXNA 1CT9A 1SU6A 3GL9A 5JALA 1I4OA 3N7TA 4J49A 4JHLA 5J1TB 4KGZA 1KAHA 2Z6QA 3R5SA 1TQ2A 1Y7TA 2QVZX 2FW8A 4TYPA 3L2OB 1YNOA 2IHNA 4W6ZA 1XZBA 2KLBA 4RQUA 5HEKA 5A4JA 3C74A 3DB1A 3H3FA 4GE3A 4HNQA 5CG2A 1KOJA 5G02A 2VXOA 2IHKA 4MV5A 3DFIA 1U9IC 2JGDB 5LOVF 4BZQA 3SS8A 2C07A 3IO3A 1IY9A 3D64A 4PYNA 4TRNA 5ITSA 3K3PA 1UMBB 3AVOA 3GK3A 4JENA 4JI0B 1XALA 2H1IA 3R3UA 1FZQA 3HM2A 1FEZA 4DQUA 2ZFUA 1SQ5A 4RK4A 1IXYA 1UBJS 2RSLA 2JVKA 3FDZA 4U2CA 2QTCA 1SG0A 1TDJA 2GF9A 4MGKR 3RYIB 4U7DA 1JXOA 3OEWA 1KZGB 1OXBB 3KR9A 1NN5A 1R9GA 2OV4A 2P9ZA 4CETA 3NWEA 4FK8A 2XITA 1KNQA 1MIHA 1QRDA 4KQHA 5AI6A 6PFKA 3CQ9A 3C7CB 5L6LB 3KS9A 3JVUA 2ZIWB 1J07A 4WBNB 4L8FA 5DASA 1LPAB 1YFKA 2H08A 5IF3A 3KSZO 1I1OA 1S9HA 4QU5A 3MT9A 4YJHA 2WSLA 1OR8A 5KWJA 4G0WA 3H5VA 1XFDA 2DFVA 4MCIA 2R8BA 3CY6A 4Q48A 3S1LA 2CJWB 1A98A 2PMFA 2O4UX 1RC8A 4F85A 1MB4A 1RYZA 2IODA 3AOGA 1M6HA 5GV8A 1CUBA 2BKEA 2VSNA 2BELA 2SBTA 4LJ5A 4MGYR 4ND1A 4PGFA 2WWVD 3UWPA 2IYPA 2Q1YA 1F17A 5K3AA 4ZI2A 2RKOA 2NO0A 1ST3A 3E3LA 4OH7A 4O4JA 3VPXA 4RLQA 1IBRA 1H6CA 5KSPA 1VL8A 3LYUA 4MJ7A 3PYXA 3FW1A 4XI9A 2EL9A 3NETA 5DWQA 5CH3A 3N2YA 1JI0A 1Z4NA 4YMHA 1KH3A 4OQZA 4KX3A 3V8QA 2IS4A 2Q7OE 1P1RA 2IUSA 3JQDA 4NDAA 2IHTA 4A15A 1SUEA 3PUXA 3LHDA 1VBNA 2QD3A 5AI9A 3P2IA 5DBGA 1ONNA 4Z0PA 4CMEA 1DB3A 2YYSA 1WF6A 4WGGA 4MDHA 1NXXA 4L4RA 4OP3A 2R6DA 4TLEA 1RJ9A 1JKMA 4ZT7A 1L5YA 2IQ5A 1R4AA 1NW9B 2WUDA 3I9JA 3LUCA 2FWJA 1FP4B 1YS6A 4Z3KA 3IKLA 4GE0A 2RHLA 3A1VA 3BWXA 1Q0PA 4IMIB 3Q3IA 3EWAA 4BEVA 4CFYA 3RO7A 1F7UA 2W6ZA 4WFKA 4QDJA 3ANSA 5LP6F 4ESVA 4K26A 1UT8A 1HXHA 1JDBC 4CI9A 5C31A 1KWKA 3HSKA 1FTYA 2HU8A 4UU7A 4BNWA 5A6SA 1JLMA 5DI3B 3MCVA 4LJ6A 5IKOA 2TECE 4HI0E 4J94A 1U3DA 4Y9TA 2LKDA 3SAJA 2ZS7A 1GZ7A 3E61A 1VYHA 4A5SA 4YMTA 1J0EA 4HMPA 4HTFA 3RUAA 4J1QA 1FYXA 2Y1FA 1I7PA 3NEYA 1TZKA 5CB0A 3HVIA 3LKDA 3OPYB 1F20A 2DQYA 4H1VA 4LMBA 3BQ9A 2AEEA 1Z6QA 3SVLA 2FN8A 1QIFA 1S2NA 2AZTA 1LX6A 3GVHA 4NG4A 3PUVA 3A1NA 5ALIA 4BGUA 3T7IA 3QBTA 1JHUA 3K6RA 1MABA 2G08A 3CUWA 4MVJI 4JX9A 5JCPA 5HUJA 5BR7A 2YJNA 3IE2A 2QTMA 2WYIA 2GYWA 1Z0IA 4P54A 3IT0A 3GI1A 4KI0A 5IBCA 4RD4A 1ORDA 1LDGA 4JC8A 2QN2A 1SXGA 1YF3A 3Q3JB 3QPCA 3OLVA 3U4IA 4YA6A 5EAIA 4OI0A 3TLGB 2PCLA 2PRJA 3HBLA 4II3A 1M5RA 2SKCA 1V3QE 2E4ZA 5AJZA 2NU7B 5J63A 1Y5MA 3W5CA 