4OJTA

Helicobacter pylori mtan complexed with s-ribosylhomocysteine and adenine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
231
structure length
231
Chain Sequence
MGQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MTA/SAH nucleosidase
publication title Crystal structures of the Helicobacter pylori MTAN enzyme reveal specific interactions between S-adenosylhomocysteine and the 5'-alkylthio binding subsite.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 88
structure length 231
sequence length 231
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ojtA00
4F2WA 4DA0A 2I4TA 1RXCA 2HWUA 5FAKA 4GMHA 4WKBA 4MCIA 3QPBA 1OTXA 1A69A 1A9TA 4OY3A 3UAVA 1PK9A 4ECEA 1VHWA 1Z37A 4L5AA 1PR6A 1ULBA 1OV6A 2QTGA 1JDUA 5F7JA 1JP7A 3FNQA 3FOWA 2HSWA 5F7ZA 1Z5NA 1A9PA 1JE0A 2I8AA 3FAZA 1RR6A 1Y1QA 3E0QA 1A9RA 3OPVA 4R2XA 4GLJA 3PHCA 3NM5A 4UC0A 1Y1SA 4MCHA 4RJ2A 1PR1A 4D8YA 4DABA 1V2HE 3OOEA 4TTAA 3D1VA 3LA8A 4K6OA 4I2VA 4TXLA 3FB1A 4G89A 1PR2A 5B7PA 1U1FA 1T8WA 1A9QA 1ODKA 1V4NA 1K27A 5EPUA 3PHBE 5F77A 3KVVA 3OZBA 4F3KA 1LVUA 1SD2A 2OC9A 4DANA 1V45E 1VMKA 1YRYE 4BMYA 4F1WA 3EEIA 1RXUA 1YBFA 3OCCA 1JYSA 2A0WA 2OC4A 1ULAA 3ONVA 4OEHA 3BSFA 4L6IA 5EFOA 1PR4A 1Z34A 1TCVA 1RXYA 4WKPA 1JDVA 3BGSA 5I3CA 3O6VA 3PNSA 1U1GA 1U1DA 2BSXA 4QASA 3SCZA 3FWPA 5CYFA 2AI3A 1Z39A 3KU4A 5F7XA 5CYGA 2XRFA 4NS1A 4WKNA 2QPLA 4NY1A 4JP5A 4PR3A 4DA7A 1Z5PA 2B94A 3GGSA 4MARA 5B7GA 5JPCA 1OTYA 1NW4A 1Y6QA 2QDKA 1ECPA 3FUCA 1PKEA 5CXSA 4OJTA 3NBQA 1OVGA 4GKAA 1CB0A 4D9HA 1Z33A 4TXNA 5B7QA 4LKRA 1LX7A 4LDNA 2PGAA 1ODJA 4GLFA 4LNAA 1PF7E 5F73A 4D98A 3UAZA 4DARA 1JDZA 4X24A 4F3CA 3LGSA 3UAWA 1V48A 1LV8A 4TTJA 5K1ZA 5B7NA 3OZEA 1A9OA 1V41E 4YMLA 2QSUA 1G2OA 2P4SA 1PBNA 1U1CA 4LNHA 2HN9A 3UAXA 3EUFA 1RCTE 2OECA 3TL6A 4TS3A 3DDOA 4F2PA 3U40A 4QEZA 1A9SA 1TD1A 4WKCA 4YJKA 2QTTA 5IFKA 1JE1A 1U1EA 5CCDA 4U2KA 3P0EA 5CCEA 1Z38A 1TCUA 4FFSA 4DA8A 1T8SA 3IEXA 4TXMA 4NSNA 1C3XA 3EMVA 5IU6A 3BL6A 3KHSA 4YO8A 1SD1A 4JWTA 5EUBA 5CXQA 4TXHA 5C80A 3BJEA 4YNBA 2HRDA 3UT6A 4OGLA 1Y1RA 1VHJA 3IOMA 3MB8A 4PNPA 1RXSA 2AI1A 4E1VA 3OZDA 1PR0A 3K8OE 2IQ5A 2A0YA 1OU4A 5KB3A 4WKOA 4D8XA 4L0MA 4G8JA 4H1TA 5F7OA 1T0UA 4M1EA 1TGVA 1NC3A 1SJ9A 1K3FA 4R31A 4DAOA 3GB9A 4OF4A 1JPVA 3EUEA 3E9ZA 1RT9A 4IP0A 3MMSA 1WTAA 1B8OA 1RSZA 4EB8A 3KVRA 1PR5A 4DA6A 1XE3A 4M7WA 4L5YA 3OF3A 3E9RA 1ODIA 5ETJA 1Z35A 3O4VA 4QFBA 1ODLA 3LBAA 1ZOSA 4QATA 4DAEA 4JOSA 2AI2A 2RJ3A 1PK7A 5F78A 1YQQA 3NM4A 1TGYA 3OOHA 1NC1A 1FXUA 4OGKA 1RFGE 2GUWA 4QARA 5DK6A 3KVYA 3C74A 3DJFA 1PW7A 2ISCA 3INYA 3K8QA 1YR3A 2AC7A 4D8VA 4L5CA 3ENZA 3P0FA 1Z5OA 4TS9A 3T94A 1Z36A 1Q1GA 1Y6RA 4G41A 1VFNA 4QAQA 4M3NA 4EARA 4TXJA 1N3IA 2H8GA 4LZWA 3DPSA 1CG6A 3DP9A 1M73E 1B8NA 4TYMA 4BMZA 1T8YA 3ODGA 4TTIA 3F8WA 4R2WA 1QE5A 4P54A 1I80A 1SQ6A 3PNPA 1ZL2A 1K9SA 1JDTA 1PWYE 5F76A 1Y1TA 2A8YA 2Q7OE 4BN0A 1JDSA 3KUKA 1OUMA 2A0XA 4BMXA 2OXFA 3NM6B 1T8RA 1V3QE 4KN5A 3DF9A 2ON6A 3UAYA 3OZCA 1YQUA 1RYZA
chains in the Genus database with same CATH superfamily
4P5PA 5G1NA 4KRFA 3WLOA 2G04A 3KRTA 1ONBA 3UA3A 3VPGA 1JLKA 2G9ZA 4DCMA 2QMUA 4TWAA 4JU8A 5LMZA 1FJ2A 1W4AA 4TWZA 3B5IA 4TTPA 1PE0A 3TDKA 2LBPA 5KJ6A 5HJ2A 4BNGA 1NMZA 3MILA 3IPLA 4BX9A 4EZBA 1V71A 2DHEA 4NXMB 2FUG1 1RJFA 1X8XA 4JL6A 3MINB 4AJ9A 4CL8A 1ZJWA 2YFHA 4IHJA 2H1RA 2FDXA 4NHEA 4OQMA 4LF4B 4GZ3A 3D8TA 3KQVA 1D3AA 3BRCA 1KAMA 2IPNA 3RREA 1TQ4A 1QDUA 3PEFA 4B33A 4DKXA 1TIKA 1W36D 3AO0B 1DAFA 1JDUA 3DFUA 5TT1A 1FBNA 3SS7X 1NBAA 3OZGA 2IA5A 4D25A 3H0CA 1C8KA 5A6SA 3RYFB 5CBPB 2F1OA 2ZSAA 4G5GA 5BVGA 1RRCA 2HK6A 3D3JA 3NKVA 2GO1A 4ER0A 2BCJQ 4EFKA 2I8AA 1X7HA 4L50A 3F47A 4FI3F 1V8BA 4UNQA 1CNEA 3KDAA 3GRVA 3LK6A 4X6UA 5AP9A 3KYBA 2OV3A 1WB6A 3CX7A 1S2GA 3NATA 5ADVA 3S44A 1PNQA 1T8TA 1Z25A 2F59A 4HUQB 4PYRA 3V8MA 4J03A 3M9WA 1SBQA 3HB9A 1MAUA 5E1OA 1JI0A 5F1OA 4IDNA 4PQEA 1DBSA 3MCVA 4PQRA 5DN6D 3NM5A 2CNOA 5H59A 2YZNA 4I9UA 4OYRA 4PC7A 1L2TA 1JPJA 1UJ6A 2VJDA 5C5EA 4JLNA 3LBYA 1W19A 3J81A 1V2HE 3OOEA 5EKSA 3TTTA 3HPRA 5FXMA 1QGAA 3TLKA 4G0OA 3W9YA 3QMMA 4DCNA 2HFJA 5HE8A 1S8AA 5DMXA 1V16A 1YS1X 3OCYA 2IHBA 2X4GA 3D1VA 1E1QA 5ALPA 3EARA 5HDBB 5I4KA 4FMDF 1D0SA 1Z63A 1ECJA 3LUFA 1N77A 5A5VA 1M83A 2XKBA 1T8WA 2ZAGA 5CT4A 3TLBA 3T4XA 2VHYA 2BYTA 1CZHA 2G88A 2OG2A 3HGTA 4OVKA 4OXRA 1K27A 4C1NA 1A4UA 1B0AA 5KKAA 3VOSA 4L28A 4TWIA 1CTQA 5B4VA 1XYVA 5KYNA 4LCEA 1QG4A 3C1TA 1KFCB 2JARA 1LVUA 4J1TC 1R37A 1ES9A 1WNTA 2VNHA 5CVJA 1VMKA 1GP2A 2ZBUA 4W8OA 2AOUB 2GH1A 4F1WA 1DC8A 5H0IA 5I9IA 3E8MA 4EFMA 5LFAA 2WFLA 3I0MA 4FOLA 4O8CA 4Z9YA 4ZVOA 4NCAA 2ZSDA 2VEOA 3LCVB 2V5VA 2CVOA 1JNXX 4HGRA 4JMLA 1TMGE 4R51A 1WPQA 3S99A 4DQDA 4EEXA 3Q7PA 4DR1B 1ZVMA 3E53A 5JO9A 1ML4A 4MVJP 4GP6A 4L6AA 4LRUA 5JANA 1ID1A 1RC1A 3ENNA 1P5RA 1FVHA 4RDXA 1CEYA 2H9IA 1P6QA 2GGSA 3WLRA 4PSCA 4ZANA 5DHUA 2H2WA 3W5BA 3O6VA 3IJRA 4J75A 4NARA 2YWJA 4WQMA 4YRBA 1NGSA 4W5TA 3ZLJA 2AKEA 4FYYA 1E1YA 1KO4A 2XADA 3L84A 5D6NA 3PL5A 3SEFA 2OTCA 2APJA 1SZDA 5A9TA 3OKCA 2FX2A 4X8HA 1Z6ZA 1UODA 1JHMA 1WABA 2GHQA 4TKMA 3FFTA 4DDHA 1RYYA 4N0DA 3RJ9A 