4OK0A

Crystal structure of putative nucleotidyltransferase from h. pylori
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
225
structure length
225
Chain Sequence
LSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of JHP933 from Helicobacter pylori J99 shows two-domain architecture with a DUF1814 family nucleotidyl transferase domain and a helical bundle domain
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords Putative
total genus 73
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ok0A02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ok0A01
4OK0A 4O8SA
chains in the Genus database with same CATH superfamily
4JRFA 5HCMA 4HFIA 3AVRA 4LMJA 1WNHA 1LXEA 3L09A 3AAIA 2KXPB 5AYSC 2IAKA 3SFDA 1SARA 5CK6A 2WU5A 2WDQA 4EYCA 2SPCA 3A5EA 2UXNB 4ILAA 2Y74A 5FP3A 2V6YB 4R9KA 4WHAA 4HWCA 4K0KT 3P4RA 2PG8A 2PBIA 2Z77A 4NPBA 1IVWA 2V7MA 3AA1B 3MWZA 1QSDA 3B4OA 4GL6A 2XRXB 2W03A 3BK9A 4XM4A 3K8PC 5BIRA 1AY7A 1JBSA 2BNGA 3CD63 3CVRA 4NXMT 1NB5I 1ZV4X 4GIWA 4WYKB 2UUAT 3C98B 2CM0A 5TAOA 3AAAB 2CWTA 3NVOA 3HK4A 4X20E 1KQS2 1R4CA 4HTEA 3J9X1 4U74A 2XQ7A 1V58A 3UU4A 2IDOB 1ZKEA 5ABEA 4PJMA 3MJXA 1ULJB 4TN7B 2JQKA 4GK0E 5LHGB 4ERRA 4LF5T 3K0ZA 4U13A 2KF6A 1C7HA 4U3CA 3ZMUB 2Y6XA 1RDSA 5G1KA 5FL1A 3N2KE 1GMPA 4ASKA 3RGRA 2WDRA 3EAMA 4KHZF 4DMVA 4UVBB 2IYJA 5JR9C 2C0SA 2LSJA 3VRAA 3ZT6A 5EK2A 2GK9A 1JB4A 3FCSB 1RGGA 4ZI2C 4P09A 4L8PA 3SFEA 3ZSSA 2DWGA 2NW8A 3CCJ3 3MG1A 4FCZA 2CW9A 3FHNA 2WP9A 3QK9A 6RNTA 4LSOA 1VQM3 1YGWA 3FF0A 1WYCA 3G0KA 2OOVC 4QWTA 2BKNA 4H63V 4DIDB 1GYBA 2KAAA 2WWUA 3HI2A 4KVHA 4ILCA 1RJOA 3I9WA 3QRDA 3CNXA 4HVNA 4X64T 3D5IA 2LSYA 5LHHB 1ZS7A 3RF1A 1MMGA 2HMMB 4JLEA 5AQTB 4GKJT 4CN1A 4JI5T 5JREA 4U31A 1OWAA 3KVAA 4DKIA 4JI6T 4ISSA 3EBTA 3H3AA 3OXAA 3CX7B 4AKGA 4PJLA 1BR2A 3JUQA 5JPUA 3RNTA 1U5PA 2KT9A 1YJN3 2Z7AA 4NPPA 5RNTA 1G0TA 1LQGC 3B8LA 1UURA 2WBLA 1T98A 3TKLB 4AQYT 2CXDA 3G713 1SJWA 2V5DA 2P9BA 1UGHI 3OWYA 3AA0B 5C2TA 3OBVE 4ILFA 1NJI4 3O9XA 3C51A 3G16A 5AQOB 4PEJA 1RCLA 3UU8A 4WZXA 5AYRB 2JIWA 1TUHA 2BT3A 1ZX2A 4L8OA 3CXC2 4LMIA 2OTJ3 4YSZA 4XDVA 5HXRA 1STDA 4EEBA 4RNYA 3SOAA 5G2GA 4DUYT 5M18A 5J1GA 4ZOLE 1MIVA 4HFDA 2VVSA 3AEAA 4YHHT 1CH0A 3PV0F 4OX9T 1MWRA 1YXRA 1C54A 2RPAA 2QGUA 1FGQA 4KFFA 5KP3A 2IHR1 3CME3 1YQ3A 4YHJA 3UFEA 4R80A 4AQFA 5CFBA 1Q42A 1M904 3FZWA 3L0RA 1UI8A 1D0ZA 1ASKA 1I3FA 1KEYA 2RFRA 1T72A 4X1YE 2KCDA 1ZP0A 4IPBA 3HKDE 4N6TA 1CYVA 2OQEA 1IV7A 2HH7A 2XAHB 3ONXA 2CFDA 4LGQA 3V5SA 3AE9A 1IZNB 3F14A 5D83A 2FJBA 3A7MA 3HOHA 1O3XA 4HKVB 3KDSE 3GZBA 1VQQA 5LOVE 3P4QA 4G2AA 3AHWA 4TWFA 3PYJA 1IQ8A 3ONJA 3FXDB 2X51A 2HOHA 4IIAA 1UUGB 4KFDA 3VF1A 4YLHA 4H3UA 5HXCA 1B2SA 2FJDA 3G6E3 1S723 3LTBA 1PYLA 2MTQA 1KNRA 1ZHCA 2OQEC 3X3ZA 4H9OC 1J1JA 2F4YA 3NBBA 2RP4A 4MALA 1GY6A 1FW7A 1OUNA 5H6QB 5LC6A 2M67A 1HR0T 2VKHA 1FMWA 1GOUA 1KWIA 2BIRA 3T0UA 5KP4A 1GD4A 1N8QA 3F7XA 2F4VT 5C3JA 1RNBA 1XMOT 1R4YA 3NZQA 2CWUA 3Q90A 2XSOB 5AIFA 5ABFA 4RNTA 3GRDA 5LA6E 2E8IA 1V74A 2ZA4A 2PNCA 3RKGA 2E2VA 3DGNA 5LJMA 3GN5B 2CBJA 3N9QA 2IA7A 2EHOC 2AE9A 4IE6A 4BJNA 5FXZA 4UR9A 5CF2A 5JBSA 4TWDA 1I2FA 4HE8A 2CG0A 4DBRA 2QA43 1W9RA 5A0OB 1N32T 5BVBA 2KF4A 2UUCT 4L5GA 1O7GB 3WAJA 4LYLB 3LTDA 3SS1A 3ONLC 4PW8A 2KSRA 4YJ3E 5GSPA 4DNDA 4EZHA 3J7Yq 1MWTA 2H88A 2H0HA 4HM7B 3KZTA 3MHEA 3LT8A 1VQ63 4AKHA 4UV9B 4B3RT 3RPUA 2E5VA 2XTLA 1ZO2A 4XBTA 4HAAA 4JI2T 1TRQA 4TWHA 1RGEA 4CN4A 3AXJA 1K8A4 4N6OB 3KV4A 1HZ1A 3UUMA 3TLWA 3OV4A 4DV5T 3KE7A 3GN5A 3PUYF 1IBLT 1D6ZA 5JR9B 3NUVA 3KV6A 2WU2A 1UDII 1IVUA 2LKHA 4U2ZA 1X1YA 1OCVA 4FMDA 1HS7A 4RNZA 3L3PA 5ABFB 2UX0A 5AI1A 4H9NC 2D2SA 3PXMA 2XM2A 4U2YA 1MOLA 4XDWA 5IERA 3NRYA 2IY2A 3ZPOA 2DI4A 3OJAA 3WMDA 5EZYE 3RYCE 5IW9A 1UK5A 7GSPA 2NW9A 9RNTA 4DV7T 1XNRT 3CPZA 2LKGA 3ZYMA 1TFOA 2O3OA 2LHNA 4DR2T 2K48A 1RGKA 1B20A 1HG2A 2N9DA 2STDA 4FCMA 2C4BA 1IK3A 4X62T 2V5CA 4N6MA 4HGAA 2D0TA 4CXXA 2EHOD 3IBPA 1S94A 2GU3A 2KRTA 2LYXA 4AEQA 2XQ4A 1GMRA 5DRVA 3KCHA 3D0TA 1BU4A 2Y48B 4DV3T 3ROBA 1YJW3 1V9DA 3I553 2UXDT 1RN4A 4DV1T 2RGQA 2D9DA 2ODUA 1UUVB 3SVAA 3ABVA 4OUQA 3QNUA 4BIRA 1GQEA 3Q5DA 3C50A 1KC84 3N9OA 2ACXA 5H6RB 1KFYA 1WR0A 2CEAA 3UT5E 3ZLIA 2WS3A 2W56B 5FY7A 1J5ET 4QX7B 4FMAA 4NUVA 1FJGT 3KBUA 1RGFA 3KKGA 2DCFA 2J1DG 4QHOA 2HMNB 4QWNB 4EW5A 3BQKA 1WRDA 1RTUA 5AQNB 1G8XA 3RGLA 3VKHA 1RLSA 1Q814 4EYUA 1K28A 2JQHA 4YSYA 3DUKA 1GOVA 3PUZF 1D6YA 1GS3A 4HFEA 4A98A 1VOMA 1OF5B 3LMLA 2MPKA 4UEMA 3N9LA 6STDA 4L0RA 2PFVA 3BNEA 4UF0B 5JDFA 4H9PC 2W0GA 3WA2X 3CC73 3N9PA 2NTXA 2H7VC 5JDNA 1AR0A 1FIOA 2EHOB 2LSIA 1W6CA 3SXXA 2W56A 4B6XA 3FLJA 3X3YA 2X9YA 1US1A 2X66A 5FVLA 4P1NA 5HXEA 2ZM8A 4HM1B 3F2EA 2X0HA 2OCTA 2W61A 1YW0A 2EHOA 3BNCA 1ZGXA 2F56A 1DU2A 1SE7A 4L7KA 4IL4A 4OYKA 1Z8UA 1IVXA 3EBYA 1IYYA 1BUQA 2Y8DA 1IJ6A 1J5WA 3NQZA 2BMRB 3CPW2 5IEOA 3O1JA 3NKZA 2I6HA 3N9NA 2B76A 4UIGA 1Q40B 1BSBA 4ZI3D 4B3MT 4WWUC 3P4SA 1VQ53 4HZ9B 3JUNA 3RDEA 4BA9A 1IU7A 1QUUA 3H3HA 4LF4T 3RI5A 3NHXA 4ILBA 1JZDA 2LEHA 5AIHA 5IG4A 3TLVA 2BG9B 4CI3B 4N6LA 2BBJA 1QMAA 2MYSA 3UJMA 5HOHA 3OTOT 5L2LA 1XDPA 4X1IE 3E99A 4YXDA 2V26A 3RX6A 3H37A 1UCIA 4HJLB 1NU3A 1N9JA 4IDZA 2N2NA 5LGUB 2D1WA 5JH7E 1HYFA 5LCYA 3EQQB 3AE1A 1BANA 1ISKA 5HEGA 4JI0T 1WMPA 1CUNA 2CFWA 3STDA 3ZJ1A 2UGIA 1TFKA 4UV8B 4FR9A 3L8RA 5AQVB 4LF9T 3O1IA 2WDVA 2XQ3A 2DL1A 4NUUA 3MA9A 1MIWA 3GSPA 2YKSA 5M1AA 3HA4A 4J5KA 3AEBA 2CRBA 3AE3A 4AQFC 4DR6T 1GY7A 3LTCA 2CWOA 3RIUA 4YY3T 2X68A 3C4WA 3ECFA 1JN5B 4LEHA 4IE5A 3UU3A 3DM8A 3HZPA 1N9EA 3CIRA 2ZLYA 3NXJA 3M8CA 3HIGA 2WO0A 3KV9A 3VKGA 2XAGB 5KP1A 1BSEA 2QGSA 4LMKA 4STDA 1HX1B 2BDEA 1O7NB 4FI5A 1AVLA 1B3SA 4YFSA 2B24B 4N6V0 3PZWA 5LMUT 2W04A 4HM2B 4A97A 1IJ5A 4UF0A 2L3LA 4TV8E 5FXWA 3K63A 1DETA 1QVF2 5CJ5A 3RLFF 5BMVE 2W2CA 5IYZE 4ZI7E 1OF5A 3OYZA 4OYJA 3UU5A 1JV2B 1MGWA 1FUSA 3DZLA 2C11A 4JI8T 1KK7A 5A1LA 3MKIA 3K3QC 3M65A 4BTYA 5JRCB 3P4WA 4IT4A 5ELJA 5AQRB 3UUXB 2XQ5A 2XY8B 2LSGA 2VB6A 4R4KA 3HIIA 3ZN1B 1DMNA 2CBIA 2XPKA 3LBXB 1XWMA 3PUVF 5AQHB 1IBKT 1F8NA 2F86B 5LBMA 3FZHB 2RCDA 4R9LA 1DYUA 1M1XB 2UXXB 5L3GB 3DJBA 3HI7A 2V7JA 5BU4A 1VZZA 1IV9A 2B1EA 4M1PA 3UUNA 5LXTE 3F8XA 2VL0A 2HPLA 3NV0A 1EQKA 1YKEB 4ZI3C 2QEX3 1JZOA 2NW7A 1BRGA 2GEXA 1BSAA 4AXPA 4X2OA 1H7CA 2C5KT 2VKOA 3PU3A 4H9RC 1FGTA 2H0IA 2WGOA 1WR6A 4J2CA 1BSDA 4OVMA 4Q25A 2V1LA 2XSAA 1TU5A 5DJQC 3S27A 4GYSA 2VL8A 5FW5A 1CQSA 2JQ9A 1M62A 1GD3A 3FZFB 3MG3A 4UVAB 4HM6B 2VASA 1I3IA 5KMGP 2MAWA 2JQQA 4JI4T 4BAYB 1IT8A 3P8CD 3LK3B 1B2XA 5IENA 3N5LA 3GZXB 3AGOA 3P7IA 2K3DA 3CK6A 4WFOA 4UELA 4TZ4C 3BNDA 2J8XB 4KFEA 2BG9C 5FY1A 4IE4A 3N2OA 2QRXA 1I0VA 2UXBT 1W00A 2K24A 4TNWA 2H89A 2CXFA 4AKZA 3P4PA 2OLTA 5AQJB 2ZL8A 1O7PB 1T7SA 4LF7T 3CCM3 1VQO3 2GXFA 3WA3A 1GMQA 2X9XA 2LOSA 3VGNA 2KLQA 4PFOA 4I4KA 4Q53A 2O9UX 2WMOA 1LVFA 3O1HA 3AE5A 3U78A 2J62A 2WM9A 1JN5A 3E0ZA 2XFSA 3MZKB 3BIRA 1BRJA 1JNQA 4AISA 2UU9T 4N6UA 3Q9DA 3AE8A 