4OK0A

Crystal structure of putative nucleotidyltransferase from h. pylori
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
225
structure length
225
Chain Sequence
b'LSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative
molecule tags Transferase
source organism Helicobacter pylori
publication title Crystal structure of JHP933 from Helicobacter pylori J99 shows two-domain architecture with a DUF1814 family nucleotidyl transferase domain and a helical bundle domain
pubmed doi rcsb
total genus 73
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ok0A02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ok0A01
4O8SA 4OK0A
chains in the Genus database with same CATH superfamily
2OCTA 2CCQA 5L4EA 3ROBA 2X68A 3BQKA 5IG3A 1RCLA 3K1SA 4UF0A 1LVKA 1PYLA 3NXJA 4JLEA 1QALA 5AQPB 3OXAA 5G1KA 3GSPA 2YU1A 2IUKA 5JR9C 4EXTA 2ZHXB 1HX1B 3P4RA 4I5QA 1TRQA 4U7IA 3EE1A 3P4QA 3RC8A 1KWIA 2YN6A 4TWHA 2I59A 1EUIC 3LT9A 2Q9QC 4EW5A 2WO0A 2KXGA 4WNKA 1TP6A 5D82A 3CPW2 1C54A 1BVIA 4BIRA 1XWMA 3K8PC 2FJEA 4AISA 3PUGA 3AAEB 3SOAA 1RMSA 4ILAA 2WDQA 4YJ3E 4DV7T 2W00A 3AMOA 2E9XC 2E5LT 5AYRB 2CHNA 2VVNA 1FUWA 1BNSA 3EVYA 1BNEA 1LVNA 1BRGA 3JCFA 4U74A 4X64T 5C2TA 3QOFA 1KNPA 4B3MT 4HOHA 5AYSC 3B8LA 4JYAT 2CFKA 4P0BA 4COFA 2GBXB 2N2NA 1JN5A 3G0KA 4QX7B 3EQQB 1R4YA 1DMQA 4B6XA 1T2HA 5L3BB 1Y64B 2IC6A 5HEHA 3WAKA 4FCJA 4DMWA 4CJNA 4PAGA 5KX5E 4IT7A 3PUWF 1MWSA 2CPTA 3RDEA 4DUYT 1ZX2A 3K9MC 4O3VA 1R4CA 1BRKA 2F56A 3CWZB 1Q7HA 1KF6A 3KZTA 2DI4A 3F7SA 3MG2A 2GBWB 1KD14 2VASA 1WYBA 2BVMA 3TLWA 1K9M4 1YKHB 1UGIA 3ZSSA 4HZ9B 3WR2A 3HX8A 3OYZA 2AAEA 2W4XA 4FCMA 3UNLA 3Q2PA 4FJOA 1CH0A 3VGNA 5ABGA 1ZGXA 1GS3A 2LT3A 4OFZA 2W62A 2D9DA 1UCUA 3T0UA 2C5KT 4IE4A 2Y48B 2W66A 3HR0A 2KWHA 1XMOT 1B2ZA 4CZZB 1U5PA 4UELA 3JUOA 2E5VA 2P0MA 2LSGA 3CCM3 4QKNA 2MF7A 2STDA 2Y73A 4PJLA 4FCZA 3QNUA 4XZCA 2FNQA 1N34T 1PY3A 2CKFB 2VKHA 1U8CB 4EYCA 3ZMZB 1W7CA 1QMAA 2E9XD 2PTFA 2OOVA 5KXJA 3F9SA 5AQUB 3JUQA 1NWWA 3C4ZA 2WDVA 3FXEB 1G8XA 4WHAA 2H89A 2CLYC 5AQLB 5HYAA 5H6RB 3PS8A 1RRLA 1MIVA 1N5HA 4CCVA 5ABFA 2WSSV 3E08A 2D42A 3AA0B 5AFUL 2CXDA 4I55E 1W0BA 2CXFA 3PJAJ 2D1WA 5STDA 3V5UA 3ANWB 2CM0A 3ETVA 1N9EA 2YFJB 4EV2A 4U7YA 2W63A 1T3BA 3LZAA 4YHHT 2W9QA 1JBTA 1MIYA 5JDMA 3SYUA 3K5TA 2CFWA 1VQK3 3OKQA 4IL4A 4OYJA 2RCDA 5EVHA 3KV4A 1F8NA 3LTDA 3LTBA 5L3DB 2EHOA 4U31A 3TLTA 3VU7H 3QB5A 3AEDA 4LF4T 1STDA 4HEAA 3G6E3 3MXZA 3UUBA 1GD3A 5JDHA 2GEXA 3CXC2 4HGAA 5AEUB 3C51A 1EA2A 5FYMA 3SRZA 4O4HE 3ER7A 1IDPA 4HE8A 1RN7A 3WDGB 2GU3A 4N6MA 1LOWA 2YFIB 1CEWI 2UUAT 1RGHA 2OA5A 3ZC1A 1B2SA 3RGRA 1UI7A 5AQIB 1AVLA 2LKGA 4PK6A 4I43B 3RYIE 3KKGA 3J7Yd 4E7SA 1IAPA 5HEOA 2W2CA 2M7OA 1BANA 4YSXA 3ZT6A 3SVAA 4L8PA 4K0UA 4LF9T 5AQVB 1IJ6A 1NWMX 4LF8T 4DUZT 3V99A 4MEIA 3QK9A 1D6UA 5M1AA 4JEHB 4UR9A 5AQHB 5CB4E 3U78A 1I2FA 3IBPA 4NHFA 2L9QA 2MC8A 4YXDA 2XQ3A 3K0ZA 5FL1A 2BVLA 1OHSA 2IMJA 3BNEA 5IG4A 3PCSA 4TWFA 2ZDJA 2XM1A 2XEPA 4LF6T 2BO9B 4WZXA 2NW7A 3ZN0B 4IPBA 3L3PA 5ABFB 3CC43 1JNRA 1BOXA 1BAOA 4K90B 4DMVA 2WU2A 4IDOA 3ANWA 1WTHA 1YGWA 3SEDA 3GRDA 3VRAA 1JBRA 2WB5A 1US1A 1UUWB 1N32T 1N5PA 4FR9A 3B13A 5LG4A 3CCV3 3AHWA 3GA8A 1GOYA 2VKJA 2DLRA 5LJNA 3LH4A 3UU6A 3H37A 3N9NA 1FGMA 2W03A 1N36T 3GAXA 3PU3A 2WGOA 1NB5I 1Q7Y4 2WY2A 5ABEA 3MJXA 5DRVA 1AVKA 2ODUA 3SOLA 4LMKA 1O7MB 3HA4A 1RN1A 3RI5A 3EDUA 1FEWA 1VQL3 2PNCA 3N54B 4C90A 3UQ7A 1UUSA 4DV3T 1T98A 2E9XA 2Z6EA 2IW5B 1SJWA 2CC3A 4X2OA 1GQEA 4CXWA 4KFFA 3IJEB 4N6UA 5AIGA 2DCFA 2E2TA 3ABVA 5IYZE 1MMAA 1V58A 3DGMA 5DABA 1NDOB 2CW9A 1TUHA 3Q5DA 3WMDA 4KT3B 3HIGA 3EF8A 2LRKA 2WMOA 1ZOYA 4GKJT 2XRXB 2SARA 1DYUA 3ONXA 1T8BA 1LKXA 4GL6A 3OV4A 2QEX3 2F5MA 3E0ZA 1ULIB 2XAGB 2NW9A 2BNGA 2WOHA 4X66T 4HWCA 5FGOA 2IY2A 1D1BA 2K5BB 3CX8B 1XNRT 4IE6A 4EYUA 3NBXX 3UULA 3S28A 2P05A 3LK42 3QK6A 4GHOA 5LOVE 1NNVA 3CQXC 3R84B 2XF3A 1E7PA 1HNXT 3H3AA 4HKVB 4P1NA 1UDII 3ONLC 1AY7A 2RGQA 4KZ1A 2CIUA 4YT0A 2Z77A 3CX6B 3S67A 2CBIA 3G06A 4P09A 5JDFA 4YHJA 5HGRA 1JB5A 1BR1A 5CA1E 1NAFA 4X62T 3K3OA 1IV9A 1Z1SA 2A9UA 2ACZA 1G73A 3F14A 2IA7A 2OWPA 1RN4A 3NRXA 3F8HA 3ZG0A 1OXZA 1B3SA 4L5GA 3NQZA 1TU5A 2LJLA 4AQYT 2XFTA 4U72A 3DZLA 2V1DB 3DH2A 2CFDA 3OVUA 3RX6A 2W6JH 3JUMA 2RBIA 1Z8UA 4DR7T 3FBLA 1RGFA 1MIWA 4EGWA 3X1DA 5JTGA 3AEGA 3C98B 1YIT3 1J5WA 3O9XA 1BNFA 1IK3A 3A8YC 1CUNA 3KVAA 1UK5A 3N9LA 4ASKA 4I0UA 3C50A 4XDWA 3CCL3 3AE2A 3CC73 1XZYA 2X66A 4ADZA 3BIRA 1L0VA 1V57A 2DWKA 4HBRA 1YVSA 3KE7A 5L3CB 3RIAA 2K3WA 2XASB 3PUXF 5LHHB 1K28A 5J1GA 2EHOC 3ZC0A 4X20E 4N3VA 2XQ4A 3DP7A 2BKPA 4EYYR 2ODVA 4H9QC 5A1LA 3DTOA 4NXMT 1B2UA 2X9XA 4IT4A 1JZDA 3I553 2Q07A 3CCJ3 3MYTA 5AQQB 1WRDA 5HXEA 1ROAA 3S27A 2M6BA 3HKCE 1ISKA 1D1CA 3FZMB 3RGLA 6RNTA 2HPLA 4HM7B 3D4AA 1I2GA 3WODG 5CA0E 2RSXA 3KSED 4XDVA 4JI7T 2F4YA 5HWXA 3LTCA 1IVWA 4X1KE 2JPFA 3N9HA 1BNRA 5JREA 1OGZA 4ZXLA 4AKHA 1BSBA 2JQKA 3ZMSB 3Q5WA 2V6YB 3ZJ2A 2CFLA 4WW0A 2B24B 3UU8A 5FP3A 2B76A 1B27A 1IQ8A 3QB5K 2FUPA 3A76A 1V9DA 5L2LA 4JEUB 1I8VA 5JQGE 3FG4A 2NWBA 4HYZA 3FSDA 1U5OA 5LP6E 4H63H 5LMNT 1AQZA 3VF1A 1YGEA 1EZ3A 1LOVA 3LDQB 4TZ4C 4QXHB 4H9PC 2MYSA 5HXRA 3DJBA 3PE0A 3CPZA 3GN5A 3AGOA 3AVSA 4HFHA 2XR8B 3JUNA 1MNDA 4FMAA 1LQMB 3TLSA 1LNHA 1Q9EA 4EZHA 3KN4A 1TFOA 5HEGA 2CWTA 1FIOA 4B3ST 1BRNL 2C11A 2NTXA 4ISSA 1AV4A 2J62A 1EKMA 4Q25A 1X1XA 5L4HA 1I94T 5LGTB 1US7B 2NOXA 2UUCT 2CG1A 1PU4A 1DU2A 2N1GA 4J5KA 1XDOA 3NVOA 3CQGB 4EV5A 3CNXA 4MBQA 3E22E 3NM7A 1E1HB 4HWDA 3PZWA 5TGNA 3N9MA 1WMNA 1OCVA 3B57A 1DETA 4KP3C 3H3HA 3VRBA 3RKOA 1SUMB 3SWHA 2GSPA 3PUVF 4TX5A 3U1WA 3PU8A 3UU3A 2UU9T 3WA2X 4ZZCA 1RGAA 4B3TT 1M9GA 2BMQB 2DL1A 3RRCA 3GZBA 4RBNA 5JDLA 2LRLA 3AAIA 4STDA 4ZI2C 1E3RA 2OQEC 2LM9A 5AQNB 3PYJA 2C10A 2QA7A 2QGUA 4MFRA 1Q814 4PK4A 4GKKT 1QLBA 4NPBA 2V6YA 3FBZA 1LXEA 3CU3A 1HYFA 4ZOLE 2YINA 3HKEE 3KCHA 2CRBA 3RPUA 3HOHA 4AI6A 3UUNA 1NU3A 4PEJA 2WS3A 5JRCA 2P38A 3S4UA 4BU4A 2L1SA 3ONJA 4K1VA 4XM4A 1YJ93 4AKYA 2YX9A 1KEYA 3B7CA 2F99A 4Z91A 3I0QA 1RLSA 4AKZA 1BRSA 5HAXA 2HMNB 1ZO2A 4LFAT 5L47A 1WMPA 1HNZT 3CC23 1UCLA 2KXPB 3G4S3 1RGKA 1IT8A 1HS7A 3C4XA 2BT3A 2ML5A 3P7IA 1TFKA 4PJJA 2I9WA 2K0MA 4R80A 4ZI3C 3NBRA 4ZS3A 5IF6A 3EBYA 3SFEA 3SXXA 5AQFB 4GSPA 2Z76A 2FJDA 4NIQA 2IMLA 3GWHA 4QHOA 2ZMAA 3OX9A 3CMA3 3KBTA 5AQOB 3RIUA 2BS3A 2KF6A 1E3VA 1PFPA 1MMDA 5TAOA 1BSAA 4O2AE 3UTKA 1GD4A 1OF5B 5CF2A 2J8XB 2WCAA 3MACA 1IVUA 1TRPA 1VQO3 5KMGP 2JQ9A 4C91A 2OLTA 3LYGA 1ZV4X 5AQKB 3IMAB 3EHZA 3MSOA 2CLYB 3ZMVB 1MGWA 3P50A 5FNVE 4R9LA 2XUEA 4DV1T 4JI6T 2VWAA 1W6CA 4XBXA 3AA6B 2K3DA 4H9SE 4OK0A 2V5DA 4DR5T 5AQGB 2KSRA 4NREA 3ETUA 5L3FB 4EZ4A 7GSPA 1GOUA 5JDNA 1GY5A 2IDOB 4IREA 5BR8T 2IUBA 4H63V 3UUXB 1W0AA 4YLHA 1VQ73 3RNTA 1DMMA 2XQ5A 1JNQA 3EB8A 2V6XA 1JB2A 4HFIA 5JPPA 3K63A 3RC3A 2KF5A 2UXDT 3BK9A 1Q824 4L8OA 3EC9A 2BMRB 2ZM2A 5FXWA 3UFGA 4ZI3D 1K8A4 1VQ93 1FUTA 3BU4A 1JNZA 2O3OA 4KMCA 3U3IA 2BG9C 4WFOA 4EV6A 5J2TE 2F4VT 2D0TA 2CX1A 3RYHE 1TJDA 1VOMA 1GOVA 1WNHA 3LTAA 2INXA 5ETWA 1BUQA 3JVCA 1WCRA 3FF0A 2GXFA 1HCIA 3LBXA 3FGYA 3VKHA 1I3FA 2XGNA 4ILCA 2M67A 3GZRA 3AE9A 1HG5A 3EN1B 3EX9A 5H6QB 5CFBA 1E97A 1B20A 3MG3A 3FH1A 2SPCA 9RNTA 5C8YE 2ZLYA 2RA1A 3TLUA 8CHOA 1LOYA 1BRIA 1TIJA 2VQFT 1M7KA 1JRQA 3PJAA 3K7CA 5BIRA 2JQQA 2XSAA 1BU4A 1VQ63 4JI2T 3TLVA 4X1YE 2J4GA 1HZ1A 4ZHQE 4MJDA 3AGNA 2X9HA 1BGSA 1OF5A 3EN8A 4CXXA 5IG0A 3VKGA 2R41A 4HM6B 3ZMTB 1CYUA 2MTQA 2YEVC 2V7KA 1WFDA 1QSDA 3MKDA 4IL9A 4KFEA 1H7CA 3KV9A 1D0YA 3ZSTA 3LSVA 2V1LA 3D3LA 2XAFB 3AE3A 1IU7A 2HMLB 3L09A 3EHCA 4CI1B 3F2EA 2W0QA 1QVG2 2WP9A 3BB9A 1O3XA 4J8TA 1B21A 4O2HA 2IC9A 4HM8B 4YY3T 3LOYA 3C4WA 3Q2MA 1EQKA 2FXTA 4CI3B 3NZPA 3CPOA 5LG3A 1WR0A 1IBLT 2V7LA 1I0VA 1OH0A 2BKOA 3N5LA 1RJOA 3NKZA 3MA9A 4UVCB 1XMQT 2K48A 2YDRA 2KRTA 5LBQB 3DGNA 1VQ43 3H51A 3WHOA 5IEOA 4FI5A 2C5JA 1O7NB 3CME3 3CIRA 2VK9A 4IE0A 3EJVA 