4KQ9A 3UK2A 1I1HA 1BXRA 3N0RA 2JFZA 1Y4AE 3GCGA 3AF6A 2PX2A 4PGAA 5JYBA 1P7CA 3WLJA 4XQ0A 1LJUA 1GP2A 2VQFB 3AW8A 1JLHA 3G23A 4M0PA 2JFBA 4NMMA 3MYYA 4X6LA 4LX0A 1A8IA 3MJ4A 4H08A 1K86A 4NZMA 5AJWA 1OAOC 4OXKA 2AQKA 2NO1A 4F12A 4UDOA 5IJZA 2Y99A 3M6AA 5LYJA 1XZJA 3RBVA 3TW8B 3JZIA 1CWUA 2EJUA 2CXSA 4KGVA 4O2AA 3FMPB 4ESHA 1G16A 4M1OA 1OFHA 4WACA 3VNSA 1WB6A 5C1OA 4UBLA 3H1EA 3K0AA 4PC6A 2FFHA 5AR1A 2Q4RA 2CLIB 2ZRIA 1M66A 2FF7A 4Y2TA 3F5QA 4D9CA 5CAEA 3SP1A 3NJ8A 1MB0A 2ZJ3A 5AKEA 1CVRA 1H3NA 3IHKA 4MUKA 4AMVA 1L9KA 3KE8A 5KQGA 3IP8A 5TGZA 1DOHA 4RE5A 5ALWA 1LLFA 3T7TA 3TW0A 3BUSA 2VXCA 4I19A 3T41A 1P7WA 3MD0A 4M87A 2VQSA 3JWEA 5DEIA 1AG9A 2AR0A 4PGMA 2CJXA 3TVTA 3WDMA 4IILA 4PPGA 5FQOA 4ZDJA 3FLBA 4HJXA 1F1BA 5H70A 5KMGA 4WNCA 1UDCA 3F5SA 4YRQA 1Q0RA 1RAEA 5JSZB 5DFAA 1MX1A 2O8CA 1M6WA 3NOQA 1ZD3A 4EBBA 1XQWA 3H5WA 2AKAB 1ZRSA 4QUHA 1D2NA 1VKOA 1RXWA 2PUDA 3B6KA 5DVZA 1TRHA 1U0SY 1QF7A 3IO5A 4N01A 5G0UA 1EP1B 2DFKB 1BVUA 1ZQ1A 2WAOA 1BMFA 4NR0A 2QSUA 1T5OA 1XC7A 2XWBF 4IIFA 5EZ5A 3WSTA 5T7BA 3RK4A 4IQ4A 1KZ6A 4RA6B 2PNFA 4DT1A 1WDWB 3BMOB 2PUJA 3NW9A 3M5WA 4B74A 5CTJA 1T0PA 4OAPA 4A7PA 3GHYA 4CM8A 5JZSA 1Y1QA 2HA5A 4LGCA 2HMUA 4J7AA 1OI2A 3PIIA 4EKIA 1DC3A 1KIAA 2HNBA 2JRCA 3DDCA 1O95D 3H86A 4A0QA 1T5HX 2JIBA 4TS4A 1CP2A 1O94D 4UHBA 1Y1PA 4F5DA 5A7HA 1FPQA 2O2HA 3PXEA 5BRJA 4BMXA 4GWKA 4R8SA 2BOVA 4PLGA 4J90A 4WKNA 2PJZA 1W5SA 2GDJA 5E8RA 5BYJA 5KYXB 3U7FB 2CN1A 1Q44A 3UB3A 2IW1A 4YXFA 2FPIA 4RFVA 5JEDA 2AOVA 3DZJA 4P2BA 3ZW9A 3IUJA 2VSOA 3T9FA 2FGJA 3KLBA 4R2HA 1WEKA 1G3MA 1WW8A 3GB9A 3E9NA 2ZIGA 1KQFA 2PR2A 2W4IA 4L75A 2JFFA 5E4JA 4F1KA 2DPGA 1QP0A 5BUZA 2P5TB 3A28A 3ZKWA 4FM9A 4MULA 3OHPA 3N86A 1XAIA 5E9AA 5DN9A 1YXMA 4P7JA 4CTNA 2O2XA 2QIPA 4HDRA 1H1DA 1Z3CA 5LYYA 2P9HA 2F8LA 1HYQA 4WESA 4AG6A 4HPWA 4TTSA 3TJRA 3SSNA 4L16A 2XMDA 4OQLA 1N6HA 4JOCA 1NZJA 1V3UA 2O7SA 3EXFA 3Q72A 1QKIA 4RVUA 3S5UA 3I5AA 3NJ4A 2F3UA 4FPXA 5BSFA 4ESOA 5F23A 3AF3A 3LQ1A 4RJLA 3UFBA 4BN4A 1S2LA 1CDDA 5EMJA 1YUMA 1ICIA 4A8PA 1R10A 2JAHA 1SOWA 2FZEA 1P8JA 2F3RA 3QBVA 3W9SA 5ALVA 3OECA 3QH4A 5ICFA 4UHCA 1KKUA 3EUWA 4UHEA 2I7TA 3LKVA 2NADA 3Q3VA 1T9DA 1TI7A 2COKA 2F1KA 1GCAA 1I4TD 2BGLA 1RE0A 2NZXA 2JFUA 2WUEA 1X77A 4QOHA 4WN9A 3D6FA 2FN3A 1U0RA 3BXGA 3D6UA 3ADPA 1ACJA 3EC7A 4L4UA 