1NNVA 3AGNA 1YIT3 2VQFT 3GMIA 4CXYA 1LVNA 5GONE 1VQL3 3MG2A 2ZMAA 1G73A 2AXDS 2XASB 4LFCT 1UI7A 4ORLA 5IHYA 5HAXA 5IWAT 2A3DA 3I563 3CC23 1XZYA 5JDMA 2IUBA 1MNDA 1STFI 1RGLA 4O2AE 2ZM2A 1UCLA 2X0LB 2WQYA 3PCSA 3CCQ3 2CX1A 1I94T 3BQIA 4DV6T 2F98A 1Q824 1AV4A 1JNZA 1B2ZA 3KV5A 5LG4A 1MMAA 1QAKA 2CHNA 2H3RA 4RBNA 1MWSA 4O2BE 2L9QA 4B3TT 1NB3I 2FJEA 2X9WA 3C4ZA 2IW5B 4I43B 3K7CA 1B2UA 4BTWA 3HKCE 5LB7B 4AI6A 3ANWB 4AKRB 5HEHA 3I0QA 4OHFA 4X5TA 2YK0A 4DR5T 2CFGA 5EVHA 3S5CA 1O7HB 3HL6A 2XHEB 1WQLB 4WW0A 1R8IA 2XQ6A 1X1WA 5F3JA 2WOHA 2PJQA 2BKOA 2BKPA 5ABHA 2L4VA 3UFGA 1AVKA 1MNLA 3UTKA 3OYXA 1Y01A 5LC7A 3CCR3 1YI23 2KMFA 1RNTA 1WMNA 1MWUA 3JVCA 1L0VA 3ETUA 4TNVA 3ZMSB 2N1GA 2A2FX 5L4EA 3KIIA 3V92A 2LSKA 1TIJA 2XQ9A 3FXEB 2LM2A 4ZEYA 1PFPA 1VQK3 4ZHQE 3WR2A 1D1CA 1I6ZA 2CFKA 1VQP3 1X1UA 5KXJA 3U97A 2I9WA 4A5XA 3NQYA 2Z6BA 1UGIA 1RSNA 4X66T 4QX8B 3PURA 3ZC1A 1XNQT 1WFDA 5IEPA 2J4GA 3CCL3 3NRXA 1HTJF 1TP6A 1UW1A 4OFZA 3MYTA 5KDMC 4QXBB 2D42A 3N9HA 4LZIA 3JAEA 3CU3A 2CA5A 2BS3A 1TRPA 2CHCA 3RKOA 3FZMB 3AE2A 2LM9A 1W0AA 1I2EA 2LJLA 3GZRA 3G06A 1RRLA 2P09A 4J5GA 4N3VA 1EUIC 3RGAA 2K3WA 3EX9A 5LYJE 1RMSA 5HCJA 3ZEFB 5FL0A 4HBRA 5DREA 1Z0PA 5AQFB 5FNVE 3LXUX 3ZMTB 3T1HT 3IHRA 2CKFB 3B7CA 4K0UA 5IG5A 2CE7A 2XAQB 1U8CB 3CC43 5AEWB 1JB5A 1Z1SA 3QC9A 3GAXA 3CCV3 1BIRA 2FJAA 4IL9A 5DABA 2HHHT 4HZBB 1RN7A 3FZKB 3EN1B 2VKJA 5HWXA 1DMQA 2JMHA 1E2AA 3T8UA 2BMQB 5LNKA 5CLKA 4H9QC 2VQET 1YIJ3 2PZVA 1N34T 1SIIA 4EBGA 5M19A 2XJ7A 1G02A 4KBMB 3UULA 3S67A 4HWDA 4GOUA 5JDGA 2XGNA 5IG3A 4EOZB 2GEYA 1DVCA 3ZT7A 5STDA 2NP9A 4HM5B 3CMLA 4GSPA 1BNGA 3ZCJA 4YT0A 1M7KA 2OA5A 3BB9A 3RRWA 5AQPB 4AQGA 1B21A 2E9XA 2YU2A 5HEUA 1BAOA 2H0GA 3LZAA 3WI3A 3LOYA 1U4QA 3P50A 1I0XA 2QIYA 4I55E 4PK6A 2KWHA 2L8KA 1E97A 1O7MB 1WCRA 4MMYB 2FXTA 2VKDA 1RKYA 3EI0A 1Q7Y4 2DNXA 5J2TE 3TLTA 1IBMT 5JR9A 3NM7A 3FBLA 4MFRA 5LMNT 4AKYA 4IE7A 2GBWB 1BNRA 2YINA 1E3VA 1K41A 4QXCB 4HM0B 1E3RA 3IEEA 4Z91A 1HNZT 1IAPA 5JDHA 4HYZA 1RGHA 4GB5A 3FBZA 2W67A 3LK2B 4MLKA 5L4HA 4ZXLA 2KF5A 1LNHA 3KFWX 3AA6B 3R6NA 4U72A 4H9SE 3CCE3 3Q2PA 1KSIA 2WMNA 2OOVA 2E2TA 1SQWA 1EG9B 1SUMB 2WAUA 4DMWA 1BNJA 3K9MC 4U7YA 3IPTA 4PJJA 4BTXA 3RC3A 5JPPA 4DR1T 1HG5A 3CCS3 3RYIE 2BMOB 1BRIA 3G8ZA 2YDSA 3GWHA 2P38A 4JI1T 4O3VA 3G4S3 1MNEA 4LF6T 5J2UE 2JMKA 4O8SA 3CWZB 5IG0A 3UQ7A 3RIAA 5FKYA 3CMA3 4LF8T 2XFTA 2GBXB 1T3BA 1Y4KA 5L3FB 1HKXA 2RA1A 1NAFA 4F6RC 4BJMA 2LRLA 1ULIB 3F9SA 3JUPA 4P0BA 3UU6A 1Q7HA 5ABGA 1W6YA 2YDQA 2Q07A 2JRKA 2AAEA 5L3BB 3GA8A 5FYMA 3FZLB 1WYBA 1W2B2 1YGEA 3QB5K 4TX4A 1E1HB 2CHOA 4ZI2D 3NBXX 4TX5A 4O4JE 2SBLA 1N8R4 2HMKB 3DH2A 1WTHA 3EVYA 5JQGE 4X1KE 2XH9A 2QA7A 1GSPA 4O02B 4JYAT 1HFAA 1YKHB 4DV0T 5ADXL 3HR0A 2G0UA 4GHOA 1JRQA 3SRZA 3PUAA 5ETWA 1JKGA 3C4XA 1W4NA 4EAHA 3DY5A 3ZFZA 5BR8T 3OKQA 1VQ73 4MBQA 3I1AA 1FUTA 4XB5A 2LQVA 2ES0A 2WY2A 2KNDA 2BBHA 1G96A 3O4XE 1UCUA 3RIUC 3UL5A 4CQIA 2XEPA 2V7LA 3PU8A 3MKDA 6GSPA 5M4YA 3D4AA 4CN6A 3CCU3 4QXHB 2Q9QA 1UCJA 2MF7A 3V5UA 3B4PA 3AEEA 1BRSA 2ML6A 7RNTA 1D1AA 3EDUA 1SHZC 2YFLB 5AEUB 1MIYA 2CXLA 2K5BB 2V8SV 3AEFA 3BNBA 3FG3A 3D79A 4ADZA 1QAFA 2FGTA 1W01A 4J9AA 2IC9A 3PUQA 3T8NA 4CPKA 3K3NA 3CKDA 4ANJA 1ZOYA 2CWVA 3CX8B 1BOXA 3EN8A 5JDLA 3WOEB 2VVNA 2YOEA 3AECA 1K9M4 1L5GB 4KZ1A 1VQ43 2LT3A 2E9XB 4I0UA 1WLXA 3JC6D 3LJCA 4ISTA 1UUWB 5AQQB 3FF2A 4AKIA 4YTMA 1OHPA 4LMLA 1OH0A 1I2GA 1EZ3A 2NR4A 4EIWA 4K1UA 2YEVC 4JUYA 2P0XA 4KX6A 4HFCA 1W2ZA 4DV2T 2BG9E 2INXA 3D5GA 2XGLA 2LLYA 1I8VA 1PU4A 2NOXA 2Y73A 2B1XB 1BUJA 3PJAJ 4DVDA 1BR0A 1EKMA 1IVVA 2X67A 5LGTB 4ZS3A 4FMCA 5IF6A 2BS2A 1JNRA 1Q40A 2CH9A 2FNQA 1S5AA 1NEKA 2VK9A 2IC6A 3N2GE 5FXXA 1EA2A 3MK7C 4IHJE 1JJ22 4TV9E 1OACA 2HPJA 3RC8A 3PE0A 4O4HE 5CXOA 4A56A 1T2IA 2DHRA 4YTPA 4WNKA 2W63A 1IQYA 3MACA 2YN6A 3VHLA 1OGZA 3QUJA 4K90B 3MPHA 1KNPA 1N36T 1HNXT 2C10A 4YTNA 4K61A 2K0MA 3V98A 2YDRA 3PJAA 1OPYA 2IMLA 5AQSB 2XAJB 4JEUB 2SARA 3T8OA 2I59A 5HGRA 2GSPA 2E2AA 3OW22 2M7OA 3D3LA 3DXOA 2IUKA 2ODVA 2CLYC 1HCIA 1DMMA 3OWSA 1XDOA 2XQ8A 3ZKRA 1JB2A 4CI1B 4EEDA 3RHWA 4NREA 1HF8A 2BS4A 4V1Av 4Z90A 3VR8A 2UUGC 1U5OA 3LT9A 5DQVA 5CA1E 1BNIA 1RHLA 3PCRA 1ROAA 1FYSA 4XBFB 5JTGA 3OX9A 3SWHA 4E7SA 4MMZB 4UXNB 2D0UA 3RH3A 4HFVA 5LHIB 3AXJB 5L47A 1YVBI 4JI3T 2WZIA 4EV5A 5HYAA 4GYRA 1FEWA 3KSPA 3JUMA 1GOYA 4LFAT 2FUPA 2K54A 4IIJE 2ML5A 3BU4A 3DP7A 1FGOA 4EB6E 1VQN3 5AIIA 3NWIA 5AFUL 4L9IA 2CLYB 3CQXC 2V6YA 4IGUA 3ZN0B 5CA0E 4ILUA 2HMJB 3ZYKA 4DUZT 1N33T 5BXQA 3LG7A 4N78D 2IMJA 1RGAA 3UNLA 4EV2A 3PTRB 1FZUA 3O8YA 2XUEA 1CEWI 1A2KA 3AEGA 2JPFA 4IT7A 3N9MA 1T8BA 3I0OA 3M3ZB 4AKLA 5EK4A 3N8BA 3AE6A 3D9RA 3DMCA 3QK6A 2J47A 2Z76A 2ACZA 1W5ZA 4R1KA 2KF3A 3FGYA 2OV9A 1UX5A 2VWAA 3UB1A 1X79A 3ZMZB 1HX8A 5LGNB 2JJ9A 3RQWA 1NDOB 3AHSA 3VRBA 1BNSA 1BRNL 3T1YT 3W15B 2RBIA 2HMLB 4IDQA 4P0AA 2BG9A 1VCTA 3HX8A 1LOXA 4KUMB 5AQKB 2W0QA 3H51A 5AQIB 4AIUA 4HM8B 3K1SA 3RQUA 1KNZA 1IQXA 3EE1A 3F40A 2W9PA 4WBNE 2D5UA 4IREA 2I0MA 3DGMA 4KHPT 2W66A 2CFLA 1Y64B 1IT7A 3NZPA 1VRBA 2XQAA 3OPCA 2V7IA 1YD8G 4HKAA 4J8TA 1SPUA 3NV0B 3GZYB 4HWHA 3EABA 1NWWA 3SLUA 3LBXA 1LOYA 3FKAA 3WDGB 4BL2A 1D0YA 1W09A 3JCFA 3ZC0A 1BRKA 1QLBA 5AQUB 3CPOA 2IUJA 1V57A 1RN1A 4GK5E 5ELUA 2RSXA 2LRKA 4PJNA 2X0YA 5I97A 2M6BA 1LRAA 4EGWA 2V6XA 5F5WA 3AMOA 3BQLA 4CXWA 4BL3A 4DR7T 1OEDE 3E08A 4CI2B 5L3CB 4EYYR 1W6GA 1VQ93 4JV5T 4DO0A 3AA7B 3ER7A 1D1BA 3URPA 3R84B 2E2UA 5TGNA 4EC6A 2W9QA 2KXGA 3S28A 4C90A 2CC3A 1YJ93 5CGMA 1GY5A 3ESLA 3QB5A 8RNTA 4JEHB 2KWIB 3IJEB 2YFIB 3PGBA 2Q9QB 2E5LT 4I5QA 2BU4A 3WAKA 2UUBT 2MC8A 5AQGB 1YHQ3 3MXZA 4HM4B 2XSHB 2W00A 4HWIB 5EQLA 3AEDA 3GWRA 1B7TA 2C5IT 3EB8A 4WYKA 4QH5A 1VQ83 2LE8A 3AE7A 1BR4A 1BSCA 1NENA 3RRCA 1NO3A 3DTOA 3X40A 8CHOA 3IA3A 5JDQA 4O4LE 1AQZA 5D82A 4O4IE 5HXSA 3KN4A 3CQGB 3NM2A 2W62A 5KX5E 3TLUA 2IIUA 3KBTA 3TDGA 3PUSA 4I4TE 3NBJA 1LRZA 1YVSA 4KT3B 3QOFA 2WOFA 3DGLA 3IMAB 5IUXA 2QYWA 4CDLA 1FUWA 4NHFA 3X1DA 1CYUA 2PTFA 3X3XA 4EXRA 1CHUA 1N5HA 1J2BA 3OWUA 4YJ2E 2Q9QC 4NIQA 1BRHA 1E7PA 5L3EB 3SYUA 4FCJA 1ROVA 2HMOB 1FA3A 3ZSTA 3FSDA 4HFBA 1B2MA 1QVG2 3EF8A 3JC6C 5JVDE 5JRCA 1W02A 1PY3A 2KINB 2YU1A 3U3IA 3FG4A 4H63H 1N5PA 3DGYA 3ANWA 1TTOA 3X41A 2Q9QD 2BZBA 1YNVX 3H3MA 1A2PA 4PAGA 1QJGA 3J7Yd 4HWFA 3SX1A 4CJNA 3EC9A 3K3OA 4KI0F 3EHCA 4YSXA 4JBWF 4HFHA 4HN9A 1W7CA 1M9GA 4BU4A 2WGQA 2R6GF 4JI7T 1OXZA 5LBQB 1Q864 1UUSA 3ZCIA 4ZS2A 3SOLA 1YQ4A 1AJ3A 1T2HA 3VU7H 1VCSA 3FH1A 1X9BA 2LHRA 4K1VA 3PUGA 1O7WB 3N54B 3FB2A 4X2HA 3V99A 4NXNT 4PK5A 1BVIA 3SEDA 1DVDA 3S29A 3PUXF 3ZT5A 4N6NB 4WBOA 4B3ST 1UCKA 2A72A 3IF8B 3A5XA 2A15A 5LG3A 2OTL3 4RZMA 2JQ5A 5F8PA 4QH4A 1KF6A 4U33A 3FG1A 3ZYLA 3EDVA 5HWYA 3WODG 4U7IA 1LOVA 1WMOA 5HXHA 4WYVA 3Q5EA 1ZEEA 3KVBA 2ZM6T 1LQMB 5LP6E 1I70A 7STDA 5G1LA 1JKGB 3CX6B 2HN2A 3NBRA 3A76A 4HM3B 3ZG0A 1NWMX 5FMNA 3F7SA 3KSED 1OEDB 3U1WA 2LOPA 1A2VA 1LKXA 4WP5A 3MSOA 2DLRA 1US7B 3AB3B 4HEAA 4QKNA 1OHSA 