4OJTA

Helicobacter pylori mtan complexed with s-ribosylhomocysteine and adenine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
231
structure length
231
Chain Sequence
MGQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MTA/SAH nucleosidase
publication title Crystal structures of the Helicobacter pylori MTAN enzyme reveal specific interactions between S-adenosylhomocysteine and the 5'-alkylthio binding subsite.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 88
structure length 231
sequence length 231
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ojtA00
1YR3A 4MARA 4DA6A 1VHJA 3BGSA 2H8GA 4TXMA 3ONVA 3UAVA 3FWPA 3MB8A 4TXLA 3T94A 2QSUA 1Z39A 1JDUA 2ISCA 1VMKA 1Z35A 1ODLA 1N3IA 4EARA 3EUEA 1JP7A 3P0EA 1RXYA 4OJTA 1V41E 2OXFA 1YQQA 2QPLA 1PK9A 1JYSA 3PHBE 1Y1TA 1T0UA 3OCCA 3BJEA 4TTIA 3OOEA 4PR3A 3PNSA 4GLJA 1RR6A 4G41A 4F3CA 4F1WA 1OTYA 1ZOSA 3KVRA 2A8YA 4H1TA 1QE5A 4BMXA 5EFOA 3EUFA 5F78A 3O6VA 1ULBA 3LBAA 4MCHA 3FAZA 4KN5A 2A0XA 4QATA 1RT9A 4L5AA 1TCVA 1PR0A 3EEIA 2HRDA 3O4VA 3C74A 2QDKA 1YQUA 4LNAA 1FXUA 4BMYA 4YNBA 1OU4A 4WKPA 1I80A 4DA8A 3DJFA 4G8JA 1V45E 4QAQA 5B7PA 1U1FA 3LGSA 3FNQA 1ULAA 1M73E 3K8OE 5IU6A 1T8YA 1LX7A 4UC0A 1G2OA 1Z33A 4D8YA 1JE0A 1NW4A 5F73A 2ON6A 3KUKA 1Z5PA 4NSNA 4QEZA 1V3QE 3E9RA 1XE3A 1TGYA 2I4TA 3PHCA 4TXHA 3K8QA 1Y6RA 3DDOA 1A9OA 3GGSA 2RJ3A 4LDNA 1TCUA 3FOWA 5F77A 4MCIA 1Y6QA 1T8RA 1NC1A 5KB3A 1T8SA 4OY3A 4EB8A 1ODKA 4DAOA 2OECA 3D1VA 4P54A 1K3FA 1SD1A 3E0QA 1PW7A 5CYFA 2HN9A 3NM5A 4NS1A 1PR1A 3GB9A 4DANA 3BL6A 5CCDA 1WTAA 5F7OA 1C3XA 4R2WA 1ODIA 4L5CA 5CCEA 4LZWA 1Z38A 3UAXA 4ECEA 3ODGA 5EPUA 4TS3A 3OZCA 1TD1A 3TL6A 1PWYE 4OEHA 4BN0A 1Y1RA 2OC4A 5DK6A 4GLFA 2B94A 1OTXA 3DPSA 3SCZA 3IOMA 1JPVA 1RYZA 5CYGA 4JWTA 4FFSA 4L0MA 3E9ZA 1PBNA 1A9PA 4DARA 1SQ6A 4D8XA 1NC3A 3F8WA 4IP0A 1V48A 1Z34A 4X24A 4YO8A 3KVVA 2QTTA 1Z36A 1OV6A 1K9SA 1B8NA 3KU4A 3FUCA 4TXNA 5IFKA 3NBQA 4DA0A 1A9RA 3BSFA 1RFGE 1PF7E 2HWUA 5EUBA 1U1EA 3DP9A 4GMHA 2P4SA 5I3CA 1RXSA 5F76A 4NY1A 4R2XA 4F2WA 2A0WA 4LNHA 4WKNA 2BSXA 2A0YA 1SJ9A 1LV8A 2PGAA 3PNPA 3UAYA 1PK7A 1V2HE 3IEXA 4YMLA 4M7WA 1ZL2A 5F7ZA 4JOSA 5K1ZA 4TTJA 4OF4A 4TYMA 3QPBA 1RSZA 4QFBA 1VFNA 3OPVA 4R31A 1OUMA 2QTGA 1Y1QA 1CG6A 4QASA 3OZEA 1RXCA 4M1EA 4BMZA 1OVGA 1Q1GA 1TGVA 2XRFA 5C80A 5CXSA 1T8WA 4PNPA 3NM4A 4RJ2A 1JDTA 3KHSA 1LVUA 1B8OA 3LA8A 1JDVA 1Z5OA 5FAKA 4I2VA 1U1DA 1Z37A 4DABA 1JE1A 3UAZA 1PKEA 1V4NA 1VHWA 1RXUA 4E1VA 2AI2A 3NM6B 1ODJA 3OF3A 3UT6A 3P0FA 1JDZA 4JP5A 1SD2A 4D98A 3KVYA 1U1CA 1K27A 4G89A 3ENZA 1PR2A 4TS9A 1Y1SA 1CB0A 1JDSA 4YJKA 1A69A 5B7GA 5B7NA 3OOHA 3FB1A 5JPCA 5B7QA 4GKAA 3EMVA 4WKCA 4DAEA 4F2PA 5F7JA 4TTAA 5F7XA 1A9TA 1A9QA 3MMSA 3U40A 1U1GA 4OGKA 1PR4A 4TXJA 3DF9A 4L6IA 1Z5NA 4WKBA 4U2KA 4WKOA 2GUWA 5ETJA 2I8AA 1PR6A 4D9HA 4LKRA 1RCTE 2Q7OE 1A9SA 4DA7A 3OZBA 2AI1A 2AI3A 4OGLA 4K6OA 1YBFA 4D8VA 4QARA 2OC9A 2AC7A 3INYA 3OZDA 2HSWA 3UAWA 5CXQA 1PR5A 4L5YA 4F3KA 1ECPA 2IQ5A 1YRYE 4M3NA
chains in the Genus database with same CATH superfamily
3AEYA 4OATA 4OX9B 4LE0A 1C3EA 4NNOA 2IPOA 2PKXA 2W8BA 3QIAA 5ELLA 1HUQA 2B3TA 1T3SA 2WWRA 3H86A 4N1AA 4PHGA 5B3JC 1AMNA 4N39A 5BSRA 4B3GA 1HDXA 2J6HA 1RRPA 2GOYA 2AUMA 2ZSFA 4PU0A 1I3NA 5HS4A 2DTEA 2IOQA 4FDVA 5E95A 2C9MA 2BFFA 4GR4A 4H59A 3DQQA 2Q5IA 3FVRA 4C6RA 2JZNA 3ZXUB 4BGDA 5FXMA 1JDUA 4BUCA 1AXEA 1E79A 4MW9A 4MRRA 2BDUA 3I32A 1NBIA 1OC2A 3BFKA 1E2NA 1FUIA 2CXNA 1GPUA 3U7RA 1Z2CA 3I5AA 1E20A 3VYRB 2AV6A 3EUEA 1VRVA 3BIXA 1KDYA 4EO9A 5J1TB 3OM9A 3DPIA 4CMIB 2AL7A 2ZAOA 3LP5A 2Q1WA 1JXOA 4DTCA 5BYKA 3SLGA 2OL4A 3NHPA 1V41E 2C82A 1J8MF 2I2BA 1KAQA 1XXHA 2W4IA 4II3A 4QJ4A 4BASA 1RI5A 4D0GA 2ERYA 3MRTA 4OYYA 4Y98A 2HFJA 2XXAA 3LVFO 3F4LA 5FBVB 1QRAA 4YCSA 3EEOA 1M2OA 3AFHA 3OPYI 3VTKA 3T6KA 1RM4A 5DBIA 4ND6A 2H08A 4I4TF 4ZVRA 1YBVA 4MKRA 3OOSA 3V1TC 3OOWA 4F3CA 4OFBA 1TADA 4QE3A 4TV8A 4JXZA 3UCEA 4PLFA 2FPIA 4C9BA 1XTKA 4UEOA 2JJ1A 1MW9X 1Z0UA 4G0ZA 4CT4B 3PF8A 3RJ5A 1AMOA 1WNFA 2O19A 3VPAA 3DDWA 1MLDA 3O9VA 1NNUA 1QE5A 2JH9A 3MEQA 4KPGA 4WH0A 5DIFA 5H70A 2W4MA 3SNKA 3MTJA 3USZA 4MX8A 2JGJA 4AC9A 3A25A 4EECA 2QUIA 4O3FA 1NVXQ 3E9NA 2FFJA 5DSZA 4ENQA 2R8RA 5DYWA 4JVSB 4YJ2A 4RIHA 2D7DA 1PL0A 5DN6D 3KL4A 5BW5A 2GX6A 4DMRA 4ESOA 2W6ZA 3EXHB 3O8DA 5F1OA 5KTPA 3WBKA 1P61B 3DMTA 1KFJB 3AWIA 5E6UB 3EIHA 3TDKA 3OAAA 4WVFA 3LQYA 1XHLA 1K06A 3GLKA 3ZEAA 2A0XA 6Q21A 3PFCA 3SQNA 4N0DA 5DLDA 2E82A 1MGOA 3ED5A 1H1TA 5DLPA 1P5JA 2JKZA 1UEIA 5EESA 3L1KA 1SRRA 1DO2A 3PDHA 1JJAA 4L5AA 4X1KA 4BU1A 3J7AC 2YJNA 4AYXA 2CNWA 2FSVC 2FRXA 2V7TA 1U9ZA 4G65A 2OK7A 3LPCA 1SVOA 2JA1A 2Q0SA 2Q6OA 4RPHA 2SNIE 3V1UA 4AQDA 5JZBA 1AGNA 3K1AA 1FXUA 4PZ0A 3DKRA 4FE3A 4FI3C 5CB0A 1HNZB 4MAAA 1KDOA 5HTOA 2GBPA 4NH4A 1RXWA 5HZKA 3N6VA 5JFGA 2YW2A 2WF7A 4DQUA 5IKXA 2X8JB 4BLUA 2G09A 2P7IA 4FT2A 4LJ7A 2H5JA 4QAQA 1BG6A 5LZ5A 1NPDA 4E46A 2Q0XA 1DIOB 2AB0A 1YDEA 3FYUC 3HDGA 3NDPA 4CLXA 4M1MA 1S8FA 1ZYUA 3EFOB 1M73E 4Q1EA 4J0IA 3I2FA 2FRDA 1RRGA 1XQXA 2P75A 3RLIA 3E5NA 4D4MA 5IN4A 2ZJ8A 4ZMBA 2AG0A 5JDCA 2EU8A 4N5DA 1TL7C 2E5WA 2ZSEA 