3U1TA 1K9SA 3VDMA 4GMXA 2WAMA 1WETA 2IEBA 3FZNA 5CGZA 5DYYA 5C1DA 3OO0A 4QXOA 1PJ3A 1FLVA 4XWOA 1JMKC 1SAYA 3JQBA 1I0LA 3H8VA 4DSUA 2Z6UA 2XXAB 2O8BB 1KK2A 2FRXA 4FXOA 4WA7A 3BD7A 2ZBRA 3PUZA 4QUEA 5ALUA 3W3AD 3TRKA 3L8MA 5CDYA 3HVUA 4JODA 2CXTA 4U1RA 3COZA 4EZIA 4CEHA 1QFZA 2AF4C 2ZS9A 4Y18A 4F2WA 1VMEA 3U6BA 2ZCUA 3KTFA 3U9LA 4HDQB 4KIGA 3W5VA 3WICA 3RNOA 3HYTA 1M72A 5GPBA 4OMUA 5GIOE 2YCLA 4RSRA 3EW7A 4ZALA 2H5EA 4KHPB 5DMHA 4YMSA 3BCUA 3L04A 1Z2NX 2NIPA 5HWSA 4TL6A 1JJIA 1GNSA 1W0CA 4TYYA 1WS6A 3ZDRA 5FX2A 3C5EA 1B00A 3N5CA 3INYA 4UAJA 1PCXA 3NEJA 1WZNA 5G0TA 2CJWA 1B8UA 4YDSA 3TM4A 4P4NA 3TNJA 3KQLA 5H9WA 3VR4D 1G6KA 4JP1A 4Y2XA 3WGJA 3HR7A 4PG7A 1GJRA 3ZDAA 4O5OA 4YN3A 5E1BA 2EJTA 4XKJA 3GJZA 2NW6A 3L1JA 4QUDA 3USCS 1SCUB 4ZVSA 3QEAZ 2HCTA 3AINA 5E6UB 3QMPA 5IZ4A 1BX3A 3EW9A 2V6BA 3B5JA 3WIBA 2K4MA 5AKZA 1RKVA 1LPMA 1P39A 2DM6A 1XEFA 2Q4EA 2LRHA 3BAFA 3FYUC 1IZ9A 3Q7SA 4XQGA 4Y1RB 4YI3A 3G2HA 1JXQA 4DJEC 2BZ0A 4LOHA 1E9BA 2CLOB 3I58A 2BHRA 5E6RB 3KELA 4BLWA 4F8YA 3KOMA 2ZWMA 3PQ7A 3MS2A 3O7WA 2WM2A 1YBMA 2BLLA 4LOJA 3QVLA 5AK3A 2P69A 2BY4A 2HQBA 4B32A 4CGZA 1T4MA 2ZYVX 2RI6A 3QYJA 4W7HA 4XLTA 3F73A 3BBPA 3A4YA 3IE1A 1EBUA 3FPJA 1RR6A 4CQJA 3LYHA 1LU9A 2OFWA 1JAZA 3I0MA 3T5GA 1GV1A 2E2WA 2GBFA 2PGNA 2VPXA 3MJVA 1NBEA 2TYSB 1OLXA 4H1TA 2F43A 1G0OA 1X80A 4Z86A 1RLJA 4ZEWA 4ZKDA 3O8LA 5JFGA 3SFVA 1MHPA 1CEYA 4JBGA 2IXFA 2HCBA 1T1IA 2P1ZA 3QOFA 1Z8HA 3HLYA 4RMHA 4JI4B 3VR4A 3HBFA 4W9NC 1H8HA 1SD2A 3JQ8B 5I4IA 1S7GA 3HEAA 1J5EB 1EM8B 2Q5OA 2XNDA 3FCCA 4IDFA 2OV3A 5ALEA 2QV7A 3FWZA 3EIEA 2UVPA 2QUBA 1GFIA 1OLUA 3BF8A 1I3CA 1DEKA 3IDOA 4PYRA 1M8GA 5CGQB 2I9PA 5K0CA 1Q77A 4Y6SA 4HZUB 3E5RA 2YUIA 4XVUA 1NXWA 3PRJA 3ZDZB 5CU7A 1BDIA 2VJAA 2Q29A 2REQA 3JYNA 3QE0A 3BHJA 4TMYA 1H69A 8GPBA 5IUJC 1X1CA 4IRUB 3EDQA 3NAGA 4CU2A 1ZCFA 3G2NA 2B1IA 2GEFA 3LT2A 3ZXIA 3G68A 1ADCA 1P60A 1EJBA 2IV3A 5A9RA 3M34A 2P4UA 5EIBC 4CPDA 3LFHA 3DYVA 1X6VA 5JECA 4XRRA 1BFKA 1IE3A 2CBGA 3GDWA 2JGDA 4XQ9A 2CJPA 3GLFE 2APJA 1ZSNA 1J6UA 1OIWA 5HIAA 5CDFE 4MROA 2R8OA 2VJBA 1U2DA 2Z43A 2EIXA 4TQUS 2V7VA 1BX0A 3ADKA 3SX2A 2JIZD 5G0VA 5G53C 3TBHA 1XHEA 3VI3B 4TKUB 4BWFB 4CIVA 3H1PA 5CYFA 4X90A 3CIOA 3JCZA 3CVXA 4L50A 4CM9A 4GX1A 4B47A 1UQRA 3QQPA 3KSRA 2H00A 2P27A 4J0QA 4EFNA 4DREA 2W4MA 2H1CA 