3D0TA 3ZEFB 2Y8DA 4HWIB 2KINB 1A67A 2ML6A 3CCS3 2XGLA 2DWGA 3CCU3 4DR1T 1UCKA 2VKDA 2XHEB 4IIJE 1VCTA 3CK6A 3AHSA 3ZN1B 4JRFA 2IUJA 3LBXB 3AE6A 4QX8B 5EK3A 4AEQA 1MNEA 1KK7A 3CVRA 5D81A 1IYYA 1UGHI 4XBYA 2QRXA 2F86B 2GEYA 3EBTA 2M6IA 5FXXA 3RHWA 4G1MB 3AVRA 3ZFZA 3R6NA 3FZHB 4KUMB 4K0KT 1SQWA 1JZOA 4HWFA 2KMFA 3AEFA 1I2EA 4H61A 2K9AA 5EK2A 2BG9B 2XAHB 1IV7A 2J1DG 4A97A 3L8RA 1S35A 4CI2B 1FMWA 3RQUA 4HFEA 3OTOT 3DMCA 4N6OB 3KFQC 4DV2T 3SLUA 4YSYA 3FF2A 3NBBA 1OEDB 5EK4A 4TX4A 2E2UA 4BTXA 1YXRA 1Z0PA 4N6LA 5GONE 3BLZA 2KZ7B 4ILBA 1RGEA 2KNDA 4WYKB 3AMOB 4AXPA 4IGUA 2AXDS 4WBNE 3UFEA 2WAUA 2A3DA 3RLFF 3IA3A 5ADXL 2L8KA 4HJLB 2WM9A 3T8UA 3E99A 4DV0T 1ULJB 4JI4T 2KAAA 2XJ7A 1M62A 1D6ZA 2VURA 1YVBI 1U4QA 2L4VA 2CWOA 3ZKRA 1DE3A 3UJMA 4UIGA 2F5WA 1W6YA 2HN1A 2JDIH 1EEJA 3NX0A 4J2CA 4EIWA 2KWIB 3DGYA 3QUJA 4X5TA 5JH7E 1QVF2 3DXOA 3UL5A 2BG9E 3NBJA 3LFMA 3NV0A 3WI3A 1VRBA 2XFSA 4QXBB 5ELJA 4UVAB 3LT8A 3PUSA 4NPPA 1IVXA 4ILFA 3WA3A 1HF8A 2Y74A 2XQ9A 3IHRA 3Q9DA 2HH7A 2OTL3 3FHNA 1NO3A 2I0MA 1OGXA 1O7WB 2E2VA 4HFVA 1NJI4 1JN5B 2A15A 1FMVA 1MOLA 4UXNB 1UURA 5AEWB 2BG9A 1FGRA 1UX4A 2JMHA 3G8ZA 2CK3H 5IHYA 3T8NA 1SHZC 2XZEA 4KI0F 3JC6D 5HOHA 2NTYA 4QWTA 3IEEA 1D1AA 3X40A 4ERRA 2AE9A 2RP4A 3RYFE 3I9YA 5HCJA 1G96A 3AE1A 2LOSA 1I70A 2BMOB 2PZVA 3NQYA 1NEKA 4KHPT 3F8XA 3CQCB 1OEDA 3HI7A 2YK0A 3PGBA 3UUMA 2HMOB 5DQVA 2H7OA 2B1EA 2OQEA 4PFOA 2J47A 4JV5T 3M3ZB 1GSPA 2A72A 1VZZA 4ORLA 4JBWF 4TNWA 4KVHA 5M18A 3F57A 4WYKA 2H0GA 5F5WA 4LSOA 3RGAA 3FB2A 3ZYMA 4U13A 3ZMUB 1VQ83 1FJGT 3BNCA 1CYVA 2WOFA 1NB3I 4ISTA 3EAMA 3RKGA 1SE7A 3K3QC 5D83A 1JV2B 2XAJB 2CFGA 4ZI2D 4AQFA 2V7MA 2EHOB 3I563 1RGGA 2L3LA 1A2PA 4XBTA 5IWAT 4KHZF 1SARA 2JIWA 2JMKA 1SIHA 4PJMA 4LF7T 3CMLA 1BSEA 4MALA 1N8R4 2BS4A 3MKIA 3NV0B 4JI5T 4I50E 8RNTA 1HKXA 4QWNB 1IZNB 5RNTA 2D5UA 4GK0E 1QUUA 2D0UA 3PURA 4OUQA 3FCSB 2BBHA 5M19A 2XSHB 2H7VC 4WWUC 1B2XA 4IDPA 1VQP3 3STDA 3RIUC 4LF5T 1LQGC 2HOHA 3LXUX 2X0LB 1UW1A 1J2BA 1I3IA 3Q5EA 3DGLA 2BS2A 1LOXA 4DR6T 1FZUA 1JKGB 2NP9A 5CXOA 1BSCA 5FY7A 4BJMA 4IIAA 3PUAA 1FA3A 4IE5A 4ZI7E 2KF4A 3I0OA 1Y4KA 2MBGA 3B4OA 4KBMB 1KFYA 3QC9A 1RDSA 1GY7A 3AE4A 4BTWA 1RGLA 2LOPA 2W61A 4EEBA 3PXMA 2LQVA 5CLKA 5HEJA 2X0HA 4E7ZA 3AE8A 3I9WA 4YJ2E 4IDQA 2C0SA 1MMGA 2HN2A 3VR8A 4NXNT 3K3NA 2IAKA 3ZT5A 5DJQC 1BNGA 2JQ5A 3PV0F 1N33T 5CK6A 4NUVA 4BTYA 1A90A 4R1KA 2LHRA 2CWYA 1O7PB 1RNTA 4UV9B 3MWZA 4CDLA 6GSPA 2K54A 1FYSA 3FZKB 2CH9A 2BZBA 7STDA 3O1HA 5L3EB 2XAQB 2CXLA 2YFLB 2A2FX 5IG5A 4OX9T 5E0OA 5AIIA 5EQLA 1G0TA 3HK4A 2C5IT 1KNZA 3KIIA 3M65A 3URPA 3Q5XA 3BNDA 1OACA 4GOUA 1YKEB 3WAJA 3WOFB 4TV8E 2LSKA 2LYXA 4N6V0 1ZP0A 2WDRA 4NUUA 4WBOA 4U33A 1MWRA 3OPCA 4U2ZA 1BRHA 1N8QA 2Z7AA 5CJ5A 4N6NB 2W04A 4AKIA 4YFSA 3KBUA 2UGIA 4EBGA 5LHIB 3OWYA 3EUHA 4EEDA 4LFBT 2YDSA 5FVKA 1BIRA 5HEUA 2Z6BA 1BUJA 3PTRB 2QYWA 1CHUA 2HHHT 3AE5A 4HFDA 4YTNA 3LK3B 3CCR3 3EDVA 4DV4T 5HWYA 3X3XA 4HM4B 1QAFA 3ZLIA 2XTLA 1RGCA 2G0UA 1OWAA 3HKDE 4YTMA 4IDNA 1JB4A 3D5IA 5LMUT 4V1Av 3L0RA 1W00A 3M8CA 4LEHA 4HM3B 3IPTA 3TDGA 1JKGA 4UVBB 5LXTE 4P0AA 1W01A 5J0ZA 4Z90A 2JQHA 1UGOA 1MNLA 2WQYA 1FUSA 1XNQT 2W56A 5G2GA 3HIIA 2QIYA 5BMVE 1T72A 3P4WA 1YI23 1G02A 4IE7A 4QH4A 3KSPA 3SS1A 5LNKA 1A2KA 4GK5E 4G63A 3KVBA 2E9XB 3NWIA 4O02B 2ZM8A 5AQJB 2XSOB 4RNZA 2C4BA 4G2AA 1Y01A 2XQ6A 2WWUA 2CG0A 2CHOA 3ALAA 2BKNA 1BR4A 3ZT7A 3VSYA 4HN9A 4JI0T 1UI8A 5FY0A 4O8SA 4CPKA 4O4JE 3CKDA 1K41A 4IDZA 3P4PA 4HM1B 4ZM8A 1E2AA 2KCDA 3I0YA 3GWRA 3JAEA 5AIFA 4DR3T 4DV6T 3HL6A 2F98A 3F40A 4AKGA 2VVSA 4HKAA 1FGQA 3N2OA 2V8SV 1YQ3A 2XSBA 1RCKA 2H3RA 4DR4T 1OEDC 1BNIA 4GB5A 4ZS2A 4BA9A 2IYJA 4I4KA 1MGRA 3LJCA 4BL3A 2WU5A 5FXZA 4DO0A 4H3UA 2MOZA 3AA1B 3MK7C 1Q40A 2XH9A 1GYBA 3V5SA 4DKIA 1N9JA 3BNBA 2XQ7A 1KSIA 3X3YA 2DHRA 3AEEA 2OV9A 4N6TA 1K734 3NM2A 4EOZB 4LMLA 2UUBT 4EAHA 4N78D 4BJNA 5AQTB 2YDQA 3N9OA 2W67A 1NENA 3X42A 4J9AA 1Q42A 1T7SA 4HFBA 4OVMA 2CBJA 3L39A 2W56B 5JBSA 4GYSA 3N8BA 5IERA 4HTEA 1WLXA 2QA43 2UXXB 2WGQA 2W2UA 4H9OC 2K24A 5IENA 1BSDA 4GYRA 3TKLB 2CWVA 3CX7B 3N9QA 4LYLB 1YJN3 3NZQA 3CD63 3OW22 4MMXB 2WZIA 1OHPA 4TUYE 2CWUA 1BRJA 1I6ZA 1VQM3 2LE8A 4DR2T 3ESLA 1W4NA 3AB3B 2ES0A 4PFPA 1UCJA 2Q9QD 3LG7A 1RTUA 4EC6A 3SOYA 3FZLB 3DGOA 4K1UA 1RKYA 4DBRA 5AQMB 1KC84 4GIWA 4QXCB 2AADA 5AI1A 1CQSA 1OEDE 3RH3A 3PDYA 4AKLA 3FZWA 5I97A 4TWDA 3B4PA 1GMPA 2X9WA 5JPUA 5FKYA 5LGUB 4IHJE 4EB6E 5C3JA 2ZA4A 1ZEEA 2XQYA 4CQIA 3H3MA 2VKOA 4U2YA 3UQ4A 5CGMA 4K61A 4RZMA 5CF1A 3AXJB 3O1IA 4XB5A 2H0IA 3GN5B 2HMMB 2Y6XA 3RF1A 3P4SA 2PG8A 3RYCE 3ECFA 2UXCT 1Q40B 2LEHA 1T2IA 4XBFB 2PJQA 2HMKB 3X41A 3MZKB 2N9DA 1B2MA 2VQET 4YTPA 5BVBA 1SA0E 2MAWA 1IBMT 4U3CA 4Z8XA 4YSZA 4R4KA 3NHXA 1LVFA 2RNTA 1ZHCA 5LA6E 4F8HA 4L7KA 4OYKA 2LHNA 5JDGA 4LGQA 3SFDA 4F6RC 1VQ53 3PCRA 2CEAA 2JRKA 2DNXA 2EHOD 1ZKEA 5GSPA 1RNBA 1HG2A 1YW0A 2IHR1 4A5XA 1UCIA 3KV6A 2ZL8A 4KX6A 3ZG5A 5JR9B 1IT7A 4LZIA 1VQQA 4Q53A 4H9NC 1RHLA 6STDA 4R9KA 1VQN3 1MWUA 4PNIA 3ZCIA 3D5GA 2Q9QB 3KINB 1W09A 2X0YA 3LK2B 1BNJA 2GK9A 3S5CA 2D2SA 3N9PA 3D9RA 3FG3A 3JC6C 4HZBB 2XQ8A 1HR0T 1MMNA 1IQXA 3PUZF 1X1UA 3X3ZA 3G16A 3GZXB 1GMRA 4HM0B 2VL8A 4PJNA 4MMZB 2H88A 5FY1A 4LMIA 2P0XA 5JRCB 4AQFC 1OUNA 4CXYA 4FMCA 1X1YA 3IF8B 4FMBA 1X79A 4AIUA 1J5ET 3GMIA 4UV8B 3UT5E 3HKBE 1LRAA 1UUGB 1DMNA 4HM5B 2XQAA 2E8IA 1OHOA 3AXJA 2XY8B 1DVDA 1W6GA 2ACXA 2XM2A 5ABHA 2GU1A 2CA5A 2H0HA 2W0GA 1V74A 3OBVE 3GZYB 2LLYA 3A5XA 3AECA 4HAAA 1ROVA 3J7Yq 3BQLA 4MLKA 1OPYA 5KP1A 2PBIA 1RRHA 3PUQA 2IIUA 5LHGB 3Q1CA 3VR9A 2NR4A 2BU4A 3DM8A 5AIHA 3UL6A 3QRDA 1JJ22 4AKRB 4CN1A 3OWSA 2QGSA 5IUXA 2KT9A 1HFAA 4DBQA 1STFI 1BR2A 2V26A 5DREA 3MPHA 4JI8T 1YJW3 4B3RT 2LSJA 4ANJA 3AEAA 2UUGC 2CE7A 3OWUA 4BL2A 1M904 5L3GB 2O9UX 3FZFB 3V92A 5LCYA 1S94A 5KP3A 5EZYE 5LBMA 3AAAB 2R4IA 2WZHA 4TV9E 5JR9A 4HVNA 4O4IE 1Q864 1HX8A 1HNWT 3U97A 1O7HB 2X51A 4CN4A 3FLJA 2UXBT 2Q9QA 1TTOA 5ELUA 1ZS7A 1S723 2BBJA 2V5CA 2SBLA 1HU9A 1WR6A 5LC7A 2RPAA 2BIRA 1IJ5A 3S29A 3O1JA 4EXRA 3RQWA 4ZZBA 2P09A 1IQYA 4WYVA 3D79A 4DIDB 5FW5A 3CCQ3 1J1JA 5LGNB 4WP5A 3HI2A 5HXHA 4DV5T 3KFWX 4TN7B 3EABA 4A98A 2XPKA 3HZPA 5A0OB 5LB7B 3UU4A 1UX5A 1BR0A 2YKSA 1GMQA 4TNVA 3N2GE 1YIJ3 4RNYA 3J9X1 2UX0A 4CN6A 2V7IA 3I1AA 2X67A 4QH1A 1SPUA 3AEBA 1YD8G 5JVDE 3F7XA 3N2KE 1O7GB 5M4YA 3UB1A 4H9RC 3ZJ1A 1S5AA 3O8YA 2QVAA 2X9YA 1AJ3A 3RRWA 1HTJF 1JBSA 1WMOA 3NUVA 3DY5A 3T1YT 3RIFA 1IBKT 2LSYA 2VB6A 1LRZA 3T1HT 1X9BA 4HM2B 1I0XA 1FW7A 5F3JA 1C7HA 4MMYB 2R6GF 3SX1A 3JADA 1M1K4 2P9BA 3ZYLA 2FJAA 2YOEA 1FGTA 1UUVB 1D0ZA 1XDPA 3FXDB 5FMNA 3JUPA 2MPKA 3FKAA 4AQGA 2FJBA 1D0XA 1FGOA 1KNRA 1WQLB 2E2AA 2UXNB 2WMNA 2BDEA 5AQRB 3P8CD 4PK5A 1MWTA 4LMJA 5F8PA 1W02A 3CCE3 1B7TA 2OOVC 4X65T 5EEOA 1GY6A 4LFCT 1DVCA 3Q90A 3CNMA 2W9PA 5BXQA 1YQ4A 5HXCA 3A7MA 1IVVA 1RSNA 2LKHA 1YNVX 5G1LA 1KQS2 4L0RA 4A56A 4X1IE 2RFRA 2PFVA 3KV5A 3T8OA 5BU4A 3C64A 3Q3FA 2BHMA 2NW8A 2HPJA 3ZYKA 4JI1T 4UF0B 2JJ9A 4DVDA 1WYCA 5LJMA 5KP4A 3O4XE 4UEMA 1W5ZA 4HFCA 4KFDA 5HCMA 3A5EA 2LSIA 2KF3A 4RNTA 3EI0A 1L5GB 4X2HA 3JAFA 4DNDA 2HMJB 3B5MA 3BQIA 1M1XB 3AA7B 2CMRA 5J2UE 4J5GA 1QJGA 1SIIA 4QH5A 2LM2A 4ILUA 3ZCJA 4HWHA 2WWVA 2FBWA 1LNIA 2V7JA 3MHEA 3NRYA 3V98A 4O2BE 1A2VA 5HXSA 2ZM0A 4O4LE 5DQWA 4XAXB 1X1WA 2WBLA 5AQSB 3FG1A 1AR0A 4I4TE 4FMDA 1W2B2 1R8IA 2YU2A 1QAKA 4ZEYA 1EG9B 5FL0A 3G713 1T5YA 1W9RA 4OHFA 3MG1A 5FVLA 1D6YA 3KDSE 3WOEB 2CHCA 4JUYA 3VHLA 4BAYB 1W2ZA 1VCSA 5LYJE 2I6HA 3ZPOA 4M1PA 5LC6A 2KLQA 2CX0A 3F31A 2B1XB 3OYXA 3LMLA 3W15B 3PUYF 5JDQA 3AE7A 5KDMC 1ASKA 3OJAA 2VL0A 4JI3T 2ZM6T 5IEPA 4PW8A 7RNTA 5IW9A 4L9IA 5FXVA 4MHCA 2FGTA 3DUKA 3UU5A 4JF8A 2OTJ3 1YHQ3
chains in the Genus database with same CATH topology