1XZFA 4Q1DA 4RWZA 3TRJA 3R5KA 4JGGA 4XLZA 2DZDA 3SZRA 6REQA 4M9QA 3EDOA 3GGOA 3SC3A 3V2HA 5CPFA 5D5QA 1DSSG 5C7OO 3U7QA 1ZICA 1Z17A 3TEJA 3C3PA 1XVAA 5JWOA 1N5JA 2QMZA 4KW7A 1Z3IX 3I3OA 3RSOA 3COJA 5HK8A 4RUKA 1B3RA 4ESVA 3KWJA 2HNAA 4PAOA 2QAJA 4PYQA 2AYYA 1PJQA 2JPDA 5TS2A 3QHPA 4P3XA 2EZUA 1KBZA 1YB1A 1QHFA 2AD5A 2PVPA 5JQWA 5EOVA 1XE3A 4BZPA 4UKDA 3BD6A 2FOXA 2X3UA 4CWAA 1RMTA 4FHDA 3G1UA 4E6PA 3JQBC 1UKEA 3ILYA 4P4GA 3STXA 5EJEA 5KDOA 1V1MA 1UMCA 2ONYA 3IPXA 4EI9A 4GL4A 3WQQA 4WZBB 3L6EA 1U3WA 4BVHA 1GL9B 1V8DA 3SLRA 1P9OA 2IHVA 5HPYB 4UXIA 4DZZA 1LWNA 2NO1A 4PSCA 3DC7A 3HJCA 4PRLA 1X8XA 4GGOA 3DVLA 2QXTA 4QXPA 2I2DA 5EMJA 1GKYA 1Y6QA 3EZLA 3ZLVA 1GYQA 3DWEX 1YB2A 1TE2A 2GKSA 2RGNA 2WFZA 1PZGA 3LY9A 1MQ9A 4LMAA 4PPYA 4R01A 2G1JA 4Z9BA 2JHPA 5EWLB 3GEIA 5AW5A 1DQSA 1LSJA 3RTCA 4DG9A 5JZMA 1L4GA 4PZZA 1VCHA 4DAOA 3SYMA 1Q7EA 3FGOA 2Q50A 1PGPA 4G4SO 4BXOB 4OH7A 1Z2EA 3ML1A 2OWEA 4AO7A 2QD5A 1YR1A 1VI2A 3Q1LA 4ZAYA 1UWLA 2AOUA 5E2BA 4AX4A 1V3VA 1NJFA 3FWNA 1E1QD 3LWBA 1NLYA 1EH5A 3FE2A 3Q11A 4PNHA 1KZ6A 4JLDA 3IESA 4HX9A 5MFZA 1UDCA 5DI3B 2ZRPA 3F6YA 1NNI1 3RYFB 5CURA 1ULHA 1YR8A 3KO8A 4EHDA 4R2WA 5FLEX 3PX3A 1THMA 4YUWA 5GWXA 4NOLA 1FRFS 2XWPA 4CEJA 1MIOB 3QUSA 1A95A 5AW9A 4A2WA 4M0MA 1K89A 1LPOA 4KQXA 1LRKA 2PLFA 5KSYA 5KU7A 3WGLA 1FU7A 3JASA 1UOQA 2XQIA 4CM7A 5IUNC 3AY7A 2F8TA 2GN9A 3IA7A 3NJ4A 3QLTA 5JIBA 1C81A 5K0JA 1ZO8A 4N7BA 1GVHA 1MNQA 3ZPXA 3WXMA 4PR0A 3WS7A 3QVGB 3DBVO 4WOPA 3E22A 4MA0A 3A9TA 3O8OB 3CNNA 3PF9A 4K46A 2J6CA 5A7GA 4LZOA 4KPFC 1EM8A 4CLDA 1SZDA 1HC7A 1LQUA 1VGQA 4L02A 3GIDA 4JBLA 2PZKA 1T35A 4R1OA 4RK0A 5FPSA 3C3BA 3M2PA 3SYLA 4JBGA 1JVBA 4I3GA 3KZXA 1KJQA 2FHPA 3IL2A 3SLKA 3VUEA 3H42B 5DIZA 3ANXA 4OJKA 1J0BA 1DJQA 4R83A 3B8HA 1Q0RA 3CA8A 1X1AA 2ZRAA 1DRVA 3S68A 1UK8A 4DV5B 4L85A 4HAOA 4US2R 4TLCA 1MP0A 1LZKA 1NVDA 1RYZA 3UY4A 2I4MA 3VU0A 4C78A 4BN4A 4D45A 2L42A 1HEUA 4FE4A 2DVMA 5C34B 2ZR0A 1ZWLA 2WT4A 3ZNNA 2H00A 1NKSA 4WUTA 1PBNA 4C88A 3EZNA 5BQ3A 4J7AA 4ZXFA 1XD2B 4IQGA 3CKYA 1V8FA 1TCAA 1XAJA 2AWOA 3IILA 1PG0A 4LOJA 5DDIP 4LVUA 1CE8A 5THQA 3G0IA 5E7QA 3UBMA 2EZ9A 1KU0A 2H9IA 2F1OA 4MOWA 2R60A 3FMFA 1UH5A 4FQ7A 4RFSB 3WGQA 1YTLA 3PHLA 4UNQA 1W88A 1P5ZB 1AKQA 2EKQA 3ZXSA 3JD3A 2G8LA 5FOWA 3E53A 1Z34A 2IXBA 3O8NA 4FGWA 2NU8A 5JD4A 4NCJA 3SHVA 4F9TA 2G28A 1UL1X 4TYYA 5AW6A 2HF7A 3BFVA 2WJPA 2AFVA 3WVNA 4ANFA 4ZARA 4B33A 3GO4A 1QONA 3B3JA 4C4RA 3FUCA 3QF7A 1Z4NA 4LCBA 1PV1A 2XOXA 2CHFA 3DE1X 2VP4A 2WY2D 1OI4A 3SFVA 4A27A 2DLCX 4MJ3A 3R5HA 1A8SA 3CH5A 4BRSA 2VK1A 2NT3A 2REQB 4G1UC 5K2MA 1D3AA 1KI2A 2QG6A 2I66A 4QWMA 4WFKA 4ZRMA 3AETA 5AK4A 3Q5GA 1IK4A 3WGKA 4MMZB 4DIKA 3T9BA 4Q9JA 4UUQA 3AM3A 3C45A 4ZQBA 3ZWXA 2AR9A 3LC7O 3IUPA 4KMRA 4MR7B 2I3BA 2A7QA 1ZH8A 2YWGA 2OV8A 2F9FA 1LV8A 3IB6A 1XZIA 3L6RA 4FFBB 1EXNA 3M0EA 1SBIA 1V2HE 2YFKA 4DV0B 3QU2A 3UKJA 4BP8A 1C41A 3KOZA 1E8MA 1U2GA 3M6IA 3VPHA 3KKLA 4YMUA 1NM5C 2PMFA 4ASUD 2OHVA 1UZNA 4JN6B 3QBTA 2F3QA 2B4TO 2GO1A 5HMMA 5K1ZA 3RG8A 3U3XA 4DJ5X 3LY8A 2EEPA 3AKCA 3LLVA 3UNXA 1Q83A 3ITKA 2PXHA 4OP2A 2X9NA 3ESRA 3JQPA 5ES3A 1QB8A 4KZPA 3K8ZA 3ON5A 4RJKA 3T1YB 4UVEA 3IV6A 2OOKA 5E4JA 1H0KA 1X2EA 5J47A 4FC6A 3TFWA 3K0AB 4YGXB 2DPHA 1BXGA 1C8KA 2AMLA 3LBYA 4Z2AA 4RD1A 2WVJA 2DKNA 3U3JA 1Q3HA 1XCLA 4KXNA 4JCOA 4MWBA 1C9MA 4IBOA 2FSFA 2ZJ5A 1F9EA 1X86B 3W7AA 4EJFA 3REGA 1IJKA 3ETEA 2YJ6A 1Y4ZA 3F78A 3HR4A 1RJDA 2QSJA 4IX1A 3HBLA 3MJCA 4Y7DA 1QS0A 3PR2B 4DQ0A 2WQ7A 4CQJA 5FPQA 3TM4A 4WSOA 2QSZA 4EH1A 4DV7B 5AI8A 2Z0MA 5I9TA 2F3TA 1O5OA 3GFTA 4PNPA 2BFAA 4CCYB 2MSEB 1ONNA 3NOQA 4FJ2A 5FBWB 2ZDHA 2GN1A 5CBPB 3D6FA 1NP6A 3CX3A 2UV8A 3FIJA 4PRYA 5LZ7A 1H0RA 2ZEJA 1T3LA 1E2IA 3OJLA 3HWSA 1HFEL 1WLSA 3E84A 2RI6A 1G98A 3UVEA 5KYNA 4XGIA 4DABA 3OZFA 2QP9X 3UAZA 2JGLA 4XQGA 3JSAA 2VTKA 1OXSC 2ZB2A 5FBHA 4B3MB 3N74A 1PGNA 3D9QX 4GM4A 2PGIA 4PO9A 3NUZA 2JD0A 1CDZA 2B2CA 2JFYA 1ZR2A 1SC9A 1YGPA 3LTNC 2NXCA 2AK2A 3EPHA 2RI0A 3U4IA 2GPYA 5ENDA 3I61A 1KI6B 3ONNA 5D8DA 3L46A 1Y34E 3ZIDA 2WMOB 4JP8A 1YJ8A 1NW5A 1R5NA 1QK5A 3B13B 4Q03A 3RD5A 4Q3NA 1HQYE 4IJKA 2GDZA 2O1WA 3PNOA 4QODA 1RLOA 4L8WB 4MEAA 4UQPA 3IE0A 5LYJA 1PZEA 3I62A 4TS9A 2XB2A 3VR4H 4HGOA 4TTTS 1SUPA 4N49A 4XWOA 1QHYA 3PEFA 2HA6A 2PGXA 2IPNA 4P4LA 3TPCA 2VLBA 4GF5A 3CVXA 1D09A 3DFMA 4Y8VA 2GT1A 3X0DA 1CUSA 4TMZA 1A69A 3EK2A 2P2LA 2BFDA 4C4OA 4DDTA 3T5GA 3OQBA 4JL5A 3TTWA 1NIPA 1FW6A 1XEWY 2JLVA 5C4GB 1BW9A 3NIGB 4IINA 4IDNA 2IQIA 1DL5A 4GU5A 1X80B 3VVLA 3MWYW 2B3DA 2DB3A 3UJ6A 5SYAA 4Q16A 2IH4A 3F67A 2IXAA 1V1JA 3RRYA 5KYGA 3AM1A 1A77A 1E9CA 3UJNA 1IY0A 1M1YB 3ZWBA 1H2BA 2C58A 3LUGA 4JJ7A 2VPTA 1M8FA 3HKDA 3SJZA 3AEQA 2WSYB 4RM3A 3COWA 1CF2O 1RKBA 1SVWA 3UM9A 2JHCA 3GJTA 4K87A 1AV6A 2AKYA 3K0EA 4KO3S 2HSJA 2Y27A 1FYEA 1WL8A 2Z56A 5F1YA 3VTFA 1D6JA 3I1FA 1EB9A 4MQEA 4OQQA 4YQFA 1BZYA 2Z08A 5MGNA 1REQA 3EULA 3PICA 5PNTA 1RS0A 1JIJA 3I8XA 3LT4A 3QW4B 5LCXA 2G07A 2PAFA 5DTMA 5I8WA 1PFYA 2ZT6A 5EIXA 1XLTC 3EDYA 3LW8A 3PPVA 4GX1A 1X9HA 3CX6A 1TZBA 4UEQA 1M7BA 2ZFUA 4MULA 2VT7A 4L8GA 4NMLA 3C5EA 4WFJA 4X00A 1M6NA 5DWQA 4ER3A 4D0NA 