3FJ1A 3AI1A 3L4EA 4K5QA 3UKDA 3QENA 5K3DA 5J4LA 1DFGA 3FBWA 1E66A 4HBZA 3A7DA 4ZO8A 1LDYA 2XVMA 1KK3A 3U81A 2FUNB 1R0XA 3W7VA 3WRYA 3LC7O 5FL7A 5CA0B 5KNCA 2RAVA 1GT6A 2HX1A 1UK9A 4KP7A 4ARSA 2QAIA 3G0HA 3ZWPA 1G20E 1G18A 1XZIA 4N0PA 5CCEA 1C1DA 3UGQA 5HFNA 4OLJA 3VPGA 2CXRA 1E0SA 3EZXA 1TEVA 1B73A 2FP3A 2P3QA 5C8YB 4R8MA 3AERB 4EY7A 1QUFA 4UQLA 5F3RA 5LZ9A 3FCOA 2PPVA 3WADA 3L8GA 5K0TA 5CX1B 5FR1A 4YUWA 2JJ8A 2GJSA 4I08A 1Z83A 1AE1A 2Q3DA 1N0UA 1NBMA 2JAWA 1Y6QA 4RPCA 4MUIA 1QKKA 1GNLA 1H2HA 2JGMA 2NSHA 2Z98A 4GGMX 1CX9B 4X9XA 3VH3A 3P9NA 2YW2A 4G8BA 1SELA 4QUGA 2BEVB 1Z6TA 3KYBA 1W581 2GRAA 4OB6A 4CM6A 3HJFA 4B3IA 2PKYX 2ID8A 1G4UR 1MZVA 2FMKA 5FJJA 2EBUA 3ZJYA 2F90A 4CNBA 3IILA 4D4GA 2AG1A 1N6NA 4KMRA 3NDJA 1FUYB 4X8HA 1V25A 3WQQA 1GQSA 3PQ2A 1HH4A 2I5PO 1LPSA 1T26A 4GICA 4IZ6A 5LP6C 5FL7D 2QM3A 4BFUA 2Q5CA 2OAEA 2QZZA 4EA6A 4PCAA 2ZAGA 5L3SB 3FHTA 3KB2A 4I1YA 4IKEA 3ZD9A 4U7WA 4R3UC 3P2KA 2FSHA 3GMTA 9LDTA 2HT1A 5HQJA 2PUTA 1XIVA 4BVGA 1HSOA 2JKZA 3PV0A 4GC9A 1EWVA 2Z08A 2FFJA 1C7ZA 4DM4A 2C9OA 4J03A 4DJDC 1KR5A 3RSZA 2F7SA 2W8BB 2OD7A 5K2MA 2IX9A 2E49A 4IGIA 1N2XA 3BMQB 4D9IA 5I4CA 1I5RA 1MG5A 1YAJA 3UMRA 3DEFA 2W6ID 4OYLA 4B43A 3FNGA 4GLLA 3LLMA 5CEFA 5H3CA 4O1IA 5HK8A 4UEOA 3G13A 3QHAA 3H11B 3IEKA 4JLBA 3EGDB 4B2PA 1UKBA 1V95A 2EX4A 4PAMA 1MT0A 4HGZA 3KAPA 4BLRA 1BXGA 2A1TR 3E2MA 4W7IA 4YRBA 2DLNA 2XCLA 4KB5A 4PEVA 1JE1A 5AHWA 1GNRA 5K6AC 2VNSA 2UXDB 3CLVA 3SBOA 3BC1A 4HGQA 2BH9A 3KYDA 2G4CA 2W2MA 3KSBC 4MW0A 5DCWA 4CNQA 8OHMA 4RD0A 3L8CA 2XE7A 3OZIA 1MVOA 4ZU6X 3TTXA 1XRQA 3A6GA 1USWA 4FCTA 1DKPA 4XCVA 5H81A 5IU6A 3P2MA 4IHJA 2WJ6A 2XI4A 3MS4A 3DKRA 1I7NA 3W8FA 3HU1A 3GN2A 3LBYA 5A1JA 2BGUA 1XYGA 1Y7IA 2RGUA 4R9NA 3OEYA 1TX4B 1Q95A 5DSTA 1KNXA 2VDMB 4W5RA 2NP6A 3TB6A 4AP9A 5IASA 2W2VA 1ZIDA 1UAGA 3KQNA 2QN1A 4LHSA 2Q5JA 4XE5A 4JC0A 3U7RA 2FF5A 3IAFA 4F6RB 5CYGA 2E9SA 3N2KB 2VDWB 4JN6B 2Q3LA 3GBPA 2A35A 4Z54A 2XMQA 4HLDA 3JV7A 3AM5A 5CMLA 1G21B 1MAWA 2DWPA 1MB2A 3W1VA 3QY9A 2PGAA 4JMLA 1FFXB 2PX4A 2CVPA 4CXMA 1N6OA 2GM9A 4RKQA 5TJHA 2G4LA 3BHIA 4X7PA 1IXKA 1DMRA 1TYCA 3CRZA 1ZJJA 1SBTA 4NOLA 2ZUBA 5CCXA 1CKEA 1Z4JA 3HYLA 3FF4A 1WE2A 3DFZA 2P6PA 2PKRA 1W36C 2GBGA 1F9AA 3K0HA 2E85A 3MB5A 3WNVA 2H4WA 1LV8A 2QG4A 3IDQA 3P9IA 1U80A 5F33A 3VR6H 2CFRA 5CXUA 