2OCTA 2CCQA 3ROBA 2X68A 3BQKA 5IG3A 4UF0A 1LVKA 3NXJA 4JLEA 1QALA 3OXAA 2YU1A 2IUKA 5JR9C 4EXTA 3EE1A 3RC8A 1KWIA 2I59A 3LT9A 2Q9QC 2WO0A 2KXGA 4WNKA 1TP6A 5D82A 3CPW2 3K8PC 3PUGA 3AAEB 3SOAA 4YJ3E 2W00A 3AMOA 2E9XC 5AYRB 1FUWA 1LVNA 3EVYA 4U74A 5AYSC 3B8LA 2CFKA 4P0BA 2GBXB 2N2NA 1JN5A 3G0KA 4QX7B 3EQQB 1DMQA 4B6XA 5L3BB 1Y64B 2IC6A 3WAKA 4FCJA 4DMWA 4PAGA 5KX5E 4IT7A 3RDEA 3K9MC 1ZX2A 4O3VA 1R4CA 3CWZB 3KZTA 2DI4A 3F7SA 3MG2A 2GBWB 1KD14 2VASA 1WYBA 2BVMA 1K9M4 1YKHB 4HZ9B 3HX8A 3OYZA 4FCMA 3UNLA 3Q2PA 4FJOA 3VGNA 1GS3A 2LT3A 4OFZA 2W62A 1UCUA 3T0UA 2C5KT 4IE4A 2Y48B 3HR0A 2KWHA 4CZZB 1U5PA 4UELA 3JUOA 2P0MA 2LSGA 3CCM3 4QKNA 2MF7A 2STDA 2Y73A 4PJLA 4FCZA 4XZCA 2FNQA 2CKFB 2VKHA 1U8CB 4EYCA 3ZMZB 1W7CA 1QMAA 2E9XD 2OOVA 3F9SA 3JUQA 1NWWA 3C4ZA 3FXEB 1G8XA 4WHAA 2CLYC 5HYAA 5H6RB 3PS8A 1RRLA 1MIVA 1N5HA 4CCVA 2WSSV 3E08A 2D42A 3AA0B 5AFUL 2CXDA 4I55E 2CXFA 2D1WA 5STDA 3V5UA 3ANWB 2CM0A 3ETVA 1N9EA 2YFJB 4EV2A 2W63A 3LZAA 2W9QA 1MIYA 5JDMA 3K5TA 2CFWA 1VQK3 3OKQA 4OYJA 2RCDA 5EVHA 3KV4A 1F8NA 3LTDA 3LTBA 5L3DB 2EHOA 3VU7H 1STDA 4HEAA 3G6E3 3MXZA 1GD3A 5JDHA 2GEXA 3CXC2 4HGAA 5AEUB 3C51A 1EA2A 5FYMA 3SRZA 4O4HE 3ER7A 1IDPA 4HE8A 1RN7A 3WDGB 2GU3A 4N6MA 2YFIB 1CEWI 2OA5A 3ZC1A 3RGRA 1UI7A 1AVLA 4PK6A 4I43B 3RYIE 3KKGA 3J7Yd 4E7SA 1IAPA 2W2CA 2M7OA 3SVAA 4L8PA 4K0UA 1IJ6A 1NWMX 3V99A 4MEIA 3QK9A 1D6UA 4JEHB 4NHFA 5CB4E 3U78A 3IBPA 2L9QA 2MC8A 3K0ZA 2BVLA 1OHSA 2IMJA 3BNEA 5IG4A 3PCSA 2ZDJA 2XEPA 2BO9B 2NW7A 3ZN0B 4IPBA 3L3PA 3CC43 4K90B 4DMVA 3ANWA 1WTHA 3SEDA 3GRDA 1US1A 1UUWB 1N5PA 4FR9A 3B13A 5LG4A 3CCV3 3GA8A 2VKJA 2DLRA 5LJNA 3LH4A 3H37A 3N9NA 1FGMA 2W03A 3GAXA 3PU3A 2WGOA 1NB5I 1Q7Y4 3MJXA 5DRVA 1AVKA 2ODUA 3SOLA 1O7MB 3HA4A 3EDUA 1FEWA 1VQL3 2PNCA 3N54B 4C90A 1T98A 2CC3A 2E9XA 4X2OA 2Z6EA 2IW5B 1SJWA 4KFFA 4CXWA 3IJEB 4N6UA 5AIGA 2DCFA 2E2TA 5IYZE 1MMAA 3DGMA 5DABA 1NDOB 2CW9A 1TUHA 3WMDA 3HIGA 3EF8A 2WMOA 2XRXB 1DYUA 3ONXA 1LKXA 4GL6A 3OV4A 2QEX3 3E0ZA 1ULIB 2XAGB 2NW9A 2BNGA 2WOHA 5FGOA 1D1BA 2K5BB 3CX8B 4IE6A 4EYUA 3NBXX 3UULA 3S28A 2P05A 3LK42 3QK6A 5LOVE 3CQXC 3R84B 2XF3A 3H3AA 4HKVB 4KZ1A 2RGQA 2CIUA 2Z77A 3CX6B 3S67A 4P09A 5JDFA 4YHJA 5HGRA 1JB5A 1BR1A 5CA1E 1NAFA 3K3OA 1IV9A 1Z1SA 1G73A 3F14A 2IA7A 2OWPA 3NRXA 3F8HA 1OXZA 4L5GA 3NQZA 1TU5A 2LJLA 2XFTA 4U72A 3DZLA 2V1DB 2CFDA 3RX6A 2W6JH 3JUMA 3FBLA 1MIWA 3C98B 1YIT3 3O9XA 1IK3A 1CUNA 3KVAA 3N9LA 4ASKA 3C50A 4XDWA 3CCL3 3CC73 2X66A 4ADZA 2DWKA 4HBRA 3KE7A 5L3CB 5LHHB 2XASB 1K28A 5J1GA 2EHOC 3ZC0A 4X20E 4N3VA 3DP7A 4EYYR 2ODVA 4H9QC 5A1LA 3DTOA 2X9XA 3I553 2Q07A 3CCJ3 3MYTA 1WRDA 5HXEA 1ROAA 3S27A 3HKCE 1ISKA 1D1CA 2HPLA 4HM7B 3WODG 5CA0E 2RSXA 3KSED 4XDVA 5HWXA 3LTCA 1IVWA 4X1KE 2JPFA 3N9HA 5JREA 1OGZA 4AKHA 3ZMSB 3Q5WA 3ZJ2A 2CFLA 4WW0A 2B24B 5FP3A 1IQ8A 3A76A 1V9DA 5L2LA 4JEUB 5JQGE 3FG4A 2NWBA 4HYZA 3FSDA 1U5OA 5LP6E 4H63H 3VF1A 1YGEA 1EZ3A 4TZ4C 4QXHB 4H9PC 2MYSA 5HXRA 3DJBA 3PE0A 3CPZA 3GN5A 3AVSA 2XR8B 3JUNA 1MNDA 4FMAA 1LNHA 4EZHA 3KN4A 1TFOA 2CWTA 1FIOA 2C11A 2NTXA 4ISSA 1AV4A 1EKMA 5LGTB 1US7B 2NOXA 2CG1A 1PU4A 2N1GA 3CQGB 4EV5A 3CNXA 4MBQA 3E22E 3NM7A 1E1HB 3PZWA 5TGNA 3N9MA 1WMNA 1OCVA 3B57A 4KP3C 3H3HA 3RKOA 3SWHA 4TX5A 3U1WA 3PU8A 3WA2X 1M9GA 2BMQB 3RRCA 3GZBA 4RBNA 5JDLA 3AAIA 4STDA 4ZI2C 1E3RA 2OQEC 2LM9A 3PYJA 2C10A 2QA7A 2QGUA 4MFRA 1Q814 4PK4A 3FBZA 1LXEA 3CU3A 4ZOLE 2YINA 3HKEE 3RPUA 4AI6A 3UUNA 1NU3A 4PEJA 5JRCA 2P38A 3S4UA 4K1VA 4XM4A 1YJ93 4AKYA 2YX9A 3B7CA 2F99A 3I0QA 4AKZA 5HAXA 2HMNB 1ZO2A 1WMPA 3CC23 2KXPB 3G4S3 1IT8A 1HS7A 3C4XA 2BT3A 2ML5A 3P7IA 2K0MA 4PJJA 1TFKA 2I9WA 4R80A 4ZI3C 3NBRA 4ZS3A 5IF6A 3EBYA 3SXXA 2Z76A 3GWHA 4QHOA 3OX9A 2ZMAA 3CMA3 3KBTA 1E3VA 1PFPA 1MMDA 5TAOA 4O2AE 3UTKA 1GD4A 1OF5B 5CF2A 3MACA 1IVUA 1VQO3 5KMGP 4C91A 3LYGA 1ZV4X 3IMAB 3MSOA 2CLYB 3ZMVB 5FNVE 4R9LA 2XUEA 2VWAA 1W6CA 4XBXA 3AA6B 4H9SE 4OK0A 4NREA 3ETUA 5L3FB 4EZ4A 5JDNA 1GY5A 4H63V 3UUXB 4YLHA 1VQ73 1DMMA 1JNQA 3EB8A 1JB2A 5JPPA 3K63A 3RC3A 3BK9A 1Q824 4L8OA 3EC9A 2BMRB 2ZM2A 5FXWA 4ZI3D 1K8A4 1VQ93 2O3OA 4KMCA 3U3IA 4WFOA 5J2TE 2D0TA 3RYHE 1VOMA 1WNHA 3LTAA 2INXA 5ETWA 1BUQA 3JVCA 3FF0A 2GXFA 1HCIA 3LBXA 3FGYA 3VKHA 2XGNA 2M67A 3GZRA 1HG5A 3EN1B 3EX9A 5H6QB 1E97A 3MG3A 3FH1A 2SPCA 2ZLYA 2RA1A 5C8YE 8CHOA 1TIJA 1JRQA 3K7CA 2JQQA 1VQ63 4X1YE 4ZHQE 4MJDA 2X9HA 1OF5A 3EN8A 4CXXA 5IG0A 3VKGA 4HM6B 3ZMTB 1CYUA 2MTQA 2YEVC 2V7KA 1QSDA 3MKDA 4KFEA 1H7CA 3KV9A 1D0YA 2V1LA 3D3LA 2XAFB 1IU7A 2HMLB 3L09A 3EHCA 4CI1B 3F2EA 2W0QA 1QVG2 3BB9A 1O3XA 4J8TA 4O2HA 2IC9A 4HM8B 3LOYA 3C4WA 3Q2MA 1EQKA 2FXTA 4CI3B 3NZPA 3CPOA 2V7LA 1OH0A 3N5LA 1RJOA 3MA9A 4UVCB 2K48A 2KRTA 5LBQB 3DGNA 1VQ43 3H51A 5IEOA 4FI5A 2C5JA 1O7NB 3CME3 2VK9A 4IE0A 3EJVA 3D0TA 3ZEFB 2Y8DA 2KINB 1A67A 2ML6A 3CCS3 2XGLA 2DWGA 3CCU3 2VKDA 2XHEB 4IIJE 2IUJA 3ZN1B 4JRFA 3LBXB 4QX8B 5EK3A 4AEQA 1MNEA 1KK7A 3CVRA 5D81A 4XBYA 2F86B 2GEYA 3EBTA 5FXXA 4G1MB 3AVRA 3R6NA 4KUMB 1SQWA 2KMFA 4H61A 2K9AA 5EK2A 2XAHB 1IV7A 2J1DG 1S35A 4CI2B 1FMWA 3DMCA 4N6OB 3KFQC 3SLUA 3FF2A 3NBBA 5EK4A 4TX4A 2E2UA 4BTXA 1Z0PA 4N6LA 5GONE 3BLZA 2KZ7B 2KNDA 4WYKB 3AMOB 4AXPA 4IGUA 4WBNE 3UFEA 2WAUA 2A3DA 5ADXL 2L8KA 4HJLB 2WM9A 3T8UA 3E99A 1ULJB 1D6ZA 1YVBI 1U4QA 2L4VA 2CWOA 3UJMA 4UIGA 1W6YA 2JDIH 3NX0A 4J2CA 4EIWA 2KWIB 3QUJA 5JH7E 1QVF2 3DXOA 3UL5A 3NBJA 3LFMA 3NV0A 3WI3A 1VRBA 2XFSA 4QXBB 5ELJA 4UVAB 3LT8A 3PUSA 1IVXA 3WA3A 1HF8A 2Y74A 3IHRA 3Q9DA 2HH7A 2OTL3 3FHNA 1NO3A 1OGXA 1O7WB 2E2VA 4HFVA 1NJI4 1JN5B 2A15A 1FMVA 1MOLA 4UXNB 5AEWB 1FGRA 1UX4A 2JMHA 3G8ZA 2CK3H 5IHYA 3T8NA 1SHZC 3JC6D 2NTYA 4QWTA 3IEEA 1D1AA 3X40A 4ERRA 2RP4A 3RYFE 3I9YA 1G96A 2LOSA 2BMOB 2PZVA 3NQYA 3F8XA 3CQCB 3HI7A 2YK0A 3PGBA 3UUMA 2HMOB 5DQVA 2H7OA 2B1EA 2OQEA 4PFOA 2A72A 1VZZA 4ORLA 4KVHA 3F57A 4WYKA 4LSOA 3RGAA 3FB2A 3ZYMA 4U13A 3ZMUB 1VQ83 3BNCA 1CYVA 2WOFA 1NB3I 4ISTA 3K3QC 5D83A 1JV2B 2XAJB 2CFGA 4ZI2D 4AQFA 2V7MA 2EHOB 3I563 2L3LA 4XBTA 2JMKA 1SIHA 4PJMA 3CMLA 4MALA 1N8R4 3MKIA 3NV0B 4I50E 1HKXA 4QWNB 1IZNB 2D5UA 4GK0E 1QUUA 2D0UA 3PURA 4OUQA 3FCSB 2XSHB 4WWUC 2H7VC 1VQP3 3STDA 3LXUX 2X0LB 1UW1A 1J2BA 3DGLA 1LOXA 1JKGB 2NP9A 5CXOA 5FY7A 4BJMA 4IIAA 3PUAA 1FA3A 4IE5A 4ZI7E 3I0OA 1Y4KA 2MBGA 3B4OA 4KBMB 3QC9A 1GY7A 4BTWA 2LOPA 2W61A 3PXMA 2LQVA 5CLKA 4E7ZA 3I9WA 4YJ2E 2C0SA 1MMGA 3K3NA 2IAKA 5DJQC 2JQ5A 5CK6A 4NUVA 4BTYA 1A90A 4R1KA 2LHRA 2CWYA 1O7PB 4UV9B 3MWZA 4CDLA 2K54A 2CH9A 2BZBA 7STDA 3O1HA 5L3EB 2XAQB 2CXLA 2YFLB 2A2FX 5IG5A 5E0OA 5AIIA 5EQLA 3HK4A 2C5IT 1KNZA 3KIIA 3M65A 3Q5XA 3BNDA 1OACA 4GOUA 1YKEB 3WAJA 3WOFB 4TV8E 2LSKA 2LYXA 4N6V0 4NUUA 4WBOA 1N8QA 2Z7AA 4N6NB 2W04A 4AKIA 4YFSA 3KBUA 4EBGA 5LHIB 3OWYA 3EUHA 2Z6BA 3PTRB 3LK3B 3CCR3 3EDVA 5HWYA 3X3XA 4HM4B 1QAFA 3ZLIA 2XTLA 2G0UA 1OWAA 3HKDE 1JB4A 4V1Av 3L0RA 1W00A 3M8CA 4LEHA 4HM3B 3IPTA 3TDGA 1JKGA 4UVBB 5LXTE 4P0AA 1W01A 1MNLA 2W56A 5G2GA 3HIIA 2QIYA 5BMVE 1YI23 4IE7A 3KSPA 3SS1A 5LNKA 1A2KA 4GK5E 4G63A 3KVBA 2E9XB 4O02B 2ZM8A 2XSOB 4RNZA 4G2AA 2WWUA 2CG0A 3ALAA 1BR4A 3VSYA 4HN9A 1UI8A 5FY0A 4O8SA 4O4JE 3CKDA 1K41A 4IDZA 4HM1B 4ZM8A 2KCDA 3I0YA 3GWRA 5AIFA 3HL6A 2F98A 3F40A 4AKGA 4HKAA 1FGQA 3N2OA 2H3RA 4GB5A 4ZS2A 4BA9A 4I4KA 3LJCA 5FXZA 4DO0A 4H3UA 2MOZA 3AA1B 3MK7C 2XH9A 1Q40A 1GYBA 3V5SA 1N9JA 3BNBA 1KSIA 3X3YA 2DHRA 4N6TA 1K734 3NM2A 4EOZB 4EAHA 4N78D 4BJNA 3N9OA 3X42A 4J9AA 1Q42A 4OVMA 2W56B 5JBSA 4GYSA 3N8BA 5IERA 4HTEA 1WLXA 2QA43 2UXXB 2WGQA 4H9OC 2K24A 5IENA 4GYRA 3TKLB 2CWVA 3CX7B 3N9QA 1YJN3 3NZQA 3CD63 3OW22 4MMXB 1OHPA 4TUYE 2CWUA 1VQM3 2LE8A 3ESLA 1W4NA 3AB3B 2ES0A 4PFPA 2Q9QD 3LG7A 4EC6A 3SOYA 3DGOA 4K1UA 1RKYA 4DBRA 1KC84 4GIWA 4QXCB 5AI1A 1CQSA 3RH3A 3PDYA 4AKLA 3FZWA 5I97A 3B4PA 2X9WA 5JPUA 5LGUB 4IHJE 4EB6E 1ZEEA 2XQYA 4CQIA 4K61A 2VKOA 4RZMA 5CF1A 3O1IA 4XB5A 2HMMB 3GN5B 2Y6XA 2PG8A 3RYCE 3ECFA 1Q40B 2LEHA 4XBFB 2PJQA 2HMKB 3X41A 3MZKB 2N9DA 5BVBA 1SA0E 4Z8XA 4R4KA 3NHXA 1LVFA 1ZHCA 5LA6E 4L7KA 4OYKA 2LHNA 5JDGA 4LGQA 4F6RC 1VQ53 3PCRA 2CEAA 2DNXA 