2H4WA 4Q48A 4TKUA 3OQIB 3C3WA 2XB8A 4JL6A 4WK4B 3QEOA 3MWEA 7GPBA 2UYGA 4PAWA 1CUFA 4OMUA 2F17A 2Q7OE 3ZDRA 3JZFA 3RRMA 3E2IA 3ZCSA 3ZDBA 3IO5A 3PQ3A 3THXA 4IVQA 4R8RA 4KOAA 2WVHA 4XX1A 3T5CA 3TKLA 3BRWA 4DQXA 1U0JA 1JX6A 2V74B 5BSMA 3ZZNA 1UMDA 4I8IA 4EJ6A 1NLZA 1ZZEA 5JI2E 3M9WA 1FJHA 2XQGA 4BNVA 1KWGA 4KFCA 5IYZB 1NR5A 1E6EA 1BDMA 2FW9A 1CKEA 2O0HA 3BFJA 3IUBA 3W5IA 5JJ5A 2R6FA 4GI3A 2PLRA 2KM1A 3SHWA 1OFUA 4J0KA 4UASA 4MW7A 3U9LA 1OB2A 4I5DA 3H5AA 5A6SB 4BKRA 1QK4A 3H0EA 1NX9A 3CJTA 4GXTA 4YDQA 5A3RA 1R64A 1W6RA 4I4IA 3ZVKA 3GR6A 4YPFA 3ELBA 5JSHA 5IXJA 2AMJA 1GR0A 4MVJI 2UZ1B 4LS3A 1CIPA 1RPNA 1PJBA 1X7HA 2WM3A 2X14A 5HFAA 3ZU2A 1JWLA 1GQFA 2HIMA 1CJBA 5G0TA 3F6CA 3IIKA 5I9LA 4LQDA 3DWIA 4JYPA 5TC4A 5LZ2A 3NHZA 4LOIA 1UT8A 1HH4A 4HEJA 4XKJA 3UENA 4XLLA 1L0BA 1WHTA 3X1JA 1Z26A 5CIWA 3OG9A 3DVAA 1T10A 1SCAA 2EZTA 2DC1A 4MUXA 4MR9B 1CUZA 5C37A 5JC1A 2Y92A 2XNJA 1Z35A 1E77A 3IALA 4LE2A 1Z74A 3F7MA 9MHTA 4S2EA 4YUZA 3I01M 4N5NA 1VE6A 4C1BA 1E61A 2CLCX 2RAUA 4J1QA 4HNQA 1KH2A 4FONA 3CSDA 4PO3X 3TRKA 1U5AA 3YASA 1DJNA 4XEUA 1ZM7A 4HDAA 1T2FA 3UJBA 5C7YA 3QVVA 4BJ1A 2D5IA 2HY7A 5I5EA 1UC9A 2YWEA 1WUKS 1YQQA 2FPOA 3L18A 3T4XA 3NHRA 3PP8A 5DZSA 2GNPA 4KDFA 3ICEA 5KNBH 3D8RA 3R23A 3IR6A 4P7BA 1UFRA 3G0HA 3SJBA 4F1KA 4KO1S 3OZUA 3CLKA 4DCCA 1IBKB 1P77A 1XFAA 4DNOA 2BEVA 4A1OA 1RR6A 1SWWA 4QGSA 1BEZA 3PSHA 4FOTA 1AD2A 1X9GA 2QXUA 2DQYA 4IGAA 1YWGO 2WYIA 1OTHA 1BNCA 2P9EA 3A6KA 4HNRA 4JGIA 4JVOA 4LYEA 5I5GA 2Q6KA 1ABEA 1EWRA 2W2PA 3PGJA 3QVMA 5CB6A 4JLAA 1WSDA 3ZLUA 5JADA 2P6UA 3RIHA 2ZBQA 3DZBA 1UODA 1LFDB 1YJBA 1TTPB 2ZGVA 3I5UA 3V7WA 2A8YA 4H1TA 4NE2A 5EKSA 1PHPA 1X7ZB 2NLOA 4BMXA 4G6ZA 1GPYA 4COOA 4L2IB 3KPJA 2OYRA 4AU1A 2J4DA 4NFSA 2QD4A 3VI4B 4F96A 2DPLA 2Q07A 4NONA 4MUYA 2WAYA 3TEFA 3KJHA 3LBAA 4D44A 1T4GA 1NXXA 1MJGM 1QTNA 3ZNOA 1V47A 4GYKA 1Z12A 4JH0A 1ZGGA 2O06A 1O94C 1UMKA 3K6RA 3O95A 4N0MA 1NLMA 2PL1A 4PLHA 1J97A 4Q39A 1ZJ4A 3HRHA 3VKVA 1V11A 1D0VA 1LNZA 4RVHA 1DDIA 2PA0A 3N2GB 3E9QA 2A1UB 4Q4DA 1D1TA 3VRHA 5DOZA 1SBTA 1LPAB 2B35A 1SKUA 2D2XA 3K72B 1HEIA 2CVPA 2JH3A 4LRTB 5DRYA 1HDRA 1Q0PA 5IFLA 3LDHA 4KITB 4FGKA 4N9QA 1YHZA 4PLTA 1ZN2A 2P69A 4H60A 4DBVO 1C29B 1JHXA 1G21B 1ZGCA 2EGHA 5G3ZA 2BH2A 1JJFA 1BMFA 4XYBA 3JATA 3UG7A 1I80A 3HPQA 4Q3KA 5J4YA 1ZJWA 5L7YA 2C9ZA 4HRVA 4N8DA 3UW1A 3O2SB 4UOQA 2OCKA 2V8BA 2G1UA 4MKFA 3DSRA 1G5PA 2F1KA 1RQPA 4Q3OA 5TNXA 5CCBA 5BWOA 2C4UA 1T2CA 1K3TA 2A94A 1OAAA 3EF1A 4TMTA 4WK0B 4MRMA 3EEQA 4UNRA 2H1HA 4DM7A 3IOBA 3PIDA 1X92A 2JIPA 1R27A 5KU1A 4DV2B 5IU6A 1OYYA 1RWPA 3VSEA 4ZDKA 3ORFA 4LXHA 1VSVA 2O2JA 3ZS8A 4JEIA 2BEWA 3CF6R 2ZBGA 4JJZA 2J4CA 4S2UA 3TIVA 4Y6LA 2NXNA 4UVHA 2Q9AA 2YICA 2GRUA 3OX1A 2QN7A 5WRFA 1I4DD 3IVMA 3KUKA 2ATEA 3C3CA 3JY6A 3B3FA 3NPAA 3P45A 4PPFA 4Y0VA 5CGZA 3AVPA 1YVUA 2IUUA 4AMVA 2WNSA 4POOA 5LWHA 2WTUA 2HA5A 3ACCA 3C5CA 5L45A 2WYUA 2EHDA 2PPVA 4BE9A 1IY8A 1A9XA 1UT5A 5F7OA 1WDTA 4BFXA 2QRUA 1ZJJA 1RZUA 2GMWA 2QRPA 3E9RA 3GLTA 3O2QB 3P9NA 1PVOA 3WKCA 5T7BA 3NTUA 3QVUA 4W6ZA 4HH3C 2FWIA 3WSVA 4AS2A 3SD7A 2KQUA 2PSEA 5F3DA 1C1XB 1GPKA 3H5RA 2X9QA 4KLAA 1L5LA 1RRCA 3C5WP 3FCOA 2UXCB 2RJ3A 4RCZA 1JI3A 1PZNA 1UBTS 4XFKA 1QHNA 2FPLA 4GPEA 2B69A 1ESNA 5E4YA 3RVJA 4AYTA 3CXRA 3GPLA 2J0UB 3PDIB 4PGAA 5DNVA 5BMVA 1KJIA 3SE7A 1ZI8A 2NSDA 4OBXA 5FD8A 1YZYA 3NC1C 2OECA 4PGHA 1OX5A 1G1MA 1KA9H 3ZDEA 5BSFA 1CJKC 2G9UA 2MCFA 1FMFA 1LW6E 3G8DA 4IICA 5JAZA 4OLAA 3FFTA 3GLQA 3PX7A 4OB8A 3I1IA 1XVLA 4QNNA 5C31A 2JFGA 3EVBA 4G9EA 4R8SA 5BVHA 5KTMA 3MJSA 1EQ2A 4Q82A 1R12A 4BVAA 2FFRA 2NIPA 3DOIA 4QXOA 3SU8A 3B6KA 4I3FA 4R5MA 1P2SA 3WGZA 4EGJA 3T1TA 1LLUA 4FYKA 4EABA 2XDQB 2GLTA 3CS3A 4ARZA 1C3XA 3DFIA 3AVTA 3NI2A 3DTTA 1XQYA 3AR6A 4NE7A 4FR5A 4ALKA 4E3ZA 4KFUA 3UT0A 4MGZR 1IBCA 3NTLA 3O8QA 1RHQA 5TVKA 3F2IA 4K6MA 3CIFA 4YCJA 3I9NA 1SBCA 4UW9A 3WNVA 1QFXA 3IIJA 5CFOA 2JI4A 5EPUA 5FWAA 2HQOA 1E5TA 1UC5B 3A4YA 3QFHA 4JROA 3RV3A 3CFYA 5KKCA 4S1TA 1L5HA 4JYMA 2C3UA 1IM8A 4DV6B 4E7PA 1HQKA 4X60A 3OQPA 2GDJA 3EGEA 2P5TB 2HSGA 3AHFA 2HWWA 2IZ5A 4E32A 1W9MA 3V80A 1RCUA 1YBHA 1ZEJA 2QTVA 4J49A 4CFYA 4B3JA 1SQFA 3H5TA 1GUBA 5CEJA 2R7NA 3KTAB 3OTWA 1O94D 4LTMA 4MB0A 3FVWA 3C0KA 4QRIA 5DK6A 4L1KA 3B9RA 4LNUB 4E2WA 4YJDA 1O9GA 2ZR8A 4M7RA 3WLMA 2DFDA 3NC4A 3PXXA 1XEXA 2BJWA 5LN1A 4WHMA 3TQCA 4ZOLF 4RIFA 4EGAA 1ZRNA 4NXNB 1T5DX 2VG8A 4MR8A 5BQ5A 5BW8A 1SHUX 2OV4A 2QBYA 1YC5A 2ZE7A 5CA0F 1L4BA 4B71A 5A9SB 3I2KA 4B75A 5JDIA 3K20A 3SNHA 2OAP1 2QZSA 3AERB 3CKKA 3AR9A 5FWYA 3WX0A 3IR7A 1NFRA 4KNVA 3HJGA 3NJ8A 4IOLA 1J0DA 1M7HA 4DWOA 4Q21A 1R74A 2WU0A 1EWKA 2CXUA 5ESRA 3STHA 1FC0A 4MGIR 5KNDA 1N2IA 1S01A 1Y4SA 2C7PA 3UA4A 3AOEA 1EFDN 1QUEA 421PA 4NOJA 4XWGA 3IMGA 2R6AA 3RU7A 1QIMA 1EUDB 2Q5HA 3T7IA 1VPVA 3IX7A 1WNTA 3CV3A 1KRHA 3WBBA 4Z3KA 3QH4A 5LOVB 5FBLB 4JSRA 4DIEA 5HIIA 5LB4A 3RVDA 3SFTA 4BCBA 5HR5A 2JG3A 1VLJA 2B34A 2EAUA 1IVNA 2V5UA 2YR0A 4JKIA 4JZYA 4NRDA 4RVSA 3ROPA 5ITVA 1F7VA 2ODBA 4J0HA 4Z9YA 1GYPA 2HWUA 1WMDA 1AQLA 1BEUB 2X1LA 3A14A 3LKVA 5AI5A 4BMSA 1A72A 2D5LA 1VC2A 1QK3A 4JJIA 5EUMA 4NEGA 4YAUA 3MWKA 