2ZBGA 1RJGA 1H5NA 1E1RD 2PLRA 3EYAA 3NTUA 4Q1AA 2VPTA 5LUAA 1J5XA 5FT9A 4TWBA 4PHCA 4PNZA 1C80A 1EYZA 2FXVA 2PGLA 4X6XA 4BO4A 2WVHA 4U9UA 3PGJA 3WICA 4YJFA 4XSVA 4RVGA 2Z9CA 1IWPB 1AKRA 1GJRA 2Y0EA 3WO1A 1HV8A 5DLDA 4JP5A 1GG2A 1FP6A 1FTQA 3C24A 3RJTA 1E92A 3WDMA 5G0UA 3IIEA 4RMNA 3NXKA 4NTZA 1NW5A 2CNWA 3HV2A 4A2QA 4B82A 4CIXA 4JI7B 4UTVA 4Y9SA 3MERA 2OV2A 2B4TO 2HF2A 2YYYA 1SRQA 1PYGA 4UTXA 1Q5PA 5B30A 3FUCA 2ATEA 2NXWA 3GFRA 3KQSA 1PKEA 3T0IA 1OFTA 2ODQA 4F4HA 4JLVA 5GJWC 2C61A 4IDCA 2C2GA 4C05A 2IS6A 5D3MB 1H2AS 1WSDA 4BKQA 1KEWA 2GD2A 2NU6B 4BLOA 2IF0A 2WUDA 3IP9A 5ALVA 5JAQA 3SSMA 1A3CA 4Y7CA 2KJQA 3W4JA 4BOYA 1QCZA 3OF5A 2MJLA 4O4JF 1EQ2A 4UUPA 2Z08A 5TMPA 2QV0A 4KODA 3COJA 1DC3A 3ER6A 3LL7A 4J0CA 3IURA 4FW9A 2RHWA 4G4SO 5JVDF 3Q15C 2A9VA 3ZY5A 3ELWA 5AW8A 1KWKA 2YR0A 3D7SA 1D7AA 1ODJA 3ZPXA 3ASYA 3KFLA 5I5GA 3T7CA 3EMBA 3F73A 1SPBS 2XR1A 2VP3A 3ORFA 3A2LA 5BW8A 5GZ1A 1O1YA 2H9YA 3EH1A 4ME6A 2FZKA 4MRRA 1YH3A 2ZE5A 3A4TA 3LPCA 2KW5A 4LDZA 4LSWA 4PLPA 3KYJB 3EGVA 2WF5A 5AKEA 3STYA 5K2MA 2J9FA 3MB5A 2V6GA 4TKLA 1ZXLA 3K4PA 4RDIA 3OCZA 1H5QA 4FDMA 1E96A 4OUDB 3THRA 5KYWA 1V5GA 2O0JA 3CSDA 4F6CA 4HQOA 3LC2O 3R7BA 1H2EA 4OBWA 4URWR 3HJTA 2VRWA 1C7IA 1FYEA 5CT8A 3L01A 4JR0A 3QJYA 4RPHA 3LC7O 1TZKA 1X70A 1FP7A 3UOAB 4L8LA 1QYWA 1PBNA 3GYGA 3WKAA 2LNDA 1Q92A 3U3RA 1NU6A 5FWYB 3KB1A 3KJZA 1LU9A 1QFZA 3WWOA 4C4RA 2GFIA 2GTHA 3LC0A 3OJLA 1EWRA 5IWCA 4R3WA 2YWDA 3EOZA 4HQNA 4F2PA 2P3OA 2FQQA 1L4YA 1DTWB 3MTIA 3PVSA 2QM8A 4LY9A 4PO9A 3VU9A 3JR3A 1AKTA 1M2VA 1T3GA 4CWAA 4MQFB 5D6OA 4N5MA 1CY7A 3OQ1A 3A6EA 4ODIA 1FE8A 1QO9A 2PFGA 3F3KA 4BE7B 2X1LA 2UZ1A 3EHEA 1JFSA 1TRKA 1YVDA 4LGYA 1NVXQ 1WW3A 3LECA 3SVTA 1J2UA 3G3EA 3HUTA 1MO4A 1N5DA 4IVPA 1Q19A 4EHAA 1KYIA 2FCAA 4YMUA 1ZIXA 1GV1A 2BLLA 3JPYA 3KXDA 1WCYA 3AR3A 4R71A 3GT0A 2HOQA 5CCEA 1R6TA 3RSCA 1CHNA 4UUBA 2V1XA 2GNPA 4TV9A 4YRRA 3AZPA 2Q3FA 621PA 2BGTA 3GLUA 2VDPB 4JH0A 4KJXA 2J9GA 1PJ8A 1EM8A 2DPYA 4W7SA 3K31A 1KMHB 2H7YA 4PPNA 2D5CA 5BR4A 3OOWA 3TQIA 3BL6A 2PQ0A 2NQ8A 5FOSA 3MS2A 1OKKA 3O90A 1A8SA 4EYQA 4YI5A 4I5DA 4JWTA 3BTUA 4WX2B 3V2GA 1EPUA 3ZGNA 4WJKB 3ZUPA 1MPXA 2OO5C 4GR5A 1Z45A 3EXHA 3ZZ0A 5LQCA 1YZNA 3LY7A 4M0LA 2B8WA 2RGNA 1H6CA 3TDMA 5IUJC 2NV0A 2WFZA 1VYHA 4ZQBA 4N9WA 2QENA 2HF8A 3G2MA 1JKIA 2ZIZA 1W35A 4MYUA 4UXJA 5IXSA 3MUNA 2PJUA 2Y6VA 3HWWA 3PUKA 2QG9A 5A7GA 3UQZA 4ANFA 5B4UA 1I7QB 1LJ8A 4PNPA 1RXSA 4CTMA 9ATCA 1WW2A 2KMLA 5BOSB 5M7EA 1HBJA 4FKZA 4M0KA 1E2IA 3U39A 4BNLA 4D4LA 1UKYA 3O9VA 4M9SA 5FFFA 3TN7A 1WHSA 3A1FA 4A73A 1DIAA 3AHCA 2VZLA 3A04A 1RQ7A 3BMOB 4CV3A 3ZWYA 2R66A 5B58T 3B8HA 1XFAA 2YY7A 1HNZB 4TLMB 2XKJE 5A5FA 1VHLA 3QU4A 2UUPA 4NMHA 4LF9B 3KOUA 3ESDA 4PXSA 4DCJA 4H7JA 3A3NA 3TNYA 5EZSA 4GBMA 4JKYA 3FTCA 3TZHA 2K7FA 4N41A 1LPOA 5CJJA 1SC4A 2ZM5A 5ANRB 1IHDA 1I7DA 2ZJZA 3LX6A 5MFPA 4M1MA 3E9EA 2FF5A 1L4GA 2FSPA 2Q1UA 2ZANA 4Q4AB 4URYR 4YAFA 3U4IA 5DN6A 5M29A 1GZHB 1EP9A 2W9XA 4RPKA 1N2EA 1ZH2A 1EK2A 2C94A 2I4LA 4WY8A 4HV4A 1WZ2A 3HDHA 3P52A 1EVLA 3VR2D 4JBIA 4MW2A 2IVFA 3EXFA 3HCPA 3NBMA 4EMBA 4PAGA 5JQGF 1RJWA 4B84A 3KAKA 1AXRA 2NPFA 1XP5A 3RVPA 1CRLA 1O6FA 2GZHA 3QWFA 3ZCXA 2WJGA 2R86A 2TSYB 1ZRHA 4A2CA 2C58A 2EZUA 2WG2A 1CUBA 4ZCIA 4EGAA 4M7WA 1EFPB 3NDPA 5JCZA 3AM5A 3BVPA 4G5OA 3R6TA 1Q1ZA 2GPAA 1AQIA 2D1YA 3BGOS 3G1UA 3NEYA 3V42A 4BO0A 5LWHA 2V7UA 3NONA 3AVUA 1CQIA 1COWA 4IQ8A 4KG7A 3ADBA 1O87A 3AIIA 4DV5B 1G8YA 1UQRA 2JGIA 3KKPA 4Q4CA 3V6MA 1WDTA 8ABPA 1YAJA 4NFYA 3BE8A 4FMBB 3AFHA 1GZ7A 1DPFA 4QD3A 1YKGA 2G83A 3O3NB 4Z2YA 1KO1A 4RDHA 1M6EX 1KPIA 1XTPA 1E9VA 4A8HA 1L3IA 5A3QA 3ER8A 2PN1A 1PUJA 1X86B 2PVSA 2QGFA 2Z5FA 5EHXA 3DCYA 3ZEAA 5JNTA 4BFXA 3LG2A 4O3FA 3FPJA 5GM2A 4H1WA 2C9BA 4NXNB 1M2OA 1ZU4A 3LKVA 2QWXA 4GL4A 5TEWA 3V8NA 4WN3A 7REQA 5PNTA 1L4EA 2HWKA 4UOEA 3WYGA 4CKBB 3CRMA 5I4BA 5K8UA 1RNLA 1JQLB 3GUZA 2R7LA 3BH6A 4Q1BA 4IRMA 1SU7A 2HSJA 1P1KA 4H7DA 3WGIA 2O6HA 2V8OA 4FZJA 3MJFA 3RARA 4MZDA 5FKJA 1P60A 2NVOA 1XEWY 2HO5A 3KVYA 4XGKA 2IHZA 2OAP1 1XK6A 1LPMA 3C15C 3VR6D 1XMOB 1DBPA 1M5TA 2Q3CA 1X1RA 3NAGA 1KU0A 2Q5JA 4R83A 2ZSJA 2IRWA 3VR6H 5IXJA 4U7PB 5KYTA 4H08A 221PA 2IKSA 2IY8A 1CR4A 1SXJE 1N2CA 2O0HA 2XHZA 3CZ5A 3KTDA 3LQRA 3MWDA 2HMWA 1DRWA 4PX9A 5LJIA 1RZUA 2ASEA 3UYKA 4E5KA 1WMFA 2REQA 5HCNA 1E1RA 3ZWNA 3K1AA 3P0FA 1S2MA 2ZT8A 4ITRC 2PS1A 5TSDA 3OFVA 4P3KA 5I9NA 1XRRA 4YY3B 5CLFA 1N8NA 3HSSA 2P3SA 4BUJA 2VZ9A 5ES4B 1NG1A 3JQ6A 3A37A 5FUXA 1Z2AA 4LJ4A 4BVKA 1F7UA 2D59A 1E62A 1NPYA 5HF6A 2R48A 4S2EA 1C5KA 4FGJA 5K3AA 2JASA 4RFSA 5L3QB 2JAQA 2WF7A 5GONB 5F98A 1WXWA 3AI7A 1YR2A 2OAEA 3HYRA 3PUJA 4RPGA 4BEJA 5KAPA 1SELA 2JNWA 3D6FA 3I2JA 4GH5A 2FWNA 2AL7A 3N0WA 2RI6A 3H6KA 4YQEA 2FZWA 1RI1A 3HCDA 2UXCB 3K8ZA 2I8CA 1P80A 4WN9A 5EN4A 4EUKA 1KJYA 2QRPA 1BXGB 2Z2YA 5SZKB 3CC8A 2C8LA 3T9CA 4BMDA 2O3RA 4ZGGA 3OSZA 5EMMA 3ODGA 2QRUA 2VC2B 4FX5A 4B3FX 3SN6A 4NYIQ 4QELA 1A9XA 4KQJA 4B6OA 2Y8EA 3WADA 3ZQJA 1UP6A 3D4PA 5HX7A 2F7SA 4ZT5A 4I1OA 2A58A 1F2UB 1ZQ1A 3N3AC 3NRCA 1Y5RA 3QXHA 1E0SA 1REQA 4O2BA 3RVSA 4H1UA 4Q7EA 4WH0A 1JWLA 1PZNA 2WSSD 2FA9A 