3PUWF 4I50E 4ZZBA 3WHOA 5HEJA 3A8YC 3Q2MA 5CB4E 2M6IA 1D6UA 2BHMA 4Z8XA 2ZHXB 1D0XA 1TJDA 4O2HA 1LNIA 2ZM0A 2X9HA 3DGOA 5AQLB 2BO9B 1KD14 4EXTA 5E0OA 4ZZCA 3EUHA 2HN1A 3PDYA 3ALAA 2XF3A 1A67A 1BNEA 4KP3C 2DWKA 2E9XD 2V1DB 5D81A 1M1K4 5J0ZA 2WB5A 4PNIA 3JUOA 1FGMA 2BVLA 1BNFA 2P0MA 3CNMA 2CG1A 3JADA 1FGRA 5FVKA 2F5MA 5LJNA 4MEIA 3EHZA 5AIGA 3AAEB 3I0YA 1LVKA 2MOZA 4HOHA 4MMXB 5DQWA 2UXCT 1SIHA 2F5WA 3EJVA 1MMDA 1S35A 1A90A 4PFPA 2WCAA 5C8YE 1HNWT 4UVCB 3Q1CA 2CWYA 3KFQC 3B57A 1MGRA 2FBWA 2W2UA 3I9YA 1X1XA 4DR4T 4JF8A 4EZ4A 4IDPA 3ZMVB 4LFBT 4XZCA 3BLZA 3X42A 1B27A 2P05A 1BGSA 2XSBA 1SA0E 3SOYA 2CCQA 3ETVA 3E22E 2H7OA 3JAFA 3F57A 4C91A 3LSVA 3AVSA 3TLSA 4H61A 1BR1A 2W4XA 4G1MB 4ZM8A 3Q5XA 4EV6A 3KINB 2GU1A 1IDPA 2CIUA 1RGCA 2QVAA 3VR9A 3C64A 3OVUA 2XZEA 2F99A 4E7ZA 5FY0A 3NX0A 3HKBE 1DE3A 3S4UA 4XAXB 2C5JA 3UQ4A 1XMQT 3UUBA 2MBGA 2YFJB 5FGOA 1UGOA 2RNTA 3LH4A 3B5MA 4MHCA 3LDQB 4PK4A 4XBYA 2JDIH 3HKEE 3AMOB 5EEOA 1JBRA 3RYHE 3RYFE 2V7KA 3K5TA 2XR8B 3ZJ2A 3L39A 3UL6A 2ZDJA 2K9AA 3WOFB 4F8HA 2CX0A 5FXVA 2CK3H 4OK0A 2L1SA 2E9XC 1MMNA 4DBQA 2AADA 2YX9A 4X65T 2WSSV 1W0BA 3LTAA 2NWBA 2XQYA 4IDOA 2XM1A 2NTYA 3Q3FA 3RIFA 4MJDA 1EEJA 3ZG5A 3B13A 5HEOA 1Q9EA 3LYGA 2R41A 3LK42 3F8HA 2CPTA 4IDNA 2KZ7B 1UX4A 5AQMB 3F31A 4G63A 1T5YA 2BVMA 4DR3T 4GKKT 3PS8A 5EK3A 1RRHA 4QH1A 4XBXA 4KMCA 2WZHA 1OGXA 1OEDC 4FJOA 3LFMA 3Q5WA 2Z6EA 2A9UA 4IE0A 4CZZB 1FMVA 2OWPA 4DV4T 5CF1A 5L3DB 3VSYA 2CMRA 3AE4A 3CQCB 2R4IA 2XAFB 1LOWA 4CCVA 2WWVA 1QALA 1HU9A 4FMBA 1OHOA 1JBTA 4COFA 1K734 1RCKA 4TUYE 2W6JH 2VURA 1OEDA
chains in the Genus database with same CATH topology
4JRFA 3AVRA 1WNHA 1LXEA 3L09A 3AAIA 2KXPB 5AYSC 2IAKA 5CK6A 4EYCA 2SPCA 2UXNB 2Y74A 5FP3A 4R9KA 4WHAA 2PG8A 2PBIA 2Z77A 1IVWA 2V7MA 3AA1B 3MWZA 1QSDA 3B4OA 4GL6A 2XRXB 2W03A 3BK9A 4XM4A 3K8PC 2BNGA 3CD63 3CVRA 1NB5I 1ZV4X 4GIWA 4WYKB 3C98B 2CM0A 5TAOA 3AAAB 2CWTA 3HK4A 4X20E 1KQS2 1R4CA 4HTEA 3J9X1 4U74A 1ZKEA 4PJMA 3MJXA 1ULJB 4TN7B 4GK0E 5LHGB 4ERRA 3K0ZA 4U13A 1C7HA 3ZMUB 2Y6XA 3N2KE 4ASKA 3RGRA 4DMVA 4UVBB 5JR9C 2C0SA 2LSJA 5EK2A 2GK9A 1JB4A 3FCSB 4ZI2C 4P09A 4L8PA 2DWGA 2NW8A 3CCJ3 3MG1A 4FCZA 2CW9A 3FHNA 3QK9A 4LSOA 1VQM3 3FF0A 1WYCA 3G0KA 2OOVC 4QWTA 4H63V 1GYBA 2WWUA 3HI2A 4KVHA 1RJOA 3I9WA 3QRDA 3CNXA 4HVNA 2LSYA 5LHHB 1MMGA 2HMMB 4JLEA 5JREA 1OWAA 3KVAA 4ISSA 3EBTA 3H3AA 3OXAA 3CX7B 4AKGA 4PJLA 1BR2A 3JUQA 5JPUA 1U5PA 2KT9A 1YJN3 2Z7AA 3B8LA 2WBLA 1T98A 3TKLB 2CXDA 3G713 1SJWA 2P9BA 3OWYA 3AA0B 3OBVE 1NJI4 3O9XA 3C51A 3G16A 4PEJA 5AYRB 1TUHA 2BT3A 1ZX2A 4L8OA 3CXC2 4LMIA 2OTJ3 4XDVA 5HXRA 1STDA 4RNYA 3SOAA 5G2GA 5J1GA 4ZOLE 1MIVA 2QGUA 1FGQA 4KFFA 5KP3A 3CME3 4YHJA 3UFEA 4R80A 4AQFA 1Q42A 1M904 3FZWA 3L0RA 1UI8A 1D0ZA 1ASKA 2RFRA 4X1YE 2KCDA 4IPBA 3HKDE 4N6TA 1CYVA 2OQEA 1IV7A 4LGQA 2HH7A 2XAHB 3ONXA 2CFDA 3V5SA 3F14A 1IZNB 5D83A 1O3XA 4HKVB 3KDSE 3GZBA 5LOVE 4G2AA 3PYJA 1IQ8A 3FXDB 2X51A 4IIAA 4KFDA 3VF1A 4YLHA 4H3UA 5HXCA 3G6E3 1S723 3LTBA 2MTQA 1ZHCA 2OQEC 3X3ZA 4H9OC 3NBBA 2RP4A 4MALA 1GY6A 1OUNA 5H6QB 5LC6A 2M67A 1KWIA 2VKHA 1FMWA 3T0UA 5KP4A 1GD4A 1N8QA 3F7XA 3NZQA 2CWUA 3Q90A 2XSOB 5AIFA 3GRDA 5LA6E 2E8IA 1V74A 2PNCA 2E2VA 3DGNA 5LJMA 3GN5B 3N9QA 2IA7A 2EHOC 4IE6A 4BJNA 5FXZA 5CF2A 5JBSA 4HE8A 2CG0A 4DBRA 2QA43 5A0OB 5BVBA 4L5GA 1O7GB 3WAJA 3LTDA 3SS1A 4PW8A 4YJ3E 4DNDA 4EZHA 3J7Yq 4HM7B 3KZTA 3MHEA 3LT8A 1VQ63 4AKHA 4UV9B 1ZO2A 3RPUA 2XTLA 4XBTA 1K8A4 4N6OB 3KV4A 3UUMA 3OV4A 3KE7A 3GN5A 1D6ZA 5JR9B 3NUVA 3KV6A 1IVUA 1OCVA 4FMDA 1HS7A 4RNZA 3L3PA 5AI1A 2UX0A 4H9NC 2D2SA 3PXMA 1MOLA 4XDWA 5IERA 3NRYA 3ZPOA 2DI4A 3OJAA 3WMDA 5EZYE 3RYCE 5IW9A 2NW9A 3CPZA 3ZYMA 1TFOA 2O3OA 2LHNA 2K48A 1HG2A 2N9DA 2STDA 4FCMA 1IK3A 4N6MA 4HGAA 2D0TA 4CXXA 2EHOD 3IBPA 1S94A 2GU3A 2KRTA 2LYXA 4AEQA 5DRVA 3D0TA 2Y48B 3ROBA 1YJW3 1V9DA 3I553 2RGQA 2ODUA 1UUVB 3SVAA 4OUQA 3C50A 1KC84 3N9OA 2ACXA 5H6RB 3UT5E 2CEAA 3ZLIA 2W56B 5FY7A 4QX7B 4FMAA 4NUVA 3KBUA 3KKGA 2DCFA 2J1DG 4QHOA 2HMNB 4QWNB 3BQKA 1WRDA 1G8XA 3VKHA 1Q814 4EYUA 1K28A 3DUKA 1D6YA 1GS3A 1VOMA 1OF5B 3LMLA 4UEMA 3N9LA 6STDA 4L0RA 2PFVA 3BNEA 4UF0B 5JDFA 4H9PC 2W0GA 3WA2X 3CC73 3N9PA 2NTXA 2H7VC 5JDNA 1AR0A 1FIOA 2EHOB 2LSIA 1W6CA 3SXXA 2W56A 4B6XA 3FLJA 3X3YA 2X9YA 1US1A 2X66A 5HXEA 2ZM8A 4HM1B 3F2EA 2OCTA 2W61A 1YW0A 2EHOA 3BNCA 4L7KA 4OYKA 1IVXA 3EBYA 1BUQA 2Y8DA 1IJ6A 3NQZA 2BMRB 3CPW2 5IEOA 3O1JA 3N9NA 1Q40B 4UIGA 4ZI3D 4WWUC 1VQ53 4HZ9B 3JUNA 3RDEA 4BA9A 1IU7A 1QUUA 3H3HA 3NHXA 2LEHA 5AIHA 5IG4A 4CI3B 4N6LA 1QMAA 2MYSA 3UJMA 5L2LA 4X1IE 3E99A 2V26A 3RX6A 3H37A 4HJLB 1NU3A 1N9JA 4IDZA 2N2NA 5LGUB 2D1WA 5JH7E 3EQQB 5LCYA 1ISKA 1WMPA 1CUNA 2CFWA 3STDA 3ZJ1A 1TFKA 4FR9A 4UV8B 3O1IA 4NUUA 3MA9A 1MIWA 3HA4A 4AQFC 1GY7A 3LTCA 2CWOA 2X68A 3C4WA 3ECFA 1JN5B 4LEHA 4IE5A 3DM8A 3HZPA 1N9EA 2ZLYA 3NXJA 3M8CA 3HIGA 2WO0A 3KV9A 3VKGA 2XAGB 5KP1A 2QGSA 4STDA 2BDEA 1O7NB 4FI5A 1AVLA 4YFSA 2B24B 4N6V0 3PZWA 2W04A 4HM2B 1IJ5A 4UF0A 2L3LA 4TV8E 5FXWA 3K63A 1QVF2 5BMVE 2W2CA 5IYZE 4ZI7E 1OF5A 3OYZA 4OYJA 1JV2B 3DZLA 2C11A 1KK7A 5A1LA 3MKIA 3K3QC 3M65A 4BTYA 5JRCB 5ELJA 3UUXB 2LSGA 2VB6A 4R4KA 3HIIA 3ZN1B 1DMNA 3LBXB 1F8NA 2F86B 5LBMA 2RCDA 4R9LA 1DYUA 1M1XB 2UXXB 5L3GB 3DJBA 3HI7A 2V7JA 1VZZA 1IV9A 2B1EA 4M1PA 3UUNA 5LXTE 3F8XA 2HPLA 3NV0A 1EQKA 1YKEB 4ZI3C 2QEX3 2NW7A 2GEXA 4AXPA 4X2OA 1H7CA 2C5KT 2VKOA 3PU3A 4H9RC 1FGTA 2WGOA 1WR6A 4J2CA 4OVMA 2V1LA 1TU5A 5DJQC 3S27A 4GYSA 2VL8A 5FW5A 1CQSA 1GD3A 3MG3A 4UVAB 4HM6B 2VASA 5KMGP 2JQQA 4BAYB 1IT8A 3P8CD 3LK3B 5IENA 3N5LA 3GZXB 3P7IA 4WFOA 4UELA 4TZ4C 3BNDA 4KFEA 5FY1A 4IE4A 3N2OA 1W00A 2K24A 4AKZA 2CXFA 2ZL8A 1O7PB 3CCM3 1VQO3 2GXFA 3WA3A 2X9XA 2LOSA 3VGNA 2KLQA 4PFOA 4I4KA 4Q53A 2O9UX 2WMOA 1LVFA 3O1HA 3U78A 2WM9A 1JN5A 3E0ZA 2XFSA 3MZKB 1JNQA 4N6UA 3Q9DA 1YIT3 3GMIA 4CXYA 1LVNA 5GONE 1VQL3 3MG2A 2ZMAA 1G73A 2XASB 1UI7A 4ORLA 5IHYA 5HAXA 2A3DA 3I563 3CC23 5JDMA 1MNDA 1STFI 4O2AE 2ZM2A 2X0LB 3PCSA 3CCQ3 3BQIA 2F98A 1Q824 1AV4A 3KV5A 5LG4A 1MMAA 1QAKA 2H3RA 4RBNA 4O2BE 2L9QA 1NB3I 2X9WA 3C4ZA 2IW5B 4I43B 3K7CA 4BTWA 3HKCE 4AI6A 3ANWB 4AKRB 3I0QA 4OHFA 2YK0A 2CFGA 5EVHA 3S5CA 1O7HB 3HL6A 2XHEB 1WQLB 4WW0A 5F3JA 2WOHA 2PJQA 2L4VA 1AVKA 1MNLA 3UTKA 3OYXA 5LC7A 3CCR3 1YI23 2KMFA 1WMNA 3JVCA 3ETUA 3ZMSB 2N1GA 2A2FX 3KIIA 3V92A 2LSKA 1TIJA 3FXEB 1PFPA 1VQK3 4ZHQE 1D1CA 2CFKA 1VQP3 3U97A 2I9WA 3NQYA 2Z6BA 4QX8B 3PURA 3ZC1A 5IEPA 3CCL3 3NRXA 1HTJF 1TP6A 1UW1A 4OFZA 3MYTA 5KDMC 4QXBB 2D42A 3N9HA 4LZIA 3CU3A 2CA5A 2CHCA 3RKOA 2LM9A 2LJLA 3GZRA 1RRLA 2P09A 4N3VA 3RGAA 3EX9A 5LYJE 3ZEFB 4HBRA 5DREA 1Z0PA 5FNVE 3LXUX 3ZMTB 3IHRA 2CKFB 3B7CA 4K0UA 5IG5A 2CE7A 2XAQB 1U8CB 3CC43 5AEWB 1JB5A 1Z1SA 3QC9A 3GAXA 3CCV3 5DABA 4HZBB 1RN7A 3EN1B 2VKJA 5HWXA 1DMQA 2JMHA 3T8UA 2BMQB 5LNKA 5CLKA 4H9QC 1YIJ3 2PZVA 1SIIA 4EBGA 4KBMB 3UULA 3S67A 4GOUA 5JDGA 2XGNA 5IG3A 4EOZB 2GEYA 1DVCA 5STDA 2NP9A 4HM5B 3CMLA 3ZCJA 