1JN0A 3WRXA 4E70A 4RH1A 3DE7X 1D1SA 1XAGA 2QLJA 1AC5A 2IYZA 1U31A 2RDMA 4RANA 2D0OB 1JLLB 1MC4A 4F3CA 1HDYA 1XTJA 7MDHA 4XDHA 3U13A 4F2DA 1P8AA 1S8FA 2RGEA 3N07A 4GLOA 5JJIA 1WX1A 1P1JA 4NDNE 2GN9A 2YWBA 3RU3A 2G80A 3LS2A 1HMPA 4Y6GB 4DWOA 2Y76A 1FSGA 2B8TA 1SBIA 2D5IA 3BQNB 3TW6A 2Q6OA 5GOZA 1AKVA 1FYFA 3JQGA 1XCJA 1YRHA 4PXSA 1FFSA 3JYOA 4MVJE 3L43A 4G1UC 4OP2A 5H3LA 5ALOA 4DBVO 1JJVA 4N40A 1KMCA 1ZUHA 4AN4A 3HRIA 3IR7A 3NWPA 4IHQA 5C1IA 3KLOA 2HIHA 1X1EA 1P2DA 1OCEA 2EERA 2RGCA 3DPIA 1F3OA 3CU5A 3KR1A 2XUKA 1TW3A 4IJWA 2JLRA 3DE2X 4Y6PA 5K3OA 4K9NA 3AHIA 4P86A 2VDWA 3SOPA 1UINA 5AVOA 2B37A 2D00A 2QUAA 3ORSA 2XEDA 1VHTA 1NF8A 3N0WA 4XGIA 1T0UA 3V8PA 4GECA 1WP9A 2R3SA 4NV1A 4MCAA 1DBQA 3QVOA 2JEYA 3K5HA 3BWCA 3WYDA 2DHEA 3SQWA 4LF7B 1XPUA 4D9MA 4XUCA 2F1OA 1RZ3A 4DNOA 2IJGX 4MYHA 4FFRA 4MCJA 3TIVA 1S8NA 2Y1EA 4UM5A 3WSWA 3CT4A 4KN9S 4ZOLF 2OCXA 5HRCA 2AJBA 2B4TO 1GQOA 5CM9C 1UM8A 5TR9A 3I1JA 4YJFA 5TMPA 1D1QA 3EXEA 2QRUA 1Z7GA 4BQOA 1TJNA 2O3QA 3A2MA 5HDQA 1QFJA 3AC0A 2WTBA 5FT9A 4RUKA 5D5PA 3PUYA 1P75A 1PT6A 9ABPA 3FSRA 1H4TA 4GPBA 4EY5A 2D74A 1JLKA 4YGXB 1EDBA 2ZG6A 1GZ5A 1J1IA 2HJHA 2PV0A 3S2IA 5LD2C 1DQYA 1EVLA 2QN7A 3CZPA 4WCDA 3P0JA 5ELLA 2I3AA 3F9RA 4G84A 1SK9A 4HO1X 2XZPA 1UF9A 3FTNA 3JWPA 3O4RA 3N87A 3ZLJA 1FMTA 3GUZA 1R6AA 1XN1A 4BUJA 2ZJBA 4HRVA 1NASA 3R9XA 2EV9A 2NO9A 2M9MA 2N0SA 2PFGA 2CXPA 3UT0A 2IU6A 1PBNA 1OHHD 1CQJA 2W2TA 3QNMA 4YAOA 3BMOA 4H3VA 1YAHA 2ZYTX 4AJPA 4O4HA 2C94A 1CC1S 4L4ZA 2A94A 2VDPB 3L9XA 3CXUA 2AOTB 4HCJA 3NGLA 3TYXA 5JRZA 1YQWA 1TFRA 2XWPA 1WUJS 3INGA 2O54A 3MAGA 4MQEB 5CA0A 2DXIA 4NQZA 3W5AA 2XUOA 3IA7A 1PBTA 4UJ3A 3QHPA 1A9XA 3LL7A 3NNNA 1TYBE 5KJ1A 1OPRA 4QUBA 2H1SA 2PZAA 5JJKA 2PSDA 3DE0X 4O2RA 4OB8A 5BT8A 1OTYA 1Y3AA 2G06A 4X97A 1NVAA 4O4LB 3S70A 1IIBA 2AW5A 3Q11A 4O63O 3STVA 4QOIA 3L92A 3WWOA 4DBZA 1GADO 4QSHA 3DLCA 4OP1A 5EA2A 2E0IA 4U0JA 3INRA 3CM0A 2VJNA 3GEPA 2J0VA 1PEYA 5JQGA 4FNAA 2ZUWA 1JKFA 4D3FA 3MOIA 1ITZA 4Y1GA 5TRTA 2GAFA 3NDBB 3Q87B 5D84A 4E09A 3SZ3A 3CV3A 1JU9A 1PYGA 3EIHA 3K0CA 3L79A 1JA0A 1HA3A 3C6MA 4BFCA 5IT0A 3ZVLA 1QE0A 2QRMA 1S9DA 2VHVA 1EIZA 2FRDA 5IDYA 4WADA 1NR7A 5ILQA 1MJ5A 3PFKA 4DW8A 1G2OA 1FFYA 1E4EA 3O47A 1JFVA 1E69A 1I4LD 2XNSA 2B4QA 2Z1DA 3H2HA 2GPTA 1NN3A 2M32A 1A8SA 3H84A 1W85B 3AY7A 