4BBJA 4WE3A 3TRIA 5JS1A 5JROA 4US1R 4AY2A 3E4CA 3EQ6A 4HGZA 4B85A 1FUUA 2Q3EA 2HIAA 4FD3A 4J7AA 4LHYA 4PN3A 1N5RA 1RFLA 2O3UA 2ZGVA 4P35A 5JCPA 4WW0A 4URZR 1MTOA 4TT8A 2OCXA 1NSTA 3VV2A 5J58A 3GLGB 4WCFB 4JIMA 2VZEA 4GWLA 1FNBA 1UQTA 5A9SB 2ZULA 1ZRSA 2H17A 4YRTA 1NJ6A 3D4IA 1JV2B 1RXIA 3GMSA 3G0IA 1H4QA 4RDCA 1V1JA 4F11A 3U61B 2NPOA 3VYSB 4F4DA 9MHTA 3NTLA 1VB5A 1ZOPA 4Q93A 3K0SA 4UMDA 2O3QA 3LTEA 3ABRB 1T9CA 3DF9A 4EKEA 4XWWA 2A9KA 3K20A 2J3JA 4J0FA 3LDHA 3TNDA 3DMFA 3NG1A 4G1VA 3DC2A 1IUOA 2G82A 2ICAA 3PUWA 1EX1A 3L8MA 4JX8A 1UPTA 1EB8A 2UZ3A 1FVOA 2R62A 1UOOA 3OQBA 4HPWA 1XLVA 2BBWA 2VF2A 1OXTA 3DEZA 3PGXA 4N5IX 4LY0A 4OHCA 1E2PA 4Y2QA 5BWOA 1NNUA 4XYLA 2VVTA 4WK2B 4ZV9A 4EB6A 1YUBA 3I9NA 1IEVA 5I7VA 3PFFA 1K0UA 3S1AA 1NHWA 3TUJC 2RAUA 1JDNA 4OFWA 4AX8A 1ZMTA 4C4OA 4CM7A 2ANBA 5H83A 4LPSA 4X60A 4LJKA 1Y3BE 1HE4A 1ZH0A 2PSDA 4OHVA 1ZSNA 1ORTA 4G5FA 4YPFA 2WZQA 4KNVA 1JLLB 3ED5A 5LQNA 2P1RA 5FWXB 3PC2A 5JV5A 4YQYA 1VMAA 1B8UA 3A1DA 3MF4A 4ENVA 3QITA 3RS4A 3ETHA 3FAZA 2O52A 4RTNA 2PRKA 3A1SA 3QV1A 3ZD8A 3ZWAA 1E2MA 3BICA 4RVDA 2G1JA 4J76A 3NMUF 5AI9A 2FEWB 2PRZA 2W6MA 5IZCA 8MHTA 3X2FA 1TA0A 3OPVA 3E9NA 4FFBA 4QQKA 4IIJB 3ROMA 1AO3A 2YWBA 4A8JC 1K8YB 4EH1A 1SY7A 1ATIA 3DUFA 4M86A 4TQUS 4DG9A 1QV7A 1V47A 2QJTA 2O4CA 3M81A 3OU6A 2ZSFA 5JSQA 2JI9A 2XCUA 1O54A 3KUUA 4KGVA 2B1RA 5EZQA 1S02A 1YBHA 1R4AA 3LLMA 4B74A 4F60A 3UMFA 3P0JA 3FJYA 3AHFA 4OSEA 2P9YA 2W2LA 2PSEA 3SBOA 3WWDA 4ARIA 4M36A 1DDOA 1P9OA 3DE0X 4PV7A 3TZBA 4M1ZA 3BA6A 3JYHA 4QBIA 2J07A 2VNSA 3SDZA 4XEUA 2X8JA 4HQKA 2W2QA 4UHCA 4UVIA 3L6UA 1I3NA 3RAPR 3JQAB 2ZB2A 5ADUS 1P7VA 1PG5A 1NXWA 5DBOA 5FB3A 2WZCA 3N70A 3BDIA 3ME5A 4CV2A 4HWKA 1F48A 5DNVA 1T5TA 3NT4A 1VHDA 4XWAA 2IYTA 4MWBA 1UADA 1N0WA 1QZZA 1OY1A 1USWA 1EWQA 2JFGA 2OC9A 4YX9A 1YFZA 3CEJA 1E2LA 1NQWA 1O08A 2JFBA 1BHSA 3LE8A 3WO0A 1XMVA 1SEPA 4HUJA 1KJWA 1BHJA 3GNQA 3WLKX 4V1CA 1NKSA 1QVAA 2OC4A 5JT1A 2Q8QA 2BTQB 3SE7A 1QK5A 3E1SA 3HNRA 3PXCX 4H7HA 4DVJA 5LNK1 1SIOA 1Z12A 3PDWA 2WU3A 2QN8A 3IR7A 2DCMA 5KDLA 2JGKA 3T06B 1G17A 2OHIA 3HL4A 3JR7A 3RKRA 3VR2A 4S0ZA 2Y1WA 4RL4A 4B31A 4BRWA 1N33B 1EXNA 1U8XX 3WNCA 1KSFX 1U0SY 2IYRA 2X13A 5JWHA 3T7TA 3AP2A 2BL4A 4IIYA 5BV0A 3MPUA 5I3CA 2C78A 3F2IA 3NHZA 3VTZA 3QYJA 5CH8A 4MUYA 2B5OA 4BCCA 1UM9A 1ZVKA 4BXOA 5DMHA 2FRVA 4QDOA 5LP6C 3STVA 3Q1KA 3VPSA 4C14A 1LBHA 5A05A 3VH3A 4EIWA 2AI3A 1T9HA 2O7QA 2DQ4A 3EGEA 3V8PA 2WLTA 4ZPXA 3OEHD 4P53A 1W0JD 4CLDA 1UBMS 1RZVA 3D54D 4NS1A 1P7WA 2EDCA 3E3OA 4ALIA 2JGJA 2DBRA 1I24A 3GFBA 1N9GA 3TCXB 3W3AD 4WT7A 4DNOA 2FFHA 5EIHA 1MJGA 3HA5A 1HL7A 1KOJA 3BK1A 3ZGZA 4HJXA 2RKOA 3CLTC 4TTQA 1UAYA 2JCSA 2QPLA 2V54A 3W3AH 3R6DA 4E33A 4UQPA 4HWRA 4PR3A 1Z0SA 4Q9NA 4WOBA 1Z5PA 2COUA 1MQ8B 3DAPA 2BFBB 3PC6A 3HLTA 4MQUA 4I1VA 1YA4A 1LFDB 4NDZA 1N6IA 1V4VA 2RJNA 2XEDA 1ZVVA 2ERYA 3DBIA 3LX5A 4JMPA 3DLPX 2I0FA 3O93A 1MCZA 3O4JA 4UHEA 4J1TA 4KIFA 1ECPA 1RE1A 1NUQA 1M6WA 1Y3CE 5TV2A 1R6UA 5TF4A 4EHFA 2DLDA 2XUJA 3KEQA 3KJEA 4MPTA 3GRPA 2FOLA 1SO8A 3GL9A 4Z4FA 4GKAA 5F51A 2H07A 3SG0A 4M55A 3W9BA 1U31A 4ZRMA 4KPGA 4AG5A 4S1WA 5A03A 5KQPA 3LRXA 1KKMA 3OQPA 1QE3A 5I5EA 2J30A 5BR1A 2RDMA 1CRQA 4NE2A 2B83A 3F8TA 4MUFA 1OU0A 1P2SA 1RYHA 2DFNA 3GEGA 4ZAGA 5JD5A 1DKNA 1HYQA 2GSDA 3BTVA 5DFAA 2KPOA 2EWVA 1IJFA 3COWA 5E4YA 3BFXA 4DDTA 3HA3A 3NOOA 4G9GA 3RTAA 3EPJA 1JSXA 1Y1KE 2Q0HA 4PYQA 3A6KA 4HQFA 5KTPA 4FQ7A 4XH9B 4CR6A 6CHYA 2NACA 5KTMA 2HFKA 3QIVA 2H2GA 3KQTA 3TH5A 2P6NA 3B48A 3UPDA 1QIJA 1LDNA 2AF3C 1U7HA 3E7FA 4RELA 2NSDA 5BSFA 1A5TA 4HNSA 4LJ9A 4O0MA 4RA9A 3RW9A 1JBQA 5TQVA 1L7BA 1LDMA 2O5CA 2OA0A 3U0BA 1K8XB 3IODA 4M6WB 2J3DA 3QYFA 1DIHA 1L9KA 3V00A 4ZVTA 4LECA 2H1SA 1RPZA 3ESCA 2AJLI 3V1KA 1LV8A 3CJQA 3MJRA 5BN4B 4PSAA 3GDFA 3GUHA 1SVKA 1UXIA 1Z4LA 2NZYA 3VFDA 2BSQA 2GD0A 2QLBA 5JY1A 3BMQB 1JHRA 1VSQA 4MGIR 4JL8A 1LZKA 3HNOA 5TEVA 1TKCA 3QPDA 4LBWA 4U63A 5HZGA 4NYMQ 1BN7A 3O2QB 1WKCA 5KZMB 1AN9A 3ZCPA 3C3WA 1SMKA 3OSUA 1ZM9A 4BP3A 1LI4A 3L4JA 4DQUA 4QEKA 3OETA 3ROFA 1RCTE 1ONOA 1CQPA 1U94A 4ZOQI 2ZJ8A 2CMGA 4P5DA 3X2SA 1TJ3A 2QAGB 2WU4A 1NI4B 1J25A 2P2ZA 2WAAA 2EBUA 3LF2A 2WJJA 1T35A 3PF8A 4L7QA 3SJ7A 4UNNA 2WSSA 3Q9NA 2OR3A 3U4CA 1PKXA 3NI2A 5G2OA 4NBTA 4JYAB 3FYUB 1OXVA 4JLJA 3GLIE 1TA4A 3MQ4A 2IP4A 2AZXA 4YJKA 1VE1A 1YJ8A 2EJUA 2X8WA 3ACBA 1SC3A 4ZAFA 3L8ZA 4IHJF 1OBFO 4Y2GA 1O97C 2IDKA 4JQYA 1SUIA 1AGPA 1EVZA 3V4VB 3WK4A 4QOJA 3GDHA 5IKOA 2FPLA 1NDUA 1L4HA 1T8SA 5CPFA 2IH2A 5DX1A 1HDEA 1ECCA 4GICA 2Z6UA 2NNWB 2PV0A 4YCDA 4I3FA 4CCYA 4DCUA 4WBNA 2BN4A 3OH8A 4UE6A 3FGPA 3B1ZA 1E5DA 1QFXA 3U81A 2OGWA 1US8A 2X0EA 1XTSA 2FPMA 1GKUB 3SZLA 2O20A 4EITA 1MBZA 2R8YA 1LTKA 3MJ4A 2VA9A 3FMOB 2RGUA 2O5EA 3Q0TA 4OQEA 1Z6QA 4TXHA 1D5CA 3OE4A 3TBFA 1GIAA 3NEJA 4EPTA 3DAYA 2ODNA 3IILA 3IUEA 5FWNA 2YV2A 3BYZA 2CL0X 4RJLA 2RHHA 4REMA 4E7PA 4YYZA 3PI7A 1J8QA 4P5EA 5EWJB 1VLVA 2Z5LA 3QYAA 1SCKA 3KPVA 1I4EB 5FV4A 3TOCA 1QTRA 1QGUA 2BM1A 2P9HA 2G1KA 2ZI7A 2ZVDA 1A1VA 4CMEC 1XRSB 5EP3A 5K3BA 3IOMA 4DIOA 2VQEB 5AO9A 2EP8A 1P1RA 1R7RA 2E48A 4KLAA 1CSEE 4UBMA 1XAGA 5B1DA 5LLSA 2FTKE 