2EHOD 2JRKA 1ZKEA 1HG2A 1YW0A 3KV6A 2ZL8A 5JR9B 1IT7A 4LZIA 4Q53A 4H9NC 6STDA 4R9KA 1VQN3 4PNIA 3ZCIA 2Q9QB 3KINB 3LK2B 2GK9A 3S5CA 2D2SA 3N9PA 3D9RA 3FG3A 3JC6C 4HZBB 1IQXA 1MMNA 3X3ZA 3G16A 3GZXB 4HM0B 2VL8A 4PJNA 4MMZB 5FY1A 4LMIA 2P0XA 5JRCB 4AQFC 1OUNA 4CXYA 4FMCA 3IF8B 4FMBA 1X79A 3GMIA 4UV8B 3UT5E 3HKBE 1DMNA 4HM5B 2E8IA 1OHOA 1DVDA 1W6GA 2ACXA 2GU1A 2CA5A 2W0GA 1V74A 3OBVE 3GZYB 3A5XA 1ROVA 3J7Yq 3BQLA 4MLKA 1OPYA 5KP1A 2PBIA 1RRHA 3PUQA 5LHGB 3Q1CA 3DM8A 5AIHA 3UL6A 3QRDA 1JJ22 4AKRB 3OWSA 2QGSA 2KT9A 1HFAA 4DBQA 1STFI 1BR2A 2V26A 5DREA 3MPHA 1YJW3 2LSJA 4ANJA 2CE7A 3OWUA 1M904 5L3GB 2O9UX 3V92A 5LCYA 1S94A 5KP3A 5EZYE 5LBMA 3AAAB 2R4IA 4TV9E 5JR9A 4HVNA 4O4IE 1Q864 1HX8A 3U97A 1O7HB 2X51A 3FLJA 5ELUA 2Q9QA 1S723 2SBLA 1HU9A 1WR6A 5LC7A 1IJ5A 3S29A 3O1JA 4EXRA 2P09A 1IQYA 5FW5A 3CCQ3 5LGNB 4WP5A 3HI2A 5HXHA 3KFWX 4TN7B 3HZPA 5A0OB 1UX5A 1BR0A 1YIJ3 3N2GE 4RNYA 3J9X1 2UX0A 2V7IA 3I1AA 2X67A 1SPUA 1YD8G 5JVDE 3F7XA 3N2KE 1O7GB 5M4YA 3UB1A 4H9RC 3ZJ1A 1S5AA 3O8YA 2X9YA 1AJ3A 3RRWA 1HTJF 1WMOA 3NUVA 3DY5A 2LSYA 2VB6A 1LRZA 4HM2B 5F3JA 1C7HA 4MMYB 3SX1A 1M1K4 2P9BA 3ZYLA 1FGTA 1UUVB 1D0ZA 3FXDB 5FMNA 3JUPA 3FKAA 4AQGA 1FGOA 1D0XA 1WQLB 2UXNB 2WMNA 2BDEA 3P8CD 4PK5A 5F8PA 1W02A 3CCE3 1B7TA 2OOVC 5EEOA 1GY6A 1DVCA 3Q90A 3CNMA 2W9PA 5BXQA 5HXCA 1IVVA 1KQS2 4L0RA 4A56A 4X1IE 2RFRA 2PFVA 3KV5A 3T8OA 3C64A 2BHMA 2NW8A 2HPJA 3ZYKA 4UF0B 2JJ9A 4DVDA 1WYCA 5LJMA 5KP4A 3O4XE 4UEMA 1W5ZA 4KFDA 2LSIA 1L5GB 4X2HA 4DNDA 2HMJB 3BQIA 1M1XB 3AA7B 2CMRA 5J2UE 1QJGA 1SIIA 4ILUA 3ZCJA 2V7JA 3MHEA 3NRYA 3V98A 4O2BE 1A2VA 5HXSA 2ZM0A 4O4LE 5DQWA 4XAXB 2WBLA 3FG1A 1AR0A 4I4TE 4FMDA 1W2B2 2YU2A 1QAKA 1EG9B 3G713 1T5YA 4OHFA 3MG1A 1D6YA 3KDSE 3WOEB 2CHCA 4JUYA 3VHLA 4BAYB 1W2ZA 5LYJE 3ZPOA 4M1PA 5LC6A 2KLQA 3F31A 2B1XB 3OYXA 3LMLA 3W15B 5JDQA 5KDMC 1ASKA 3OJAA 5IEPA 4PW8A 5IW9A 4L9IA 5FXVA 4MHCA 2FGTA 3DUKA 4JF8A 2OTJ3 1YHQ3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O8S A;  4OK0 A; 
#chains in the Genus database with same CATH topology
 2OCT A;  2CCQ A;  5L4E A;  3ROB A;  2X68 A;  3BQK A;  5IG3 A;  1RCL A;  3K1S A;  4UF0 A;  1LVK A;  1PYL A;  3NXJ A;  4JLE A;  1QAL A;  5AQP B;  3OXA A;  5G1K A;  3GSP A;  2YU1 A;  2IUK A;  5JR9 C;  4EXT A;  2ZHX B;  1HX1 B;  3P4R A;  4I5Q A;  1TRQ A;  4U7I A;  3EE1 A;  3P4Q A;  3RC8 A;  1KWI A;  2YN6 A;  4TWH A;  2I59 A;  1EUI C;  3LT9 A;  2Q9Q C;  4EW5 A;  2WO0 A;  2KXG A;  4WNK A;  1TP6 A;  5D82 A;  3CPW 2;  1C54 A;  1BVI A;  4BIR A;  1XWM A;  3K8P C;  2FJE A;  4AIS A;  3PUG A;  3AAE B;  3SOA A;  1RMS A;  4ILA A;  2WDQ A;  4YJ3 E;  4DV7 T;  2W00 A;  3AMO A;  2E9X C;  2E5L T;  5AYR B;  2CHN A;  2VVN A;  1FUW A;  1BNS A;  3EVY A;  1BNE A;  1LVN A;  1BRG A;  3JCF A;  4U74 A;  4X64 T;  5C2T A;  3QOF A;  1KNP A;  4B3M T;  4HOH A;  5AYS C;  3B8L A;  4JYA T;  2CFK A;  4P0B A;  4COF A;  2GBX B;  2N2N A;  1JN5 A;  3G0K A;  4QX7 B;  3EQQ B;  1R4Y A;  1DMQ A;  4B6X A;  1T2H A;  5L3B B;  1Y64 B;  2IC6 A;  5HEH A;  3WAK A;  4FCJ A;  4DMW A;  4CJN A;  4PAG A;  5KX5 E;  4IT7 A;  3PUW F;  1MWS A;  2CPT A;  3RDE A;  4DUY T;  1ZX2 A;  3K9M C;  4O3V A;  1R4C A;  1BRK A;  2F56 A;  3CWZ B;  1Q7H A;  1KF6 A;  3KZT A;  2DI4 A;  3F7S A;  3MG2 A;  2GBW B;  1KD1 4;  2VAS A;  1WYB A;  2BVM A;  3TLW A;  1K9M 4;  1YKH B;  1UGI A;  3ZSS A;  4HZ9 B;  3WR2 A;  3HX8 A;  3OYZ A;  2AAE A;  2W4X A;  4FCM A;  3UNL A;  3Q2P A;  4FJO A;  1CH0 A;  3VGN A;  5ABG A;  1ZGX A;  1GS3 A;  2LT3 A;  4OFZ A;  2W62 A;  2D9D A;  1UCU A;  3T0U A;  2C5K T;  4IE4 A;  2Y48 B;  2W66 A;  3HR0 A;  2KWH A;  1XMO T;  1B2Z A;  4CZZ B;  1U5P A;  4UEL A;  3JUO A;  2E5V A;  2P0M A;  2LSG A;  3CCM 3;  4QKN A;  2MF7 A;  2STD A;  2Y73 A;  4PJL A;  4FCZ A;  3QNU A;  4XZC A;  2FNQ A;  1N34 T;  1PY3 A;  2CKF B;  2VKH A;  1U8C B;  4EYC A;  3ZMZ B;  1W7C A;  1QMA A;  2E9X D;  2PTF A;  2OOV A;  5KXJ A;  3F9S A;  5AQU B;  3JUQ A;  1NWW A;  3C4Z A;  2WDV A;  3FXE B;  1G8X A;  4WHA A;  2H89 A;  2CLY C;  5AQL B;  5HYA A;  5H6R B;  3PS8 A;  1RRL A;  1MIV A;  1N5H A;  4CCV A;  5ABF A;  2WSS V;  3E08 A;  2D42 A;  3AA0 B;  5AFU L;  2CXD A;  4I55 E;  1W0B A;  2CXF A;  3PJA J;  2D1W A;  5STD A;  3V5U A;  3ANW B;  2CM0 A;  3ETV A;  1N9E A;  2YFJ B;  4EV2 A;  4U7Y A;  2W63 A;  1T3B A;  3LZA A;  4YHH T;  2W9Q A;  1JBT A;  1MIY A;  5JDM A;  3SYU A;  3K5T A;  2CFW A;  1VQK 3;  3OKQ A;  4IL4 A;  4OYJ A;  2RCD A;  5EVH A;  3KV4 A;  1F8N A;  3LTD A;  3LTB A;  5L3D B;  2EHO A;  4U31 A;  3TLT A;  3VU7 H;  3QB5 A;  3AED A;  4LF4 T;  1STD A;  4HEA A;  3G6E 3;  3MXZ A;  3UUB A;  1GD3 A;  5JDH A;  2GEX A;  3CXC 2;  4HGA A;  5AEU B;  3C51 A;  1EA2 A;  5FYM A;  3SRZ A;  4O4H E;  3ER7 A;  1IDP A;  4HE8 A;  1RN7 A;  3WDG B;  2GU3 A;  4N6M A;  1LOW A;  2YFI B;  1CEW I;  2UUA T;  1RGH A;  2OA5 A;  3ZC1 A;  1B2S A;  3RGR A;  1UI7 A;  5AQI B;  1AVL A;  2LKG A;  4PK6 A;  4I43 B;  3RYI E;  3KKG A;  3J7Y d;  4E7S A;  1IAP A;  5HEO A;  2W2C A;  2M7O A;  1BAN A;  4YSX A;  3ZT6 A;  3SVA A;  4L8P A;  4K0U A;  4LF9 T;  5AQV B;  1IJ6 A;  1NWM X;  4LF8 T;  4DUZ T;  3V99 A;  4MEI A;  3QK9 A;  1D6U A;  5M1A A;  4JEH B;  4UR9 A;  5AQH B;  5CB4 E;  3U78 A;  1I2F A;  3IBP A;  4NHF A;  2L9Q A;  2MC8 A;  4YXD A;  2XQ3 A;  3K0Z A;  5FL1 A;  2BVL A;  1OHS A;  2IMJ A;  3BNE A;  5IG4 A;  3PCS A;  4TWF A;  2ZDJ A;  2XM1 A;  2XEP A;  4LF6 T;  2BO9 B;  4WZX A;  2NW7 A;  3ZN0 B;  4IPB A;  3L3P A;  5ABF B;  3CC4 3;  1JNR A;  1BOX A;  1BAO A;  4K90 B;  4DMV A;  2WU2 A;  4IDO A;  3ANW A;  1WTH A;  1YGW A;  3SED A;  3GRD A;  3VRA A;  1JBR A;  2WB5 A;  1US1 A;  1UUW B;  1N32 T;  1N5P A;  4FR9 A;  3B13 A;  5LG4 A;  3CCV 3;  3AHW A;  3GA8 A;  1GOY A;  2VKJ A;  2DLR A;  5LJN A;  3LH4 A;  3UU6 A;  3H37 A;  3N9N A;  1FGM A;  2W03 A;  1N36 T;  3GAX A;  3PU3 A;  2WGO A;  1NB5 I;  1Q7Y 4;  2WY2 A;  5ABE A;  3MJX A;  5DRV A;  1AVK A;  2ODU A;  3SOL A;  4LMK A;  1O7M B;  3HA4 A;  1RN1 A;  3RI5 A;  3EDU A;  1FEW A;  1VQL 3;  2PNC A;  3N54 B;  4C90 A;  3UQ7 A;  1UUS A;  4DV3 T;  1T98 A;  2E9X A;  2Z6E A;  2IW5 B;  1SJW A;  2CC3 A;  4X2O A;  1GQE A;  4CXW A;  4KFF A;  3IJE B;  4N6U A;  5AIG A;  2DCF A;  2E2T A;  3ABV A;  5IYZ E;  1MMA A;  1V58 A;  3DGM A;  5DAB A;  1NDO B;  2CW9 A;  1TUH A;  3Q5D A;  3WMD A;  4KT3 B;  3HIG A;  3EF8 A;  2LRK A;  2WMO A;  1ZOY A;  4GKJ T;  2XRX B;  2SAR A;  1DYU A;  3ONX A;  1T8B A;  1LKX A;  4GL6 A;  3OV4 A;  2QEX 3;  2F5M A;  3E0Z A;  1ULI B;  2XAG B;  2NW9 A;  2BNG A;  2WOH A;  4X66 T;  4HWC A;  5FGO A;  2IY2 A;  1D1B A;  2K5B B;  3CX8 B;  1XNR T;  4IE6 A;  4EYU A;  3NBX X;  3UUL A;  3S28 A;  2P05 A;  3LK4 2;  3QK6 A;  4GHO A;  5LOV E;  1NNV A;  3CQX C;  3R84 B;  2XF3 A;  1E7P A;  1HNX T;  3H3A A;  4HKV B;  4P1N A;  1UDI I;  3ONL C;  1AY7 A;  2RGQ A;  4KZ1 A;  2CIU A;  4YT0 A;  2Z77 A;  3CX6 B;  3S67 A;  2CBI A;  3G06 A;  4P09 A;  5JDF A;  4YHJ A;  5HGR A;  1JB5 A;  1BR1 A;  5CA1 E;  1NAF A;  4X62 T;  3K3O A;  1IV9 A;  1Z1S A;  2A9U A;  2ACZ A;  1G73 A;  3F14 A;  2IA7 A;  2OWP A;  1RN4 A;  3NRX A;  3F8H A;  3ZG0 A;  1OXZ A;  1B3S A;  4L5G A;  3NQZ A;  1TU5 A;  2LJL A;  4AQY T;  2XFT A;  4U72 A;  3DZL A;  2V1D B;  3DH2 A;  2CFD A;  3OVU A;  3RX6 A;  2W6J H;  3JUM A;  2RBI A;  1Z8U A;  4DR7 T;  3FBL A;  1RGF A;  1MIW A;  4EGW A;  3X1D A;  5JTG A;  3AEG A;  3C98 B;  1YIT 3;  1J5W A;  3O9X A;  1BNF A;  1IK3 A;  3A8Y C;  1CUN A;  3KVA A;  1UK5 A;  3N9L A;  4ASK A;  4I0U A;  3C50 A;  4XDW A;  3CCL 3;  3AE2 A;  3CC7 3;  1XZY A;  2X66 A;  4ADZ A;  3BIR A;  1L0V A;  1V57 A;  2DWK A;  4HBR A;  1YVS A;  3KE7 A;  5L3C B;  3RIA A;  2K3W A;  2XAS B;  3PUX F;  5LHH B;  1K28 A;  5J1G A;  2EHO C;  3ZC0 A;  4X20 E;  4N3V A;  2XQ4 A;  3DP7 A;  2BKP A;  4EYY R;  2ODV