2HI0A 1TTQB 3D0OA 3OPQA 4LY3A 4KPEC 3ITEA 1WDMA 3NTRA 4HYYA 5TQ0B 2FOIA 3HO1A 3KQTA 1TMOA 2SCUB 2LKCA 2LE0A 3RCBA 2Z04A 2TSYB 3M4NA 2JLWA 1JFFA 3QE2A 1CP2A 1T3ZA 1W34A 3E9YA 3N8GA 2PBZA 1VOTA 2PD4A 2VP5A 3CJQA 1R18A 3CZCA 2GAJA 4KX5A 1U0GA 4LJ4A 2H7CA 3RDPA 4EFKA 5K7SA 3ODPA 1O57A 3HY4A 1Q2UA 1S2GA 1D1PA 3BCSA 3WLSA 4JJ4A 4OF4A 4QXAA 2V03A 2AG6A 4LYGA 4M89A 1PV2A 3DDZX 1PUJA 4F72A 1H2EA 1TMGE 3UBTA 4U39A 3FZYA 2IBTA 2N42A 1VPEA 3TIGA 1GGEA 4M8KA 3V00A 2ORIA 4MHTA 3EA5A 5MHTA 1D2GA 4MYSA 3JQ9C 1CG6A 2GUGA 3BMNA 1Y7IA 5BNIA 4E88A 3RYCA 1NAIA 2W6JA 4C7VA 3K0BA 5FV7A 3VBCA 4JENA 5JNWA 1IY2A 3FG9A 4RZQA 2C88A 1DKLA 2HBRA 4P58A 5T8KA 1U0RA 1Z88A 3N0XA 5HIMA 4GX5A 3C3XA 1EQUA 4W9RA 1JSXA 3TN7A 3AF3A 1G5RA 3OFVA 4I5FA 4OKIA 2P90A 4MI1A 4EAAA 4JBIA 2P6PA 1ZIOA 2AXNA 1BYUA 1YJ5A 3NETA 4FQ5A 1SN7A 4FJ1A 4LJ5A 4O5OA 1LVUA 1VYHA 3UJ8A 1C8BA 1MV5A 3IQDB 4BDTA 1B8OA 3D2BA 5AKIA 1QZZA 4PX2A 4RVGA 5EP3A 3KOXA 4WOCA 5LXTA 1DIAA 4ILEA 4BNMA 1AV7A 2P9HA 4Q4HB 2O8BB 5D5HA 4MV5A 4EWLA 1CY8A 1G17A 5DH9A 1B43A 1Z37A 3T3IA 3K92A 3M5WA 2MT9A 3U6BA 3JWIA 1ENZA 1YZVA 3NO4A 4M37A 2IITA 1OH5A 4LWQA 1QP8A 2IUYA 2JZOA 3I6QA 3QLVC 1J9ZA 1IEQA 2F7SA 2ZBVA 4L22A 4QX6A 2BEKA 3G2MA 3PU6A 5AM5A 4PO8A 4DNFA 2QTMA 3MWFA 4E1VA 1M0SA 2JFQA 3CRQA 3LGXA 3TO5A 3VJKA 3EEBA 2JAUA 3TJMA 4NPAA 3VISA 2QQGA 3M83A 3B85A 4H77A 4X20B 1BE0A 2C4HA 4A6DA 1Z45A 3GFFA 2ZIFA 1KFCB 5JV5A 1HDZA 2I4OA 4MDYA 3SR0A 2NU9B 2O7NA 5C8YA 3SHTA 2QM0A 2MYUA 1KK0A 1UBKS 2O3JA 4M1ZA 4P7KA 3IHWA 4AUEA 1XZHA 1NLUA 1R8XA 3GU3A 1AKYA 1Y1SA 5JFOA 1GRVA 4EM6A 3IERA 2FZKA 3A1DA 2DKFA 1YZKA 1XIVA 3KUCA 4B2LA 3SBOA 1H3FA 1N4DA 2FTKE 3IKMB 2Q0QA 1NXOA 1U0LA 3DVSX 1EBBA 1J21A 3GFSA 3LUFA 2IHUA 3NZEA 4ZT7A 5BSKA 4CETA 4N76A 2CUZA 3C7AA 3JAKA 3ZQUA 2W42A 3R9WA 2XYPA 1XU7A 3H4VA 1Q15A 5E1DA 4UPVA 1PJ2A 3USCS 4LHWA 3QI2A 3WYNA 5E1BA 4CM4A 5H3CA 4AJKA 3LQKA 3EMVA 2I6SA 1KBQA 4X64B 2VF8A 5F4BA 1QLHA 3WXBA 3N59A 3KKMA 2H4XA 1E7WA 3QX7A 4MYHA 4TKLA 2JIBA 3TR0A 3GD5A 2ZRQA 2NG1A 2X5NA 3NVAA 4FCWA 4K7JA 3OQJA 4IOJA 5D3MA 4CTNA 4S0ZA 1DEKA 1A9TA 1M6HA 1OA0A 4UDYX 2G06A 3AP2A 1WMBA 2NTEA 2ZYTX 4DIOA 5K3EA 3G2JA 3L9WA 3GXOA 4JB0A 1KTIA 1OAOA 3KCNA 2AR7A 3HBFA 3WYCA 5HHTA 5JCPA 1T9CA 3SVZA 3U37A 3QK7A 4DLZA 1S6YA 1K98A 1W19A 2WV7A 2INGX 4YAOA 3AIMA 3UUWA 2PQ6A 4PX9A 4LHYA 4AM8A 2OBBA 2P2SA 3FYUB 4EKDA 3FJYA 5CFPA 4YBRA 2I4LA 2PUWA 4BEWA 1M6VA 3Q72A 5ABPA 1KXJA 1K7YA 1Z5VA 3DOHA 2FW1A 4G2NA 5FT9A 4ENUA 1T2EA 2IP2A 3WMEA 4FN5A 4LX0A 1YOVB 2R2GA 1UBSB 3ZY3A 4HNUA 4K9DA 2VXBA 3LX5A 3TLZA 3ECAA 1BWQA 1N2SA 5K99A 4EB3A 2HJGA 4CMEC 1ZW1A 3L40A 4UHFA 3HU5A 1OBFO 3RVOA 5EZYB 2FETA 3EVZA 1B26A 2JI9A 3HLYA 1XD8A 2NSHA 1AZSC 1GFIA 3P27A 5ICMA 3QLUA 4P9NA 4RD0A 4UE3S 2ZPAA 4R1LA 1TLLA 4NBLA 3TK1A 4C04A 4DXHA 4KRFA 4QEDA 5DGXA 1YHNA 4KBYA 3SBEA 2ZOSA 4AQYB 4DMUB 1QF9A 4TN5A 3V4PB 3FOZA 1MT3A 1HFWA 3FWYA 5TF4A 1TOAA 4LJ9A 3KQNA 1MQAA 2OFXA 1F0PA 4WJLA 2CVOA 3M89A 4B17A 4W7IA 4YV2A 3C7DB 3FETA 3GNTA 3N8NA 1T8PA 2XTMA 3K0FA 1U7DA 4C0QC 1XTBA 2Y4OA 1TJ3A 4MARA 5J63A 4MAFA 2TYSB 4XIFA 2HSZA 2UUPA 4IIEA 4O1IA 1VHJA 3UFXA 5A6VA 1SCUB 4PLGA 4E14A 1YJCA 3ZY5A 1PT5A 4IDHA 3OIWA 1HNWB 4MK4A 2FSHA 2HRCA 1C1DB 1F8GA 3W04A 1YS6A 5C1PA 4F5ZA 3A1CA 4JGBA 1JEYA 5H02A 4JJ8A 2AYXA 5HQ3A 1F20A 3FH0A 3GAAA 4YA6A 4HLQB 3H1EA 4N4AA 4PLCA 5AM2A 2GA8A 5BMOA 5HE8A 4V0NA 5KQLA 1RHUA 2DH5A 2JJQA 2XQVA 4GGMX 3JWEA 3U3DA 1ZCFA 3FX2A 1LTKA 4I99A 3GN2A 4O4HB 4G1MB 2JAOA 1Z4IA 2COUA 1CCWA 1NRIA 5CVDA 3SJ7A 4UM7A 2BZ0A 3ANSA 2BHLA 5BQXA 1FQKA 1EUZA 5JQGB 4ZEVA 2WM9B 1NDHA 3A1SA 2OXFA 1XKLA 1JA9A 1ULTA 3FJ1A 3D5EA 1PK9A 2ZYAA 1XXLA 1YRQA 4UCFA 3ZWVA 4LV6A 4PZPA 4DCGA 2WTXA 3H3XA 3SXUA 4DFDA 1M8PA 3OOEA 1HT0A 4CQNA 1LNQA 3H2KA 2XGJA 1HEYA 2PX0A 1EVEA 2W6NA 3AUTA 3DAYA 5CPBA 4ZJPA 1PO7A 3MIIA 2DFNA 4KGVA 3Q6NA 1ZQ9A 3CEHA 2APJA 2HNBA 3F90A 4J7CA 2GARA 1P91A 3RWOA 3V3TA 4NZ9A 3VNRA 2D62A 2RC6A 4O4IB 2RGCA 4MRSA 1P3DA 4TTQA 4KQGA 3ZKAA 3C8MA 2GH1A 2NYVA 2HWXA 2R1TA 4K8RB 2FV8A 3LPNA 1JR4A 2Q6LA 2ES4A 1H6BA 1O9HA 2QRVB 4I36A 1QYRA 1B73A 1VL2A 1KJJA 1KVRA 2DWQA 2I1VB 3CINA 5F78A 2TECE 3GROA 4DPKA 5JH7B 1JDPA 4IXNA 5C1OA 4FTWA 2ZDGA 1EFLA 2J0VA 3LF2A 3R6TA 5EY5B 5L9AA 4OQDA 3C6ZA 3DTNA 4AG6A 3ER6A 2AC4A 4LX8A 4D5EA 1N3YA 1VBMA 1OZHA 1ZL0A 2QV7A 1RKQA 2Y93A 3B9QA 3FAZA 3MILA 2HPAA 3DBHA 1P3JA 1UBNA 5BR4A 2P41A 4MVXA 3WDMA 4OPMA 4JJGA 1ATIA 1TJ5A 2QRGA 4JBWA 4TMXA 3U17A 5LNK1 4C4TA 4EHNA 3KWMA 2UU9B 1GITA 4GFDA 3IQXA 1M66A 3N53A 3UIEA 5BNZA 3MIZA 4BOYA 4D46A 3A4VA 3N2EA 3QMVA 4JA2A 1HKUA 2FVYA 3FDZA 5K0SA 5H68A 1NN5A 3ZY6A 3K35A 2QE7D 1ZVVA 2NAFA 1G3RA 1OI7A 2Q5FA 2YHSA 3BRQA 4ASUA 1AO0A 3RS5A 1T1JA 1WWKA 4YRQA 1DRUA 2B8JA 4FEYA 5DPMA 4MI3A 5AJHA 3FNHA 3IBSA 1OBVA 1VL5A 2O2IA 2QTHA 4R9VA 3QEAZ 4B31A 1DG3A 1CPYA 2HWYA 1T9ZA 2IPMA 3JQAA 1E2UA 1QRDA 5CJ2A 1EWVA 1G8PA 4A10A 2ZIVB 5L3QA 1L5NA 3PNBA 3GA7A 3FFAA 1OX4B 2JBHA 4PYNA 1LV7A 3PNKA 3WGJA 3WADA 4C7MA 2JVJA 1KPIA 3L84A 4B6OA 1CJUC 3AXTA 4JSTA 1AKWA 1LX7A 2JLXA 1RTKA 3TL3A 4CMKA 1P2DA 2QTNA 4J3JA 2AKAB 3BXOA 5BSEA 1NI4A 1U94A 2XCTB 1W48A 