2OA5A 3BB9A 3RRWA 4AQGA 2E9XA 2YU2A 3LZAA 3WI3A 3LOYA 1U4QA 2QIYA 4I55E 4PK6A 2KWHA 2L8KA 1E97A 1O7MB 4MMYB 2FXTA 2VKDA 1RKYA 1Q7Y4 2DNXA 5J2TE 5JR9A 3NM7A 3FBLA 4MFRA 4AKYA 4IE7A 2GBWB 2YINA 1E3VA 1K41A 4QXCB 4HM0B 1E3RA 3IEEA 1IAPA 5JDHA 4HYZA 4GB5A 3FBZA 3LK2B 4MLKA 1LNHA 3KFWX 3AA6B 3R6NA 4U72A 4H9SE 3CCE3 3Q2PA 1KSIA 2WMNA 2OOVA 2E2TA 1SQWA 1EG9B 2WAUA 4DMWA 3K9MC 3IPTA 4PJJA 4BTXA 3RC3A 5JPPA 1HG5A 3CCS3 3RYIE 2BMOB 3G8ZA 3GWHA 2P38A 4O3VA 3G4S3 1MNEA 5J2UE 2JMKA 4O8SA 3CWZB 5IG0A 3CMA3 2XFTA 2GBXB 1Y4KA 5L3FB 1HKXA 2RA1A 1NAFA 4F6RC 4BJMA 1ULIB 3F9SA 3JUPA 4P0BA 1W6YA 2Q07A 2JRKA 5L3BB 3GA8A 5FYMA 1WYBA 1W2B2 1YGEA 4TX4A 1E1HB 4ZI2D 3NBXX 4TX5A 4O4JE 2SBLA 1N8R4 2HMKB 1WTHA 3EVYA 5JQGE 4X1KE 2XH9A 2QA7A 4O02B 1HFAA 1YKHB 5ADXL 3HR0A 2G0UA 1JRQA 3SRZA 3PUAA 5ETWA 1JKGA 3C4XA 1W4NA 4EAHA 3DY5A 3OKQA 1VQ73 4MBQA 3I1AA 4XB5A 2LQVA 2ES0A 2KNDA 1G96A 3O4XE 1UCUA 3UL5A 4CQIA 2XEPA 2V7LA 3PU8A 3MKDA 5M4YA 3CCU3 4QXHB 2Q9QA 2MF7A 3V5UA 3B4PA 2ML6A 1D1AA 3EDUA 1SHZC 2YFLB 5AEUB 1MIYA 2CXLA 2K5BB 3BNBA 3FG3A 4ADZA 1QAFA 2FGTA 1W01A 4J9AA 2IC9A 3PUQA 3T8NA 3K3NA 3CKDA 4ANJA 2CWVA 3CX8B 3EN8A 5JDLA 3WOEB 1K9M4 1L5GB 4KZ1A 1VQ43 2LT3A 2E9XB 1WLXA 3JC6D 3LJCA 4ISTA 1UUWB 3FF2A 4AKIA 1OHPA 1OH0A 1EZ3A 4EIWA 4K1UA 2YEVC 4JUYA 2P0XA 1W2ZA 2INXA 2XGLA 1PU4A 2NOXA 2Y73A 2B1XB 1BR0A 4DVDA 1EKMA 1IVVA 2X67A 5LGTB 4ZS3A 4FMCA 5IF6A 1Q40A 2CH9A 2FNQA 1S5AA 2VK9A 2IC6A 3N2GE 5FXXA 1EA2A 3MK7C 4IHJE 1JJ22 4TV9E 1OACA 2HPJA 3RC8A 3PE0A 4O4HE 5CXOA 4A56A 2DHRA 4WNKA 2W63A 1IQYA 3MACA 3VHLA 1OGZA 3QUJA 4K90B 3MPHA 2C10A 4K61A 3V98A 2K0MA 1OPYA 2XAJB 4JEUB 3T8OA 2I59A 5HGRA 3OW22 2M7OA 3D3LA 3DXOA 2IUKA 2ODVA 2CLYC 1HCIA 1DMMA 3OWSA 1JB2A 4CI1B 4NREA 1HF8A 4V1Av 1U5OA 3LT9A 5DQVA 5CA1E 3PCRA 1ROAA 4XBFB 3OX9A 3SWHA 4E7SA 4MMZB 4UXNB 2D0UA 3RH3A 4HFVA 5LHIB 1YVBI 4EV5A 5HYAA 4GYRA 1FEWA 3KSPA 3JUMA 2K54A 4IIJE 2ML5A 3DP7A 1FGOA 4EB6E 1VQN3 5AIIA 5AFUL 4L9IA 2CLYB 3CQXC 4IGUA 3ZN0B 5CA0E 4ILUA 2HMJB 3ZYKA 5BXQA 3LG7A 4N78D 2IMJA 3UNLA 4EV2A 3PTRB 3O8YA 2XUEA 1CEWI 1A2KA 2JPFA 4IT7A 3N9MA 3I0OA 4AKLA 5EK4A 3N8BA 3D9RA 3DMCA 3QK6A 2Z76A 1W5ZA 4R1KA 3FGYA 1UX5A 2VWAA 3UB1A 3ZMZB 1HX8A 5LGNB 2JJ9A 1NDOB 3W15B 2HMLB 4P0AA 3HX8A 1LOXA 4KUMB 2W0QA 3H51A 4HM8B 1KNZA 1IQXA 3EE1A 3F40A 2W9PA 4WBNE 2D5UA 3DGMA 2CFLA 1Y64B 1IT7A 3NZPA 1VRBA 2V7IA 1YD8G 4HKAA 4J8TA 1SPUA 3NV0B 3GZYB 1NWWA 3SLUA 3LBXA 3FKAA 3WDGB 1D0YA 3ZC0A 3CPOA 2IUJA 4GK5E 5ELUA 2RSXA 4PJNA 5I97A 3AMOA 3BQLA 4CXWA 3E08A 4CI2B 5L3CB 4EYYR 1W6GA 1VQ93 4DO0A 3AA7B 3ER7A 1D1BA 3R84B 2E2UA 5TGNA 4EC6A 2W9QA 2KXGA 3S28A 4C90A 2CC3A 1YJ93 1GY5A 3ESLA 4JEHB 2KWIB 3IJEB 2YFIB 3PGBA 2Q9QB 3WAKA 2MC8A 1YHQ3 3MXZA 4HM4B 2XSHB 2W00A 5EQLA 3GWRA 1B7TA 2C5IT 3EB8A 4WYKA 1VQ83 2LE8A 1BR4A 3RRCA 1NO3A 3DTOA 3X40A 8CHOA 5JDQA 4O4LE 5D82A 4O4IE 5HXSA 3KN4A 3CQGB 3NM2A 2W62A 5KX5E 3KBTA 3TDGA 3PUSA 4I4TE 3NBJA 1LRZA 2WOFA 3DGLA 3IMAB 4CDLA 1FUWA 4NHFA 1CYUA 3X3XA 4EXRA 1N5HA 1J2BA 3OWUA 4YJ2E 2Q9QC 5L3EB 4FCJA 1ROVA 2HMOB 1FA3A 3FSDA 1QVG2 3EF8A 3JC6C 5JVDE 5JRCA 1W02A 2KINB 2YU1A 3U3IA 3FG4A 4H63H 1N5PA 3ANWA 3X41A 2Q9QD 2BZBA 4PAGA 1QJGA 3J7Yd 3SX1A 3EC9A 3K3OA 3EHCA 4HN9A 1W7CA 1M9GA 2WGQA 1OXZA 5LBQB 1Q864 3ZCIA 4ZS2A 3SOLA 1AJ3A 3VU7H 3FH1A 2LHRA 4K1VA 3PUGA 1O7WB 3N54B 3FB2A 4X2HA 3V99A 4PK5A 3SEDA 1DVDA 3S29A 4N6NB 4WBOA 2A72A 3IF8B 3A5XA 2A15A 2OTL3 4RZMA 2JQ5A 5F8PA 3FG1A 3ZYLA 3EDVA 5HWYA 3WODG 1WMOA 5HXHA 1ZEEA 3KVBA 5LP6E 7STDA 1JKGB 3CX6B 3NBRA 3A76A 4HM3B 1NWMX 5FMNA 3F7SA 3KSED 3U1WA 2LOPA 1A2VA 1LKXA 4WP5A 3MSOA 2DLRA 1US7B 3AB3B 4HEAA 4QKNA 1OHSA 4I50E 5CB4E 3Q2MA 2BHMA 1D6UA 4Z8XA 1D0XA 4O2HA 2ZM0A 2X9HA 3DGOA 2BO9B 1KD14 4EXTA 5E0OA 3EUHA 3PDYA 3ALAA 2XF3A 1A67A 4KP3C 2DWKA 2E9XD 2V1DB 5D81A 1M1K4 4PNIA 3JUOA 1FGMA 2BVLA 2P0MA 2CG1A 3CNMA 1FGRA 5LJNA 4MEIA 5AIGA 3AAEB 3I0YA 1LVKA 2MOZA 4MMXB 5DQWA 1SIHA 3EJVA 1MMDA 1S35A 1A90A 4PFPA 5C8YE 4UVCB 3Q1CA 2CWYA 3KFQC 3B57A 3I9YA 4JF8A 4EZ4A 3ZMVB 4XZCA 3BLZA 3X42A 2P05A 1SA0E 3SOYA 2CCQA 3ETVA 3E22E 2H7OA 3F57A 4C91A 3AVSA 4H61A 1BR1A 4G1MB 4ZM8A 3Q5XA 3KINB 2GU1A 1IDPA 2CIUA 3C64A 2F99A 4E7ZA 5FY0A 3NX0A 3HKBE 3S4UA 4XAXB 2C5JA 2YFJB 2MBGA 5FGOA 3LH4A 4MHCA 4PK4A 4XBYA 2JDIH 3HKEE 3AMOB 5EEOA 3RYHE 3RYFE 2V7KA 3K5TA 2XR8B 3ZJ2A 3UL6A 2ZDJA 2K9AA 3WOFB 5FXVA 2CK3H 4OK0A 2E9XC 1MMNA 4DBQA 2YX9A 2WSSV 3LTAA 2NWBA 2XQYA 2NTYA 4MJDA 3B13A 3LYGA 3F8HA 3LK42 2KZ7B 1UX4A 3F31A 4G63A 1T5YA 2BVMA 3PS8A 5EK3A 1RRHA 4XBXA 4KMCA 1OGXA 4FJOA 3LFMA 3Q5WA 2Z6EA 4IE0A 4CZZB 1FMVA 2OWPA 5CF1A 5L3DB 3VSYA 2CMRA 3CQCB 2R4IA 2XAFB 4CCVA 1QALA 1HU9A 4FMBA 1OHOA 1K734 4TUYE 2W6JH 1X79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OK0 A;  4O8S A; 
#chains in the Genus database with same CATH topology
 4JRF A;  5HCM A;  4HFI A;  3AVR A;  4LMJ A;  1WNH A;  1LXE A;  3L09 A;  3AAI A;  2KXP B;  5AYS C;  2IAK A;  3SFD A;  1SAR A;  5CK6 A;  2WU5 A;  2WDQ A;  4EYC A;  2SPC A;  3A5E A;  2UXN B;  4ILA A;  2Y74 A;  5FP3 A;  2V6Y B;  4R9K A;  4WHA A;  4HWC A;  4K0K T;  3P4R A;  2PG8 A;  2PBI A;  2Z77 A;  4NPB A;  1IVW A;  2V7M A;  3AA1 B;  3MWZ A;  1QSD A;  3B4O A;  4GL6 A;  2XRX B;  2W03 A;  3BK9 A;  4XM4 A;  3K8P C;  5BIR A;  1AY7 A;  1JBS A;  2BNG A;  3CD6 3;  3CVR A;  4NXM T;  1NB5 I;  1ZV4 X;  4GIW A;  4WYK B;  2UUA T;  3C98 B;  2CM0 A;  5TAO A;  3AAA B;  2CWT A;  3NVO A;  3HK4 A;  4X20 E;  1KQS 2;  1R4C A;  4HTE A;  3J9X 1;  4U74 A;  2XQ7 A;  1V58 A;  3UU4 A;  2IDO B;  1ZKE A;  5ABE A;  4PJM A;  3MJX A;  1ULJ B;  4TN7 B;  2JQK A;  4GK0 E;  5LHG B;  4ERR A;  4LF5 T;  3K0Z A;  4U13 A;  2KF6 A;  1C7H A;  4U3C A;  3ZMU B;  2Y6X A;  1RDS A;  5G1K A;  5FL1 A;  3N2K E;  1GMP A;  4ASK A;  3RGR A;  2WDR A;  3EAM A;  4KHZ F;  4DMV A;  4UVB B;  2IYJ A;  5JR9 C;  2C0S A;  2LSJ A;  3VRA A;  3ZT6 A;  5EK2 A;  2GK9 A;  1JB4 A;  3FCS B;  1RGG A;  4ZI2 C;  4P09 A;  4L8P A;  3SFE A;  3ZSS A;  2DWG A;  2NW8 A;  3CCJ 3;  3MG1 A;  4FCZ A;  2CW9 A;  3FHN A;  2WP9 A;  3QK9 A;  6RNT A;  4LSO A;  1VQM 3;  1YGW A;  3FF0 A;  1WYC A;  3G0K A;  2OOV C;  4QWT A;  2BKN A;  4H63 V;  4DID B;  1GYB A;  2KAA A;  2WWU A;  3HI2 A;  4KVH A;  4ILC A;  1RJO A;  3I9W A;  3QRD A;  3CNX A;  4HVN A;  4X64 T;  3D5I A;  2LSY A;  5LHH B;  1ZS7 A;  3RF1 A;  1MMG A;  2HMM B;  4JLE A;  5AQT B;  4GKJ T;  4CN1 A;  4JI5 T;  5JRE A;  4U31 A;  1OWA A;  3KVA A;  4DKI A;  4JI6 T;  4ISS A;  3EBT A;  3H3A A;  3OXA A;  3CX7 B;  4AKG A;  4PJL A;  1BR2 A;  3JUQ A;  5JPU A;  3RNT A;  1U5P A;  2KT9 A;  1YJN 3;  2Z7A A;  4NPP A;  5RNT A;  1G0T A;  1LQG C;  3B8L A;  1UUR A;  2WBL A;  1T98 A;  3TKL B;  4AQY T;  2CXD A;  3G71 3;  1SJW A;  2V5D A;  2P9B A;  1UGH I;  3OWY A;  3AA0 B;  5C2T A;  3OBV E;  4ILF A;  1NJI 4;  3O9X A;  3C51 A;  3G16 A;  5AQO B;  4PEJ A;  1RCL A;  3UU8 A;  4WZX A;  5AYR B;  2JIW A;  1TUH A;  