A;  4H9Q C;  5A1L A;  3DTO A;  4NXM T;  1B2U A;  2X9X A;  4IT4 A;  1JZD A;  3I55 3;  2Q07 A;  3CCJ 3;  3MYT A;  5AQQ B;  1WRD A;  5HXE A;  1ROA A;  3S27 A;  2M6B A;  3HKC E;  1ISK A;  1D1C A;  3FZM B;  3RGL A;  6RNT A;  2HPL A;  4HM7 B;  3D4A A;  1I2G A;  3WOD G;  5CA0 E;  2RSX A;  3KSE D;  4XDV A;  4JI7 T;  2F4Y A;  5HWX A;  3LTC A;  1IVW A;  4X1K E;  2JPF A;  3N9H A;  1BNR A;  5JRE A;  1OGZ A;  4ZXL A;  4AKH A;  1BSB A;  2JQK A;  3ZMS B;  3Q5W A;  2V6Y B;  3ZJ2 A;  2CFL A;  4WW0 A;  2B24 B;  3UU8 A;  5FP3 A;  2B76 A;  1B27 A;  1IQ8 A;  3QB5 K;  2FUP A;  3A76 A;  1V9D A;  5L2L A;  4JEU B;  1I8V A;  5JQG E;  3FG4 A;  2NWB A;  4HYZ A;  3FSD A;  1U5O A;  5LP6 E;  4H63 H;  5LMN T;  1AQZ A;  3VF1 A;  1YGE A;  1EZ3 A;  1LOV A;  3LDQ B;  4TZ4 C;  4QXH B;  4H9P C;  2MYS A;  5HXR A;  3DJB A;  3PE0 A;  3CPZ A;  3GN5 A;  3AGO A;  3AVS A;  4HFH A;  2XR8 B;  3JUN A;  1MND A;  4FMA A;  1LQM B;  3TLS A;  1LNH A;  1Q9E A;  4EZH A;  3KN4 A;  1TFO A;  5HEG A;  2CWT A;  1FIO A;  4B3S T;  1BRN L;  2C11 A;  2NTX A;  4ISS A;  1AV4 A;  2J62 A;  1EKM A;  4Q25 A;  1X1X A;  5L4H A;  1I94 T;  5LGT B;  1US7 B;  2NOX A;  2UUC T;  2CG1 A;  1PU4 A;  1DU2 A;  2N1G A;  4J5K A;  1XDO A;  3NVO A;  3CQG B;  4EV5 A;  3CNX A;  4MBQ A;  3E22 E;  3NM7 A;  1E1H B;  4HWD A;  3PZW A;  5TGN A;  3N9M A;  1WMN A;  1OCV A;  3B57 A;  1DET A;  4KP3 C;  3H3H A;  3VRB A;  3RKO A;  1SUM B;  3SWH A;  2GSP A;  3PUV F;  4TX5 A;  3U1W A;  3PU8 A;  3UU3 A;  2UU9 T;  3WA2 X;  4ZZC A;  1RGA A;  4B3T T;  1M9G A;  2BMQ B;  2DL1 A;  3RRC A;  3GZB A;  4RBN A;  5JDL A;  2LRL A;  3AAI A;  4STD A;  4ZI2 C;  1E3R A;  2OQE C;  2LM9 A;  5AQN B;  3PYJ A;  2C10 A;  2QA7 A;  2QGU A;  4MFR A;  1Q81 4;  4PK4 A;  4GKK T;  1QLB A;  4NPB A;  2V6Y A;  3FBZ A;  1LXE A;  3CU3 A;  1HYF A;  4ZOL E;  2YIN A;  3HKE E;  3KCH A;  2CRB A;  3RPU A;  3HOH A;  4AI6 A;  3UUN A;  1NU3 A;  4PEJ A;  2WS3 A;  5JRC A;  2P38 A;  3S4U A;  4BU4 A;  2L1S A;  3ONJ A;  4K1V A;  4XM4 A;  1YJ9 3;  4AKY A;  2YX9 A;  1KEY A;  3B7C A;  2F99 A;  4Z91 A;  3I0Q A;  1RLS A;  4AKZ A;  1BRS A;  5HAX A;  2HMN B;  1ZO2 A;  4LFA T;  5L47 A;  1WMP A;  1HNZ T;  3CC2 3;  1UCL A;  2KXP B;  3G4S 3;  1RGK A;  1IT8 A;  1HS7 A;  3C4X A;  2BT3 A;  2ML5 A;  3P7I A;  1TFK A;  4PJJ A;  2I9W A;  2K0M A;  4R80 A;  4ZI3 C;  3NBR A;  4ZS3 A;  5IF6 A;  3EBY A;  3SFE A;  3SXX A;  5AQF B;  4GSP A;  2Z76 A;  2FJD A;  4NIQ A;  2IML A;  3GWH A;  4QHO A;  2ZMA A;  3OX9 A;  3CMA 3;  3KBT A;  5AQO B;  3RIU A;  2BS3 A;  2KF6 A;  1E3V A;  1PFP A;  1MMD A;  5TAO A;  1BSA A;  4O2A E;  3UTK A;  1GD4 A;  1OF5 B;  5CF2 A;  2J8X B;  2WCA A;  3MAC A;  1IVU A;  1TRP A;  1VQO 3;  5KMG P;  2JQ9 A;  4C91 A;  2OLT A;  3LYG A;  1ZV4 X;  5AQK B;  3IMA B;  3EHZ A;  3MSO A;  2CLY B;  3ZMV B;  1MGW A;  3P50 A;  5FNV E;  4R9L A;  2XUE A;  4DV1 T;  4JI6 T;  2VWA A;  1W6C A;  4XBX A;  3AA6 B;  2K3D A;  4H9S E;  4OK0 A;  2V5D A;  4DR5 T;  5AQG B;  2KSR A;  4NRE A;  3ETU A;  5L3F B;  4EZ4 A;  7GSP A;  1GOU A;  5JDN A;  1GY5 A;  2IDO B;  4IRE A;  5BR8 T;  2IUB A;  4H63 V;  3UUX B;  1W0A A;  4YLH A;  1VQ7 3;  3RNT A;  1DMM A;  2XQ5 A;  1JNQ A;  3EB8 A;  2V6X A;  1JB2 A;  4HFI A;  5JPP A;  3K63 A;  3RC3 A;  2KF5 A;  2UXD T;  3BK9 A;  1Q82 4;  4L8O A;  3EC9 A;  2BMR B;  2ZM2 A;  5FXW A;  3UFG A;  4ZI3 D;  1K8A 4;  1VQ9 3;  1FUT A;  3BU4 A;  1JNZ A;  2O3O A;  4KMC A;  3U3I A;  2BG9 C;  4WFO A;  4EV6 A;  5J2T E;  2F4V T;  2D0T A;  2CX1 A;  3RYH E;  1TJD A;  1VOM A;  1GOV A;  1WNH A;  3LTA A;  2INX A;  5ETW A;  1BUQ A;  3JVC A;  1WCR A;  3FF0 A;  2GXF A;  1HCI A;  3LBX A;  3FGY A;  3VKH A;  1I3F A;  2XGN A;  4ILC A;  2M67 A;  3GZR A;  3AE9 A;  1HG5 A;  3EN1 B;  3EX9 A;  5H6Q B;  5CFB A;  1E97 A;  1B20 A;  3MG3 A;  3FH1 A;  2SPC A;  9RNT A;  5C8Y E;  2ZLY A;  2RA1 A;  3TLU A;  8CHO A;  1LOY A;  1BRI A;  1TIJ A;  2VQF T;  1M7K A;  1JRQ A;  3PJA A;  3K7C A;  5BIR A;  2JQQ A;  2XSA A;  1BU4 A;  1VQ6 3;  4JI2 T;  3TLV A;  4X1Y E;  2J4G A;  1HZ1 A;  4ZHQ E;  4MJD A;  3AGN A;  2X9H A;  1BGS A;  1OF5 A;  3EN8 A;  4CXX A;  5IG0 A;  3VKG A;  2R41 A;  4HM6 B;  3ZMT B;  1CYU A;  2MTQ A;  2YEV C;  2V7K A;  1WFD A;  1QSD A;  3MKD A;  4IL9 A;  4KFE A;  1H7C A;  3KV9 A;  1D0Y A;  3ZST A;  3LSV A;  2V1L A;  3D3L A;  2XAF B;  3AE3 A;  1IU7 A;  2HML B;  3L09 A;  3EHC A;  4CI1 B;  3F2E A;  2W0Q A;  1QVG 2;  2WP9 A;  3BB9 A;  1O3X A;  4J8T A;  1B21 A;  4O2H A;  2IC9 A;  4HM8 B;  4YY3 T;  3LOY A;  3C4W A;  3Q2M A;  1EQK A;  2FXT A;  4CI3 B;  3NZP A;  3CPO A;  5LG3 A;  1WR0 A;  1IBL T;  2V7L A;  1I0V A;  1OH0 A;  2BKO A;  3N5L A;  1RJO A;  3NKZ A;  3MA9 A;  4UVC B;  1XMQ T;  2K48 A;  2YDR A;  2KRT A;  5LBQ B;  3DGN A;  1VQ4 3;  3H51 A;  3WHO A;  5IEO A;  4FI5 A;  2C5J A;  1O7N B;  3CME 3;  3CIR A;  2VK9 A;  4IE0 A;  3EJV A;  3D0T A;  3ZEF B;  2Y8D A;  4HWI B;  2KIN B;  1A67 A;  2ML6 A;  3CCS 3;  2XGL A;  2DWG A;  3CCU 3;  4DR1 T;  1UCK A;  2VKD A;  2XHE B;  4IIJ E;  1VCT A;  3CK6 A;  3AHS A;  3ZN1 B;  4JRF A;  2IUJ A;  3LBX B;  3AE6 A;  4QX8 B;  5EK3 A;  4AEQ A;  1MNE A;  1KK7 A;  3CVR A;  5D81 A;  1IYY A;  1UGH I;  4XBY A;  2QRX A;  2F86 B;  2GEY A;  3EBT A;  2M6I A;  5FXX A;  3RHW A;  4G1M B;  3AVR A;  3ZFZ A;  3R6N A;  3FZH B;  4KUM B;  4K0K T;  1SQW A;  1JZO A;  4HWF A;  2KMF A;  3AEF A;  1I2E A;  4H61 A;  2K9A A;  5EK2 A;  2BG9 B;  2XAH B;  1IV7 A;  2J1D G;  4A97 A;  3L8R A;  1S35 A;  4CI2 B;  1FMW A;  3RQU A;  4HFE A;  3OTO T;  3DMC A;  4N6O B;  3KFQ C;  4DV2 T;  3SLU A;  4YSY A;  3FF2 A;  3NBB A;  1OED B;  5EK4 A;  4TX4 A;  2E2U A;  4BTX A;  1YXR A;  1Z0P A;  4N6L A;  5GON E;  3BLZ A;  2KZ7 B;  4ILB A;  1RGE A;  2KND A;  4WYK B;  3AMO B;  4AXP A;  4IGU A;  2AXD S;  4WBN E;  3UFE A;  2WAU A;  2A3D A;  3RLF F;  3IA3 A;  5ADX L;  2L8K A;  4HJL B;  2WM9 A;  3T8U A;  3E99 A;  4DV0 T;  1ULJ B;  4JI4 T;  2KAA A;  2XJ7 A;  1M62 A;  1D6Z A;  2VUR A;  1YVB I;  1U4Q A;  2L4V A;  2CWO A;  3ZKR A;  1DE3 A;  3UJM A;  4UIG A;  2F5W A;  1W6Y A;  2HN1 A;  2JDI H;  1EEJ A;  3NX0 A;  4J2C A;  4EIW A;  2KWI B;  3DGY A;  3QUJ A;  4X5T A;  5JH7 E;  1QVF 2;  3DXO A;  3UL5 A;  2BG9 E;  3NBJ A;  3LFM A;  3NV0 A;  3WI3 A;  1VRB A;  2XFS A;  4QXB B;  5ELJ A;  4UVA B;  3LT8 A;  3PUS A;  4NPP A;  1IVX A;  4ILF A;  3WA3 A;  1HF8 A;  2Y74 A;  2XQ9 A;  3IHR A;  3Q9D A;  2HH7 A;  2OTL 3;  3FHN A;  1NO3 A;  2I0M A;  1OGX A;  1O7W B;  2E2V A;  4HFV A;  1NJI 4;  1JN5 B;  2A15 A;  1FMV A;  1MOL A;  4UXN B;  1UUR A;  5AEW B;  2BG9 A;  1FGR A;  1UX4 A;  2JMH A;  3G8Z A;  2CK3 H;  5IHY A;  3T8N A;  1SHZ C;  2XZE A;  4KI0 F;  3JC6 D;  5HOH A;  2NTY A;  4QWT A;  3IEE A;  1D1A A;  3X40 A;  4ERR A;  2AE9 A;  2RP4 A;  3RYF E;  3I9Y A;  5HCJ A;  1G96 A;  3AE1 A;  2LOS A;  1I70 A;  2BMO B;  2PZV A;  3NQY A;  1NEK A;  4KHP T;  3F8X A;  3CQC B;  1OED A;  3HI7 A;  2YK0 A;  3PGB A;  3UUM A;  2HMO B;  5DQV A;  2H7O A;  2B1E A;  2OQE A;  4PFO A;  2J47 A;  4JV5 T;  3M3Z B;  1GSP A;  2A72 A;  1VZZ A;  4ORL A;  4JBW F;  4TNW A;  4KVH A;  5M18 A;  3F57 A;  4WYK A;  2H0G A;  5F5W A;  4LSO A;  3RGA A;  3FB2 A;  3ZYM A;  4U13 A;  3ZMU B;  1VQ8 3;  1FJG T;  3BNC A;  1CYV A;  2WOF A;  1NB3 I;  4IST A;  3EAM A;  3RKG A;  1SE7 A;  3K3Q C;  5D83 A;  1JV2 B;  2XAJ B;  2CFG A;  4ZI2 D;  4AQF A;  2V7M A;  2EHO B;  3I56 3;  1RGG A;  2L3L A;  1A2P A;  4XBT A;  5IWA T;  4KHZ F;  1SAR A;  2JIW A;  2JMK A;  1SIH A;  4PJM A;  4LF7 T;  3CML A;  1BSE A;  4MAL A;  1N8R 4;  2BS4 A;  3MKI A;  3NV0 B;  4JI5 T;  4I50 E;  8RNT A;  1HKX A;  4QWN B;  1IZN B;  5RNT A;  2D5U A;  4GK0 E;  1QUU A;  2D0U A;  3PUR A;  4OUQ A;  3FCS B;  2BBH A;  5M19 A;  2XSH B;  2H7V C;  4WWU C;  1B2X A;  4IDP A;  1VQP 3;  3STD A;  3RIU C;  4LF5 T;  