2DJIA 1KI1A 3C41J 5EC8A 3N76A 3WLAA 4OLJA 1R16A 1CJVC 1ULSA 2M1ZA 3KYCB 3BL8A 3OCXA 4XJSA 2KJQA 1VBNA 3FNFA 3LYAA 3GEMA 1G6KA 3ICWA 3LXUX 3AU9A 4L3OA 3SJAA 4HLUA 4QPDA 4ZJYA 1XV5A 3ER8A 2EC5A 3WWYA 3H8WA 3MOGA 1XYYA 1CUHA 5T6MA 2QLJA 2UVPA 4BWYA 4HFJA 4Q1VA 5B2EA 4RTMA 1WZ2A 1IN6A 2H7YA 2P3QA 2XDYA 2ODTX 4NNPA 3HJHA 4KOEC 1PEDA 5KNCH 3WB2A 2ZETA 2YW9A 3OJOA 4FBGA 5KWSA 5LP1A 1LC3A 3I45A 3WWDA 1LBQA 1JHUA 3GLVA 1PEYA 3E27A 3KLOA 2QG4A 3P96A 1HE3A 1D2HA 3OP4A 2F90A 4J6EA 4LRXA 3QP9A 3CSSA 1TKBA 5FPYA 1G8SA 4X44A 2OT3B 2PMDA 2JGIA 1G55A 1TUBB 3L04A 3Q40A 3EBPA 4W4TA 3RTDA 4BO3A 4C22A 1GQ2A 5IVIA 5E38A 3AUYA 3T3EA 1MJHA 3WL6A 2V6JA 3B78A 2P9CA 1OKKD 4FGSA 4GAEA 4LDZA 2A9OA 2O9JA 3PQ5A 3E0QA 1GNLA 2RH4A 3D0QA 2OAQ1 2G70A 2XQFA 2ZTLA 3U7JA 4BKPA 5LVAA 2JFNA 4EG4A 1RC0A 4CIBA 5LQNA 2WG0A 1DQPA 2C5HA 3EVEA 7MHTA 2ZB8A 1PR1A 1PQ4A 4JP3A 4YRKA 3RM3A 3LG2A 1TO1E 3MD0A 3X2EA 2X5JO 3WKAA 5KAPA 3ROTA 1FFBA 3Q3EA 2BRUC 4IDAA 4F21A 3H17A 4BAZA 5HZGA 2QVBA 2B5OA 3KJGA 4XGRA 4A6XA 2B1GA 3OZTA 1NBEA 3ETHA 4Y0AA 4AKEA 9LDTA 2GJ9A 4IDOA 4EG7A 4Q7LA 3ZHQA 3PIRA 1Y3CE 4WD3A 4XRGA 1GO2A 3Q12A 3O93A 1ZXXA 2IP1A 2JLSA 4DXDA 1HOTA 1FDOA 5I4IA 2EIXA 4EI7A 3FGZA 2O3QA 5EHXA 2IOFA 4TS3A 3VPXA 4Q6WA 1P4SA 3P4YA 3ZU3A 2FEPA 1Y4AE 2BJHA 1EAYA 4O2LA 2XCIA 3O91A 3PUHA 4RKRA 2IVZA 2V8OA 2AW3A 4MLDA 4P98A 4TLBA 3CHYA 3OIGA 4KWCA 4OEHA 3TOZA 1CLEA 2XWSA 3LYHA 4RHFA 1H6DA 3ESZA 3TS1A 2FG5A 5FNVF 1U28A 3B36A 1J1IA 1FDSA 1PS8A 2LIVA 3HCRA 1DC8A 2XH8A 1Z0SA 1URPA 3BEDA 3SK0A 3FHLA 1X42A 3A4NA 5DYNA 3U31A 4RENA 1HDGO 1YQ9A 1U2EA 3DPSA 1J70A 3G13A 4G1BA 3SCZA 3KQKA 2QAIA 4BQEA 5BV2P 2AVDA 3K5IA 2EWMA 1YA4A 1RYFA 1XXHB 2VZEA 1H8HD 4X8LA 2KHZA 5FJJA 3H6GA 2QIOA 3B82A 4CTMA 2XXAB 2NXEA 2O3UA 5JEEA 2RAVA 4UQLA 4DC1A 4GKJB 1MKYA 4AG5A 3WZMA 3H04A 5CX1A 3ZHYA 4P4SA 2REOA 4GRAA 2IP4A 4OU5A 1X7DA 2XCOA 3PT9A 3VO1A 3LC2O 1W25A 2Y67A 4JCCA 3BK1A 1S7GA 1PTKA 2WWGA 1X7XB 3L7DA 4RMNA 3DEYX 4JFRA 3IMFA 5HIKA 5CR9A 2B0JA 2FPIB 3CLRC 2BFBA 4YO8A 1QP7A 1E1LA 1DRKA 1RXIA 2J0EA 1DCMA 2WPDD 1RWWA 1PN3A 1Z36A 1YJXA 1YMUA 3ME5A 3GLFB 2C3PA 2EXXA 4LMPA 5AKHA 4BRZA 1YK0A 2OM6A 3NBQA 1AKMA 2P0AA 4YJ2B 5K4HA 2I7DA 1ZNYA 3FPHA 4X62B 4R8LA 2A1TS 1OFIA 3AGQA 1NT2A 5EUBA 4D4LA 4DR4B 4JI8B 1XMIA 2CMGA 3DP9A 3KKPA 5I3CA 4M1SA 2VUTA 1NF8A 2P9TA 3M1YA 5A3VA 1Y82A 1ITZA 1RZVA 1VL6A 4X1KB 5B58C 3W6NA 2DFLA 5KVQA 5K0EA 3I0ZA 2R44A 3MHPA 1D6SA 1P1FA 3UAYA 3TQQA 2MR6A 5CT8A 3L1HA 3K1AB 2FJUA 1S2MA 1TCCA 1EFHA 2M6KA 3U4GA 3N7UA 3B1XA 5EHIA 3C1UA 4CVNA 2CT8A 2RJOA 2R0QC 3RF6A 3HYSA 3AWDA 3INNA 4DILA 4BMNA 2V58A 5LA6B 1G5IA 1U7TA 1OPRA 1WPGA 2Q3JA 2QUAA 3EMDA 4RX1A 3OOYA 2MINA 4TYMA 1T9GS 2J3LA 4LECA 3DDSA 4JNCA 4X6LA 1Y1LA 2CFTA 3OLVA 1QIDA 2JGKA 2O8EB 4HV4A 1L8OA 4LYHA 5JSYA 4DR1B 2AG5A 5DASA 3WK6A 4RESA 5DI9A 1BFKA 1QKJA 3JQ6A 2QN6A 3B8EA 3IAXA 5AVZA 3G88A 2W90A 4TSFD 2ZUSA 3KRTA 4DCVA 4MHSA 2W22A 3QVOA 4K9OA 4LYDA 3KT3A 2VATA 4FXOA 3IEIA 2B7BA 3RC7A 4B7XA 2FI1A 4BLOA 4C0WA 4ZYYA 6REQB 1T13A 1BJKA 4Q7MB 1OGYA 2H65A 1JZTA 2GEFA 4FYWA 1GRNA 2ZT8A 1NU6A 4Y9DA 1TUIA 1EVZA 1H0HA 1SAYA 1UP4A 1RVV1 3K9QO 3KJFA 4J91A 2HDWA 1UPBA 3WYBA 5ED4A 5K5EA 5IABA 4MZDA 1HPLA 3AP1A 4X5OA 1H4QA 2XR1A 4LDPA 4QHTA 1G0OA 3GLRA 5CXSA 2H1FA 3OZ7A 4DSUA 1WCV1 1UMBA 2F8SA 2XUDA 1RLJA 1BX0A 1SK9A 5H1YA 1E3WA 1LJ8A 3WK8A 5LIRA 2A67A 3AKEA 4OK3A 4W5QA 3OZSA 1FU8A 2FZCA 3LA8A 1IDN1 3M5DA 5ALGA 5F35A 5IK2A 1X1RA 4ARAA 2J45A 3AESA 5DHQA 4CLRA 1JMYA 2HSDA 3MCTA 1GPLA 3TLEA 3WLHA 2ZZNA 5GONF 2Q7XA 1V1MB 1UMCB 2WIKA 1DKPA 3HMKA 3WIOA 3ZHZA 4EW2A 1NMSA 4IXDA 2CLSA 2V5AA 5JAOA 4A4DA 1PCXA 4WNYA 1YFKA 2ZBRA 3KJQA 4BFZA 2H8KA 1E3DA 3BEOA 2JATA 1NYTA 2WA2A 3C3DA 3MRVA 4GC9A 2EFCB 4BNGA 3BSWA 3FRHA 3PWTA 4Z4EA 1DAPA 1QR6A 4M9CA 4NXMB 3TLMA 4B6JA 2PUBA 2JJMA 2XZOA 4LOKA 1P2GA 1ODTC 1TQ2A 3C48A 2EP7A 3OF3A 4GNKA 3U3KA 4M1QA 4U5QA 3D6MA 4ZC8A 3WLQA 1JDZA 2H1SA 2HQRA 2RHRA 3IP3A 3D6JA 4EA7A 2VZ9A 4FB4A 4V1CI 3ANLA 5L8VA 2C1ZA 2VAXA 1CZNA 3L92A 2AOUB 3D7KA 3ZTYA 2XT0A 4RGYA 4FHZA 2B0CA 2YYYA 4A36A 3HMQA 2DQ4A 2EW8A 3GZNB 1CB0A 1N6RA 4O2RA 4Y9TA 5KYUB 1H3EA 5H4GA 2YXLA 3OCUA 5THKA 2HLNA 5CFNA 4CDMA 1I7QB 4D1YA 3J81k 2AJBA 3A3OA 3S7ZA 3L8ZA 1Z4OA 4ZVLA 2FXVA 1CEYA 2ZBDA 1ZK3A 3HYRA 2Q1YA 1BN6A 3TM5A 3GJ0A 5DGDA 4YALA 1X38A 2C4NA 4QULA 1ZXLA 5JHHB 2IGTA 2ZE8A 2G04A 4DR3B 1R6TA 1J5XA 3OOHA 3R5FA 4ARSA 4CEJB 4C0JA 4IWYA 3FR8A 1QHGA 2A57A 4U7HA 1AA6A 3P9KA 3L4EA 2DULA 2XOKA 4PZUA 3MJEA 1R0KA 3ILVA 3RRXA 5CFRA 4L3WA 3CLRD 1N7JA 2VSOA 1Q0HA 4IHQA 1UPCA 1EFKA 2QMUA 4LYJA 4P3KA 4QA9A 2VHYA 4PAGA 2LPMA 3CY6A 3M33A 1M2JA 2W83A 3OLWA 1ZRMA 4GMFA 5FORA 4OLBA 4RPGA 1CJTC 2XD4A 3D3EA 3O1HB 1QHEA 1ORDA 3SSAA 4B74A 2EERA 1ZGJA 4GQIA 1YNSA 1JYEA 3LBFA 2ENUA 1RKXA 2H2AA 4EW6A 4KGXA 4TXJA 4KUGA 2QAGA 2D1FA 3QUBA 3E2PA 1DI0A 3UZUA 1PD1A 3PDWA 3R75A 4I4LA 3D2AA 3N05A 4R3NA 3VO8A 5JVDF 5FTNA 3DBOB 2ZI4A 3JQFC 4FMCB 4LC0A 2A58A 4J1TA 2XHEA 4BECA 2JGAA 2GEVA 4YREA 1C0IA 4M7PA 2R5WA 3V9PA 4QOHA 4DMLA 1JGTA 4HS9A 4GSLA 1XHFA 2C57A 1HSZA 1N0WA 1WPQA 2OKGA 4I3HA 5CFLA 1IBMB 3FMIA 3I72A 1CE8B 