1F9EA 4L08A 2KLHA 2R2GA 3PRJA 4XSHA 4B4UA 3ITEA 1XDBA 2C9MA 1PYOA 3SYNA 3AM1A 3A7DA 1ZMOA 1Z16A 1Z7GA 3PLNA 3OZDA 3VZRA 3JVUA 4MS4A 1T0HB 2DFPA 2YH2A 2HPVA 2PU7A 5EJ7A 1EVKA 3TMYA 2OBLA 1JZSA 7YASA 5KQMA 4QUIA 3IFSA 2OCAA 1T9GS 1H9CA 1I6MA 5CYPA 4MO2A 4TMYA 5ECYA 1OH5A 1IXRC 2C2MA 2WHXA 4RCVA 1U3DA 2BEUB 2NG1A 1B43A 1H65A 2HZBA 3D0KA 3D4LA 1SJ9A 4M1TA 1UBSB 4WNAB 5JHHB 1MO2A 1S6YA 4Q05A 4YLGA 1NSYA 1HH4A 5KSWB 5TY0A 2D8MA 4KI0A 4BAZA 1RMTA 2Q9BA 3GR6A 4OHZA 3HB4X 4LJRA 3ZHUA 1TKAA 3MHPA 2NUAB 2NO0A 4KE9A 1O4WA 4TZTA 3IPXA 3GRAA 1RHUA 2MSLA 2ZRBA 4YP0A 5E2BA 1RXVA 5FTKA 2ZXEA 2XGSA 3JQDA 1TT5B 1WTAA 3PX3A 4MQLA 4NBRA 2GM5A 3JQGA 4L3WA 2FSSA 4D80A 3EPHA 1B8OA 3C39A 4JHXA 1AK9A 3RHTA 2DWQA 3RU9A 4CI9A 3LV8A 1E6LA 3NV9A 3MA0A 1JA0A 2HSDA 2Q4OA 2C7QA 1FX0A 1MXFA 3ZGOA 2VQFB 1LFAA 1Z4JA 1BX3A 4HTFA 4IIUA 4LOIA 1JR3A 1TQ6A 2BDUA 3PLRA 4FILA 4LN1A 4NPAA 3REQB 3UQYS 2G5PA 5IT4A 3E9RA 3HXOA 5HJEA 3ZWBA 1MENA 3KEMA 4HCJA 1YZFA 2XNKA 1TI7A 4LXXA 1B00A 2E49A 3LT4A 2XMGA 2BR4A 3IGFA 4M0DA 2I6XA 1G9SA 2OKGA 3LBAA 1VL2A 3ABZA 4IX9A 5JH7B 4Y2SA 1D4OA 1DE0A 2QN2A 3GEMA 2HBRA 3CVXA 1UDBA 4P3YA 4PFSA 4I99A 1SULA 3LQ4A 4GOND 2B21A 2QTLA 3HFSA 4LZZA 5I7AA 2PHZA 3CLSC 4EG4A 5I9BA 3UO8B 1OASA 1OAAA 2GBLA 4XR9A 5K4AA 1IVYA 10MHA 2WFMA 5FO0A 3ZZUA 2OM6A 3JY6A 4RK1A 1Q0ZA 3N8IA 3NM4A 5KMGA 4NABA 3EZ2A 2DR2A 1D9XA 3LBHA 4PCLA 1O95C 4EM6A 4JOCA 2OCPA 2O8CA 4GC5A 3QUSA 3WQQA 4LJ6A 3EVTA 2BOVA 1XIVA 4IIJF 4MZXA 4M98A 4XQ9A 4KDEA 2ZE7A 5JNWA 1QCCA 3DJFA 3ZCSA 1U80A 1E1CB 3KJGA 5F9MA 1G5IA 3SF8A 2FE4A 2CMHA 2VJKA 1PG0A 3CNHA 4KQ9A 3H16A 4ZREA 3IDFA 4H9GA 1SURA 1XKQA 2R85A 3O75A 1V9SA 1YR3A 3Q8WA 3R4VA 4NU6A 4PTZA 4QXRA 5DTEA 1DQNA 4D8VA 6NULA 4R2LA 5IYZA 4JOQA 4AIRA 5AUQA 1UFKA 1X94A 4ED9A 5HJ7A 2DT5A 2C7RA 5AW5A 1HR0B 3CUSA 3OEHA 4FXPA 1W0JA 5B57C 1YL5A 4F93B 2P41A 3ENKA 2FLWA 4M9CA 5EMHA 1O7JA 4B81A 4XR4A 3AVQA 3WIEA 1H0RA 3MN1A 4POOA 5A4FS 3OTQA 3W3AA 4RW0A 5EEHA 1PR3A 1H2BA 4JJGA 4ZKEA 3ASVA 2JFNA 3KD3A 4BLTA 2FJPA 4HDOB 2F8SA 5BWMA 2FMUA 3IX7A 1WUKS 1LBEA 3QVGB 5LUBA 4KR9A 2B92A 3HKBB 1PZGA 1SBCA 1YCFA 2IL1A 2Q45A 3L8GA 4J16C 1FFAA 1K7CA 4JVLA 4QJ3A 1W93A 1E4EB 5TMBA 2JHPA 4C7XA 5LYJF 2RI1A 4TYPA 1PFKA 3JXEA 1ONSA 3Q1LA 2GYWA 5EGNA 4ZCLA 4QWMA 3FF4A 2IOFA 4HAWA 3VZPA 3EIWA 1RLUA 3G2HA 3MFYA 4RHXA 4RZSA 3C6QA 1LPSA 3NFYA 5E6SB 3WY9A 1UXHA 4IFTA 2A92A 2YDYA 3OEYA 5FQOA 3JAWB 2QJWA 1LI5A 3FD8A 3RBZA 1AZLA 4MV1A 3UHFA 3C4JA 4K9DA 4DTCA 1SZPA 5G4KB 5CBPA 2B1QA 3B6EA 3FF1A 3MIIA 3I6ZA 1Y42X 3PNBA 4FP9A 1YS4A 4U3JB 1VCMA 1ZGBA 4Y6OA 1J8VA 1P73A 5I45A 5EEGA 2GVNA 3JRWA 4M0FA 5JXJA 5KC8A 1MMFB 3IV9A 4KYUA 1IUKA 1J06A 4B35A 2SECE 1CP2A 3IKLA 3JV7A 1PJBA 2VDJA 4LXUA 4XDHA 3UK1A 1P1JA 3NXSA 2VUTA 3BWCA 3GC6A 2FPIB 3DMTC 4S0XA 4LMBA 4IVNA 3R5XA 5C8VA 1C2TA 4V2IA 2AMLA 3L1UA 5JMWA 4PR0A 2GN9A 2ZYDA 2VDQB 4FWBA 4F4UA 3LWDA 1YL7A 1EFDN 3MMZA 3HTXA 4V0LA 1DHRA 3QJ5A 5HJ5A 3COYA 2GXUA 4KMOA 4PLYA 1XXHE 5JLJA 1L4KA 3UH0A 3AI1A 3BXZA 1B42A 5AM2A 1K68A 3Q0EA 3QLVA 2W2VA 5KNBD 1D1QA 3IKMB 3KCQA 1H0SA 3RT1A 1V1MA 5KDDA 5KNBH 2PR2A 1ISRA 2WT8A 3ANNA 3ORQA 1ZIDA 2R7AA 2BZ0A 3LYLA 1Q7BA 1N0HA 3OT5A 3TM4A 2BFFB 3F5SA 3FSJX 1EX6A 2P8JA 3P94A 3EBPA 4OOEA 4UFPA 1SKYB 1W76A 5A5GA 1NP6A 1ODSA 1GSAA 5TQJA 3T99A 2HWUA 3T95A 2BFEA 3M4XA 4DPLA 5KTYA 5FI3A 2CE7A 2DWUA 5AVWA 1KS2A 2HTFA 2O8EA 2C9DA 2L0XA 4O2AA 2I4NA 5C2JB 2D6FA 1WSWA 2YXPX 5CA0B 4I4TB 1NVFA 1W5AA 1C8LA 3FLEA 3ZLBA 2JVIA 4NJOA 4E32A 1NP3A 3SQLA 1W4ZA 5ITSA 5A02A 4JC8A 2Y0PA 2W2XA 5ALYA 1Q0SA 4H4CA 1MEEA 4YALA 2WM9B 4CN9A 3IC5A 4V0OA 1GTMA 4F2HA 1LI7A 3GJZA 1GG8A 2AFHA 3MTAA 4NEGA 1QQBA 1SQ0A 2C5AA 3DVAB 4AS3A 2PMDA 3AFMA 1E3TA 3FOWA 1KPHA 1Y8RA 5G40A 1YA8A 3EGXB 3G13A 1Z7WA 5JW6A 3FAKA 1W47A 3IEPA 3N53A 3HXLA 3ZJYA 3M4YA 4BRZA 2O50A 4HNHA 3ETLA 2QB5A 2G71A 1X1AA 3P9NA 4BDSA 3MG9A 3WB9A 4JQZA 1ZJ4A 1TM1E 1KJZA 2CJXA 3E61A 1GZ6A 2MSDB 4Z0HO 4V0MA 5FNVB 1BFDA 3LC1O 5AVUA 1DTEA 3GPBA 1T5DX 3MTJA 3HGMA 1DFGA 1HFWA 1N6OA 5IVIA 4FHZA 5CCXA 1W5BA 4IWYA 3SLGA 5DI3A 4DR3B 3V7YA 5FO1A 3ZE9A 1JI3A 1WKVA 2CNNA 5JAUA 3OT1B 1GZVA 4BKPA 3S5UA 2R8EA 4N47A 1KWGA 3I5YA 3ZJUA 3KT6A 5IPFA 2QGNA 4E5SA 1VJRA 1XZQA 4R1QA 4UPEA 4I3HA 3THXA 4Q7LA 3MGBA 1F3LA 4U7GA 3OCUA 2C92A 3W1VA 4DJEC 3FTEA 2BRUA 2P9CA 5IMBA 5EWLA 4M22A 2RHMA 5J4LA 4G9EA 2C5BA 4QREA 3E22B 3O21A 3ETEA 3TTWA 3D0RA 3L82B 4GR4A 2ZUDA 3L02A 3L41A 2QROA 3SEQA 2GM9A 3EFHA 4GGPA 4LYJA 1Q6YA 2GF2A 3ENVA 4MV9A 1SXIA 2WAYA 3L04A 2UU9B 3SC3A 5ULLA 3MUFA 3QVWA 4AJIA 1ISJA 2V7TA 3CVJA 3KEGA 4QPDA 3IUQA 4P4LA 4U2GA 1OYWA 4O3MA 3A1TA 1IPHA 2ZRPA 1I7SB 3OZBA 3RSGA 3WZ2A 4CF6A 4F2DA 2EJCA 5K09A 3HJUA 3C16C 1H69A 4G8BA 4LTDA 5D3MA 5DVZA 4V2UA 1ABFA 2E89A 3SDBA 4B2LA 2PRIA 4HGNA 3OCCA 2OK7A 4XYBA 4EGQA 2CL5A 1LGYA 1JIJA 1IJBA 3C43A 1GUZA 1VFPA 4CV1A 3GLHA 4F72A 4ETNA 5HVNA 5BWNA 1GD1O 5L6LB 1BIFA 1AT1A 2AFRA 4NQZA 2GS9A 2DQKA 2HGZA 3CKLA 4ZVLA 5KINB 4B3GA 5T3YA 3DM5A 1WUJS 4XPIB 1XTRA 4G0WA 1JDVA 5BV1A 4YEDA 2W2MA 3PDUA 4D9NA 1OXUA 5B1HA 4DV0B 1J0DA 2FSUA 3NJ4A 2HLHA 4UDYX 4TLEA 2B4YA 4M0CA 4A8JA 2JB9A 5G3YA 