1LQG C;  2HOH A;  3LXU X;  2X0L B;  1UW1 A;  1J2B A;  1I3I A;  3Q5E A;  3DGL A;  2BS2 A;  1LOX A;  4DR6 T;  1FZU A;  1JKG B;  2NP9 A;  5CXO A;  1BSC A;  5FY7 A;  4BJM A;  4IIA A;  3PUA A;  1FA3 A;  4IE5 A;  4ZI7 E;  2KF4 A;  3I0O A;  1Y4K A;  2MBG A;  3B4O A;  4KBM B;  1KFY A;  3QC9 A;  1RDS A;  1GY7 A;  3AE4 A;  4BTW A;  1RGL A;  2LOP A;  2W61 A;  4EEB A;  3PXM A;  2LQV A;  5CLK A;  5HEJ A;  2X0H A;  4E7Z A;  3AE8 A;  3I9W A;  4YJ2 E;  4IDQ A;  2C0S A;  1MMG A;  2HN2 A;  3VR8 A;  4NXN T;  3K3N A;  2IAK A;  3ZT5 A;  5DJQ C;  1BNG A;  2JQ5 A;  3PV0 F;  1N33 T;  5CK6 A;  4NUV A;  4BTY A;  1A90 A;  4R1K A;  2LHR A;  2CWY A;  1O7P B;  1RNT A;  4UV9 B;  3MWZ A;  4CDL A;  6GSP A;  2K54 A;  1FYS A;  3FZK B;  2CH9 A;  2BZB A;  7STD A;  3O1H A;  5L3E B;  2XAQ B;  2CXL A;  2YFL B;  2A2F X;  5IG5 A;  4OX9 T;  5E0O A;  5AII A;  5EQL A;  1G0T A;  3HK4 A;  2C5I T;  1KNZ A;  3KII A;  3M65 A;  3URP A;  3Q5X A;  3BND A;  1OAC A;  4GOU A;  1YKE B;  3WAJ A;  3WOF B;  4TV8 E;  2LSK A;  2LYX A;  4N6V 0;  1ZP0 A;  2WDR A;  4NUU A;  4WBO A;  4U33 A;  1MWR A;  3OPC A;  4U2Z A;  1BRH A;  1N8Q A;  2Z7A A;  5CJ5 A;  4N6N B;  2W04 A;  4AKI A;  4YFS A;  3KBU A;  2UGI A;  4EBG A;  5LHI B;  3OWY A;  3EUH A;  4EED A;  4LFB T;  2YDS A;  5FVK A;  1BIR A;  5HEU A;  2Z6B A;  1BUJ A;  3PTR B;  2QYW A;  1CHU A;  2HHH T;  3AE5 A;  4HFD A;  4YTN A;  3LK3 B;  3CCR 3;  3EDV A;  4DV4 T;  5HWY A;  3X3X A;  4HM4 B;  1QAF A;  3ZLI A;  2XTL A;  1RGC A;  2G0U A;  1OWA A;  3HKD E;  4YTM A;  4IDN A;  1JB4 A;  3D5I A;  5LMU T;  4V1A v;  3L0R A;  1W00 A;  3M8C A;  4LEH A;  4HM3 B;  3IPT A;  3TDG A;  1JKG A;  4UVB B;  5LXT E;  4P0A A;  1W01 A;  5J0Z A;  4Z90 A;  2JQH A;  1UGO A;  1MNL A;  2WQY A;  1FUS A;  1XNQ T;  2W56 A;  5G2G A;  3HII A;  2QIY A;  5BMV E;  1T72 A;  3P4W A;  1YI2 3;  1G02 A;  4IE7 A;  4QH4 A;  3KSP A;  3SS1 A;  5LNK A;  1A2K A;  4GK5 E;  4G63 A;  3KVB A;  2E9X B;  3NWI A;  4O02 B;  2ZM8 A;  5AQJ B;  2XSO B;  4RNZ A;  2C4B A;  4G2A A;  1Y01 A;  2XQ6 A;  2WWU A;  2CG0 A;  2CHO A;  3ALA A;  2BKN A;  1BR4 A;  3ZT7 A;  3VSY A;  4HN9 A;  4JI0 T;  1UI8 A;  5FY0 A;  4O8S A;  4CPK A;  4O4J E;  3CKD A;  1K41 A;  4IDZ A;  3P4P A;  4HM1 B;  4ZM8 A;  1E2A A;  2KCD A;  3I0Y A;  3GWR A;  3JAE A;  5AIF A;  4DR3 T;  4DV6 T;  3HL6 A;  2F98 A;  3F40 A;  4AKG A;  2VVS A;  4HKA A;  1FGQ A;  3N2O A;  2V8S V;  1YQ3 A;  2XSB A;  1RCK A;  2H3R A;  4DR4 T;  1OED C;  1BNI A;  4GB5 A;  4ZS2 A;  4BA9 A;  2IYJ A;  4I4K A;  1MGR A;  3LJC A;  4BL3 A;  2WU5 A;  5FXZ A;  4DO0 A;  4H3U A;  2MOZ A;  3AA1 B;  3MK7 C;  1Q40 A;  2XH9 A;  1GYB A;  3V5S A;  4DKI A;  1N9J A;  3BNB A;  2XQ7 A;  1KSI A;  3X3Y A;  2DHR A;  3AEE A;  2OV9 A;  4N6T A;  1K73 4;  3NM2 A;  4EOZ B;  4LML A;  2UUB T;  4EAH A;  4N78 D;  4BJN A;  5AQT B;  2YDQ A;  3N9O A;  2W67 A;  1NEN A;  3X42 A;  4J9A A;  1Q42 A;  1T7S A;  4HFB A;  4OVM A;  2CBJ A;  3L39 A;  2W56 B;  5JBS A;  4GYS A;  3N8B A;  5IER A;  4HTE A;  1WLX A;  2QA4 3;  2UXX B;  2WGQ A;  2W2U A;  4H9O C;  2K24 A;  5IEN A;  1BSD A;  4GYR A;  3TKL B;  2CWV A;  3CX7 B;  3N9Q A;  4LYL B;  1YJN 3;  3NZQ A;  3CD6 3;  3OW2 2;  4MMX B;  2WZI A;  1OHP A;  4TUY E;  2CWU A;  1BRJ A;  1I6Z A;  1VQM 3;  2LE8 A;  4DR2 T;  3ESL A;  1W4N A;  3AB3 B;  2ES0 A;  4PFP A;  1UCJ A;  2Q9Q D;  3LG7 A;  1RTU A;  4EC6 A;  3SOY A;  3FZL B;  3DGO A;  4K1U A;  1RKY A;  4DBR A;  5AQM B;  1KC8 4;  4GIW A;  4QXC B;  2AAD A;  5AI1 A;  1CQS A;  1OED E;  3RH3 A;  3PDY A;  4AKL A;  3FZW A;  5I97 A;  4TWD A;  3B4P A;  1GMP A;  2X9W A;  5JPU A;  5FKY A;  5LGU B;  4IHJ E;  4EB6 E;  5C3J A;  2ZA4 A;  1ZEE A;  2XQY A;  4CQI A;  3H3M A;  2VKO A;  4U2Y A;  3UQ4 A;  5CGM A;  4K61 A;  4RZM A;  5CF1 A;  3AXJ B;  3O1I A;  4XB5 A;  2H0I A;  3GN5 B;  2HMM B;  2Y6X A;  3RF1 A;  3P4S A;  2PG8 A;  3RYC E;  3ECF A;  2UXC T;  1Q40 B;  2LEH A;  1T2I A;  4XBF B;  2PJQ A;  2HMK B;  3X41 A;  3MZK B;  2N9D A;  1B2M A;  2VQE T;  4YTP A;  5BVB A;  1SA0 E;  2MAW A;  1IBM T;  4U3C A;  4Z8X A;  4YSZ A;  4R4K A;  3NHX A;  1LVF A;  2RNT A;  1ZHC A;  5LA6 E;  4F8H A;  4L7K A;  4OYK A;  2LHN A;  5JDG A;  4LGQ A;  3SFD A;  4F6R C;  1VQ5 3;  3PCR A;  2CEA A;  2JRK A;  2DNX A;  2EHO D;  1ZKE A;  5GSP A;  1RNB A;  1HG2 A;  1YW0 A;  2IHR 1;  4A5X A;  1UCI A;  3KV6 A;  2ZL8 A;  4KX6 A;  3ZG5 A;  5JR9 B;  1IT7 A;  4LZI A;  1VQQ A;  4Q53 A;  4H9N C;  1RHL A;  6STD A;  4R9K A;  1VQN 3;  1MWU A;  4PNI A;  3ZCI A;  3D5G A;  2Q9Q B;  3KIN B;  1W09 A;  2X0Y A;  3LK2 B;  1BNJ A;  2GK9 A;  3S5C A;  2D2S A;  3N9P A;  3D9R A;  3FG3 A;  3JC6 C;  4HZB B;  2XQ8 A;  1HR0 T;  1MMN A;  1IQX A;  3PUZ F;  1X1U A;  3X3Z A;  3G16 A;  3GZX B;  1GMR A;  4HM0 B;  2VL8 A;  4PJN A;  4MMZ B;  2H88 A;  5FY1 A;  4LMI A;  2P0X A;  5JRC B;  4AQF C;  1OUN A;  4CXY A;  4FMC A;  1X1Y A;  3IF8 B;  4FMB A;  1X79 A;  4AIU A;  1J5E T;  3GMI A;  4UV8 B;  3UT5 E;  3HKB E;  1LRA A;  1UUG B;  1DMN A;  4HM5 B;  2XQA A;  2E8I A;  1OHO A;  3AXJ A;  2XY8 B;  1DVD A;  1W6G A;  2ACX A;  2XM2 A;  5ABH A;  2GU1 A;  2CA5 A;  2H0H A;  2W0G A;  1V74 A;  3OBV E;  3GZY B;  2LLY A;  3A5X A;  3AEC A;  4HAA A;  1ROV A;  3J7Y q;  3BQL A;  4MLK A;  1OPY A;  5KP1 A;  2PBI A;  1RRH A;  3PUQ A;  2IIU A;  5LHG B;  3Q1C A;  3VR9 A;  2NR4 A;  2BU4 A;  3DM8 A;  5AIH A;  3UL6 A;  3QRD A;  1JJ2 2;  4AKR B;  4CN1 A;  3OWS A;  2QGS A;  5IUX A;  2KT9 A;  1HFA A;  4DBQ A;  1STF I;  1BR2 A;  2V26 A;  5DRE A;  3MPH A;  4JI8 T;  1YJW 3;  4B3R T;  2LSJ A;  4ANJ A;  3AEA A;  2UUG C;  2CE7 A;  3OWU A;  4BL2 A;  1M90 4;  5L3G B;  2O9U X;  3FZF B;  3V92 A;  5LCY A;  1S94 A;  5KP3 A;  5EZY E;  5LBM A;  3AAA B;  2R4I A;  2WZH A;  4TV9 E;  5JR9 A;  4HVN A;  4O4I E;  1Q86 4;  1HX8 A;  1HNW T;  3U97 A;  1O7H B;  2X51 A;  4CN4 A;  3FLJ A;  2UXB T;  2Q9Q A;  1TTO A;  5ELU A;  1ZS7 A;  1S72 3;  2BBJ A;  2V5C A;  2SBL A;  1HU9 A;  1WR6 A;  5LC7 A;  2RPA A;  2BIR A;  1IJ5 A;  3S29 A;  3O1J A;  4EXR A;  3RQW A;  4ZZB A;  2P09 A;  1IQY A;  4WYV A;  3D79 A;  4DID B;  5FW5 A;  3CCQ 3;  1J1J A;  5LGN B;  4WP5 A;  3HI2 A;  5HXH A;  4DV5 T;  3KFW X;  4TN7 B;  3EAB A;  4A98 A;  2XPK A;  3HZP A;  5A0O B;  5LB7 B;  3UU4 A;  1UX5 A;  1BR0 A;  2YKS A;  1GMQ A;  4TNV A;  3N2G E;  1YIJ 3;  4RNY A;  3J9X 1;  2UX0 A;  4CN6 A;  2V7I A;  3I1A A;  2X67 A;  4QH1 A;  1SPU A;  3AEB A;  1YD8 G;  5JVD E;  3F7X A;  3N2K E;  1O7G B;  5M4Y A;  3UB1 A;  4H9R C;  3ZJ1 A;  1S5A A;  3O8Y A;  2QVA A;  2X9Y A;  1AJ3 A;  3RRW A;  1HTJ F;  1JBS A;  1WMO A;  3NUV A;  3DY5 A;  3T1Y T;  3RIF A;  1IBK T;  2LSY A;  2VB6 A;  1LRZ A;  3T1H T;  1X9B A;  4HM2 B;  1I0X A;  1FW7 A;  5F3J A;  1C7H A;  4MMY B;  2R6G F;  3SX1 A;  3JAD A;  1M1K 4;  2P9B A;  3ZYL A;  2FJA A;  2YOE A;  1FGT A;  1UUV B;  1D0Z A;  1XDP A;  3FXD B;  5FMN A;  3JUP A;  2MPK A;  3FKA A;  4AQG A;  2FJB A;  1D0X A;  1FGO A;  1KNR A;  1WQL B;  2E2A A;  2UXN B;  2WMN A;  2BDE A;  5AQR B;  3P8C D;  4PK5 A;  1MWT A;  4LMJ A;  5F8P A;  1W02 A;  3CCE 3;  1B7T A;  2OOV C;  4X65 T;  5EEO A;  1GY6 A;  4LFC T;  1DVC A;  3Q90 A;  3CNM A;  2W9P A;  5BXQ A;  1YQ4 A;  5HXC A;  3A7M A;  1IVV A;  1RSN A;  2LKH A;  1YNV X;  5G1L A;  1KQS 2;  4L0R A;  4A56 A;  4X1I E;  2RFR A;  2PFV A;  3KV5 A;  3T8O A;  5BU4 A;  3C64 A;  3Q3F A;  2BHM A;  2NW8 A;  2HPJ A;  3ZYK A;  4JI1 T;  4UF0 B;  2JJ9 A;  4DVD A;  1WYC A;  5LJM A;  5KP4 A;  3O4X E;  4UEM A;  1W5Z A;  4HFC A;  4KFD A;  5HCM A;  3A5E A;  2LSI A;  2KF3 A;  4RNT A;  3EI0 A;  1L5G B;  4X2H A;  3JAF A;  4DND A;  2HMJ B;  3B5M A;  3BQI A;  1M1X B;  3AA7 B;  2CMR A;  5J2U E;  4J5G A;  1QJG A;  1SII A;  4QH5 A;  2LM2 A;  4ILU A;  3ZCJ A;  4HWH A;  2WWV A;  2FBW A;  1LNI A;  2V7J A;  3MHE A;  3NRY A;  3V98 A;  4O2B E;  1A2V A;  5HXS A;  2ZM0 A;  4O4L E;  5DQW A;  4XAX B;  1X1W A;  2WBL A;  5AQS B;  3FG1 A;  1AR0 A;  4I4T E;  4FMD A;  1W2B 2;  1R8I A;  2YU2 A;  1QAK A;  4ZEY A;  1EG9 B;  5FL0 A;  3G71 3;  1T5Y A;  1W9R A;  4OHF A;  3MG1 A;  5FVL A;  1D6Y A;  3KDS E;  3WOE B;  2CHC A;  4JUY A;  3VHL A;  4BAY B;  1W2Z A;  1VCS A;  5LYJ E;  2I6H A;  3ZPO A;  4M1P A;  5LC6 A;  2KLQ A;  2CX0 A;  3F31 A;  2B1X B;  3OYX A;  3LML A;  3W15 B;  3PUY F;  5JDQ A;  3AE7 A;  5KDM C;  1ASK A;  3OJA A;  2VL0 A;  4JI3 T;  2ZM6 T;  5IEP A;  4PW8 A;  7RNT A;  5IW9 A;  4L9I A;  5FXV A;  4MHC A;  2FGT A;  3DUK A;  3UU5 A;  4JF8 A;  2OTJ 3;  1YHQ 3; 