4GE0A 3Q2IA 5EE0A 1E2FA 4G1FA 4QGAA 1Y8RA 2IYNA 2JF0A 3MUOA 3NR2A 3OZBA 2AI1A 1UXOA 5CM2Z 1NRWA 2CJWB 2EWWA 4PCAA 4YP0A 4K6OA 5KTNA 3DE3X 1FFEA 4ON9A 1YBFA 2NO9A 1QE3A 3BHIA 5DNDA 3E7FA 2NU8B 4KIFA 1DOZA 4D3XA 3DM9B 3AI1A 3UEOA 2WR8A 1I4LD 5DNYB 3UT5A 1F2TA 3UAWA 5T41A 2PG3A 3E9DA 4DLPA 1N92A 4MICA 4Z5XA 1Y80A 3ZHBA 1KGSA 2AJCA 2OV2A 4TSRA 2XDWA 5CYOA 2GA9A 3T7JA 2BOVA 3DMHA 4N0PA 1QQTA 2OTCA 3VOAA 3CVUA 2ETVA 3FI9A 1OLSA 2C4MA 3GUUA 3V8BA 3K3PA 4DA6A 2EFDB 4YFVA 3RQSA 2MSCB 2OBMA 1P2FA 4DSTA 4HT3B 1NURA 2JAHA 4JJKA 3IKLA 1GPJA 1MOSA 3LWZA 3TJRA 1G6HA 4C14A 4E4RA 1Y9JA 2PLAA 2CSXA 1QV7A 2J9FA 4JU8A 1Z5GA 1II9A 1JN0A 1HE5A 4I1IA 2IYLD 1OF1A 4QJIA 3V7UA 1YZHA 2Z2JA 1V71A 3TQHA 2CCKA 3LHSA 4M1WA 4I66A 1P73A 1VMKA 5CYPA 2Y99A 1K4KA 3C3YA 3SF8A 3NNNA 1V7QA 3AJ8A 1CUYA 3R7WA 1W47A 1NTOA 5CVJA 2XMBA 1KETA 2FG6C 3PQ7A 5EWMA 1XQWA 1DG9A 1GZHB 2J30A 4JP2A 2QQ0A 3HYTA 4PE5B 1DEOA 5KTSA 2V1UA 3GMIA 2QTAA 3KR9A 1JFVA 3RIYA 3VVBA 3Q9NA 1IZ7A 4OM7A 3CBQA 4QIHA 1W0JA 4Q7EA 5KS2A 4XXHA 1BXGB 3A6FA 2RK4A 2SHKA 1XR3A 2VC2B 3B6IA 2V7WA 3PTLA 1M5UA 2XV1A 5ICCA 1W85B 3RWMB 2JLZA 2WJYA 4RQBA 3EQ6A 2FFAA 4ZAFA 2E21A 4LZPA 1NONA 4BJ3A 4X6XA 2PX8A 3ROMA 1U81A 4JUDX 4HEHA 4E7OA 4Z7QB 1K4MA 3DYVA 2F1IA 1QS0B 1SVMA 5YASA 2ZKIA 4KYVA 2C2OA 1KMMA 5ISMA 4WECA 5JO0A 3PK0A 1FJ2A 1RFLA 3A9RA 3ORRA 1NA5A 1P2TA 3WRYA 4FYMA 4DLBA 2VI5A 2D3WA 4DJEC 3IA2A 3URMA 3FYTA 1QVVA 4UDOA 1N2XA 2XX3A 4Y7CA 4JI3B 3RUDA 5GIOE 2JFVA 4E5KA 2XUFA 2G80A 3LBHA 2R47A 3ZE6A 4RWEA 1G60A 3PXUA 3AU8A 3PLAE 1R9GA 2NPIA 4HNHA 2E89A 1L4HA 4M60A 4N5LA 1A1VA 4NECA 1HT3A 5D6OA 1SUSA 3NT4A 2ZLBA 2ZUWA 3SOZA 4ZRDA 4S0XA 3TQRA 3UICA 3T95A 5I9IA 1I9GA 1CTQA 4LJAA 1B93A 4ESHA 3ZJYA 5A4IS 5KWJA 5AP9A 4C7JA 1U2DA 3K9BA 1KY4A 1L3CA 2PKCA 2ZVJA 3FCAA 3SG0A 2ODAA 2WTBA 1UAAA 4KSCA 3BMXA 4CKCA 5JI3E 4BMYA 2WICA 3LLCA 3KJZA 1NQTA 1ULZA 3AB8A 1AQYA 4TS4A 2ZUEA 5CT5A 1QX3A 4ZCTA 3DJFA 3P8ZA 2VAPA 3JARB 4BBPA 4K05A 4I7EA 4A26A 5EGSA 2ZITA 1FP6A 3BIOA 4NVRA 4Y9RA 4DC9A 2JFWA 5B7PA 1I10A 5LYJB 2R5FA 2IYUA 3KLBA 5K6AA 4PRZA 4QHSA 3F4BA 4UUAA 4A3SA 4AAYA 1QWSA 5L4SA 2HRRA 2F2TA 4HDQB 1BMTA 3VR6D 2R62A 3I5XA 5FHQA 2GN8A 2E4UA 1NXSA 3JZMA 4L3VA 1XTTA 5BO5A 3TQOA 4HFMA 5FPKA 4R71A 3B5JA 1P1JA 1RWVA 2BUAA 2Y1EA 2FPPA 3K9WA 2WTMA 3PS9A 3QE4A 3W4KA 3KR1A 3UK7A 1Z8DA 1IE3A 4ZOLA 2BV3A 1CQIA 1ENOA 2TMKA 2RGRA 1AUVA 1BRMA 5KO2A 2AWNA 3C39A 2IYSA 1W4LA 2BJVA 2Y9MB 2DE0X 5FBZA 3U09A 2D7JA 4N03A 4K6KA 1TX4B 2XRYA 3TECE 2PL5A 2WTNA 2P2DA 3KSDO 1N8SA 3LTEA 4DG5A 4GW3A 1FTGA 3A4LA 3LD9A 3C4VA 4FYHA 1DFIA 3Q3CA 4OA8A 4WCFC 3CN9A 1R4MB 2BEJA 1ZWKA 1KPHA 4BGEA 3TGLA 3THYB 1GILA 2PRJA 3A6EA 4TM7A 4DB4A 5E6SA 3RT9A 4EHHA 1TRHA 3FFBA 4H7JA 1Z4KA 4KHZA 3UMVA 4QSMA 1NW7A 3ADKA 3CZ4A 4KQKA 1SZJG 2CE7A 2GAIA 1JVNA 3K2IA 2JK0A 1U2SA 1CW2B 4QUAA 2J32A 4AWAA 4BX9A 4Q00A 3NJRA 1CRWG 4XJTA 4MCIA 3TR5A 5DE3A 4F45A 4JI2B 5IUKC 2PL9A 2F3UA 3A27A 3E7XA 1DTEA 2DU8A 4ZTBA 1L4FA 4QJBA 4ZQIA 2AK3A 5TF0A 1K1EA 2CWWA 2H1WA 3RHSA 1ODKA 4ZCRA 1KR2A 3LMKA 4LZJA 4BP3A 4KH1A 1LX6A 3MWEB 3QWHA 2PUHA 2BLNA 1OIXA 3H7IA 3QKRA 2JIRA 3ZWQA 4HDCA 3ZE9A 4BGVA 2H0RA 2DH6A 2XMDA 4OUDA 3TVDA 2PX3A 2VYNA 1LPMA 1QQ6A 1W1UA 1KYIA 2OBFA 1DMRA 4HQ6A 4XIGS 5LP6F 5GY7A 2ODEA 3FUWA 4FFRA 1N3BA 1NG1A 1UMDB 1YKGA 2PEZA 5JU6A 5CITA 4XTRA 3CCCA 1VJTA 1MH1A 1DAMA 3BL6A 3P52A 3JQRA 3KHUA 2O1SA 4L16A 1FL9A 4GP7A 4L0DA 3IUEA 1PWXA 4E12A 1QTIA 2V98A 3ABIA 5J2TF 1QIJA 3NWOA 2C0PA 5JBIA 3H16A 1LY1A 1FYXA 1N25A 1TW3A 4D3YA 1VDZA 2VHVA 1N0UA 1AUXA 3OWXA 5IM4F 4RANA 3CVWA 4Z4IA 4YRBA 5L3SA 3NALA 1GTVA 1Z38A 5J1SB 2WUDA 2YWCA 2P9QA 3GPIA 1E7QA 4D6YA 1E2GA 3N70A 2B5VA 2KBEA 3FOBA 3HGMA 4CM9A 1Y42X 3FOFC 4PWYA 3GQVA 4YXWA 4XB1A 3PUKA 1QOPB 3E6AA 1WSAA 3DOFA 1ETHA 3UUGA 4B09A 3OEHD 1H8ED 3RK0A 2PXAA 5DTQA 3GDOA 3PPWA 1EFAA 1YKFA 1AK2A 5IXYA 1F4VA 4F85A 3MOIA 4JR2A 4LVNA 2HIAA 3EF0A 4N54A 3JVUA 3UPDA 3PUXA 3TGWA 5K45A 1BCSA 3LCMA 2ZROA 3FHJA 5JR3A 4FIDA 1Z0AA 2FKNA 1GGHA 2BFEA 2X9VA 3HE3A 2BLLA 4LHZA 2E4XA 3USES 5GIPE 1DG1G 2WIDA 4NOKA 3D6NB 3RSLA 5AVJA 1M76A 1M9NA 2GZMA 3LVRE 1S2OA 1QC5A 3UJPA 4EUSA 1T3GA 4OQNA 5JYBA 1RJ9A 4QREA 2ZWAA 5BWNA 3AV3A 2ATIA 3BRSA 3OTQA 3K16A 4WW0A 5U4QA 3BQNB 4XA8A 1CIVA 2FOLA 1WCIA 3K0CC 3NHJA 4LI3X 1E8NA 1ORVA 4DLUA 2DQZA 3DEJA 4RMGA 3R74A 4Z0TA 3STUA 1PEKE 3JWGA 1PJSA 3A6LA 3QJYA 1VG8A 2DHCA 4F5DA 2VDKB 4D8XA 5JYCA 2OP1A 4HDOB 2OBNA 3IBFA 1LJLA 4H31A 1FFSA 5EXEA 2IS6A 1G5HA 3E0XA 4X97A 1O8CA 2C78A 1LB1B 4JUCA 1EK2A 1PS0A 2QEQA 3COZA 2YY6A 4YASA 2WWFA 1NUQA 2A9KA 1K8YB 2ZP1A 1EB8A 4N9WA 4GEKA 2P6OA 2QTTA 4EY5A 4ODIA 3G9ZA 4CL2A 3BT7A 4B2IA 2G9ZA 2PSHA 2XVAA 1T2DA 2J3DA 4E22A 2Y0EA 4DCTA 3VZSA 4HBZA 3GLIE 1OREA 5L40A 2X3YA 3H11B 4B47A 3Q87B 1IQRA 2C96A 1NZFA 3OWHA 3UH1A 1RFGE 3PJFA 1T9BA 2NO4A 4ZZ0A 1E6WA 3IULA 1KQPA 2XWBF 1QVWA 1A5ZA 1E1RD 2XMCA 3P9PA 4EPTA 1KIAA 2W0MA 4K6CA 4QJ5A 4CXMA 4DR2B 1GM5A 2Z6UA 2RSLA 2D5AA 3A6JA 4GDMA 1V11B 2UYQA 4NY1A 4EEZA 3MHTA 2M32A 3DFZA 2A0WA 4F2WA 2V0NA 2O3TA 3IHTA 1TM1E 1E3MA 3X2SA 4BB5A 5AW4A 3I9LA 1HY3A 1YQDA 2C5BA 1YQGA 1X0XA 