2BT3 A;  1ZX2 A;  4L8O A;  3CXC 2;  4LMI A;  2OTJ 3;  4YSZ A;  4XDV A;  5HXR A;  1STD A;  4EEB A;  4RNY A;  3SOA A;  5G2G A;  4DUY T;  5M18 A;  5J1G A;  4ZOL E;  1MIV A;  4HFD A;  2VVS A;  3AEA A;  4YHH T;  1CH0 A;  3PV0 F;  4OX9 T;  1MWR A;  1YXR A;  1C54 A;  2RPA A;  2QGU A;  1FGQ A;  4KFF A;  5KP3 A;  2IHR 1;  3CME 3;  1YQ3 A;  4YHJ A;  3UFE A;  4R80 A;  4AQF A;  5CFB A;  1Q42 A;  1M90 4;  3FZW A;  3L0R A;  1UI8 A;  1D0Z A;  1ASK A;  1I3F A;  1KEY A;  2RFR A;  1T72 A;  4X1Y E;  2KCD A;  1ZP0 A;  4IPB A;  3HKD E;  4N6T A;  1CYV A;  2OQE A;  1IV7 A;  2HH7 A;  2XAH B;  3ONX A;  2CFD A;  4LGQ A;  3V5S A;  3AE9 A;  1IZN B;  3F14 A;  5D83 A;  2FJB A;  3A7M A;  3HOH A;  1O3X A;  4HKV B;  3KDS E;  3GZB A;  1VQQ A;  5LOV E;  3P4Q A;  4G2A A;  3AHW A;  4TWF A;  3PYJ A;  1IQ8 A;  3ONJ A;  3FXD B;  2X51 A;  2HOH A;  4IIA A;  1UUG B;  4KFD A;  3VF1 A;  4YLH A;  4H3U A;  5HXC A;  1B2S A;  2FJD A;  3G6E 3;  1S72 3;  3LTB A;  1PYL A;  2MTQ A;  1KNR A;  1ZHC A;  2OQE C;  3X3Z A;  4H9O C;  1J1J A;  2F4Y A;  3NBB A;  2RP4 A;  4MAL A;  1GY6 A;  1FW7 A;  1OUN A;  5H6Q B;  5LC6 A;  2M67 A;  1HR0 T;  2VKH A;  1FMW A;  1GOU A;  1KWI A;  2BIR A;  3T0U A;  5KP4 A;  1GD4 A;  1N8Q A;  3F7X A;  2F4V T;  5C3J A;  1RNB A;  1XMO T;  1R4Y A;  3NZQ A;  2CWU A;  3Q90 A;  2XSO B;  5AIF A;  5ABF A;  4RNT A;  3GRD A;  5LA6 E;  2E8I A;  1V74 A;  2ZA4 A;  2PNC A;  3RKG A;  2E2V A;  3DGN A;  5LJM A;  3GN5 B;  2CBJ A;  3N9Q A;  2IA7 A;  2EHO C;  2AE9 A;  4IE6 A;  4BJN A;  5FXZ A;  4UR9 A;  5CF2 A;  5JBS A;  4TWD A;  1I2F A;  4HE8 A;  2CG0 A;  4DBR A;  2QA4 3;  1W9R A;  5A0O B;  1N32 T;  5BVB A;  2KF4 A;  2UUC T;  4L5G A;  1O7G B;  3WAJ A;  4LYL B;  3LTD A;  3SS1 A;  3ONL C;  4PW8 A;  2KSR A;  4YJ3 E;  5GSP A;  4DND A;  4EZH A;  3J7Y q;  1MWT A;  2H88 A;  2H0H A;  4HM7 B;  3KZT A;  3MHE A;  3LT8 A;  1VQ6 3;  4AKH A;  4UV9 B;  4B3R T;  3RPU A;  2E5V A;  2XTL A;  1ZO2 A;  4XBT A;  4HAA A;  4JI2 T;  1TRQ A;  4TWH A;  1RGE A;  4CN4 A;  3AXJ A;  1K8A 4;  4N6O B;  3KV4 A;  1HZ1 A;  3UUM A;  3TLW A;  3OV4 A;  4DV5 T;  3KE7 A;  3GN5 A;  3PUY F;  1IBL T;  1D6Z A;  5JR9 B;  3NUV A;  3KV6 A;  2WU2 A;  1UDI I;  1IVU A;  2LKH A;  4U2Z A;  1X1Y A;  1OCV A;  4FMD A;  1HS7 A;  4RNZ A;  3L3P A;  5ABF B;  2UX0 A;  5AI1 A;  4H9N C;  2D2S A;  3PXM A;  2XM2 A;  4U2Y A;  1MOL A;  4XDW A;  5IER A;  3NRY A;  2IY2 A;  3ZPO A;  2DI4 A;  3OJA A;  3WMD A;  5EZY E;  3RYC E;  5IW9 A;  1UK5 A;  7GSP A;  2NW9 A;  9RNT A;  4DV7 T;  1XNR T;  3CPZ A;  2LKG A;  3ZYM A;  1TFO A;  2O3O A;  2LHN A;  4DR2 T;  2K48 A;  1RGK A;  1B20 A;  1HG2 A;  2N9D A;  2STD A;  4FCM A;  2C4B A;  1IK3 A;  4X62 T;  2V5C A;  4N6M A;  4HGA A;  2D0T A;  4CXX A;  2EHO D;  3IBP A;  1S94 A;  2GU3 A;  2KRT A;  2LYX A;  4AEQ A;  2XQ4 A;  1GMR A;  5DRV A;  3KCH A;  3D0T A;  1BU4 A;  2Y48 B;  4DV3 T;  3ROB A;  1YJW 3;  1V9D A;  3I55 3;  2UXD T;  1RN4 A;  4DV1 T;  2RGQ A;  2D9D A;  2ODU A;  1UUV B;  3SVA A;  3ABV A;  4OUQ A;  3QNU A;  4BIR A;  1GQE A;  3Q5D A;  3C50 A;  1KC8 4;  3N9O A;  2ACX A;  5H6R B;  1KFY A;  1WR0 A;  2CEA A;  3UT5 E;  3ZLI A;  2WS3 A;  2W56 B;  5FY7 A;  1J5E T;  4QX7 B;  4FMA A;  4NUV A;  1FJG T;  3KBU A;  1RGF A;  3KKG A;  2DCF A;  2J1D G;  4QHO A;  2HMN B;  4QWN B;  4EW5 A;  3BQK A;  1WRD A;  1RTU A;  5AQN B;  1G8X A;  3RGL A;  3VKH A;  1RLS A;  1Q81 4;  4EYU A;  1K28 A;  2JQH A;  4YSY A;  3DUK A;  1GOV A;  3PUZ F;  1D6Y A;  1GS3 A;  4HFE A;  4A98 A;  1VOM A;  1OF5 B;  3LML A;  2MPK A;  4UEM A;  3N9L A;  6STD A;  4L0R A;  2PFV A;  3BNE A;  4UF0 B;  5JDF A;  4H9P C;  2W0G A;  3WA2 X;  3CC7 3;  3N9P A;  2NTX A;  2H7V C;  5JDN A;  1AR0 A;  1FIO A;  2EHO B;  2LSI A;  1W6C A;  3SXX A;  2W56 A;  4B6X A;  3FLJ A;  3X3Y A;  2X9Y A;  1US1 A;  2X66 A;  5FVL A;  4P1N A;  5HXE A;  2ZM8 A;  4HM1 B;  3F2E A;  2X0H A;  2OCT A;  2W61 A;  1YW0 A;  2EHO A;  3BNC A;  1ZGX A;  2F56 A;  1DU2 A;  1SE7 A;  4L7K A;  4IL4 A;  4OYK A;  1Z8U A;  1IVX A;  3EBY A;  1IYY A;  1BUQ A;  2Y8D A;  1IJ6 A;  1J5W A;  3NQZ A;  2BMR B;  3CPW 2;  5IEO A;  3O1J A;  3NKZ A;  2I6H A;  3N9N A;  2B76 A;  4UIG A;  1Q40 B;  1BSB A;  4ZI3 D;  4B3M T;  4WWU C;  3P4S A;  1VQ5 3;  4HZ9 B;  3JUN A;  3RDE A;  4BA9 A;  1IU7 A;  1QUU A;  3H3H A;  4LF4 T;  3RI5 A;  3NHX A;  4ILB A;  1JZD A;  2LEH A;  5AIH A;  5IG4 A;  3TLV A;  2BG9 B;  4CI3 B;  4N6L A;  2BBJ A;  1QMA A;  2MYS A;  3UJM A;  5HOH A;  3OTO T;  5L2L A;  1XDP A;  4X1I E;  3E99 A;  4YXD A;  2V26 A;  3RX6 A;  3H37 A;  1UCI A;  4HJL B;  1NU3 A;  1N9J A;  4IDZ A;  2N2N A;  5LGU B;  2D1W A;  5JH7 E;  1HYF A;  5LCY A;  3EQQ B;  3AE1 A;  1BAN A;  1ISK A;  5HEG A;  4JI0 T;  1WMP A;  1CUN A;  2CFW A;  3STD A;  3ZJ1 A;  2UGI A;  1TFK A;  4UV8 B;  4FR9 A;  3L8R A;  5AQV B;  4LF9 T;  3O1I A;  2WDV A;  2XQ3 A;  2DL1 A;  4NUU A;  3MA9 A;  1MIW A;  3GSP A;  2YKS A;  5M1A A;  3HA4 A;  4J5K A;  3AEB A;  2CRB A;  3AE3 A;  4AQF C;  4DR6 T;  1GY7 A;  3LTC A;  2CWO A;  3RIU A;  4YY3 T;  2X68 A;  3C4W A;  3ECF A;  1JN5 B;  4LEH A;  4IE5 A;  3UU3 A;  3DM8 A;  3HZP A;  1N9E A;  3CIR A;  2ZLY A;  3NXJ A;  3M8C A;  3HIG A;  2WO0 A;  3KV9 A;  3VKG A;  2XAG B;  5KP1 A;  1BSE A;  2QGS A;  4LMK A;  4STD A;  1HX1 B;  2BDE A;  1O7N B;  4FI5 A;  1AVL A;  1B3S A;  4YFS A;  2B24 B;  4N6V 0;  3PZW A;  5LMU T;  2W04 A;  4HM2 B;  4A97 A;  1IJ5 A;  4UF0 A;  2L3L A;  4TV8 E;  5FXW A;  3K63 A;  1DET A;  1QVF 2;  5CJ5 A;  3RLF F;  5BMV E;  2W2C A;  5IYZ E;  4ZI7 E;  1OF5 A;  3OYZ A;  4OYJ A;  3UU5 A;  1JV2 B;  1MGW A;  1FUS A;  3DZL A;  2C11 A;  4JI8 T;  1KK7 A;  5A1L A;  3MKI A;  3K3Q C;  3M65 A;  4BTY A;  5JRC B;  3P4W A;  4IT4 A;  5ELJ A;  5AQR B;  3UUX B;  2XQ5 A;  2XY8 B;  2LSG A;  2VB6 A;  4R4K A;  3HII A;  3ZN1 B;  1DMN A;  2CBI A;  2XPK A;  3LBX B;  1XWM A;  3PUV F;  5AQH B;  1IBK T;  1F8N A;  2F86 B;  5LBM A;  3FZH B;  2RCD A;  4R9L A;  1DYU A;  1M1X B;  2UXX B;  5L3G B;  3DJB A;  3HI7 A;  2V7J A;  5BU4 A;  1VZZ A;  1IV9 A;  2B1E A;  4M1P A;  3UUN A;  5LXT E;  3F8X A;  2VL0 A;  2HPL A;  3NV0 A;  1EQK A;  1YKE B;  4ZI3 C;  2QEX 3;  1JZO A;  2NW7 A;  1BRG A;  2GEX A;  1BSA A;  4AXP A;  4X2O A;  1H7C A;  2C5K T;  2VKO A;  3PU3 A;  4H9R C;  1FGT A;  2H0I A;  2WGO A;  1WR6 A;  4J2C A;  1BSD A;  4OVM A;  4Q25 A;  2V1L A;  2XSA A;  1TU5 A;  5DJQ C;  3S27 A;  4GYS A;  2VL8 A;  5FW5 A;  1CQS A;  2JQ9 A;  1M62 A;  1GD3 A;  3FZF B;  3MG3 A;  4UVA B;  4HM6 B;  2VAS A;  1I3I A;  5KMG P;  2MAW A;  2JQQ A;  4JI4 T;  4BAY B;  1IT8 A;  3P8C D;  3LK3 B;  1B2X A;  5IEN A;  3N5L A;  3GZX B;  3AGO A;  3P7I A;  2K3D A;  3CK6 A;  4WFO A;  4UEL A;  4TZ4 C;  3BND A;  2J8X B;  4KFE A;  2BG9 C;  5FY1 A;  4IE4 A;  3N2O A;  2QRX A;  1I0V A;  2UXB T;  1W00 A;  2K24 A;  4TNW A;  2H89 A;  2CXF A;  4AKZ A;  3P4P A;  2OLT A;  5AQJ B;  2ZL8 A;  