#chains in the Genus database with same CATH homology
 2OCT A;  2CCQ A;  3ROB A;  2X68 A;  3BQK A;  5IG3 A;  4UF0 A;  1LVK A;  3NXJ A;  4JLE A;  1QAL A;  3OXA A;  2YU1 A;  2IUK A;  5JR9 C;  4EXT A;  3EE1 A;  3RC8 A;  1KWI A;  2I59 A;  3LT9 A;  2Q9Q C;  2WO0 A;  2KXG A;  4WNK A;  1TP6 A;  5D82 A;  3CPW 2;  3K8P C;  3PUG A;  3AAE B;  3SOA A;  4YJ3 E;  2W00 A;  3AMO A;  2E9X C;  5AYR B;  1FUW A;  1LVN A;  3EVY A;  4U74 A;  5AYS C;  3B8L A;  2CFK A;  4P0B A;  2GBX B;  2N2N A;  1JN5 A;  3G0K A;  4QX7 B;  3EQQ B;  1DMQ A;  4B6X A;  5L3B B;  1Y64 B;  2IC6 A;  3WAK A;  4FCJ A;  4DMW A;  4PAG A;  5KX5 E;  4IT7 A;  3RDE A;  3K9M C;  1ZX2 A;  4O3V A;  1R4C A;  3CWZ B;  3KZT A;  2DI4 A;  3F7S A;  3MG2 A;  2GBW B;  1KD1 4;  2VAS A;  1WYB A;  2BVM A;  1K9M 4;  1YKH B;  4HZ9 B;  3HX8 A;  3OYZ A;  4FCM A;  3UNL A;  3Q2P A;  4FJO A;  3VGN A;  1GS3 A;  2LT3 A;  4OFZ A;  2W62 A;  1UCU A;  3T0U A;  2C5K T;  4IE4 A;  2Y48 B;  3HR0 A;  2KWH A;  4CZZ B;  1U5P A;  4UEL A;  3JUO A;  2P0M A;  2LSG A;  3CCM 3;  4QKN A;  2MF7 A;  2STD A;  2Y73 A;  4PJL A;  4FCZ A;  4XZC A;  2FNQ A;  2CKF B;  2VKH A;  1U8C B;  4EYC A;  3ZMZ B;  1W7C A;  1QMA A;  2E9X D;  2OOV A;  3F9S A;  3JUQ A;  1NWW A;  3C4Z A;  3FXE B;  1G8X A;  4WHA A;  2CLY C;  5HYA A;  5H6R B;  3PS8 A;  1RRL A;  1MIV A;  1N5H A;  4CCV A;  2WSS V;  3E08 A;  2D42 A;  3AA0 B;  5AFU L;  2CXD A;  4I55 E;  2CXF A;  2D1W A;  5STD A;  3V5U A;  3ANW B;  2CM0 A;  3ETV A;  1N9E A;  2YFJ B;  4EV2 A;  2W63 A;  3LZA A;  2W9Q A;  1MIY A;  5JDM A;  3K5T A;  2CFW A;  1VQK 3;  3OKQ A;  4OYJ A;  2RCD A;  5EVH A;  3KV4 A;  1F8N A;  3LTD A;  3LTB A;  5L3D B;  2EHO A;  3VU7 H;  1STD A;  4HEA A;  3G6E 3;  3MXZ A;  1GD3 A;  5JDH A;  2GEX A;  3CXC 2;  4HGA A;  5AEU B;  3C51 A;  1EA2 A;  5FYM A;  3SRZ A;  4O4H E;  3ER7 A;  1IDP A;  4HE8 A;  1RN7 A;  3WDG B;  2GU3 A;  4N6M A;  2YFI B;  1CEW I;  2OA5 A;  3ZC1 A;  3RGR A;  1UI7 A;  1AVL A;  4PK6 A;  4I43 B;  3RYI E;  3KKG A;  3J7Y d;  4E7S A;  1IAP A;  2W2C A;  2M7O A;  3SVA A;  4L8P A;  4K0U A;  1IJ6 A;  1NWM X;  3V99 A;  4MEI A;  3QK9 A;  1D6U A;  4JEH B;  4NHF A;  5CB4 E;  3U78 A;  3IBP A;  2L9Q A;  2MC8 A;  3K0Z A;  2BVL A;  1OHS A;  2IMJ A;  3BNE A;  5IG4 A;  3PCS A;  2ZDJ A;  2XEP A;  2BO9 B;  2NW7 A;  3ZN0 B;  4IPB A;  3L3P A;  3CC4 3;  4K90 B;  4DMV A;  3ANW A;  1WTH A;  3SED A;  3GRD A;  1US1 A;  1UUW B;  1N5P A;  4FR9 A;  3B13 A;  5LG4 A;  3CCV 3;  3GA8 A;  2VKJ A;  2DLR A;  5LJN A;  3LH4 A;  3H37 A;  3N9N A;  1FGM A;  2W03 A;  3GAX A;  3PU3 A;  2WGO A;  1NB5 I;  1Q7Y 4;  3MJX A;  5DRV A;  1AVK A;  2ODU A;  3SOL A;  1O7M B;  3HA4 A;  3EDU A;  1FEW A;  1VQL 3;  2PNC A;  3N54 B;  4C90 A;  1T98 A;  2CC3 A;  2E9X A;  4X2O A;  2Z6E A;  2IW5 B;  1SJW A;  4KFF A;  4CXW A;  3IJE B;  4N6U A;  5AIG A;  2DCF A;  2E2T A;  5IYZ E;  1MMA A;  3DGM A;  5DAB A;  1NDO B;  2CW9 A;  1TUH A;  3WMD A;  3HIG A;  3EF8 A;  2WMO A;  2XRX B;  1DYU A;  3ONX A;  1LKX A;  4GL6 A;  3OV4 A;  2QEX 3;  3E0Z A;  1ULI B;  2XAG B;  2NW9 A;  2BNG A;  2WOH A;  5FGO A;  1D1B A;  2K5B B;  3CX8 B;  4IE6 A;  4EYU A;  3NBX X;  3UUL A;  3S28 A;  2P05 A;  3LK4 2;  3QK6 A;  5LOV E;  3CQX C;  3R84 B;  2XF3 A;  3H3A A;  4HKV B;  4KZ1 A;  2RGQ A;  2CIU A;  2Z77 A;  3CX6 B;  3S67 A;  4P09 A;  5JDF A;  4YHJ A;  5HGR A;  1JB5 A;  1BR1 A;  5CA1 E;  1NAF A;  3K3O A;  1IV9 A;  1Z1S A;  1G73 A;  3F14 A;  2IA7 A;  2OWP A;  3NRX A;  3F8H A;  1OXZ A;  4L5G A;  3NQZ A;  1TU5 A;  2LJL A;  2XFT A;  4U72 A;  3DZL A;  2V1D B;  2CFD A;  3RX6 A;  2W6J H;  3JUM A;  3FBL A;  1MIW A;  3C98 B;  1YIT 3;  3O9X A;  1IK3 A;  1CUN A;  3KVA A;  3N9L A;  4ASK A;  3C50 A;  4XDW A;  3CCL 3;  3CC7 3;  2X66 A;  4ADZ A;  2DWK A;  4HBR A;  3KE7 A;  5L3C B;  5LHH B;  2XAS B;  1K28 A;  5J1G A;  2EHO C;  3ZC0 A;  4X20 E;  4N3V A;  3DP7 A;  4EYY R;  2ODV A;  4H9Q C;  5A1L A;  3DTO A;  2X9X A;  3I55 3;  2Q07 A;  3CCJ 3;  3MYT A;  1WRD A;  5HXE A;  1ROA A;  3S27 A;  3HKC E;  1ISK A;  1D1C A;  2HPL A;  4HM7 B;  3WOD G;  5CA0 E;  2RSX A;  3KSE D;  4XDV A;  5HWX A;  3LTC A;  1IVW A;  4X1K E;  2JPF A;  3N9H A;  5JRE A;  1OGZ A;  4AKH A;  3ZMS B;  3Q5W A;  3ZJ2 A;  2CFL A;  4WW0 A;  2B24 B;  5FP3 A;  1IQ8 A;  3A76 A;  1V9D A;  5L2L A;  4JEU B;  5JQG E;  3FG4 A;  2NWB A;  4HYZ A;  3FSD A;  1U5O A;  5LP6 E;  4H63 H;  3VF1 A;  1YGE A;  1EZ3 A;  4TZ4 C;  4QXH B;  4H9P C;  2MYS A;  5HXR A;  3DJB A;  3PE0 A;  3CPZ A;  3GN5 A;  3AVS A;  2XR8 B;  3JUN A;  1MND A;  4FMA A;  1LNH A;  4EZH A;  3KN4 A;  1TFO A;  2CWT A;  1FIO A;  2C11 A;  2NTX A;  4ISS A;  1AV4 A;  1EKM A;  5LGT B;  1US7 B;  2NOX A;  2CG1 A;  1PU4 A;  2N1G A;  3CQG B;  4EV5 A;  3CNX A;  4MBQ A;  3E22 E;  3NM7 A;  1E1H B;  3PZW A;  5TGN A;  3N9M A;  1WMN A;  1OCV A;  3B57 A;  4KP3 C;  3H3H A;  3RKO A;  3SWH A;  4TX5 A;  3U1W A;  3PU8 A;  3WA2 X;  1M9G A;  2BMQ B;  3RRC A;  3GZB A;  4RBN A;  5JDL A;  3AAI A;  4STD A;  4ZI2 C;  1E3R A;  2OQE C;  2LM9 A;  3PYJ A;  2C10 A;  2QA7 A;  2QGU A;  4MFR A;  1Q81 4;  4PK4 A;  3FBZ A;  1LXE A;  3CU3 A;  4ZOL E;  2YIN A;  3HKE E;  3RPU A;  4AI6 A;  3UUN A;  1NU3 A;  4PEJ A;  5JRC A;  2P38 A;  3S4U A;  4K1V A;  4XM4 A;  1YJ9 3;  4AKY A;  2YX9 A;  3B7C A;  2F99 A;  3I0Q A;  4AKZ A;  5HAX A;  2HMN B;  1ZO2 A;  1WMP A;  3CC2 3;  2KXP B;  3G4S 3;  1IT8 A;  1HS7 A;  3C4X A;  2BT3 A;  2ML5 A;  3P7I A;  2K0M A;  4PJJ A;  1TFK A;  2I9W A;  4R80 A;  4ZI3 C;  3NBR A;  4ZS3 A;  5IF6 A;  3EBY A;  3SXX A;  2Z76 A;  3GWH A;  4QHO A;  3OX9 A;  2ZMA A;  3CMA 3;  3KBT A;  1E3V A;  1PFP A;  1MMD A;  5TAO A;  4O2A E;  3UTK A;  1GD4 A;  1OF5 B;  5CF2 A;  3MAC A;  1IVU A;  1VQO 3;  5KMG P;  4C91 A;  3LYG A;  1ZV4 X;  3IMA B;  3MSO A;  2CLY B;  3ZMV B;  5FNV E;  4R9L A;  2XUE A;  2VWA A;  1W6C A;  4XBX A;  3AA6 B;  4H9S E;  4OK0 A;  4NRE A;  3ETU A;  5L3F B;  4EZ4 A;  5JDN A;  1GY5 A;  4H63 V;  3UUX B;  4YLH A;  1VQ7 3;  1DMM A;  1JNQ A;  3EB8 A;  1JB2 A;  5JPP A;  3K63 A;  3RC3 A;  3BK9 A;  1Q82 4;  4L8O A;  3EC9 A;  2BMR B;  2ZM2 A;  5FXW A;  4ZI3 D;  1K8A 4;  1VQ9 3;  2O3O A;  4KMC A;  3U3I A;  4WFO A;  5J2T E;  2D0T A;  3RYH E;  1VOM A;  1WNH A;  3LTA A;  2INX A;  5ETW A;  1BUQ A;  3JVC A;  3FF0 A;  2GXF A;  1HCI A;  3LBX A;  3FGY A;  3VKH A;  2XGN A;  2M67 A;  3GZR A;  1HG5 A;  3EN1 B;  3EX9 A;  5H6Q B;  1E97 A;  3MG3 A;  3FH1 A;  2SPC A;  2ZLY A;  2RA1 A;  5C8Y E;  8CHO A;  1TIJ A;  1JRQ A;  3K7C A;  2JQQ A;  1VQ6 3;  4X1Y E;  4ZHQ E;  4MJD A;  2X9H A;  1OF5 A;  3EN8 A;  4CXX A;  5IG0 A;  3VKG A;  4HM6 B;  3ZMT B;  1CYU A;  2MTQ A;  2YEV C;  2V7K A;  1QSD A;  3MKD A;  4KFE A;  1H7C A;  3KV9 A;  1D0Y A;  2V1L A;  3D3L A;  2XAF B;  1IU7 A;  2HML B;  3L09 A;  3EHC A;  4CI1 B;  3F2E A;  2W0Q A;  1QVG 2;  3BB9 A;  1O3X A;  4J8T A;  4O2H A;  2IC9 A;  4HM8 B;  3LOY A;  3C4W A;  3Q2M A;  1EQK A;  2FXT A;  4CI3 B;  3NZP A;  3CPO A;  2V7L A;  1OH0 A;  3N5L A;  1RJO A;  3MA9 A;  4UVC B;  2K48 A;  2KRT A;  5LBQ B;  3DGN A;  1VQ4 3;  3H51 A;  5IEO A;  4FI5 A;  2C5J A;  1O7N B;  3CME 3;  2VK9 A;  4IE0 A;  3EJV A;  3D0T A;  