1L7DA 5CM9C 3AI3A 3CUKA 5EP4A 4AFNA 4ZHQF 1A4XA 2O8CB 4OAPA 4D0SA 4G5OA 2IEIA 2P7HA 1J90A 2VHCA 4FYPA 1GT6A 1NF2A 1FUEA 2WAXA 1FX0A 3PPYA 1Y48E 1SC1A 2R00A 2ZYIA 5AOVA 2HMYB 2PZJA 5KIAA 4YMIA 4PSKA 4Z3DA 2BKXA 4GI1A 4KAXA 2P5UA 1LBIA 3LU1A 4RBNA 3RS9A 4ENWA 4QFBA 1FYVA 4QEKA 1ADBA 2ASVA 2FWBA 4CIXA 3KQLA 3NGLA 2RBKA 2VJYA 2NT4A 2QL6A 3OCWA 1I2ZA 1NAHA 2EJUA 1EP2B 3ORSA 5DHAA 3SSOA 5C9ZA 2GHIA 1DIGA 1SHLA 4CKEA 3IAFA 4PXSA 4QASA 5LZ9A 2G76A 2N1MA 4IH9A 1LK7A 2O4CA 2VZ8A 1SBYA 2EW1A 1GXSA 2Q5QA 3O1JC 1HXHA 5FQOA 2BEWB 2QW1A 4WKGA 3WIEA 2FWAA 3FFWA 4QBFA 4U0JA 2XRFA 4FZ5A 2MSNA 2RHLA 1AXRA 5KX5F 3QZUA 3AC0A 4UFPA 5JJCA 2O7VA 2R6JA 1N8NA 1TF7A 2OUIA 2R87A 1C4KA 3LW7A 4YS6A 5JPIA 3A2NA 1P0IA 4R6XA 3RSQA 3PLNA 2FMXA 5DYTA 3A28A 3AXSA 4XYGA 3G6KA 4TKVB 3HKCA 4BNDA 4LHEA 2O2EA 3SSNA 5JNUA 1YQTA 1A9XB 3HA2A 1UXKA 2JIDA 4QOFA 1CS4C 2I03A 5IZCC 3L4BA 4LQLA 4NHOA 1EKXA 5JNVA 2VO1A 3NT5A 2Z2IA 5ADWA 1B3BA 5DXAA 4RKWA 2CWDA 4NX2A 5TDHA 2VJKA 3PGVA 2IPLA 2PUFA 1JE1A 2Z8YM 4GQBA 5JCXA 3AEUB 2ZUCA 1BO6A 1ARZA 2XB4A 2ZS8A 3DBIA 5B37A 1E9VA 3KQPA 2R7AA 4EL0A 3MBKA 2HPHA 3OY7A 3R7NA 3SIPA 4FYIA 1PI3A 2I6GA 1NXVA 1NQXA 1U7UA 3ID6C 4L9RA 4QQKA 1U6IA 4XW2A 5TEWA 5ICGA 3HP1A 4F8EA 5TARA 4YDSA 4HDSA 3QENA 4QPJC 5A5DA 1Y3BE 4K28A 3S55A 2F9LA 3MPUA 1BXKA 4KQ1A 1SD2A 2Q2QA 4DCOA 3RABA 1NUHA 1RABA 5DBGA 5EPEA 4GM1A 3DTYA 4Z1MA 2OXTA 3RTEA 4QO7A 2BAGA 4NG4A 4NMHA 3T7AA 1E7RA 2WT8A 3QY0A 3DO5A 3TNLA 3ZDFA 4AS3A 1KJZA 2XUQA 3CX7A 3T5TA 5KTYA 3IIMA 3AT1A 2HK8A 3GT4A 4WDRA 5DCUA 5IUJC 4FUQA 1NQUA 1FQOA 4RIIA 5DT2A 1KJ9A 4MUJA 4ARZB 3NTOA 3VZRA 4HZUB 4RQUA 1V5FA 2GSWA 1KAEA 3QKUA 4R4JA 1GPWB 4FFVA 2X3FA 4P2GA 4G84A 5IHXA 2C29D 1SVNA 2C92A 3IS3A 4PZCA 2J5XA 4C0HA 5JWRA 1IPEA 4JLOA 4YR7A 1PYGA 5FUQA 3ZKWA 4G0OA 4D8TA 3WTBA 2YXDA 3WGVA 3ONDA 1XCBA 2WF5A 1EWQA 1L5HB 3E81A 4LCEA 3NGXA 1MX5A 2FCAA 2ZTHA 4JXKA 4Z86A 3RS7A 4ZI2A 2REBA 1UOPA 4DJJA 4NULA 3V8NA 3OLQA 4AY6A 3M6FA 3WIUA 3A6PC 2P9ZA 2FQQA 1OH7A 4CQLA 3PLRA 3RBAA 3BVPA 3N2YA 2PX5A 4KVAA 1RYMA 2IFTA 3GVIA 2AXPA 2B1IA 1X87A 3OPMA 3DCYA 5T3YA 1SIOA 3S3TA 5EXXA 3VMFA 4D9CA 3OQ1A 2JGFA 4AP5A 5KVVA 3HEAA 2FLWA 3I04M 4HGQA 1W76A 1KRWA 1P7WA 3W7VA 1XEXB 2R9VA 3H2SA 3T9CA 3RBVA 1ZM4A 4QUKA 4MR8B 1HURA 1VZ2A 1E2EA 3HN6A 4R1PA 2Z95A 5K4GA 2YBEA 3RH0A 1LDBA 4TTSA 3M4YA 3HO6A 2GCOA 4IEIA 5DYYA 3MA0A 2SICE 3IMCA 3JW8A 1QIHA 1BHSA 2XUJA 4HKTA 3GFQA 5FWYB 4AO8A 1QOZA 1YUMA 3TQIA 1A9SA 1LJUA 4G4GA 4N8EA 3RJZA 5FOVA 2A6PA 2AJDA 3B2NA 3MB5A 5CTJA 5GJBA 2AIRA 3RRFA 1K97A 3LUAA 4L8VA 5TX7A 3GARA 3HRIA 4BIIA 1VSUA 4DCSA 1WU8A 2KSQA 2NZXA 1PV4A 4G1EB 1D8AA 2IODA 4C06A 3ROFA 1DAOA 2ZK7A 1R0WA 2RGGA 3P9IA 4C0SA 5CXQA 2B21A 3LUKA 1O54A 2DFVA 1QLWA 1YFZA 2P4UA 1K08A 1YDHA 2P3OA 2PT6A 3G5MA 3HVHA 4MGYR 1WHSB 3GLGB 1T6YA 3BOSA 2OFWA 2G6BA 1QPZA 2PD6A 4V2UA 1WSBA 3KOYA 5ELXA 5AESA 1MNAA 3D1JA 4IMJB 1VIYA 3AHGA 4FSDA 1L7BA 5JASA 3H87A 3QOXA 4UCQA 1Z06A 1U9CA 2Z9BA 2BI7A 5AIAA 2R8YA 1I24A 3SC2B 4X93A 5IAOA 1VA5A 3IDOA 4K81B 4NYMR 3B12A 2O1EA 4B7UA 4KN9S 1U0TA 1H23A 4PFJA 1MV8A 3GFVA 4FHCA 4P6VF 3T7RA 4B4WA 2FPGB 1PNTA 2EGUA 5FUXA 2XAUA 3H5VA 4YQYA 1BWSA 4UEKA 5INTA 3ZGLA 1OXMA 3PC8A 3AIOA 1JFFB 4XVUA 1KSHA 2PANA 2X2PA 1K8QA 2RKOA 4H6WA 1HA3A 4KR0A 5KYVA 1IZ9A 3ZE0B 3I83A 5JISA 3AHJA 5EJ7A 2NADA 3UK2A 3VHRA 2BKVA 4A2CA 5A04A 1XK6A 5AHWA 5DEIA 2G5TA 1IHOA 1QG4A 1XI2A 4I4NA 2QL5A 2Q62A 1HRDA 2ZRCA 4LBZA 5K3CA 3TF5A 4Z4QA 1HR0B 1EFVA 4NCXA 1L8QA 2VP3A 1II8B 5LQAA 5IS2A 1TAUA 1WB9A 1TM5E 1G5QA 1H69A 1NP3A 2ZYGA 4V3CA 2WSBA 4F2GA 3LUHA 5LDHA 1M2HA 4A8JC 4MA4A 4GECA 3RYCB 4RKEA 1I36A 3ZK8A 1TPZA 2IGBA 3ANTA 3FTCA 2LW7A 1U3FA 4GICA 4R1UA 4PBRA 1FMJA 5CB8A 1J8VA 2WWTA 1SHKA 1CQXA 3R3XA 1SCKA 4YCNA 1DQZA 1K0FA 1E1CA 2BKAA 4O8ZA 4E2ZA 2DUNA 2I8CA 2UZIR 4YTEA 5K0ZA 3WI7A 1P8AA 3GN1A 3NEJA 2Z1MA 4QO8A 4RHUA 1VJRA 2QX9A 3IBGA 3K2BA 1H05A 1BGWA 3ZCTA 2O5CA 4J07A 5SV2A 4HB4A 2J41A 3CR3C 3BD9A 2LD4A 3H5WA 3ICVA 1BEEA 3OCYA 1DBRA 2J5BA 5IRCD 3CEPB 4OSOA 4AMBA 3Q8LA 1C5KA 2CHGA 1Y7HA 3C8DA 4NFYA 2PVCA 5AMXA 4MS3A 5LXTB 5JMPA 1N8KA 4IZOA 4CF6A 1ISHA 2F4VB 1L4UA 4DZTA 1DBQA 1L2TA 2WKQA 4JQZA 3ZWWA 1NWHA 5BPHA 5KTTA 2CFIA 4HOYA 1MD9A 2E48A 3A31A 1E1NA 3LWNA 4GOKA 2QT1A 3EDQA 3WK4A 4B6EA 4NH0A 2F55A 1M8GA 5AUOB 4PN3A 4N48A 1GPDG 2XGGA 3HDYA 3RYHA 2NZUG 2WHPB 5AVTA 4EW1A 4DL9A 1PSWA 5CIYA 4X8OA 4BS9A 3GHHA 3R0JA 4EYSA 3NV9A 1YKSA 3AQ4A 2QDXA 4B2YA 1HZJA 1TI7A 3M6MD 4GRDA 4I9GA 4NHEA 2G82A 4XUDA 4S1OA 2OMKA 5CW1A 1IIBA 3RNOA 1J07A 5C8YB 1FDTA 2X1MA 4H18A 5REQB 3VYSB 3CXUA 1QQ7A 3R5XA 4UQOA 1E2DA 3TD2A 2ZTMA 1ICIA 1Y5IA 2VYFA 5HUQA 4OHCA 2KS6A 4IV5A 2RH9B 4ZEXA 2JI8A 1FDUA 4B4KA 4R98A 3A6ZA 3M81A 4AXXA 2YXPX 2X0NA 1EIZA 2I76A 1W5BA 1J4AA 3A9SA 2Y0CA 1UEJA 2GD1O 2FLVA 2WK1A 4E33A 4X7RA 4A6EA 4MUBA 1E0AA 1O6ZA 1TM2A 3HWWA 3QE3A 1OXTA 1I6WA 4L7VA 1M10A 3V8RA 1GQSA 1G8JA 3HADA 1C7FA 4V0OA 2Y66A 3CU5A 1N34B 2ZS7A 2FQWA 1L9KA 5HX7A 4TT8A 4QNMA 4DR6B 3D6HA 2YC4C 1NOIA 1Z4JA 3O21A 5FV4A 5D3MB 1Y0BA 4IV8A 4ALIA 2I78A 4Z7JA 4GZ3A 1CUBA 4AG3A 3LX6A 4JV5B 4NFHA 4DMKA 1YS4A 4BKOA 3F5MA 