3LZCA 4TTVA 5CVEA 1V39A 1L5NA 3GCDA 1KEEB 2XOXA 3ESRA 2X7XA 1E9FA 1GGEA 4II3A 2JJ1A 4LK2A 3THSA 4DLXA 1X7WB 3EGOA 1ND6A 1UMDB 1GN8A 4W5JA 4EYGA 1FLAA 2REOA 3UJNA 2H11A 2V7XA 2EZ8A 4OUDA 3QKRA 1Y1LA 1JECA 3CZ9A 3F2VA 1MT0A 4Q4DA 5ICEA 2V7BA 4I5FA 1NA5A 4B7CA 5H4HA 3OP1A 3EB9A 3ML1A 2OXCA 5DGTA 5HCUA 3BEOA 4BX8A 2PFKA 3IELA 3QKTA 4IKPA 4E22A 1EU1A 1G5HA 1YXMA 2QVBA 3JW8A 3AKEA 4P6VF 4AN0A 1Z5UA 1W8DA 2ATIA 2ACKA 2OBBA 4FE7A 2Q5EA 2BP7A 4HR7A 1MFZA 3ZI4A 4E4TA 1R9MA 1EVJA 3TQCA 5A62A 1SQFA 2HIMA 3OAAD 4XSGA 5DHAA 2QX4A 3MWYW 4LDRA 5AM4A 2R4UA 4LOKA 1PLJA 4ZP1A 5JDCA 2XMSA 1P1BA 1HURA 2I71A 2VSQA 3D4OA 3K1ZA 4S1TA 3ZNQA 1P0PA 2BMWA 4X3OA 3DMPA 4ZCTA 5IK2D 1RQNA 4EB0A 5IANA 5AW3A 5ERXA 3OLYA 5KX5B 1W4RA 4MQFA 3C6KA 1K5HA 4DLKA 5ELXA 3SK0A 1TK9A 2AVNA 3O83A 2G36A 2BEKA 4RTJA 1AKMA 1GNPA 1VYVA 2EJVA 2QRLA 3GH1A 4RE6A 1JIUA 3VYWA 3H2BA 2A84A 3KSAC 1DIOB 2JGNA 2EQBA 4G8CA 2GEJA 4I6GA 4G3XA 4GZ5A 4J0KA 2QF7A 2VUSA 1KYYA 3AHGA 1MX1A 1C0IA 4ABYA 1R4ZA 2GRJA 4EMUA 1J33A 1RWWA 3UY4A 4B47A 5HK9A 1DUSA 3TXYA 1VYUA 1JIVA 2GN2A 1GQYA 1Q15A 3PXBA 3FNGA 4PHFA 4ZOAA 3Q72A 5LQKA 1AO0A 2F3TA 1SA0A 1WMEA 2YYZA 4Z4IA 2OQIA 2OWDA 5E9JA 4KIJA 4O2BF 4W7HA 3PQFA 1JKXA 4WXEA 5F73A 2G4VA 3HG7A 1TQ8A 3GVXA 3SWWA 3MRTA 3UWKA 2PU5A 2EZ9A 3NBZC 3P9YA 3UMBA 2PGNA 3WNQA 4OHYA 1DJPA 3OZ7A 3SBEA 4V24A 4AWAA 2A5YB 3A1UA 1K8QA 1GKLA 5IJ9B 3DZFA 3SS8A 1F4PA 1E2KA 3LHIA 3SC6A 3TNFA 3DO6A 1Z06A 2ZBDA 4B32A 4DBZA 5K6AA 3I52A 5AH0A 2ET6A 1V41E 1U9IA 2BI8A 1Y7TA 2FH5B 3OFND 5C8XA 2ZROA 3P20A 1RLIA 1F8YA 3LHSA 3U80A 3ZZNA 2FFBA 2GESA 5AHRA 1IN7A 1U90A 1ZLYA 2R3SA 2DP4E 2ZJOA 2WG0A 3HBNA 2P4SA 3UMRA 1OGJA 2Z2IA 3BFJA 1U1CA 3JQ7B 1WVIA 3KZKA 4LNHA 4TLDA 2W6OA 5TGTA 1XTJA 3ZWDA 5L4NA 2ZUVA 4FEAA 3ILXA 2LVBA 1ZK0A 4GI7A 3O3OB 2IZ5A 3OD5A 3C7CB 2HT6A 4PU0A 4RFLA 2PGIA 1DC7A 3BFVA 4HDRA 1UBHS 3E5RA 4GZ6A 1I3CA 3HY4A 4RKQA 3RANA 2HTEA 3AKYA 4KV7A 1A9SA 4Q4AA 1EK6A 3PUHA 4WNIA 4QUDA 1T36B 4PZEA 4PX3A 1GRCA 4LFCB 3QX8A 4HFJA 1OI4A 2XUKA 3D2CA 1U8TA 5EVJA 4Z6KA 1IDN1 3HCFA 1JR4A 5ITWA 5HKKD 2RJOA 2VDKB 4PLWA 3T7IA 2RHBA 4G1UC 4KB5A 4FYVA 1W73A 3P0HA 3PBKA 5KNBA 4OJKA 2ORVA 3B5JA 2H65A 3IEXA 4OP3A 1ZGGA 4QGSA 3VMFA 1FQOA 5E6RB 3ILVA 2YYSA 3JD0A 5JSYA 3PYXA 3BAFA 4A7PA 4EW3A 5EJ4A 5IWAB 3WAJA 3D8BA 4G0YA 3BGDA 2OVFA 2IQIA 3WKEA 4XKJA 2PG3A 1SXJB 1T4CB 1AHHA 1BH6A 1JKJB 3IYLW 3PV0A 3OU7A 4FQ8A 4ZU1X 4YAGA 4NHOA 2JLXA 1GFIA 3K0AA 1KJIA 4N8EA 1PUXA 4EAQA 3V3TA 5MHTA 3MYYA 1WCXA 3M6FA 1NUSA 2ZIAA 3R5HA 7MDHA 2ZK7A 1ZMRA 1T9GR 4TRJA 4BKMA 5HPYB 1G60A 3KQWA 1KI3A 4GXRA 5JE8A 4MS1B 3DV0B 1A9ZA 3AUTA 2KSQA 2PK3A 4XDZA 5IDVA 5LLTA 2MMGA 3GO4A 1FFSA 2D2EA 1EFVB 1KIFA 1VRWA 2EEZA 1D07A 3PEVA 4UOZA 3VH2A 4DGSA 3EQ9A 1KMCA 2FZVA 4WKOA 3QBTA 2CDBA 3IP5A 1F6WA 3NAZA 3WIBA 4UTZA 2AJ8A 4Z0TA 5IAJA 4IIHA 5KI6A 1O0BA 2E85A 4UU1A 2E18A 4X94A 4CCAA 3H3FA 4J0HA 3THYB 3ANTA 1PD0A 2AN9A 1WD7A 5AKIA 5CDFA 1GPWB 1WSBA 1TGVA 4XUEA 4ZAZA 4LZNA 4B5KA 3PD1A 3C85A 3Q4GA 3T3DA 5KYXB 2G3YA 3N6VA 2ZT6A 3DKIA 1JFRA 3SEZA 2P68A 4AJKA 4DIDA 3ZW8A 1T29A 2XGGA 3U16A 4RTMA 3GP5A 3KPJA 4LNUB 4MWDA 4NZPA 3TI9A 4DAOA 3P2IA 4XIIA 1QH9A 5C81A 4GGOA 1IN5A 3QMWA 4X1KA 5DBEX 1PG2A 1QVVA 3AF2A 3B3GA 4L0DA 2IUEA 1G21E 4GWGA 3AJ8A 1PJ3A 1E3WB 2GDJA 3G2OA 2MMCA 1NL3A 4EB8A 3ZVMA 1OFUX 1JVBA 1Z7YA 3GHYA 5GVRA 4N7BA 3UAOA 4J49A 5M34A 3DCNA 5KKCA 3NJ8A 5JRDS 2ZDHA 4EJ6A 4OB7A 4EW1A 3FVVA 1FJHA 4N76A 1NY5A 3KB6A 1O96A 2AHRA 2QVLA 1T2DA 4MJ7A 4L5YA 3WJ1A 2IHNA 4EG6A 5AJTA 4EFDA 3WB2A 5FLEX 1RAGA 2BGJA 2I22A 4UHHA 2BWJA 3UXYA 1JH8A 2WYHA 5K03A 4WOPA 3GGPA 4EEZA 4C7MA 1HDOA 1DRKA 1PS0A 1I9CA 1P5JA 2CLDX 3BXXA 4X85A 3EH2A 1XQVA 4D0LB 4D81A 1TX4B 2YOGA 2TRSB 3VO2A 4Z9FA 3WHKA 4BQQA 2EZ4A 4RHYA 5NLLA 4EQ6A 1IEXA 2VQ3A 1A2QA 3GIWA 4JELA 2OLKA 3IXMA 4QNNA 4CM5A 1Z6GA 3F6RA 1QHEA 4QOHA 5CTAA 1EXWA 2OV6A 2WAOA 4XZ3A 1ZK4A 4KQHA 3Q41A 4BFLA 1Q6ZA 4F4IA 1QH0A 2TMKA 4BVFA 2PX6A 3TTVA 4HEHA 1GFZA 4RBNA 3CHYA 4KBGA 3PX7A 2ZBPA 1ORDA 3I6IA 3AEQB 3RUFA 1SVLA 2WQ7A 4NOJA 2QN1A 1P2TA 5ITVA 3CEAA 5CT5A 5A9SA 4ACAA 1EQAA 2ID4A 3T1HB 1VSUA 2UYQA 3WP0A 3EC7A 2V03A 5BWLA 2MYUA 1PSZA 1XLUA 2XXJA 1MFPA 3TLGB 3TZLA 1TVKA 2OFWA 1P2DA 5CG2A 3K70C 3D81A 4F38A 2UZ4A 2WY2D 1AS3A 2PGXA 2OO7A 3HZRA 2YHUA 4BJ3A 1EX7A 1DRJA 3B2QA 1H6AA 4P38A 2BCEA 2Q1SA 3MBKA 4NK4A 3EIEA 1TYBE 1LW7A 1L6RA 1I6WA 2XMDA 1JGTA 1V37A 5DKFA 4FKBA 3B52X 2BHRA 1F8XA 1GL3A 5ALUA 821PA 3OI7A 3F67A 4CNBA 3ANLA 1K97A 2QUAA 3QBVA 3Q7IA 1CWUA 4Q9JA 1MV5A 3LQYA 1OC4A 5SY4A 4CM9D 3A11A 1BCSA 2QE7D 3ZHRA 1T1RA 1LD3A 4YCCA 3DDHA 2WYUA 1TK2A 3OAAA 4A0FA 2NAFA 4JBLA 4XFKA 4XVCA 4YQFA 1I3LA 1Z4NA 2IIVA 2JIPA 3GCXA 1ONNA 3G2QA 2FUKA 1CV2A 3L5KA 1CQJA 1M76A 4AMGA 5FA8A 4DLNA 4BNDB 3U7HB 4LZWA 1BDHA 3LCRA 1R0YA 3QPUA 5A0VA 4RS4A 2ZRMA 5AXBA 5IK2A 1FJXA 3MMNA 5HTOA 4N3CA 1C3JA 3HCNA 1GOTA 1SK8A 1OFUA 5K3FB 5LA6B 4CKYA 4JB2A 5JECA 3VX4A 3O8CA 2XB2A 2XW6A 1QANA 4GKKB 2DAPA 1P19A 3NBAA 3TSAA 3Q10A 1LLDA 3Q6MA 1NMEA 3VDXA 3HZHA 3MOGA 2IDJA 1SOUA 3THOA 1QE5A 1YI8A 2AD1A 2E9SA 2W43A 2XVXA 2Y1LA 3F6CA 5FWXA 5B37A 1E7MA 3L46A 3DBRA 