3OIGA 2G28A 3OZ7A 4Y1FA 1GYRA 5C4MA 3UT5B 5L40A 1NQXA 4PAOA 1QG4A 5CITA 4WMLA 1GM5A 4ISCA 4PO1A 5GZ6A 2DH5A 4CHGA 2OM6A 2QX7A 3WYEA 4UHJA 4B46A 4GYJA 3W7BA 3ZJTA 1FFHA 4LPKA 2WQZA 4I9GA 5B1DA 3R5HA 3R0VA 1A2KC 4IR7A 3W8DA 3PQ4A 4HL6A 4RSMA 4AJ9A 2AQIA 4WCVA 3AEYA 3K0FB 2NZVG 4PS1A 4OOFA 2H5IA 1FQOA 1T24A 3M82A 1WNFA 2H59A 3G8CA 3IB6A 1GQ2A 3EXG1 3O4GA 4L5YA 2V4ZA 4OPMA 1IIRA 1NFFA 3BAZA 1WO8A 2YUTA 1GUDA 1H9AA 2EFEB 3KKPA 3OX2A 1YFLA 4G0VA 3PWTA 5JH7B 1VDZA 3KFXA 1SUSA 4KR9A 5BN3B 3QTTA 3D9QX 1H2RS 2A0KA 1UBTS 2XNJA 3H3JA 4MRPA 1NPTO 4XB2A 4Z8YA 5FPSA 4ZVTA 1C0KA 1G8FA 3IOBA 4EHNA 4NAHA 3WBFA 4LDJA 2QP3A 4LZAA 1F2DA 1SHZA 5DRTA 1LPOA 3EVDA 4KE6A 4Q9HA 3RS4A 3KTOA 4AYTA 1KAEA 4WT7A 3B1FA 4XIYA 1E6EA 1Z08A 3RG2A 3L7MA 3TCNA 1O6BA 8ATCA 3WL6A 2XLCA 2YJZA 1Y4DE 4RHYA 1VSTA 5KO2A 3HCEA 5IVPA 5F2KA 4M8SA 1N8NA 2D0IA 1X13A 4DF3A 3PXAA 4GI5A 4CMCA 4KAAA 2CDRA 4V0OA 3LT5A 1NVKA 5AKLA 3WGMA 5BMVA 1LUAA 4CKWA 6CHYA 1HNWB 3IERA 1V8BA 4FUQA 2GESA 4WZAA 4JYAB 1KK0A 2J9RA 2FHPA 2VEOA 3PPYA 5TVGA 3T7DA 1QGDA 4LOIA 5K3SA 5CA1F 4WKCA 1FQKA 4IJUA 1SCKA 1F0NA 1SKYE 1JSLA 3BFJA 3VYTB 1NSYA 3E5MA 5IUNC 4IV0A 2VTBA 1G8AA 2NPOA 1I1QB 1L5QA 2HEIA 5DT2A 1M6EX 3OPMA 2ID7A 2VK2A 2PL9A 2J6IA 2ATEA 4ZP1A 2RHTA 1IFXA 2DPXA 2D1SA 2D2EA 1XQXA 1NW7A 2WD7B 3KU1A 4RWZA 2FR1A 5FUVA 1Z4QA 3SIRA 3MGAA 5L4NA 1Z7BA 2QL9A 2BVNA 2A3RA 1J2YA 4A26A 4JL6A 4CKZA 3K0KA 1A2BA 1KOLA 2GD2A 1L7PA 2P41A 3AJ9A 3BWMA 1F6BA 2VI5A 1GUAA 1HRDA 3OSUA 3VOBA 1BHJA 4CIWA 5B4UA 5KREA 3GLIB 4GX2A 3K05A 5EHGA 4E0BA 5BSEA 3E35A 2BJWA 3OF3A 4R7ZA 4CEHB 1U0BB 4F72A 1HO3A 3SBDA 2XUDA 3IEVA 1Q84A 5KCZA 1WMAA 2JJ2A 5EMMA 1A76A 4BL5A 3HFJA 3KOZA 5F1PA 2GYYA 3ASVA 3FSJX 4GI7A 4HAZA 4MRVA 1LSUA 1I0IA 1P29A 3NALA 2CT8A 2IDJA 1Q15A 1V11B 2ZJ7A 3C3XA 1RMTA 3WI7A 1SUWA 3LVQE 1NV8A 2VYVD 1GAEO 3ANYB 5B57C 5C5EA 1C8BA 5EIXA 5FR2A 1PSDA 4TSRA 3WZLA 4ZDIA 5CA1A 1U2RA 1C8VB 2ID4A 4DR5B 3QPAA 4D3XA 5MN5A 3TRFA 4JI2B 1NJFA 4GOND 3TPFA 4FX2A 1VIMA 1IOWA 2OHIA 4QO7A 4EKYA 4EW3A 3AEQB 2QVXX 1PP4A 4JV5B 1HQCA 4Q1AA 1Y8ZA 1YJCA 2IHVA 3DL2A 2I34A 3ROZA 1A4UA 5B3AA 1ZGGA 3T4XA 1CFJA 1D3AA 2AXEA 1X0VA 3BK1A 3MT0A 4DRYA 1OV4A 2QJOA 3PJDA 4Z3DA 5F78A 4W8OA 4LZNA 5H59A 2AZMA 1CHNA 2Q46A 4P4LA 2I29A 4MMYB 3ZTYA 3T4EA 3CR3C 3A3PA 4JJ6A 2Q49A 1R16A 5H80A 