3GIWA 3K73O 4AY4A 1TQHA 2C7RA 3V5NA 1DWPA 2J3EA 4GO1A 1Y6RA 1LQ2A 1P7VA 5K2OA 1Q1EA 1XRQA 3GGSA 4WOBA 1NW9B 1I0IA 3A6HA 1HDOA 4B43A 5BRAA 4HPJB 5I9MA 2I33A 3NRJA 2VWHA 1M1UA 1S9DA 1JPUA 1U2RA 3FOWA 4M6WB 1XJCA 1QF7A 3EUAA 1P7ZA 4KXFB 3VMMA 3UGTA 4B6RA 4D96A 4EPXA 3PWSA 5IULC 2ZT7A 4FILA 3OTOB 4OHKA 4KH0A 5EIAA 1RBYA 2HRBA 4NBWA 4MUHA 1QVAA 1RIIA 4RZXA 4OI2A 3IAUA 2IXFA 1DWQA 5T3UA 3FZQA 4D82A 5HKLA 5ITZA 1TF2A 2PNJA 2WV9A 4AECA 5CG2A 3BERA 5B1YA 1MHTA 2OP0A 4B2PA 5JJLA 1XYVA 3SFZA 2IW3A 3ETGA 5DLYA 4B3SB 1DWOA 3O38A 3ZD7A 3IE1A 1PTJC 3H9GA 4ND5A 2ZYUX 5FQNA 2WJ3A 4RPJA 2RIRA 1JRLA 4C30A 2VHXA 3QLEA 3WNQA 2A5JA 2ZI7A 3QYAA 2O05A 4MV8A 1U0HC 2CFOA 3KVNA 1DIBA 2C0QA 2QYSA 2YV4A 1Y5LA 4R16A 1W36C 4ND3A 1EEHA 2G83A 3DZJA 1Y8CA 3SJCA 1LBSA 4KNYA 1QXSA 1T0JB 4X71A 3MWJA 3DS8A 3HNPA 4EG5A 2D1RA 3PUYA 1G291 2WJ4A 3SYTA 4C7BA 1Y9ZA 4OLHA 4TMKA 1R0LA 4UCWA 4DDMA 1CF9A 1DPGA 3HA7A 3CLVA 3KAKA 5CDHA 3K0FB 5DGCA 5JTTA 2VWPA 4FOPA 1IWPB 3IPRA 2RK3A 3CLUC 4UBIA 1JG3A 1ACJA 1FZTA 4QPZA 1PGQA 4J75A 2YTZA 3PC4A 1VHTA 3MUEA 2ST1A 3GGPA 2X4IA 3HEBA 4OXYA 3RKUA 3TL6A 1F12A 5HRAA 2ZU6A 1WQ4A 4G5SA 1T6BY 2UYOA 1DAEA 3ORHA 4P86A 4J0FA 3U81A 3TAXA 3WRXC 2DBVO 3CB2A 1R50A 2EX4A 5KOYA 4LC1A 1ID1A 1GL3A 1LW7A 1P60A 1IXRC 2PUVA 2LR0A 4GLFA 4JJEA 3CPHA 2W2XA 2EQBA 6CHYA 5DM1A 2BP7A 1BS9A 4BVFA 1JU3A 4TL8A 3DAGA 3TQFA 3V4FA 1EIWA 3CPEA 2P6RA 1OT3A 4LRUA 2B25A 3GDGA 2OORA 2Q4TA 3C8ZA 1Z6TA 1XZQA 1CY7A 3F9RA 2XT6A 3WFZA 4DLYA 3LPDA 4RY2A 2F48A 4UBMA 3GDHA 3VKFA 4WOKA 2PYIA 4G5YA 2A9QA 4HQLA 2A86A 4TQAA 5EKXA 3SXUB 4OYHA 1HQDA 2ZULA 3IHLA 1QHSA 4FZ3A 5CA1F 4GP6A 1W4ZA 3ZY4A 2YHUA 1ID8A 1VPWA 1SA0B 1NXQA 1E99A 5DP2A 4C0XA 1Q3TA 2DTXA 3I0MA 1O96A 4HTFB 3VAYA 3RC8A 2VRCA 1P0MA 1XFDA 1SVSA 3WYGA 2BUCA 4R7ZA 5LZ8A 2H1OA 2WHQA 1GA4A 3FROA 3W1WA 3BD8A 3EZXA 3ZXIA 5GV8A 3KLMX 4HK4A 4U4AA 1V9LA 1FYFA 4MPDA 2WD7B 3OFND 2AMFA 5IDVA 4B34A 7REQB 4D3FA 3ES9A 1WJGA 3X1WA 2H1LA 1DFGA 1M1YE 2V45A 4GD3Q 3T3NA 4WFQA 1GU1A 4Q9LA 3AJAA 3TYXA 3VH1A 1QGZA 3BSFA 4RM2A 4DREA 4EGQA 4NV1A 5FB3A 1LRJA 4ZVNA 1B8UA 3DV0A 2RGXA 4XQCA 2OCBA 3DBHB 5A62A 4GMHA 1Q7TA 1JNXX 2GASA 1INLA 5AW7A 3V2GA 5F76A 2XGSA 2NSYA 1YRAA 2PJZA 2PRIA 4KQCA 1HLGA 5L3VA 4Q18A 4BUZA 3EDCA 1WEHA 2IYXA 2A59A 2BM9A 5IC5A 4ZGWA 2DQSA 3WWPA 3K6SA 2R8PA 3CLHA 3FDZB 4KI0A 2IHKA 3WL3A 2NO0A 2AXQA 3G0OA 1CUXA 1SUAA 5JSUA 2XB6A 1XTRA 4ZVUA 5G0WA 3F3YA 1H1DA 3ROXA 3GT0A 4DLKA 1ZR4A 4XTCS 3BWMA 1N3LA 2BISA 2QXYA 3KSUA 4IHJA 5DISB 2A9VA 4AJ4A 1FDWA 3MT9A 1ADGA 4EPWA 4WBXC 2ZCUA 4W8GA 5H8WA 1VGRA 5J59A 1JILA 5K3SA 1JEJA 3T5PA 1HETA 3CUEF 1BHJA 2RHTA 1H2WA 2IYAA 3PFIA 4MA5A 1W2HA 3ZOZA 3E58A 4CF3A 5K05A 1ZSVA 1GGFA 1I33A 3B1ZA 3CF2A 3DXYA 1KI9A 4KUEA 3X44A 4HWGA 1D7OA 1NI4B 1X70A 4AMYA 4BFYA 3CW9A 1CUEA 3E3LA 5JVDA 1CEXA 2I1LA 3ZCQA 4M0DA 5IVDA 1NMZA 5D7BA 2P79A 4J4TA 3C3KA 1KQFA 1QMPA 3EGDB 1T5LA 3DKIA 1L9XA 4L5BA 5AK0A 5ARCA 4DGSA 1N6HA 3UJDA 1G8GA 3GJ6A 2NTNA 2C5FA 3E9CA 5FX2A 2UVPB 1N6KA 3CWQA 2ONKA 4MINA 1CRZA 1XO1A 3T7SA 4B79A 1P6XA 3C4QA 3PL1A 2PMCA 2ADFA 2PX2A 4HI0E 1UC8A 1T43A 1LI4A 5HFNA 2DSTA 1JAZA 2CJXA 4GLBA 3WBJA 3GGDA 4YRSA 2I6FA 1QCDA 2DKOA 1BX1A 1XU4A 3CLUD 3P2EA 2E87A 3HRKA 1GZ6A 2GO7A 2ZR7A 4YCDA 5F1PA 1KYZA 3JRXA 1DO8A 1M2VA 2JGDA 4G9BA 2IDZA 3LWDA 1I2DA 5ADHA 3CO5A 1M34E 3EH1A 4HNVA 2QJRA 3EXEA 3MCWA 3OESA 1I7SB 2CHQA 4K6FA 4NENB 1SOMA 4MWSA 4YI5A 3I92A 3JZDA 1Q2XA 1QG2A 1Y33E 3I8SA 2CLDX 1AQNA 1X1BA 3QE0A 4H7DA 2WWHA 1IRIA 3BGWA 2OFPA 2F67A 3G6WA 3OZIA 5FL7D 1E2BA 1JG4A 1POWA 2J46A 1PR9A 4RH0A 2J7KA 2ZUVA 1SIBE 3L7IA 1NBME 3MWDA 3W05A 2CVHA 4IM7A 4PHFA 3SMVA 4BFTA 5DB4A 3LP6A 2NO6A 3FKJA 3RSFA 2B37A 3CISA 4DF3A 1I13A 5IJ9B 1OFUX 1OHHD 1Z0DA 3T5BA 3B70A 1S0UA 3HJAA 4X61A 2FSPA 5KTRA 4QFCA 1BE8A 3WO0A 1IBLB 1H42A 4MJ7A 2BTQA 4U7FA 4F93B 2E6KA 3WLEA 4F92B 5BQFA 2LNDA 1SD5A 3D4PA 3ZQJA 1YZQA 2Y1LA 2EJTA 3LHDA 2MU1A 3HCWA 1B0PA 4HRYA 4EJSA 4EZBA 4NJEA 5BSWA 1DTWA 1NVAA 1X8KA 3WKBA 1U9YA 1K5PA 1J06A 3M4JA 1RNLA 3Q98A 4QWWA 2OV1A 4CG3A 4JOBA 3J80A 4HG2A 4RD3A 4GKKB 1E2HA 3OLZA 4B73A 3VC1A 5F7XA 3RVNA 2ESRA 5TPZD 2BFNA 1MF7A 1NQ5A 3RI3A 1WB4A 2R5NA 5DT9A 4AMZA 1VCMA 1C9KA 2JGMA 3OHSX 2BGLA 4HXYA 4IY1A 1Z63A 4Y3UA 4BP9A 1DC6A 2FKAA 2IZZA 3IJRA 2F43B 5EP2A 3HB4X 1MOQA 4I9HA 1E64A 3QMPA 1OLXA 4MB6A 2NYUA 2W2LA 4PHCA 4TLLB 2RHCA 1ZD1A 3IDSA 3O75A 3IEKA 4WKBA 2PTHA 4DLTA 5EYPB 2Q28A 1MORA 3UJAA 1G21E 2VH2A 1B4DA 1MABA 3FZNA 5B64A 4JYCA 1PR6A 2ZYSA 4LBWA 2DG2A 5I01A 1IATA 1WE2A 3BF8A 1JHRA 1U8TA 5F2OA 1RP7A 3M9LA 4ZT2A 4U00A 4OOFA 2VJPA 4ER7A 4HGRA 3N6XA 1OJ7A 2SBTA 5K0GA 2DFTA 3OX2A 1VLQA 5IN5A 5CX1B 3WGMA 4R51A 3IIIA 4O4LF 3KQSA 1BJTA 1UK6A 4FS8A 4M0CA 2HV9A 3KLNA 4I55F 4ZYLA 1E2QA 1VJ1A 5CFMA 3M6UA 3HZHA 1WU7A 2PGNA 4OGLA 1KZGB 1P7YA 3RTAA 5I48A 3TCKA 1M6WA 4DLRA 3L77A 3HYLA 1GAJA 3QPCA 2WILA 2IU6A 4XB6B 5FYDA 4D9KA 2XNHA 3DLBA 1I30A 5AVUA 1QP4A 2CMKA 2YNMA 3H6KA 1M74A 4OJMX 4B6SA 2QUHA 3HP4A 1E6LA 3PG5A 5AI0A 1JG7A 1CULC 4GPIB 4HNGA 4KBGA 5K8JB 2IV2X 4FYJA 4KQHA 2ZIGA 1OASA 2I9PA 1XPUA 2LV8A 2SECE 1WQ3A 3FN4A 5KTOA 4M86A 3S1SA