4TPKA 3WWZA 3IEVA 1W9HA 1H6BA 1R4MB 1WXHA 1YU9A 2B2CA 2WA2A 1U2QA 3CWCA 4X66B 1II9A 1OX4A 2Z1NA 1SAYA 3LX4A 2J3KA 5JXHA 1U3UA 1BA3A 2FU5C 2GI4A 4NOMA 4HVCA 1EJBA 2JPDA 3LT5A 4OB6A 3PNPA 1YDEA 2EYQA 2O05A 5HWSA 4E21A 1L8AA 5HQ3B 1HZZA 3QPWA 5CURA 3GFFA 4HYEA 3LXXA 1YHYA 2B61A 3UCFA 1DO2A 2ZVQX 5CD1A 1HNXB 3OCWA 2Q5FA 4WECA 5L8VA 4BN0A 1JDSA 4I55A 5AJVB 3GLFA 1Y3FE 2MSCB 4NNJA 3S2ZA 3TL6A 3VMMA 1CUAA 4CF5A 1GTSA 4CIWA 1BZYA 2ZZKA 1T8RA 4DXHA 3BB1A 2VP5A 4N48A 1G63A 1OR8A 2I7TA 3F90A 1B1CA 1NW6A 2OBFA 4I14A 3V7WA 2A4KA 1TW3A 3VUEA 2AZDA 4KUGA 5LXTB 1L7OA 2DE0X 2YWFA 4ZXPA 4URXR 1XEXB 3P9KA 1LC0A 3CH5A 4HNGA 2YRXA 3OFNA 1YTLA 4LHSA 5BSWA 1TTTA 1UOQA 4WBNF 3D5QA 4JUIA 4J16A 5DO9A 4E70A 1C0LA 1SVWA 1AMOA 1WHTB 3EZNA 3OY7A 1CY1A 4YRQA 2PRJA 3RKUA 2AOWA 1TVMA 1HLFA 3F71A 1SVNA 4KE6A 4OY3A 2HT1A 3FMGA 3L7KA 4J7CA 1H8ED 1CS4C 1MPTA 3QY0A 5DX8A 1UBLS 1RHKA 1PK9A 3B13B 2OCIA 1HLDA 3GUYA 3OECA 2IUSA 4PRLA 4X00A 4CUKA 3L0DA 4OI4A 1ODCA 3FLMA 1QO7A 2DBYA 2HUPA 1FIUA 4EYEA 1EDOA 4XCXA 4KITB 3ADDA 3IPRA 4YS6A 3IHTA 3WLLA 2NZJA 1D6MA 3EWAA 5IFLA 5DTQA 4E07A 1X1CA 1JP7A 1VKHA 2HUNA 2P5TB 2R7NA 3VJLA 3QRWA 1OROA 1GL7A 1R5NA 2V3WA 5IKPA 4UOQA 4UBKA 1LQ2A 3NVKI 3W05A 5E1BA 4I81A 2Q0XA 3BCUA 5HKKA 2MSWA 3H4MA 3Q2KA 2I3AA 2AXQA 5KO2A 1QQ7A 4LRXA 1W87A 1L4MA 1NI5A 1XLTC 3FY4A 3N8GA 1I6LA 4LMPA 4AY5A 3GUVA 3OA2A 2QDXA 4RESA 1KDYA 2A86A 2AN4A 2JEZA 2ZR8A 3KVNA 3D43A 4CQMD 1SXQA 4TQAA 5B53A 4U7WA 3AJRA 4ARUA 3FHCB 3PGLA 1MHTA 4R2XA 2ZRIA 4UC0A 1XTIA 1PJZA 4KQXA 3AUKA 3T3EA 4QQ8A 1G8AA 4GUAA 4HEQA 1CC1S 1ZKMA 1GNSA 4UUNA 3HDVA 2JD1A 3ZW9A 1IONA 1WVGA 2C57A 2F3RA 3EXG1 4TL6A 4REOA 5CR9A 4O1IA 1NQXA 1EFLA 3SF0A 3QUTA 2GCOB 3AR7A 3EMKA 1V1RA 1RM4A 2XEXA 3MQ2A 3OPQA 4G1FA 4DWOA 5MN5A 3SZMA 1KFBB 2R6FA 4IUYA 2QTVA 2FR1A 2Y05A 4JZKA 4U6SA 2ZSIA 3B1KA 3PDIB 4YRDA 2AG1A 1KI8A 1W2HA 4RLSA 5C31A 4PXAA 1DP4A 1GYPA 5BUCA 2R79A 2HB6A 3FBTA 3O74A 1CZUA 1XU9A 4ROSA 2ZYHA 3WWPA 3IBSA 3G5UA 5CNIA 4ZYXA 1FMTA 4CLOB 5CFMA 4QJIA 1TFRA 1N5LA 2B9EA 4IOMA 3FCUB 2WUWE 4FR2A 2IYFA 4JB8A 1C9JA 4BPRA 2RHRA 3CG4A 3E15A 3GLRA 3H4TA 3AEUA 4LXIA 5FULA 1VCIA 3GJQA 1CIJA 2I5PO 2L42A 3A1NA 2O1SA 3B70A 2WTAA 2ZJ4A 4Z4CA 2DQYA 1Y9JA 2ODBA 1DCFA 3AEZA 4GMXA 5HG0A 1KYXA 4RUKA 1IOLA 3TMAA 1EAMA 3I1YA 2XSZD 2PVCA 4KIWA 4NX2A 4INAA 5T64A 2ZQ5A 4UASA 1PV1A 4GLOA 5AJWA 4R7ZA 2FG6C 3BH7A 1E2BA 3BC1A 1O3YA 3O3CA 3ZDDA 3FRIA 1NUUA 2QLLA 3WK6A 2PBFA 3A58B 1Q84A 3DMHA 3PEUA 3MWFA 1GGFA 4K3UA 5EG5A 4BQOA 5KJ1A 1XZCA 2F3SA 5D51S 5DNUA 4J3NA 4KNWA 2JFYA 2AXNA 2ADOA 1PT8A 2WSIA 2XZDA 4C6SA 1LSUA 3HKCB 3D6AA 3JASB 4ZC8A 2WJ4A 3D2BA 4Q4JB 4AZWA 4BGUA 1AA9A 5JCOA 2FFQA 3N2LA 5I7SA 4N40A 2D4HA 2XUAA 3GLIB 4GSKA 1CJSA 1FUEA 1NU8A 2QL5A 1AD2A 4EGCB 3OCXA 4HG2A 4X84A 3EG5A 4HYTA 4Q6BA 4RAQA 1OI3A 2GPBA 2H59A 3R8FA 1L6IA 4R3NA 2GCPA 4EG3A 5KTRA 4IV5A 3DUWA 1B6GA 2VJNA 2AYXA 4M6WA 1BGVA 2PXAA 5H5JA 1FPMA 2V6FA 2OGUA 2WILA 4CR8A 3QX3A 4G24A 5JD4A 2XHEA 5IN4A 2BM9A 2O2SA 3G79A 3OE5A 4RHEA 3UIEA 3SXUA 5BYKA 2OAGA 5B36A 2H3HA 1QG6A 1KJ8A 2D0DA 1LLFA 1F2DA 3FFAA 3R0IA 1ZC3A 3PEEA 3SY8A 2RE8A 4D8TA 3FUUA 4MVJG 4BU1A 2HKIA 3W7VA 3NOXA 5BRNA 3NVAA 1E3IA 1MNAA 1QOPB 1VE5A 2AJDA 4QO8A 3U48A 3RR2A 3MD9A 2FHPA 1UBUS 1BSVA 1DHTA 2NSLA 3G6WA 4RMHA 3KQUA 4HH3C 1ZWLA 1NI4A 1MT3A 5CX4A 1Y7PA 5CFLA 4HB0A 3MJVA 4M54A 3I4FA 2CGEA 4K6HA 5ALNA 2RH9B 3LWZA 1NN1A 1U4OA 3SYLA 4R1UA 1U0EA 4G0UA 2C00A 1U28C 5DRTA 1J2EA 3AHEA 1OI2A 2RH5A 4JGGA 4TMVA 1GU1A 3VSCA 2X86A 4OQXA 4RJKA 3VBCA 1R9NA 1U3VA 3TD6A 1HDYA 3DTVB 2QP9X 3WL3A 3DNMA 1UC5B 4QBGB 3K96A 1E3LA 1H9AA 1OWOA 2WUEA 3FA2A 4PC3A 4AXBA 3QKSB 2GDZA 1UMBB 2LV8A 2IYUA 4A23A 1S3SA 2IE8A 4KAXA 4B43A 4DXDA 3AUAA 4OLBA 3Q88A 4ZK6A 4MRSA 5BMVA 3ADKA 1GUDA 3OUZA 1E6UA 5I7FA 1IQPA 5F1YA 1TC1A 2HK7A 3JS5A 5MGBA 1WJGA 1ZIOA 1XPUA 4F1JA 1W52X 1VA4A 2QW0X 1SGWA 3W8EA 1V8ZA 3Q11A 4F3YA 1W4CA 1T43A 3CIFA 1X8LA 1XTKA 3P97A 4L0CA 4XARA 2ZUCA 4Z5XA 5BPFA 4MRMA 3DHYA 5GAJA 1Y6FA 3R8XA 2C97A 2MCFA 4CM9A 1ISPA 1ICEA 2FW8A 2GAFA 4YV2A 3FDFA 2QE7A 2RGWA 2IIBA 3DOCA 3N2KB 3LLVA 4PYMA 4PX5A 4GHWA 1FS6A 1ZDMA 1TZ2A 5AM5A 5EWJA 4D9BA 2WG1A 3V46A 5K8IA 4CMIA 1K0FA 4MR8A 2IYWA 2VXBA 1C7QA 3AGQA 2GD6A 5BMOA 2VWGA 1YRBA 1TJ4A 2R6GA 2BI4A 3FFXA 4IEFB 5M5BA 2QTMA 3KKMA 4JBXA 3LNCA 2QNBA 4HYQA 1LNSA 4WNYA 4PZZA 4HGYA 4MV4A 3G5LA 2P9JA 4R9NA 3PFNA 5IN5A 2OZKA 4ZT2A 1H93A 5FH9A 3VAAA 4JT9A 4U7HA 4OP1A 1HT3A 1R00A 2JFZA 3EZLA 2DGDA 3CR8A 3CLRC 4B6QA 2WDZA 3UMGA 3REOA 2BONA 2VTEA 2J9RA 4S1NA 3IDSA 5KOJB 5CM9C 4OH7A 1H3EA 3LXRA 3HXPA 2ZBEA 4J7XA 4MWTA 1GVHA 5BYJA 2GFHA 4TKVB 6Q21A 2XBMA 3QVSA 1ZK2A 4PAQA 4TQGA 4V3BA 4I9GA 2UZAA 3SDSA 4YUWA 3WOVA 5AKKA 5JSZA 5C37A 3U40A 5AHXA 5CVTA 1U4SA 3BFPA 3UICA 4YXWD 1P62B 3ELYA 1E79A 1S4QA 2GEVA 3EZGA 1VB3A 3FZQA 4MUAA 4POAA 4O2AF 2ZTSA 2G1AA 4ZQHA 4KX3A 1DI0A 1IRXA 3C3AA 3SBDA 3MWEB 2IH5A 1EVQA 2NUAA 3G7NA 4E6EA 4DDKA 1JXQA 1WCWA 5AW0A 4U2KA 2E6KA 5E3IA 3ROKA 3ZHCA 3TW8A 1L8QA 3GFGA 2I1LA 3BEDA 4TT3A 3CYFA 1AUVA 2C4HA 2V8BA 4QUJA 5JHGB 3VZCA 2YVKA 4FEGA 2VATA 4AY3A 4PPGA 1UKEA 3THWA 1X0VA 1CUHA 