1O7P B;  1T7S A;  4LF7 T;  3CCM 3;  1VQO 3;  2GXF A;  3WA3 A;  1GMQ A;  2X9X A;  2LOS A;  3VGN A;  2KLQ A;  4PFO A;  4I4K A;  4Q53 A;  2O9U X;  2WMO A;  1LVF A;  3O1H A;  3AE5 A;  3U78 A;  2J62 A;  2WM9 A;  1JN5 A;  3E0Z A;  2XFS A;  3MZK B;  3BIR A;  1BRJ A;  1JNQ A;  4AIS A;  2UU9 T;  4N6U A;  3Q9D A;  3AE8 A;  1NNV A;  3AGN A;  1YIT 3;  2VQF T;  3GMI A;  4CXY A;  1LVN A;  5GON E;  1VQL 3;  3MG2 A;  2ZMA A;  1G73 A;  2AXD S;  2XAS B;  4LFC T;  1UI7 A;  4ORL A;  5IHY A;  5HAX A;  5IWA T;  2A3D A;  3I56 3;  3CC2 3;  1XZY A;  5JDM A;  2IUB A;  1MND A;  1STF I;  1RGL A;  4O2A E;  2ZM2 A;  1UCL A;  2X0L B;  2WQY A;  3PCS A;  3CCQ 3;  2CX1 A;  1I94 T;  3BQI A;  4DV6 T;  2F98 A;  1Q82 4;  1AV4 A;  1JNZ A;  1B2Z A;  3KV5 A;  5LG4 A;  1MMA A;  1QAK A;  2CHN A;  2H3R A;  4RBN A;  1MWS A;  4O2B E;  2L9Q A;  4B3T T;  1NB3 I;  2FJE A;  2X9W A;  3C4Z A;  2IW5 B;  4I43 B;  3K7C A;  1B2U A;  4BTW A;  3HKC E;  5LB7 B;  4AI6 A;  3ANW B;  4AKR B;  5HEH A;  3I0Q A;  4OHF A;  4X5T A;  2YK0 A;  4DR5 T;  2CFG A;  5EVH A;  3S5C A;  1O7H B;  3HL6 A;  2XHE B;  1WQL B;  4WW0 A;  1R8I A;  2XQ6 A;  1X1W A;  5F3J A;  2WOH A;  2PJQ A;  2BKO A;  2BKP A;  5ABH A;  2L4V A;  3UFG A;  1AVK A;  1MNL A;  3UTK A;  3OYX A;  1Y01 A;  5LC7 A;  3CCR 3;  1YI2 3;  2KMF A;  1RNT A;  1WMN A;  1MWU A;  3JVC A;  1L0V A;  3ETU A;  4TNV A;  3ZMS B;  2N1G A;  2A2F X;  5L4E A;  3KII A;  3V92 A;  2LSK A;  1TIJ A;  2XQ9 A;  3FXE B;  2LM2 A;  4ZEY A;  1PFP A;  1VQK 3;  4ZHQ E;  3WR2 A;  1D1C A;  1I6Z A;  2CFK A;  1VQP 3;  1X1U A;  5KXJ A;  3U97 A;  2I9W A;  4A5X A;  3NQY A;  2Z6B A;  1UGI A;  1RSN A;  4X66 T;  4QX8 B;  3PUR A;  3ZC1 A;  1XNQ T;  1WFD A;  5IEP A;  2J4G A;  3CCL 3;  3NRX A;  1HTJ F;  1TP6 A;  1UW1 A;  4OFZ A;  3MYT A;  5KDM C;  4QXB B;  2D42 A;  3N9H A;  4LZI A;  3JAE A;  3CU3 A;  2CA5 A;  2BS3 A;  1TRP A;  2CHC A;  3RKO A;  3FZM B;  3AE2 A;  2LM9 A;  1W0A A;  1I2E A;  2LJL A;  3GZR A;  3G06 A;  1RRL A;  2P09 A;  4J5G A;  4N3V A;  1EUI C;  3RGA A;  2K3W A;  3EX9 A;  5LYJ E;  1RMS A;  5HCJ A;  3ZEF B;  5FL0 A;  4HBR A;  5DRE A;  1Z0P A;  5AQF B;  5FNV E;  3LXU X;  3ZMT B;  3T1H T;  3IHR A;  2CKF B;  3B7C A;  4K0U A;  5IG5 A;  2CE7 A;  2XAQ B;  1U8C B;  3CC4 3;  5AEW B;  1JB5 A;  1Z1S A;  3QC9 A;  3GAX A;  3CCV 3;  1BIR A;  2FJA A;  4IL9 A;  5DAB A;  2HHH T;  4HZB B;  1RN7 A;  3FZK B;  3EN1 B;  2VKJ A;  5HWX A;  1DMQ A;  2JMH A;  1E2A A;  3T8U A;  2BMQ B;  5LNK A;  5CLK A;  4H9Q C;  2VQE T;  1YIJ 3;  2PZV A;  1N34 T;  1SII A;  4EBG A;  5M19 A;  2XJ7 A;  1G02 A;  4KBM B;  3UUL A;  3S67 A;  4HWD A;  4GOU A;  5JDG A;  2XGN A;  5IG3 A;  4EOZ B;  2GEY A;  1DVC A;  3ZT7 A;  5STD A;  2NP9 A;  4HM5 B;  3CML A;  4GSP A;  1BNG A;  3ZCJ A;  4YT0 A;  1M7K A;  2OA5 A;  3BB9 A;  3RRW A;  5AQP B;  4AQG A;  1B21 A;  2E9X A;  2YU2 A;  5HEU A;  1BAO A;  2H0G A;  3LZA A;  3WI3 A;  3LOY A;  1U4Q A;  3P50 A;  1I0X A;  2QIY A;  4I55 E;  4PK6 A;  2KWH A;  2L8K A;  1E97 A;  1O7M B;  1WCR A;  4MMY B;  2FXT A;  2VKD A;  1RKY A;  3EI0 A;  1Q7Y 4;  2DNX A;  5J2T E;  3TLT A;  1IBM T;  5JR9 A;  3NM7 A;  3FBL A;  4MFR A;  5LMN T;  4AKY A;  4IE7 A;  2GBW B;  1BNR A;  2YIN A;  1E3V A;  1K41 A;  4QXC B;  4HM0 B;  1E3R A;  3IEE A;  4Z91 A;  1HNZ T;  1IAP A;  5JDH A;  4HYZ A;  1RGH A;  4GB5 A;  3FBZ A;  2W67 A;  3LK2 B;  4MLK A;  5L4H A;  4ZXL A;  2KF5 A;  1LNH A;  3KFW X;  3AA6 B;  3R6N A;  4U72 A;  4H9S E;  3CCE 3;  3Q2P A;  1KSI A;  2WMN A;  2OOV A;  2E2T A;  1SQW A;  1EG9 B;  1SUM B;  2WAU A;  4DMW A;  1BNJ A;  3K9M C;  4U7Y A;  3IPT A;  4PJJ A;  4BTX A;  3RC3 A;  5JPP A;  4DR1 T;  1HG5 A;  3CCS 3;  3RYI E;  2BMO B;  1BRI A;  3G8Z A;  2YDS A;  3GWH A;  2P38 A;  4JI1 T;  4O3V A;  3G4S 3;  1MNE A;  4LF6 T;  5J2U E;  2JMK A;  4O8S A;  3CWZ B;  5IG0 A;  3UQ7 A;  3RIA A;  5FKY A;  3CMA 3;  4LF8 T;  2XFT A;  2GBX B;  1T3B A;  1Y4K A;  5L3F B;  1HKX A;  2RA1 A;  1NAF A;  4F6R C;  4BJM A;  2LRL A;  1ULI B;  3F9S A;  3JUP A;  4P0B A;  3UU6 A;  1Q7H A;  5ABG A;  1W6Y A;  2YDQ A;  2Q07 A;  2JRK A;  2AAE A;  5L3B B;  3GA8 A;  5FYM A;  3FZL B;  1WYB A;  1W2B 2;  1YGE A;  3QB5 K;  4TX4 A;  1E1H B;  2CHO A;  4ZI2 D;  3NBX X;  4TX5 A;  4O4J E;  2SBL A;  1N8R 4;  2HMK B;  3DH2 A;  1WTH A;  3EVY A;  5JQG E;  4X1K E;  2XH9 A;  2QA7 A;  1GSP A;  4O02 B;  4JYA T;  1HFA A;  1YKH B;  4DV0 T;  5ADX L;  3HR0 A;  2G0U A;  4GHO A;  1JRQ A;  3SRZ A;  3PUA A;  5ETW A;  1JKG A;  3C4X A;  1W4N A;  4EAH A;  3DY5 A;  3ZFZ A;  5BR8 T;  3OKQ A;  1VQ7 3;  4MBQ A;  3I1A A;  1FUT A;  4XB5 A;  2LQV A;  2ES0 A;  2WY2 A;  2KND A;  2BBH A;  1G96 A;  3O4X E;  1UCU A;  3RIU C;  3UL5 A;  4CQI A;  2XEP A;  2V7L A;  3PU8 A;  3MKD A;  6GSP A;  5M4Y A;  3D4A A;  4CN6 A;  3CCU 3;  4QXH B;  2Q9Q A;  1UCJ A;  2MF7 A;  3V5U A;  3B4P A;  3AEE A;  1BRS A;  2ML6 A;  7RNT A;  1D1A A;  3EDU A;  1SHZ C;  2YFL B;  5AEU B;  1MIY A;  2CXL A;  2K5B B;  2V8S V;  3AEF A;  3BNB A;  3FG3 A;  3D79 A;  4ADZ A;  1QAF A;  2FGT A;  1W01 A;  4J9A A;  2IC9 A;  3PUQ A;  3T8N A;  4CPK A;  3K3N A;  3CKD A;  4ANJ A;  1ZOY A;  2CWV A;  3CX8 B;  1BOX A;  3EN8 A;  5JDL A;  3WOE B;  2VVN A;  2YOE A;  3AEC A;  1K9M 4;  1L5G B;  4KZ1 A;  1VQ4 3;  2LT3 A;  2E9X B;  4I0U A;  1WLX A;  3JC6 D;  3LJC A;  4IST A;  1UUW B;  5AQQ B;  3FF2 A;  4AKI A;  4YTM A;  1OHP A;  4LML A;  1OH0 A;  1I2G A;  1EZ3 A;  2NR4 A;  4EIW A;  4K1U A;  2YEV C;  4JUY A;  2P0X A;  4KX6 A;  4HFC A;  1W2Z A;  4DV2 T;  2BG9 E;  2INX A;  3D5G A;  2XGL A;  2LLY A;  1I8V A;  1PU4 A;  2NOX A;  2Y73 A;  2B1X B;  1BUJ A;  3PJA J;  4DVD A;  1BR0 A;  1EKM A;  1IVV A;  2X67 A;  5LGT B;  4ZS3 A;  4FMC A;  5IF6 A;  2BS2 A;  1JNR A;  1Q40 A;  2CH9 A;  2FNQ A;  1S5A A;  1NEK A;  2VK9 A;  2IC6 A;  3N2G E;  5FXX A;  1EA2 A;  3MK7 C;  4IHJ E;  1JJ2 2;  4TV9 E;  1OAC A;  2HPJ A;  3RC8 A;  3PE0 A;  4O4H E;  5CXO A;  4A56 A;  1T2I A;  2DHR A;  4YTP A;  4WNK A;  2W63 A;  1IQY A;  3MAC A;  2YN6 A;  3VHL A;  1OGZ A;  3QUJ A;  4K90 B;  3MPH A;  1KNP A;  1N36 T;  1HNX T;  2C10 A;  4YTN A;  4K61 A;  2K0M A;  3V98 A;  2YDR A;  3PJA A;  1OPY A;  2IML A;  5AQS B;  2XAJ B;  4JEU B;  2SAR A;  3T8O A;  2I59 A;  5HGR A;  2GSP A;  2E2A A;  3OW2 2;  2M7O A;  3D3L A;  3DXO A;  2IUK A;  2ODV A;  2CLY C;  1HCI A;  1DMM A;  3OWS A;  1XDO A;  2XQ8 A;  3ZKR A;  1JB2 A;  4CI1 B;  4EED A;  3RHW A;  4NRE A;  1HF8 A;  2BS4 A;  4V1A v;  4Z90 A;  3VR8 A;  2UUG C;  1U5O A;  3LT9 A;  5DQV A;  5CA1 E;  1BNI A;  1RHL A;  3PCR A;  1ROA A;  1FYS A;  4XBF B;  5JTG A;  3OX9 A;  3SWH A;  4E7S A;  4MMZ B;  4UXN B;  2D0U A;  3RH3 A;  4HFV A;  5LHI B;  3AXJ B;  5L47 A;  1YVB I;  4JI3 T;  2WZI A;  4EV5 A;  5HYA A;  4GYR A;  1FEW A;  3KSP A;  3JUM A;  1GOY A;  4LFA T;  2FUP A;  2K54 A;  4IIJ E;  2ML5 A;  3BU4 A;  3DP7 A;  1FGO A;  4EB6 E;  1VQN 3;  