3UBMA 4ZCMA 3CKYA 3PNSA 5F3WB 2GVZC 2Q6VA 1J0CA 5B2ZA 3B2QA 5FADA 3UTCA 2MINA 1LY1A 2W83A 4KN5A 5GOTA 1R4MA 4FWBA 3DO8A 4MQFB 3WLPA 5K8TA 4Q7MB 3CGGA 3HCPA 4YJ2F 5BRAA 3CINA 4GOOD 3SC6A 1JAXA 5HOEA 1K0UA 4KMOA 3AIOA 3CCCA 3GUCA 1HDGO 4DY4A 2G8NA 5ULLA 5H16A 3K2IA 3O82A 4IIGA 4L22A 3RT9A 3RTDA 3U4CA 1PL8A 1F48A 1TIBA 3KZ1E 4HLUA 2FPOA 4I9NA 4KDRA 2OBNA 2ONCA 3FGZA 4Q9KA 3WHKA 2X9LA 1ISRA 2ZI3A 2YQZA 3T99A 1WUHS 1Y63A 4LF5B 4YT2A 2B2NA 4FILA 5GAJA 4N76A 1TVKA 1SC3A 3LOPA 5FOWA 1UP6A 4DLPA 1SVKA 3ZDYB 4WK6A 3ZWCA 4RS3A 4LXIA 4QTZA 1G6HA 3EVCA 4CLOB 2GJKA 1KDZA 4EECA 4EY8A 4ZHQA 1E3SA 1ZCZA 1I5OA 1P0QA 4EVQA 1BS2A 4RMJA 4KI7A 3WB2A 2YZ2A 1NBIA 3RKRA 1V7ZA 2Z8XA 3AVTA 4XFDA 5IJ0B 3AQIA 5JY6A 4KQ2A 2PH5A 2PCJA 2F3PA 4HXFB 2OHGA 4Y2GA 1HDOA 1I7LA 2GSWA 4BN5A 3ZJUA 3RRZA 2RBEA 3O74A 5EE5B 2YR0A 5FTWA 5JARA 4B85A 1UPFA 2Y92A 3LY7A 4R81A 3DDSA 4RW0A 3COPA 3W5UA 4PINA 5AK4A 1K6IA 2QQ5A 1R8SA 3GZNB 1HOXA 2WM8A 3QEOA 3SYTA 3UBTA 1FPMA 3WYBA 3TLCA 1NBWB 1ZSYA 1CEQA 4B5KA 2OY0A 4HDAA 4X54A 2O05A 4PC1A 5C32A 3H9UA 5C5IA 4P32A 3WGIA 1CFZA 5LJIA 5HFJA 4TKUA 5E7IA 1O7JA 4N48A 1U8FO 3ZE7A 1DJOA 4BFLA 3Q7TA 2P79A 3CLTC 4LRQA 4ND8A 3GXOA 5BVHA 5EP4A 4M83A 3FOBA 2CFTA 1Z6PA 2CXUA 2GJAA 1I6KA 4WUTA 3GZNA 1TAQA 3LBFA 1L4FA 3UW1A 4F9GA 5M5BA 1P4AA 2ATVA 4J4TA 5DHFA 1TGYA 3JATA 5JS6A 4HDKB 4S1OA 4TQAA 1C7IA 4RMIA 2J48A 2YJ6A 5A5FA 4H0FA 3C7AA 2ZPUA 3IOCA 1WMFA 3COYA 4XPZA 1IQPA 3W2HA 3TQQA 3O1LA 4YTEA 3TX6A 1BZYA 1QSGA 4D8TA 2J85A 2Q9AA 3M9LA 2IYEA 2NTVA 4MVXA 5A9SA 1ID1A 4NBUA 5PGMA 2X0RA 4CCAA 4DA7A 1N0HA 2XRZA 5A0VA 4OXNA 5ELMA 1QYRA 2PBLA 4K0KB 3RSLA 3CX7A 3MSCA 4ASUA 2HHHB 1DELA 1EFCA 3VZCA 4TZ6A 3TDMA 1WSWA 4CFSA 1L7OA 1JHQA 2ZYRA 3Q8KA 4MJLA 1KI7A 2I8AA 3ABZA 1JR2A 2WWHA 1A95A 2R7KA 3I28A 3SKVA 5HJ7A 3BEDA 2JASA 4X65B 4Z9XA 2QTNA 3T38A 3FAZA 1YUNA 2EYUA 3MTEA 4IUDS 1ZA1A 3E1GA 3P97A 4KO3S 4N7MA 4CMIA 1T0HB 3DOCA 4FN5A 1EB8A 1P91A 2FSVC 4ACAA 1QBGA 2I6FA 3D3QA 2LDBA 3FZGA 4RKRA 1CJKC 2HA2A 2FR8A 2JW5A 1YVEI 4IXDA 3SEQA 3I30X 1NT4A 2G77B 3O4JA 4IIVA 1NW6A 3GUVA 4U7TB 2C2BA 1W73A 3QJ5A 3O3OB 4CIAA 2XSZD 2XKAA 3G2MA 4L6IA 4BP8A 4ZZ3A 4EG8A 1JT9A 4RH3A 3EX7C 1Y3HA 2AFRA 3W90A 4PR0A 4H6VA 1ZN7A 3OJCA 3T3HA 3BRQA 5JJCA 3KQKA 1J9GA 4E5PA 2FW0A 1BE6A 1YFJA 3RSQA 1NU6A 2HU2A 4OLAA 2WAAA 