1HQDA 1PHPA 1E2UA 4JC5A 4AQDA 2VDWB 2LDXA 1QIEA 4RK0A 3LY9A 4D6YA 3EODA 4EJSA 1COZA 4DLWA 2ALJA 2OY0A 1DMSA 2QUIA 4X5OA 2K5UA 3KHSA 2W6QA 2WZBA 3KJNA 3BWYA 5E7QA 1J90A 4BNUA 4C20A 2PMCA 1XRPA 1NTOA 3HVRA 2C3YA 5EQDA 2OXRA 4RHFA 3W5IA 2OCYC 2H7CA 2R47A 4OGLA 3H7IA 3UFXB 2P7IA 4M21A 1JHPA 1ZA1A 1L5VA 1C4KA 1JIXA 3NYQA 2CMKA 1H2FA 2ZYRA 3UCEA 2C54A 1H8EA 1G5RA 1NMSA 2HK8A 3ZCRA 3WLQA 4WLUA 4JLOA 1RJEA 2Q3JA 4CFSA 2I33A 4PZYA 5JS7A 5AVTA 5JBQA 4OOFA 2G1UA 2RB4A 3K8OE 4CKCA 3T3NA 4JUBA 2PWBA 2YC4C 3RUHA 3GPLA 2IXEA 3R9XA 2VYQA 4WFKA 4CQJA 3W9SA 1ZWKA 1K6XA 1E9AA 1VI5A 1FSSA 1DC6A 3ZTWA 3UHPA 4HVTA 2RAPA 4W5QA 3O1JC 1OLSA 5ARBA 4WKGA 4ALNA 1E1CA 4YMIA 2O0KA 4M1EA 1U2DC 4DW8A 4MLDA 3IO5A 4CQMA 4EPWA 2DWPA 1UM8A 1XMJA 1IMOA 1EUDB 3A70A 4BQEA 1RP7A 3FPCA 3ONEA 3LT2A 3H97A 1EFKA 2PLNA 4F97A 2VDVE 4HDNB 3GNLA 1RYDA 5LOVA 1EBFA 1M6YA 3EUEA 4TM7A 1CRZA 4ID3A 3CURA 1JMVA 4DQKA 4R6XA 2DPGA 3JVIA 1I4TD 4JNKA 2Q7DA 3TW6A 3SQOA 4OI2A 3BE6A 3JQ8A 1YF3A 4CF3A 1XC7A 2GXSA 3ROGA 5FBWB 2GZMA 3W6ZA 2A33A 3G68A 4BNWA 4Y0NA 4BLQA 1XXHB 4B9AA 3S2SA 1FXSA 5H9WA 2PZ8A 2QXUA 1MW8X 1G55A 3BHJA 4LOJA 3HMQA 1O89A 1LNZA 3T7KA 4C07A 2B5VA 3Q5DA 4BB5A 4ZI3A 5JDIA 3VI4B 1M8GA 4Q1CA 4FT2A 2V98A 5ALGA 5LZ8A 1JZTA 1ZOSA 2IODA 1HKHA 2C3UA 1OQAA 2WJHA 3AR8A 4TVOA 4BL5A 4EJMA 2PUVA 2FWAA 3ZW7A 4XPZA 2ONCA 3Q0IA 3AF3A 4KQ2A 4ZFNA 3GVIA 4JA0A 2QTZA 1AS2A 1E2DA 4Q37A 3KELA 5JQWA 4I50B 2V0CA 2XLBA 1XEFA 3KJQA 2XSZA 2CJFA 4NJEA 4F8YA 2Q27A 3O8LA 3UHOA 3S55A 1UCFA 4DC9A 4UTRA 5JNVA 3DKPA 1LF5A 4NATA 2XMQA 2XY4A 4IGIA 1GTVA 1TGYA 2KB0A 4B1FA 1KO8A 2JZNA 2VT7A 2Q7XA 3H83A 3OOHA 5G53C 5K0LA 4JROA 3FGZA 3VR1A 6PFKA 3CX8A 3G59A 4DMKA 3RRMA 2EZTA 2GPJA 3MCWA 1OGYA 5AWFC 5LQSA 2B8TA 4OGKA 3PK0A 1QZUA 2CCJA 1X13A 2GWRA 2GUWA 4HRVA 4UTNA 4ZICA 1Y8QB 2DQZA 4ZQCB 3ZDFA 1FUIA 4ESVA 1N78A 1YZYA 2RKWA 2VPWA 2Z30A 4RKEA 1XNJA 2Y4NA 5L95A 2XTMA 1MC8A 4L1KA 1J70A 3EG9B 3K9BA 4C5CA 1C1YA 2QSZA 5CXQA 4X1IB 4EF6A 4OI1A 3AFIA 4J1SA 2VH5R 2HHLA 1TZMA 13PKA 2GPTA 1A7AA 4MQEA 1QONA 3HK2A 3SJUA 2JH9A 2VF5X 4TRMA 4IO0A 3C6ZA 3MXTA 1DEKA 3ZI7A 5IF3A 3WQSB 2CUKA 3DYVA 3JWPA 2IH4A 1ADBA 1Z5OA 1SXJD 3KTFA 1L7NA 1S96A 3E4DA 5EA2A 4TS9A 1AHPA 2L17A 1HNNA 1VPLA 1GQSA 4BWYA 4ZCRA 1Z36A 3PRYA 4FT4A 5AI4A 5BNIA 2Z8ZA 4GP7A 4NBKA 2AOXA 1J21A 2GZAA 2C3PA 3H1EA 1Y9EA 3W7BA 3JYQA 4IAOA 4MYHA 1DWUA 4EARA 1RI2A 4TXJA 1N3IA 1NXXA 4U02A 2MOKA 2QV7A 5LP6F 3A32A 1NVVQ 2X15A 1A5ZA 2BY4A 4JLAA 4BZXA 3CS3A 4M46A 4XYGA 2C8VA 1OFGA 3OZUA 1TCCA 1HWYA 5HIIA 1IZZA 1CLEA 4K81B 5B2FA 1FW6A 2QTBA 5C9ZA 2GHTA 1UWVA 1KDVA 4JJAA 4YJGA 1UEXC 3EUWA 4OLJA 4TLAA 1IWOA 4ZVQA 1DDGA 1S2LA 4J4TA 2CF5A 1QH1A 2W2TA 3DE5X 3LT1A 1XI2A 4B7ZA 4YLYA 1QU2A 4ARVA 1A72A 2ZRCA 2BHLA 3AYXB 4WXHA 3SQMA 4ZEMA 5K8TA 3UMJA 4J0DA 1SUEA 3FCAA 5A1JA 3LUHA 2OV8A 4REQA 4EA6A 1TM2A 4F3TA 5A1TA 1RRPA 1VSBA 4V0KA 1ZL2A 2WAMA 2ZB3A 2ZITA 1NQAO 4N1AA 4BMVA 3G5AA 4CHTA 5AVZA 2AMYA 1L0BA 1J0BA 3I2FA 4EJSB 1Z2EA 3HI4A 3OT1A 1GKKA 2AV6A 2VP4A 3ESYA 1OXBB 1YJBA 4KH0A 4W6ZA 1XMXA 4DV4B 4IRXA 3NJRA 4MHOA 4PPYA 2OLJA 4L27A 4G26A 1XA0A 4KGDA 5L53A 3AUFA 5EPEA 2CY0A 3O2SB 3NUGA 4B4DA 2UYYA 4NLLA 1A8HA 2PYDA 4RCYA 5HA5A 4ZQGA 4C0LA 1B2RA 2VBIA 2HA3A 1FFGA 5DBHX 1IXSB 1X7YB 1KQOA 4QPPA 4CHGA 4CU2A 5CX1B 1JU3A 1G5PA 3S3TA 3K3PA 1PQPA 5TQ0A 3X0DA 4K0KB 2O5VA 2B4QA 2PZGA 2Z9BA 1IM5A 5ALRA 5TNXA 1JFFA 3NHAA 3LPMA 1W1WA 1KOLA 1SXPA 1QFYA 2E5WA 1UP7A 1BQ4A 5H3CA 2ZRNA 1G8GA 5AYVA 3AVPA 3VVBA 5DGHA 1DX6A 1YZ3A 3SR3A 2ZYGA 3PF9A 4DSUA 2JCYA 1U7DA 1VHWA 4JBNA 4RFVA 5EWMB 4P8RA 4KMMA 1GTZA 1QYXA 5E1MA 4I1SA 4DQ0A 4YXWA 1VP9A 5SZJA 4XRRA 1XVLA 3J7TA 3M6UA 2B2XA 1R0BA 3VDQA 4ERXA 5JADA 3P9CA 4DMRA 1BKSB 1R10A 5DLQC 5TGZA 4WXPA 1U0NA 1T3SA 2BGNA 1TJ5A 1SVUA 2X23A 4QG7A 2C59A 3P9ZA 5DIFA 3DE4X 2JANA 1K7SN 3C97A 2ZSBA 4O4LB 2XUGA 1M6VB 3UB2A 4EYKA 2A5DA 4CDNA 5COAA 2HGSA 5AW2A 4KL8S 2A3RA 4HPXB 3Q7QA 3RRJA 2ZQYA 2EOAA 1Y1QA 2QORA 2IPLA 1P9NA 5REQB 3TZKA 2HK9A 1F4LA 2BELA 4KUHA 4ZT3A 1E9EA 1G20A 1XZFA 3U1TA 3AXTA 4IMJB 3Q7RA 4JYPA 5MFZA 3I6BA 4FOTA 1YCDA 4PRKA 4B6RA 1U9YA 2GK7A 2PXXA 4I9HA 4CYMA 2FWMX 5FPTA 1OLOA 1XRQA 2ZRKA 3SICE 4YV1A 5B1IA 3EUAA 3QOYA 4WLOA 5SYAA 2G70A 1II8B 1SU6A 1XT6A 2C04A 4XQ0A 4YECA 5J5CA 2Y0DA 5DLPA 1F0KA 3VNVA 1Q74A 4IV8A 1E7YA 2FYTA 2HXSA 1JFTA 3K9FC 4LAFA 5LBUA 1AF4A 3R3VA 2NZVG 1KEZA 1O8BA 2I1WA 4FN5A 2E87A 3ZWPA 2XE7A 5EIXA 1JQAA 1K88A 4HFMA 4OLFA 5F12A 4ZDJA 2GCNA 2MINB 3PNQA 4G89A 5ISMA 4W9NA 2JDID 1QIKA 2CFTA 3ICOA 1BOOA 4URHA 2AMFA 4YRLA 3WQHA 4EG8A 5IW8A 1T5BA 3GBPA 4D02A 2J3EA 3EXG2 3KT3A 3QX7A 1PZXA 1QHXA 2ZYIA 3A31A 2NU8A 1SVSA 4GPD1 3A2MA 3S68A 3GG2A 1MU0A 1ZUD1 3NHLA 2GO7A 3OA0A 4NBUA 3TJMA 4ALMA 3WGTA 3P8ZA 5DHRA 1JALA 3ETJA 4GP9A 5G4LA 1MV8A 3VJRA 3WBFA 1U8FO 3Q9SA 2H1IA 2GAAA 3VR3D 1RXEA 1NWHA 5LC1A 5LCXA 1XNHA 4MVXA 3GQBB 5JIBA 5HRCA 1BWPA 1AQLA 1BHQ1 1XB2A 2Q9CA 3M1AA 3FN4A 4L4ZA 5BRJA 4JODA 2XXAA 3UUWA 4TZ0A 1PJLA 3UWSA 3ONVA 3TQFA 3VO8A 3ZU2A 3U44B 2AN1A 3PRKE 4RTQA 1I10A 2Y2VA 2GLTA 4AJEA 3TX6A 4HSEA 3OZTA 3JRXA 3SX2A 4H3KB 1IG0A 1BXRB 1WQ4A 4PTYA 1AA6A 