5AII A;  3NWI A;  5AFU L;  4L9I A;  2CLY B;  3CQX C;  2V6Y A;  4IGU A;  3ZN0 B;  5CA0 E;  4ILU A;  2HMJ B;  3ZYK A;  4DUZ T;  1N33 T;  5BXQ A;  3LG7 A;  4N78 D;  2IMJ A;  1RGA A;  3UNL A;  4EV2 A;  3PTR B;  1FZU A;  3O8Y A;  2XUE A;  1CEW I;  1A2K A;  3AEG A;  2JPF A;  4IT7 A;  3N9M A;  1T8B A;  3I0O A;  3M3Z B;  4AKL A;  5EK4 A;  3N8B A;  3AE6 A;  3D9R A;  3DMC A;  3QK6 A;  2J47 A;  2Z76 A;  2ACZ A;  1W5Z A;  4R1K A;  2KF3 A;  3FGY A;  2OV9 A;  1UX5 A;  2VWA A;  3UB1 A;  1X79 A;  3ZMZ B;  1HX8 A;  5LGN B;  2JJ9 A;  3RQW A;  1NDO B;  3AHS A;  3VRB A;  1BNS A;  1BRN L;  3T1Y T;  3W15 B;  2RBI A;  2HML B;  4IDQ A;  4P0A A;  2BG9 A;  1VCT A;  3HX8 A;  1LOX A;  4KUM B;  5AQK B;  2W0Q A;  3H51 A;  5AQI B;  4AIU A;  4HM8 B;  3K1S A;  3RQU A;  1KNZ A;  1IQX A;  3EE1 A;  3F40 A;  2W9P A;  4WBN E;  2D5U A;  4IRE A;  2I0M A;  3DGM A;  4KHP T;  2W66 A;  2CFL A;  1Y64 B;  1IT7 A;  3NZP A;  1VRB A;  2XQA A;  3OPC A;  2V7I A;  1YD8 G;  4HKA A;  4J8T A;  1SPU A;  3NV0 B;  3GZY B;  4HWH A;  3EAB A;  1NWW A;  3SLU A;  3LBX A;  1LOY A;  3FKA A;  3WDG B;  4BL2 A;  1D0Y A;  1W09 A;  3JCF A;  3ZC0 A;  1BRK A;  1QLB A;  5AQU B;  3CPO A;  2IUJ A;  1V57 A;  1RN1 A;  4GK5 E;  5ELU A;  2RSX A;  2LRK A;  4PJN A;  2X0Y A;  5I97 A;  2M6B A;  1LRA A;  4EGW A;  2V6X A;  5F5W A;  3AMO A;  3BQL A;  4CXW A;  4BL3 A;  4DR7 T;  1OED E;  3E08 A;  4CI2 B;  5L3C B;  4EYY R;  1W6G A;  1VQ9 3;  4JV5 T;  4DO0 A;  3AA7 B;  3ER7 A;  1D1B A;  3URP A;  3R84 B;  2E2U A;  5TGN A;  4EC6 A;  2W9Q A;  2KXG A;  3S28 A;  4C90 A;  2CC3 A;  1YJ9 3;  5CGM A;  1GY5 A;  3ESL A;  3QB5 A;  8RNT A;  4JEH B;  2KWI B;  3IJE B;  2YFI B;  3PGB A;  2Q9Q B;  2E5L T;  4I5Q A;  2BU4 A;  3WAK A;  2UUB T;  2MC8 A;  5AQG B;  1YHQ 3;  3MXZ A;  4HM4 B;  2XSH B;  2W00 A;  4HWI B;  5EQL A;  3AED A;  3GWR A;  1B7T A;  2C5I T;  3EB8 A;  4WYK A;  4QH5 A;  1VQ8 3;  2LE8 A;  3AE7 A;  1BR4 A;  1BSC A;  1NEN A;  3RRC A;  1NO3 A;  3DTO A;  3X40 A;  8CHO A;  3IA3 A;  5JDQ A;  4O4L E;  1AQZ A;  5D82 A;  4O4I E;  5HXS A;  3KN4 A;  3CQG B;  3NM2 A;  2W62 A;  5KX5 E;  3TLU A;  2IIU A;  3KBT A;  3TDG A;  3PUS A;  4I4T E;  3NBJ A;  1LRZ A;  1YVS A;  4KT3 B;  3QOF A;  2WOF A;  3DGL A;  3IMA B;  5IUX A;  2QYW A;  4CDL A;  1FUW A;  4NHF A;  3X1D A;  1CYU A;  2PTF A;  3X3X A;  4EXR A;  1CHU A;  1N5H A;  1J2B A;  3OWU A;  4YJ2 E;  2Q9Q C;  4NIQ A;  1BRH A;  1E7P A;  5L3E B;  3SYU A;  4FCJ A;  1ROV A;  2HMO B;  1FA3 A;  3ZST A;  3FSD A;  4HFB A;  1B2M A;  1QVG 2;  3EF8 A;  3JC6 C;  5JVD E;  5JRC A;  1W02 A;  1PY3 A;  2KIN B;  2YU1 A;  3U3I A;  3FG4 A;  4H63 H;  1N5P A;  3DGY A;  3ANW A;  1TTO A;  3X41 A;  2Q9Q D;  2BZB A;  1YNV X;  3H3M A;  1A2P A;  4PAG A;  1QJG A;  3J7Y d;  4HWF A;  3SX1 A;  4CJN A;  3EC9 A;  3K3O A;  4KI0 F;  3EHC A;  4YSX A;  4JBW F;  4HFH A;  4HN9 A;  1W7C A;  1M9G A;  4BU4 A;  2WGQ A;  2R6G F;  4JI7 T;  1OXZ A;  5LBQ B;  1Q86 4;  1UUS A;  3ZCI A;  4ZS2 A;  3SOL A;  1YQ4 A;  1AJ3 A;  1T2H A;  3VU7 H;  1VCS A;  3FH1 A;  1X9B A;  2LHR A;  4K1V A;  3PUG A;  1O7W B;  3N54 B;  3FB2 A;  4X2H A;  3V99 A;  4NXN T;  4PK5 A;  1BVI A;  3SED A;  1DVD A;  3S29 A;  3PUX F;  3ZT5 A;  4N6N B;  4WBO A;  4B3S T;  1UCK A;  2A72 A;  3IF8 B;  3A5X A;  2A15 A;  5LG3 A;  2OTL 3;  4RZM A;  2JQ5 A;  5F8P A;  4QH4 A;  1KF6 A;  4U33 A;  3FG1 A;  3ZYL A;  3EDV A;  5HWY A;  3WOD G;  4U7I A;  1LOV A;  1WMO A;  5HXH A;  4WYV A;  3Q5E A;  1ZEE A;  3KVB A;  2ZM6 T;  1LQM B;  5LP6 E;  1I70 A;  7STD A;  5G1L A;  1JKG B;  3CX6 B;  2HN2 A;  3NBR A;  3A76 A;  4HM3 B;  3ZG0 A;  1NWM X;  5FMN A;  3F7S A;  3KSE D;  1OED B;  3U1W A;  2LOP A;  1A2V A;  1LKX A;  4WP5 A;  3MSO A;  2DLR A;  1US7 B;  3AB3 B;  4HEA A;  4QKN A;  1OHS A;  3PUW F;  4I50 E;  4ZZB A;  3WHO A;  5HEJ A;  3A8Y C;  3Q2M A;  5CB4 E;  2M6I A;  1D6U A;  2BHM A;  4Z8X A;  2ZHX B;  1D0X A;  1TJD A;  4O2H A;  1LNI A;  2ZM0 A;  2X9H A;  3DGO A;  5AQL B;  2BO9 B;  1KD1 4;  4EXT A;  5E0O A;  4ZZC A;  3EUH A;  2HN1 A;  3PDY A;  3ALA A;  2XF3 A;  1A67 A;  1BNE A;  4KP3 C;  2DWK A;  2E9X D;  2V1D B;  5D81 A;  1M1K 4;  5J0Z A;  2WB5 A;  4PNI A;  3JUO A;  1FGM A;  2BVL A;  1BNF A;  2P0M A;  3CNM A;  2CG1 A;  3JAD A;  1FGR A;  5FVK A;  2F5M A;  5LJN A;  4MEI A;  3EHZ A;  5AIG A;  3AAE B;  3I0Y A;  1LVK A;  2MOZ A;  4HOH A;  4MMX B;  5DQW A;  2UXC T;  1SIH A;  2F5W A;  3EJV A;  1MMD A;  1S35 A;  1A90 A;  4PFP A;  2WCA A;  5C8Y E;  1HNW T;  4UVC B;  3Q1C A;  2CWY A;  3KFQ C;  3B57 A;  1MGR A;  2FBW A;  2W2U A;  3I9Y A;  1X1X A;  4DR4 T;  4JF8 A;  4EZ4 A;  4IDP A;  3ZMV B;  4LFB T;  4XZC A;  3BLZ A;  3X42 A;  1B27 A;  2P05 A;  1BGS A;  2XSB A;  1SA0 E;  3SOY A;  2CCQ A;  3ETV A;  3E22 E;  2H7O A;  3JAF A;  3F57 A;  4C91 A;  3LSV A;  3AVS A;  3TLS A;  4H61 A;  1BR1 A;  2W4X A;  4G1M B;  4ZM8 A;  3Q5X A;  4EV6 A;  3KIN B;  2GU1 A;  1IDP A;  2CIU A;  1RGC A;  2QVA A;  3VR9 A;  3C64 A;  3OVU A;  2XZE A;  2F99 A;  4E7Z A;  5FY0 A;  3NX0 A;  3HKB E;  1DE3 A;  3S4U A;  4XAX B;  2C5J A;  3UQ4 A;  1XMQ T;  3UUB A;  2MBG A;  2YFJ B;  5FGO A;  1UGO A;  2RNT A;  3LH4 A;  3B5M A;  4MHC A;  3LDQ B;  4PK4 A;  4XBY A;  2JDI H;  3HKE E;  3AMO B;  5EEO A;  1JBR A;  3RYH E;  3RYF E;  2V7K A;  3K5T A;  2XR8 B;  3ZJ2 A;  3L39 A;  3UL6 A;  2ZDJ A;  2K9A A;  3WOF B;  4F8H A;  2CX0 A;  5FXV A;  2CK3 H;  4OK0 A;  2L1S A;  2E9X C;  1MMN A;  4DBQ A;  2AAD A;  2YX9 A;  4X65 T;  2WSS V;  1W0B A;  3LTA A;  2NWB A;  2XQY A;  4IDO A;  2XM1 A;  2NTY A;  3Q3F A;  3RIF A;  4MJD A;  1EEJ A;  3ZG5 A;  3B13 A;  5HEO A;  1Q9E A;  3LYG A;  2R41 A;  3LK4 2;  3F8H A;  2CPT A;  4IDN A;  2KZ7 B;  1UX4 A;  5AQM B;  3F31 A;  4G63 A;  1T5Y A;  2BVM A;  4DR3 T;  4GKK T;  3PS8 A;  5EK3 A;  1RRH A;  4QH1 A;  4XBX A;  4KMC A;  2WZH A;  1OGX A;  1OED C;  4FJO A;  3LFM A;  3Q5W A;  2Z6E A;  2A9U A;  4IE0 A;  4CZZ B;  1FMV A;  2OWP A;  4DV4 T;  5CF1 A;  5L3D B;  3VSY A;  2CMR A;  3AE4 A;  3CQC B;  2R4I A;  2XAF B;  1LOW A;  4CCV A;  2WWV A;  1QAL A;  1HU9 A;  4FMB A;  1OHO A;  1JBT A;  4COF A;  1K73 4;  1RCK A;  4TUY E;  2W6J H;  2VUR A;  1OED A; 
#chains in the Genus database with same CATH homology