3ZEF B;  2Y8D A;  2KIN B;  1A67 A;  2ML6 A;  3CCS 3;  2XGL A;  2DWG A;  3CCU 3;  2VKD A;  2XHE B;  4IIJ E;  2IUJ A;  3ZN1 B;  4JRF A;  3LBX B;  4QX8 B;  5EK3 A;  4AEQ A;  1MNE A;  1KK7 A;  3CVR A;  5D81 A;  4XBY A;  2F86 B;  2GEY A;  3EBT A;  5FXX A;  4G1M B;  3AVR A;  3R6N A;  4KUM B;  1SQW A;  2KMF A;  4H61 A;  2K9A A;  5EK2 A;  2XAH B;  1IV7 A;  2J1D G;  1S35 A;  4CI2 B;  1FMW A;  3DMC A;  4N6O B;  3KFQ C;  3SLU A;  3FF2 A;  3NBB A;  5EK4 A;  4TX4 A;  2E2U A;  4BTX A;  1Z0P A;  4N6L A;  5GON E;  3BLZ A;  2KZ7 B;  2KND A;  4WYK B;  3AMO B;  4AXP A;  4IGU A;  4WBN E;  3UFE A;  2WAU A;  2A3D A;  5ADX L;  2L8K A;  4HJL B;  2WM9 A;  3T8U A;  3E99 A;  1ULJ B;  1D6Z A;  1YVB I;  1U4Q A;  2L4V A;  2CWO A;  3UJM A;  4UIG A;  1W6Y A;  2JDI H;  3NX0 A;  4J2C A;  4EIW A;  2KWI B;  3QUJ A;  5JH7 E;  1QVF 2;  3DXO A;  3UL5 A;  3NBJ A;  3LFM A;  3NV0 A;  3WI3 A;  1VRB A;  2XFS A;  4QXB B;  5ELJ A;  4UVA B;  3LT8 A;  3PUS A;  1IVX A;  3WA3 A;  1HF8 A;  2Y74 A;  3IHR A;  3Q9D A;  2HH7 A;  2OTL 3;  3FHN A;  1NO3 A;  1OGX A;  1O7W B;  2E2V A;  4HFV A;  1NJI 4;  1JN5 B;  2A15 A;  1FMV A;  1MOL A;  4UXN B;  5AEW B;  1FGR A;  1UX4 A;  2JMH A;  3G8Z A;  2CK3 H;  5IHY A;  3T8N A;  1SHZ C;  3JC6 D;  2NTY A;  4QWT A;  3IEE A;  1D1A A;  3X40 A;  4ERR A;  2RP4 A;  3RYF E;  3I9Y A;  1G96 A;  2LOS A;  2BMO B;  2PZV A;  3NQY A;  3F8X A;  3CQC B;  3HI7 A;  2YK0 A;  3PGB A;  3UUM A;  2HMO B;  5DQV A;  2H7O A;  2B1E A;  2OQE A;  4PFO A;  2A72 A;  1VZZ A;  4ORL A;  4KVH A;  3F57 A;  4WYK A;  4LSO A;  3RGA A;  3FB2 A;  3ZYM A;  4U13 A;  3ZMU B;  1VQ8 3;  3BNC A;  1CYV A;  2WOF A;  1NB3 I;  4IST A;  3K3Q C;  5D83 A;  1JV2 B;  2XAJ B;  2CFG A;  4ZI2 D;  4AQF A;  2V7M A;  2EHO B;  3I56 3;  2L3L A;  4XBT A;  2JMK A;  1SIH A;  4PJM A;  3CML A;  4MAL A;  1N8R 4;  3MKI A;  3NV0 B;  4I50 E;  1HKX A;  4QWN B;  1IZN B;  2D5U A;  4GK0 E;  1QUU A;  2D0U A;  3PUR A;  4OUQ A;  3FCS B;  2XSH B;  4WWU C;  2H7V C;  1VQP 3;  3STD A;  3LXU X;  2X0L B;  1UW1 A;  1J2B A;  3DGL A;  1LOX A;  1JKG B;  2NP9 A;  5CXO A;  5FY7 A;  4BJM A;  4IIA A;  3PUA A;  1FA3 A;  4IE5 A;  4ZI7 E;  3I0O A;  1Y4K A;  2MBG A;  3B4O A;  4KBM B;  3QC9 A;  1GY7 A;  4BTW A;  2LOP A;  2W61 A;  3PXM A;  2LQV A;  5CLK A;  4E7Z A;  3I9W A;  4YJ2 E;  2C0S A;  1MMG A;  3K3N A;  2IAK A;  5DJQ C;  2JQ5 A;  5CK6 A;  4NUV A;  4BTY A;  1A90 A;  4R1K A;  2LHR A;  2CWY A;  1O7P B;  4UV9 B;  3MWZ A;  4CDL A;  2K54 A;  2CH9 A;  2BZB A;  7STD A;  3O1H A;  5L3E B;  2XAQ B;  2CXL A;  2YFL B;  2A2F X;  5IG5 A;  5E0O A;  5AII A;  5EQL A;  3HK4 A;  2C5I T;  1KNZ A;  3KII A;  3M65 A;  3Q5X A;  3BND A;  1OAC A;  4GOU A;  1YKE B;  3WAJ A;  3WOF B;  4TV8 E;  2LSK A;  2LYX A;  4N6V 0;  4NUU A;  4WBO A;  1N8Q A;  2Z7A A;  4N6N B;  2W04 A;  4AKI A;  4YFS A;  3KBU A;  4EBG A;  5LHI B;  3OWY A;  3EUH A;  2Z6B A;  3PTR B;  3LK3 B;  3CCR 3;  3EDV A;  5HWY A;  3X3X A;  4HM4 B;  1QAF A;  3ZLI A;  2XTL A;  2G0U A;  1OWA A;  3HKD E;  1JB4 A;  4V1A v;  3L0R A;  1W00 A;  3M8C A;  4LEH A;  4HM3 B;  3IPT A;  3TDG A;  1JKG A;  4UVB B;  5LXT E;  4P0A A;  1W01 A;  1MNL A;  2W56 A;  5G2G A;  3HII A;  2QIY A;  5BMV E;  1YI2 3;  4IE7 A;  3KSP A;  3SS1 A;  5LNK A;  1A2K A;  4GK5 E;  4G63 A;  3KVB A;  2E9X B;  4O02 B;  2ZM8 A;  2XSO B;  4RNZ A;  4G2A A;  2WWU A;  2CG0 A;  3ALA A;  1BR4 A;  3VSY A;  4HN9 A;  1UI8 A;  5FY0 A;  4O8S A;  4O4J E;  3CKD A;  1K41 A;  4IDZ A;  4HM1 B;  4ZM8 A;  2KCD A;  3I0Y A;  3GWR A;  5AIF A;  3HL6 A;  2F98 A;  3F40 A;  4AKG A;  4HKA A;  1FGQ A;  3N2O A;  2H3R A;  4GB5 A;  4ZS2 A;  4BA9 A;  4I4K A;  3LJC A;  5FXZ A;  4DO0 A;  4H3U A;  2MOZ A;  3AA1 B;  3MK7 C;  2XH9 A;  1Q40 A;  1GYB A;  3V5S A;  1N9J A;  3BNB A;  1KSI A;  3X3Y A;  2DHR A;  4N6T A;  1K73 4;  3NM2 A;  4EOZ B;  4EAH A;  4N78 D;  4BJN A;  3N9O A;  3X42 A;  4J9A A;  1Q42 A;  4OVM A;  2W56 B;  5JBS A;  4GYS A;  3N8B A;  5IER A;  4HTE A;  1WLX A;  2QA4 3;  2UXX B;  2WGQ A;  4H9O C;  2K24 A;  5IEN A;  4GYR A;  3TKL B;  2CWV A;  3CX7 B;  3N9Q A;  1YJN 3;  3NZQ A;  3CD6 3;  3OW2 2;  4MMX B;  1OHP A;  4TUY E;  2CWU A;  1VQM 3;  2LE8 A;  3ESL A;  1W4N A;  3AB3 B;  2ES0 A;  4PFP A;  2Q9Q D;  3LG7 A;  4EC6 A;  3SOY A;  3DGO A;  4K1U A;  1RKY A;  4DBR A;  1KC8 4;  4GIW A;  4QXC B;  5AI1 A;  1CQS A;  3RH3 A;  3PDY A;  4AKL A;  3FZW A;  5I97 A;  3B4P A;  2X9W A;  5JPU A;  5LGU B;  4IHJ E;  4EB6 E;  1ZEE A;  2XQY A;  4CQI A;  4K61 A;  2VKO A;  4RZM A;  5CF1 A;  3O1I A;  4XB5 A;  2HMM B;  3GN5 B;  2Y6X A;  2PG8 A;  3RYC E;  3ECF A;  1Q40 B;  2LEH A;  4XBF B;  2PJQ A;  2HMK B;  3X41 A;  3MZK B;  2N9D A;  5BVB A;  1SA0 E;  4Z8X A;  4R4K A;  3NHX A;  1LVF A;  1ZHC A;  5LA6 E;  4L7K A;  4OYK A;  2LHN A;  5JDG A;  4LGQ A;  4F6R C;  1VQ5 3;  3PCR A;  2CEA A;  2DNX A;  2EHO D;  2JRK A;  1ZKE A;  1HG2 A;  1YW0 A;  3KV6 A;  2ZL8 A;  5JR9 B;  1IT7 A;  4LZI A;  4Q53 A;  4H9N C;  6STD A;  4R9K A;  1VQN 3;  4PNI A;  3ZCI A;  2Q9Q B;  3KIN B;  3LK2 B;  2GK9 A;  3S5C A;  2D2S A;  3N9P A;  3D9R A;  3FG3 A;  3JC6 C;  4HZB B;  1IQX A;  1MMN A;  3X3Z A;  3G16 A;  3GZX B;  4HM0 B;  2VL8 A;  4PJN A;  4MMZ B;  5FY1 A;  4LMI A;  2P0X A;  5JRC B;  4AQF C;  1OUN A;  4CXY A;  4FMC A;  3IF8 B;  4FMB A;  1X79 A;  3GMI A;  4UV8 B;  3UT5 E;  3HKB E;  1DMN A;  4HM5 B;  2E8I A;  1OHO A;  1DVD A;  1W6G A;  2ACX A;  2GU1 A;  2CA5 A;  2W0G A;  1V74 A;  3OBV E;  3GZY B;  3A5X A;  1ROV A;  3J7Y q;  3BQL A;  4MLK A;  1OPY A;  5KP1 A;  2PBI A;  1RRH A;  3PUQ A;  5LHG B;  3Q1C A;  3DM8 A;  5AIH A;  3UL6 A;  3QRD A;  1JJ2 2;  4AKR B;  3OWS A;  2QGS A;  2KT9 A;  1HFA A;  4DBQ A;  1STF I;  1BR2 A;  2V26 A;  5DRE A;  3MPH A;  1YJW 3;  2LSJ A;  4ANJ A;  2CE7 A;  3OWU A;  1M90 4;  5L3G B;  2O9U X;  3V92 A;  5LCY A;  1S94 A;  5KP3 A;  5EZY E;  5LBM A;  3AAA B;  2R4I A;  4TV9 E;  5JR9 A;  4HVN A;  4O4I E;  1Q86 4;  1HX8 A;  3U97 A;  1O7H B;  2X51 A;  3FLJ A;  5ELU A;  2Q9Q A;  1S72 3;  2SBL A;  1HU9 A;  1WR6 A;  5LC7 A;  1IJ5 A;  3S29 A;  3O1J A;  4EXR A;  2P09 A;  1IQY A;  5FW5 A;  3CCQ 3;  5LGN B;  4WP5 A;  3HI2 A;  5HXH A;  3KFW X;  4TN7 B;  3HZP A;  5A0O B;  1UX5 A;  1BR0 A;  1YIJ 3;  3N2G E;  4RNY A;  3J9X 1;  2UX0 A;  2V7I A;  3I1A A;  2X67 A;  1SPU A;  1YD8 G;  5JVD E;  3F7X A;  3N2K E;  1O7G B;  5M4Y A;  3UB1 A;  4H9R C;  3ZJ1 A;  1S5A A;  3O8Y A;  2X9Y A;  1AJ3 A;  3RRW A;  1HTJ F;  1WMO A;  3NUV A;  3DY5 A;  2LSY A;  2VB6 A;  1LRZ A;  4HM2 B;  5F3J A;  1C7H A;  4MMY B;  3SX1 A;  1M1K 4;  2P9B A;  3ZYL A;  1FGT A;  1UUV B;  1D0Z A;  3FXD B;  5FMN A;  3JUP A;  3FKA A;  4AQG A;  1FGO A;  1D0X A;  1WQL B;  2UXN B;  2WMN A;  2BDE A;  3P8C D;  4PK5 A;  5F8P A;  1W02 A;  3CCE 3;  1B7T A;  2OOV C;  5EEO A;  1GY6 A;  1DVC A;  3Q90 A;  3CNM A;  2W9P A;  5BXQ A;  5HXC A;  1IVV A;  1KQS 2;  4L0R A;  4A56 A;  4X1I E;  2RFR A;  2PFV A;  3KV5 A;  3T8O A;  3C64 A;  2BHM A;  2NW8 A;  2HPJ A;  3ZYK A;  4UF0 B;  2JJ9 A;  4DVD A;  1WYC A;  5LJM A;  5KP4 A;  3O4X E;  4UEM A;  1W5Z A;  4KFD A;  2LSI A;  1L5G B;  4X2H A;  4DND A;  2HMJ B;  3BQI A;  1M1X B;  3AA7 B;  2CMR A;  5J2U E;  1QJG A;  1SII A;  4ILU A;  3ZCJ A;  2V7J A;  3MHE A;  3NRY A;  3V98 A;  4O2B E;  1A2V A;  5HXS A;  2ZM0 A;  4O4L E;  5DQW A;  4XAX B;  2WBL A;  3FG1 A;  1AR0 A;  4I4T E;  4FMD A;  1W2B 2;  2YU2 A;  1QAK A;  1EG9 B;  3G71 3;  1T5Y A;  4OHF A;  3MG1 A;  1D6Y A;  3KDS E;  3WOE B;  2CHC A;  4JUY A;  3VHL A;  4BAY B;  1W2Z A;  5LYJ E;  3ZPO A;  4M1P A;  5LC6 A;  2KLQ A;  3F31 A;  2B1X B;  3OYX A;  3LML A;  3W15 B;  5JDQ A;  5KDM C;  1ASK A;  3OJA A;  5IEP A;  4PW8 A;  5IW9 A;  4L9I A;  5FXV A;  4MHC A;  2FGT A;  3DUK A;  4JF8 A;  2OTJ 3;  1YHQ 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...