3K0AB 1A71A 4WI1A 2RGRA 5AM4A 1MUUA 3H5RA 3MWDA 4IXNA 4J0GA 2FPPB 1YB2A 1VA4A 2ZTHA 3C85A 4TX1A 7REQB 2XDAA 4ZYWA 4JI7B 4KPYA 2O8FA 1H6DA 4TT3D 1R6BX 4ZRNA 1WZCA 3MUOA 1DRVA 3H1AA 5JYEA 4UMFA 2CYBA 3I5XA 2OT3B 3PJFA 3KL2A 1AJEA 4K1LA 1HLGA 1JAIA 1O3YA 2VHWA 1XMPA 3UHAA 2A67A 3THYB 2RONA 3EQ7A 2VPYA 3FPCA 1XXHB 1BGWA 1QV9A 4EHIA 2P30A 3UKJA 4CYMA 1XU4A 4UTVA 5JAIA 4FOSA 3FR7A 1NJGA 1Z8FA 2IXEA 1TM3E 1L6IA 1J9EA 3I5MA 5HE9A 3VU8A 4DCTA 5JNWA 2ACWA 2OWEA 2YJTD 5JFTA 3UCEA 4Z4GA 1M2OB 3WOVA 1BA2A 1H5UA 1THGA 4QPPA 1EIWA 1QGYA 3ZVMA 4UE2A 2PQ2A 4JY7A 2X4LA 1OLSB 4O0LA 1EUQA 3GAZA 3M6MD 1OBOA 5A62A 4YP5A 3AP1A 4FMBB 3CSDA 1JGTA 1X7ZA 2PSEA 3F7OA 3M0EA 4A36A 4YROA 4XD7A 4PWZA 1A3CA 4IP0A 1CLUA 1X1BA 3SDZA 2FE4A 2XRMA 5BNFA 4QARA 3BCSA 3S99A 2QMOA 4RZUA 1COWD 2HQSA 1PW5A 3ASZA 2XNCA 3FSGD 4HB3A 4UVHA 4YJDA 5K0EA 4HRYA 4NRDA 1G1AA 2V6FA 1KQ3A 2XWSA 3DCNA 3ORHA 1YJAA 4YRLA 1F5SA 5D1NA 3P9SA 3OIFA 2DOKA 3RVRA 4EQZA 3VOAA 3T3NA 2R62A 1HURA 2B4AA 5AQ1A 3A6EA 3AFGA 3FNBA 1Y9DA 2ZWPA 2QHXA 1OXKB 4S1VA 1FNDA 3DA8A 4LBZA 4TLBA 3A6HA 1H2FA 3GLSA 2DRIA 4CQLB 5K8JB 3GWGA 1VHQA 5EIBD 1EUDA 3OOJA 1LVGA 2WJPA 2JLSA 3CMCO 4RV5A 1FE8A 2AJDA 1XJ0A 3R3YA 4RPHA 1J22A 3ODGA 3IDSA 4TL7A 2P5UA 3V1LA 2R1TB 4V0MA 3PFCA 3E3AA 1DO2A 3G79A 1TZBA 3M9WA 1XVUA 3ZCSA 1QFYA 5SYMA 1M54A 3CWQA 4AMYA 2QYTA 1XWIA 1XI2A 4CMHA 5CVUA 3G82C 3RWBA 1D7AA 1UEXC 1M7HA 3GG2A 2DWOA 3KFVA 3MCTA 2QX4A 3GJ6A 2X0EA 1LW6E 4K8OA 4CG2A 4UC0A 2RG1A 4AYXA 3WQHA 1NG1A 4BO5A 4WBNF 5LLDA 3TGWA 3BCRA 4FXPA 3ZHXA 3NORA 4MVJA 3C3AA 2R7AA 5F2NA 1LBSA 3MGKA 3OCJA 2GTHA 1JHAA 3E0QA 4YQEA 4DYVA 3QWFA 3RS5A 2HYDA 3H5OA 4FYMA 4OGWA 5JHHB 3G2PA 2OBFA 1XEAA 2H1HA 5D3MA 1SUPA 3ZHOA 2OD2A 4W9MC 3NXSA 1OXUA 2YWDA 2BPOA 4I4NA 1O97D 4POAA 2ATIA 2FEKA 4D3SA 2CF6A 2PV7A 4J16A 4X5OA 3OT5A 4QBFA 1V71A 1QZ3A 3D3KA 1FS6A 3D6MA 5KVSA 3GZTB 1U2GC 4FGWA 4GKVA 5LCXA 2O0LA 4KQWA 4IDPA 1NQUA 3UPTA 3BS4A 1DAMA 2ZJAA 5T4EA 1QHFA 2Q7DA 2D1YA 3VQTA 3GFOA 2E5FA 2UZ3A 2ZTVA 1A72A 3BD8A 4HQOA 3B78A 4NE9A 1A9PA 4E03A 1J1UA 2XXBA 4Q47A 4OLHA 4E5NA 1MEOA 5DX0A 3ESZA 4WKGA 3V4VB 3KPYA 4URUR 1L0BA 3R9KA 4YUZA 3AOEC 4RA6A 3BMCB 3UC5A 4GP9A 4I3FA 4RENA 4B83A 1C1HA 2QY6A 3MUFA 3DBLA 2J7PD 4Q7LA 5KYKA 1VZ2A 1X92A 2BW0A 2ETVA 4XASA 4D42A 3VU9A 2RH9B 5DOZA 4BEWA 4MP8A <