4FWTA 2NOAA 5CK5A 1WG8A 1U98A 3QE0A 1IIBA 2GD1O 1H2HA 1Z8FA 3SLRA 3T1VA 4D96A 4QASA 4C21A 3AF1A 1XN4A 3ADOA 1OILA 4NP6A 2PZJA 4QRIA 2ONJA 5K8CA 1EFCA 2AJCA 1GG5A 2W6PA 2MSKA 4FYKA 4P3PA 1XQYA 3IVRA 1BE8A 4L9WA 4PAWA 4F0JA 2WWXA 3C5VA 1XG5A 4H7IA 1FF9A 5DIZA 3MT7A 1TUIA 1U0FA 3JATB 4BZZA 5DOZA 1E4VA 3NZEA 5IJ9A 1L8XA 2VPYA 2HLNA 5CYGA 4CTOA 5IRCD 3BX1A 3LHKA 4BBPA 3O8QB 4ZAYA 4F6RB 2IDMA 4WOJA 3I5XA 3E8XA 5E95A 5A06A 3PYMA 1I32A 3PSAA 4EHBA 5A7HA 4J7UA 2CFRA 3ZGXA 2BR5A 1WL8A 1QUFA 3U2QA 3M5WA 2VXCA 5CDYA 4MGKR 3QY9A 1HSZA 1YO6A 1X38A 3ABQB 1G4AE 1WDMA 1ILWA 1PDWA 3M5PA 1CUEA 4TMWA 1V11B 2A9FA 3O3MB 3FSRA 2LRHA 4YWJA 4X93A 4D9KA 4X1YB 1KH1A 4E7OA 1Z6TA 2VJOA 4XB2A 4XIJA 1RVV1 2PQ6A 3R5JA 4JR2A 1VBMA 1UKCA 4DANA 1ENYA 4GSLA 2EFGA 4OJTA 5LQRA 1QC5A 1BCRB 3ICCA 1S2OA 4YDRA 4ZALA 1U11A 1TYAE 2JFHA 3CE6A 5JFTA 5FF9A 5K9ZA 2WKQA 1IHXA 2IWHA 3B9PA 1CULC 2PX3A 2O0LA 4HDKA 4IDOA 3UJ7A 1NVKA 5C1IA 2DPXA 1FFEA 3N5CA 4FGSA 2AC4A 2F3PA 5B2ZA 2I4MA 5JWOA 4GX5A 2I6FA 3EPPA 2CXQA 4JAVC 1KHHA 1JQDA 5HF9A 2HY7A 3RS5A 1QRUA 1YJ5A 1VG8A 1MIOB 1GZ3A 4FDUA 2DETA 1TQDA 1Z33A 5TR9A 1U2GA 3RVJA 4PXYA 2V4UA 4Q03A 1GSHA 2WWTA 1Z5WA 5BV8A 3MJHA 2KLBA 2Y1OA 1FZTA 1LX7A 2B20A 2PGAA 4FEEA 4YA6A 4LV8B 4MDYA 1M1ZA 1SXJA 1T4CA 4QWWA 3V32A 3HS3A 3ZHZA 4EYOA 4KO8A 1XR3A 4OQFA 5K3OA 2CNKA 4QBKA 3V8EA 4RIIA 2ODPA 1N3LA 3ORYA 3BB3A 5HIMA 1G21B 4PQGA 2GWHA 4LVNA 2ZBFA 3QA9A 1M67A 3SC4A 3ZOKA 1WWKA 3ZE8A 2FEOA 4RMJA 4L74A 4MV7A 5BWCA 5ICSA 1HEIA 4Y1RB 2HJVA 4R7TA 5H16A 5KSPA 1G7CA 3WGHA 2D4AA 4BMCA 3R7FA 5KQRA 3VO9A 5DCLA 4EUFA 1YQ9A 5E6UB 1NLZA 1LSJA 5BVHB 4BO6A 4HX5A 3ITNA 4IHKA 3U3XA 4PGFA 5IT0A 1OHHA 1XAJA 1NR7A 3IMKA 4BFUA 4DT1A 2AQ8A 3UT5A 2IPOA 3UMYA 5AJXA 2XPCA 3JAKB 2O07A 1PCXA 1I7PA 1VC2A 1F9AA 3GMIA 1K2WA 1XD9A 1XN1A 2JJ2D 1IE3A 3HHEA 4MICA 3DFKA 5TPWA 4AF6A 3GLKA 3ZCTA 4P08A 3VC7A 3FKQA 3NIWA 5L51A 3KIPA 1R8SA 2QNRA 3TIVA 4AJOA 1U9ZA 5KYXA 1DQRA 1M2NA 3PEYA 5KU7A 1A2KC 3MPOA 2JKZA 3JWEA 3LPNA 4QEZA 2VSOA 1EXDA 2PT5A 2CXXA 3V55A 1TD1A 4RPLA 4LNUA 3S0JA 4JI8B 4GO1A 4KQCA 1MRNA 2UUBB 4OA5A 3C8ZA 1HEYA 4ZYTA 3PC8C 3VNRA 2WIGA 4IKEA 2WD7B 4AKEA 1J5EB 2R6DA 5LYYA 2HNKA 3KYCA 4RH3A 1Q57A 1BQEA 1VKNA 3RT9A 1TCUA 4DA8A 1RLMA 3E9MA 3L77A 2GZDA 4FSDA 4BNMA 4DWWA 3KHUA 4ZYVA 4TXMA 1MAVA 4NSNA 4PIMA 4FBGA 1EE9A 1IQUA 4XX0A 2W6ZA 1EZ1A 5IEJA 1GNVA 2E3JA 3FPEA 4JGBA 2J85A 3RS3A 2GILA 5A6VA 2J4DA 2F8MA 2C1EA 5JYDA 5KJEA 1OGIA 2ZS9A 1G5FA 1G8JA 1PVVA 4ITVA 1II0A 2XBUA 1C4WA 2YNMC 2QP4A 1ZD3A 3Q2OA 4LMAA 3V1UA 2XZLA 2GOYA 1NBMA 2A0UA 3GJTA 4HXYA 3V1TC 1VPDA 4RQUA 3C1AA 3PR1A 4OFXA 1OBCA 4X20B 3FZNA 3K2QA 2ENWA 2RBEA 5JSHA 4ZZ3A 1ZJ5A 1ACMA 4M89A 2Z6VA 3C7DB 4E5UA 2A9OA 5K0FA 4FUTA 3GT4A 1QKJA 4L51A 3EZ6A 1C41A 1Z4IA 3IXLA 3GA7A 3UF0A 3DDZX 3EIUA 4D26A 1Y6GA 1FYVA 2IF2A 1CY2A 3TKAA 2AWOA 3X1KA 1EUCB 4KWHA 2IGBA 4GI5A 3ZGLA 5F3DA 3ABSB 1TO1E 2ZRQA 1H4TA 1ZNZA 4TSRA 1DO8A 3ZDEA 2JRCA 3LKBA 4II7A 5EJMA 3VJKA 4DMFA 2FV8A 3SD7A 3TLGA 5EP2A 2B36A 3C3DA 2IOFK 1M34E 4D9EA 2H51A 1IXKA 1HG0A 1K3FA 2M32A 1RWVA 2Q3LA 3BCRA 4KO2S 3WMGA 5KOIA 2EIXA 3IDZA 4ZVPA 2AIRA 4PF1A 5C8YA 1CYEA 1IM8A 4CIDA 5GADl 1NXVA 4QXAA 3I73A 2DHQA 4YCJA 2JFQA 3GPCA 3GMTA 5IJ0A 4PLCA 5DYNA 2SKDA 4Z8YA 2O23A 4RD0A 1A8QA 3ZIDA 4GXNA 4FNMA 4GI3A 1W5SA 1ZHHA 3WLNA 1AKYA 3GXOA 5ERYA 1P0MA 2XVMA 4MH0R 4YVFA 3ICEA 1WMAA 1BA2A 5FBQB 4YXFA 2XCQA 3ZHOA 5CB4B 5FPSA 3U5TA 4C2BA 1OA1A 1Z4KA 1Y4AE 2JDIA 3KEOA 1BROA 2JLAA 2P4UA 1O9BA 4EWLA 3Q8LA 1WVMA 2YWCA 4PYOA 4BNDA 3ECCA 4YJ3B 5ETJA 5EZ6B 4ZMBA 1UZNA 2B1IA 3BMNB 2PX4A 2HBZA 1CHDA 3AB8A 4I7EA 4U2CA 5AKJA 3RD5A 1W9MA 4DMGA 4YCLA 3PT5A 1KSJA 1X1EA 3PXDA 4GM0A 1FK8A 2OZLB 4HDMB 3H6HA 3MQFA 2KBFA 3QVJA 1KYTA 3LWBA 3IBCA 4IUCS 4H7FA 2DPLA 1EBBA 1O6CA 1T2AA 2IUTA 4B4WA 3VR3A 3K70B 1A77A 4YMHA 4OXNA 3RUCA 2R00C 5FORA 4NZOA 5IH7A 2ZUBA 2NO9A 1VJTA 4Y2UA 5EHZA 5GZ3A 1K5PA 1DAKA 1K98A 2GZ1A 4O4LF 1NUTA 1Q2XA 1X42A 3U9TA 3UK0A 5CA1F 3FNIA 3SJAA 2IEYA 1E2NA 3F6SA 3RSLA 5C8DA 2ZR7A 3QELB 1ZXBA 1HM5A 1KI1A 1QR6A 4IQGA 4OK6A 2XDQB 3HVJA 3A3PA 4JA2A 1O4VA 3DO5A 3WZMA 2XA1A 3GN1A 3L7MA 2PYIA 4K40A 4BEBA 3R5SA 1ACLA 1ESDA 1U7XA 2VK2A 3JYPA 4N49A 5AUNB 3AVXA 1YJQA 3LWNA 1PNTA 1VSTA 1TUEA 1XZKA 2IHKA 2JGEA 2VBGA 4PVDA 4G4SP 3ZLUA 4JT2A 4ZI5A 3PD0A 4DLYA 2BKLA 3G9ZA 3PI6A 121PA 4KI7A 3DNFA 1EKXA 5I9TA 1JEYB 5EOVA 1ZJYA 3NP9A 5CYOA 4KWIA 1KS9A 1JU4A 3ZXUB 3K1YA 3AJ9A 2FCRA 1I30A 3PVZA 1IY8A 1OREA 5F5XA 3V4RA 1CIVA 2AW3A 4QBTA 4N54A 3RUAA 2G5TA 4TWJA 2PEZA 1GEGA 3TSOA 3FKSD 1M8JA 3KT0A 4QGHA 4K6GA 3F6EX 1Q11A 2GR9A 1XEXA 4EKNB 1UMCA 4HHEA 2XQGA 1RMQA 3KYIB 3O8BA 4L57A 4R54A 2H5JA 3L6CA 2BUAA 5BMVF 1FDUA 1M2JA 3KZNA 3WGVA 5ED0A 4QYSA 1FRQA 5DV9A 3DZBA 2AQKA 3RYTC 2HW8A 4NENB 1XTVA 4N39A 4XFDA 1LVGA 2EQAA 2PL9A 3W2FA 1QTIA 1FRNA 2JZOA 2FVYA 1ZU5A 1GILA 1SOWA 4PS0A 2FMHA 2NTJA 5DT2A 3VXKA 1SHJA 3ABOB 3OZWA 3GH3A 1XL1A 2Y76A 3F49S 5B6PA 3C1UA 5KS2A 1AQNA 4DVGA 1MLDA 4WSOA 3UMMA 3GJ5A 4KKXB 3UHAA 3EEFA 3MM4A 4IS2A 1NN0A 4B3TB 3O4GA 3V4PB 3N86A 3R77A 4DCTA 4W9MC 2P9GA 1HTTA 1HT0A 3H84A 4CKEA 5AOVA 3AFNA 4J9