 4JRF A;  3AVR A;  1WNH A;  1LXE A;  3L09 A;  3AAI A;  2KXP B;  5AYS C;  2IAK A;  5CK6 A;  4EYC A;  2SPC A;  2UXN B;  2Y74 A;  5FP3 A;  4R9K A;  4WHA A;  2PG8 A;  2PBI A;  2Z77 A;  1IVW A;  2V7M A;  3AA1 B;  3MWZ A;  1QSD A;  3B4O A;  4GL6 A;  2XRX B;  2W03 A;  3BK9 A;  4XM4 A;  3K8P C;  2BNG A;  3CD6 3;  3CVR A;  1NB5 I;  1ZV4 X;  4GIW A;  4WYK B;  3C98 B;  2CM0 A;  5TAO A;  3AAA B;  2CWT A;  3HK4 A;  4X20 E;  1KQS 2;  1R4C A;  4HTE A;  3J9X 1;  4U74 A;  1ZKE A;  4PJM A;  3MJX A;  1ULJ B;  4TN7 B;  4GK0 E;  5LHG B;  4ERR A;  3K0Z A;  4U13 A;  1C7H A;  3ZMU B;  2Y6X A;  3N2K E;  4ASK A;  3RGR A;  4DMV A;  4UVB B;  5JR9 C;  2C0S A;  2LSJ A;  5EK2 A;  2GK9 A;  1JB4 A;  3FCS B;  4ZI2 C;  4P09 A;  4L8P A;  2DWG A;  2NW8 A;  3CCJ 3;  3MG1 A;  4FCZ A;  2CW9 A;  3FHN A;  3QK9 A;  4LSO A;  1VQM 3;  3FF0 A;  1WYC A;  3G0K A;  2OOV C;  4QWT A;  4H63 V;  1GYB A;  2WWU A;  3HI2 A;  4KVH A;  1RJO A;  3I9W A;  3QRD A;  3CNX A;  4HVN A;  2LSY A;  5LHH B;  1MMG A;  2HMM B;  4JLE A;  5JRE A;  1OWA A;  3KVA A;  4ISS A;  3EBT A;  3H3A A;  3OXA A;  3CX7 B;  4AKG A;  4PJL A;  1BR2 A;  3JUQ A;  5JPU A;  1U5P A;  2KT9 A;  1YJN 3;  2Z7A A;  3B8L A;  2WBL A;  1T98 A;  3TKL B;  2CXD A;  3G71 3;  1SJW A;  2P9B A;  3OWY A;  3AA0 B;  3OBV E;  1NJI 4;  3O9X A;  3C51 A;  3G16 A;  4PEJ A;  5AYR B;  1TUH A;  2BT3 A;  1ZX2 A;  4L8O A;  3CXC 2;  4LMI A;  2OTJ 3;  4XDV A;  5HXR A;  1STD A;  4RNY A;  3SOA A;  5G2G A;  5J1G A;  4ZOL E;  1MIV A;  2QGU A;  1FGQ A;  4KFF A;  5KP3 A;  3CME 3;  4YHJ A;  3UFE A;  4R80 A;  4AQF A;  1Q42 A;  1M90 4;  3FZW A;  3L0R A;  1UI8 A;  1D0Z A;  1ASK A;  2RFR A;  4X1Y E;  2KCD A;  4IPB A;  3HKD E;  4N6T A;  1CYV A;  2OQE A;  1IV7 A;  4LGQ A;  2HH7 A;  2XAH B;  3ONX A;  2CFD A;  3V5S A;  3F14 A;  1IZN B;  5D83 A;  1O3X A;  4HKV B;  3KDS E;  3GZB A;  5LOV E;  4G2A A;  3PYJ A;  1IQ8 A;  3FXD B;  2X51 A;  4IIA A;  4KFD A;  3VF1 A;  4YLH A;  4H3U A;  5HXC A;  3G6E 3;  1S72 3;  3LTB A;  2MTQ A;  1ZHC A;  2OQE C;  3X3Z A;  4H9O C;  3NBB A;  2RP4 A;  4MAL A;  1GY6 A;  1OUN A;  5H6Q B;  5LC6 A;  2M67 A;  1KWI A;  2VKH A;  1FMW A;  3T0U A;  5KP4 A;  1GD4 A;  1N8Q A;  3F7X A;  3NZQ A;  2CWU A;  3Q90 A;  2XSO B;  5AIF A;  3GRD A;  5LA6 E;  2E8I A;  1V74 A;  2PNC A;  2E2V A;  3DGN A;  5LJM A;  3GN5 B;  3N9Q A;  2IA7 A;  2EHO C;  4IE6 A;  4BJN A;  5FXZ A;  5CF2 A;  5JBS A;  4HE8 A;  2CG0 A;  4DBR A;  2QA4 3;  5A0O B;  5BVB A;  4L5G A;  1O7G B;  3WAJ A;  3LTD A;  3SS1 A;  4PW8 A;  4YJ3 E;  4DND A;  4EZH A;  3J7Y q;  4HM7 B;  3KZT A;  3MHE A;  3LT8 A;  1VQ6 3;  4AKH A;  4UV9 B;  1ZO2 A;  3RPU A;  2XTL A;  4XBT A;  1K8A 4;  4N6O B;  3KV4 A;  3UUM A;  3OV4 A;  3KE7 A;  3GN5 A;  1D6Z A;  5JR9 B;  3NUV A;  3KV6 A;  1IVU A;  1OCV A;  4FMD A;  1HS7 A;  4RNZ A;  3L3P A;  5AI1 A;  2UX0 A;  4H9N C;  2D2S A;  3PXM A;  1MOL A;  4XDW A;  5IER A;  3NRY A;  3ZPO A;  2DI4 A;  3OJA A;  3WMD A;  5EZY E;  3RYC E;  5IW9 A;  2NW9 A;  3CPZ A;  3ZYM A;  1TFO A;  2O3O A;  2LHN A;  2K48 A;  1HG2 A;  2N9D A;  2STD A;  4FCM A;  1IK3 A;  4N6M A;  4HGA A;  2D0T A;  4CXX A;  2EHO D;  3IBP A;  1S94 A;  2GU3 A;  2KRT A;  2LYX A;  4AEQ A;  5DRV A;  3D0T A;  2Y48 B;  3ROB A;  1YJW 3;  1V9D A;  3I55 3;  2RGQ A;  2ODU A;  1UUV B;  3SVA A;  4OUQ A;  3C50 A;  1KC8 4;  3N9O A;  2ACX A;  5H6R B;  3UT5 E;  2CEA A;  3ZLI A;  2W56 B;  5FY7 A;  4QX7 B;  4FMA A;  4NUV A;  3KBU A;  3KKG A;  2DCF A;  2J1D G;  4QHO A;  2HMN B;  4QWN B;  3BQK A;  1WRD A;  1G8X A;  3VKH A;  1Q81 4;  4EYU A;  1K28 A;  3DUK A;  1D6Y A;  1GS3 A;  1VOM A;  1OF5 B;  3LML A;  4UEM A;  3N9L A;  6STD A;  4L0R A;  2PFV A;  3BNE A;  4UF0 B;  5JDF A;  4H9P C;  2W0G A;  3WA2 X;  3CC7 3;  3N9P A;  2NTX A;  2H7V C;  5JDN A;  1AR0 A;  1FIO A;  2EHO B;  2LSI A;  1W6C A;  3SXX A;  2W56 A;  4B6X A;  3FLJ A;  3X3Y A;  2X9Y A;  1US1 A;  2X66 A;  5HXE A;  2ZM8 A;  4HM1 B;  3F2E A;  2OCT A;  2W61 A;  1YW0 A;  2EHO A;  3BNC A;  4L7K A;  4OYK A;  1IVX A;  3EBY A;  1BUQ A;  2Y8D A;  1IJ6 A;  3NQZ A;  2BMR B;  3CPW 2;  5IEO A;  3O1J A;  3N9N A;  1Q40 B;  4UIG A;  4ZI3 D;  4WWU C;  1VQ5 3;  4HZ9 B;  3JUN A;  3RDE A;  4BA9 A;  1IU7 A;  1QUU A;  3H3H A;  3NHX A;  2LEH A;  5AIH A;  5IG4 A;  4CI3 B;  4N6L A;  1QMA A;  2MYS A;  3UJM A;  5L2L A;  4X1I E;  3E99 A;  2V26 A;  3RX6 A;  3H37 A;  4HJL B;  1NU3 A;  1N9J A;  4IDZ A;  2N2N A;  5LGU B;  2D1W A;  5JH7 E;  3EQQ B;  5LCY A;  1ISK A;  1WMP A;  1CUN A;  2CFW A;  3STD A;  3ZJ1 A;  1TFK A;  4FR9 A;  4UV8 B;  3O1I A;  4NUU A;  3MA9 A;  1MIW A;  3HA4 A;  4AQF C;  1GY7 A;  3LTC A;  2CWO A;  2X68 A;  3C4W A;  3ECF A;  1JN5 B;  4LEH A;  4IE5 A;  3DM8 A;  3HZP A;  1N9E A;  2ZLY A;  3NXJ A;  3M8C A;  3HIG A;  2WO0 A;  3KV9 A;  3VKG A;  2XAG B;  5KP1 A;  2QGS A;  4STD A;  2BDE A;  1O7N B;  4FI5 A;  1AVL A;  4YFS A;  2B24 B;  4N6V 0;  3PZW A;  2W04 A;  4HM2 B;  1IJ5 A;  4UF0 A;  2L3L A;  4TV8 E;  5FXW A;  3K63 A;  1QVF 2;  5BMV E;  2W2C A;  5IYZ E;  4ZI7 E;  1OF5 A;  3OYZ A;  4OYJ A;  1JV2 B;  3DZL A;  2C11 A;  1KK7 A;  5A1L A;  3MKI A;  3K3Q C;  3M65 A;  4BTY A;  5JRC B;  5ELJ A;  3UUX B;  2LSG A;  2VB6 A;  4R4K A;  3HII A;  3ZN1 B;  1DMN A;  3LBX B;  1F8N A;  2F86 B;  5LBM A;  2RCD A;  4R9L A;  1DYU A;  1M1X B;  2UXX B;  5L3G B;  3DJB A;  3HI7 A;  2V7J A;  1VZZ A;  1IV9 A;  2B1E A;  4M1P A;  3UUN A;  5LXT E;  3F8X A;  2HPL A;  3NV0 A;  1EQK A;  1YKE B;  4ZI3 C;  2QEX 3;  2NW7 A;  2GEX A;  4AXP A;  4X2O A;  1H7C A;  2C5K T;  2VKO A;  3PU3 A;  4H9R C;  1FGT A;  2WGO A;  1WR6 A;  4J2C A;  4OVM A;  2V1L A;  1TU5 A;  5DJQ C;  3S27 A;  4GYS A;  2VL8 A;  5FW5 A;  1CQS A;  1GD3 A;  3MG3 A;  4UVA B;  4HM6 B;  2VAS A;  5KMG P;  2JQQ A;  4BAY B;  1IT8 A;  3P8C D;  3LK3 B;  5IEN A;  3N5L A;  3GZX B;  3P7I A;  4WFO A;  4UEL A;  4TZ4 C;  3BND A;  4KFE A;  5FY1 A;  4IE4 A;  3N2O A;  1W00 A;  2K24 A;  4AKZ A;  2CXF A;  2ZL8 A;  1O7P B;  3CCM 3;  1VQO 3;  2GXF A;  3WA3 A;  2X9X A;  2LOS A;  3VGN A;  2KLQ A;  4PFO A;  4I4K A;  4Q53 A;  2O9U X;  2WMO A;  1LVF A;  3O1H A;  3U78 A;  2WM9 A;  1JN5 A;  3E0Z A;  2XFS A;  3MZK B;  1JNQ A;  4N6U A;  3Q9D A;  1YIT 3;  3GMI A;  4CXY A;  1LVN A;  5GON E;  1VQL 3;  3MG2 A;  2ZMA A;  1G73 A;  2XAS B;  1UI7 A;  4ORL A;  5IHY A;  5HAX A;  2A3D A;  3I56 3;  3CC2 3;  5JDM A;  1MND A;  1STF I;  4O2A E;  2ZM2 A;  2X0L B;  3PCS A;  3CCQ 3;  3BQI A;  2F98 A;  1Q82 4;  1AV4 A;  3KV5 A;  5LG4 A;  1MMA A;  1QAK A;  2H3R A;  4RBN A;  4O2B E;  2L9Q A;  1NB3 I;  2X9W A;  3C4Z A;  2IW5 B;  4I43 B;  3K7C A;  4BTW A;  3HKC E;  4AI6 A;  3ANW B;  4AKR B;  3I0Q A;  4OHF A;  2YK0 A;  2CFG A;  5EVH A;  3S5C A;  1O7H B;  3HL6 A;  2XHE B;  1WQL B;  4WW0 A;  5F3J A;  2WOH A;  2PJQ A;  2L4V A;  1AVK A;  1MNL A;  3UTK A;  3OYX A;  5LC7 A;  3CCR 3;  1YI2 3;  2KMF A;  1WMN A;  3JVC A;  3ETU A;  3ZMS B;  2N1G A;  2A2F X;  3KII A;  3V92 A;  2LSK A;  1TIJ A;  3FXE B;  1PFP A;  1VQK 3;  4ZHQ E;  1D1C A;  2CFK A;  1VQP 3;  3U97 A;  2I9W A;  3NQY A;  2Z6B A;  4QX8 B;  3PUR A;  3ZC1 A;  5IEP A;  3CCL 3;  3NRX A;  1HTJ F;  1TP6 A;  1UW1 A;  4OFZ A;  3MYT A;  5KDM C;  4QXB B;  2D42 A;  3N9H A;  4LZI A;  3CU3 A;  2CA5 A;  2CHC A;  3RKO A;  2LM9 A;  2LJL A;  3GZR A;  1RRL A;  2P09 A;  4N3V A;  3RGA A;  3EX9 A;  5LYJ E;  3ZEF B;  4HBR A;  5DRE A;  1Z0P A;  5FNV E;  3LXU X;  3ZMT B;  3IHR A;  2CKF B;  3B7C A;  4K0U A;  5IG5 A;  2CE7 A;  2XAQ B;  1U8C B;  3CC4 3;  5AEW B;  1JB5 A;  1Z1S A;  3QC9 A;  3GAX A;  3CCV 3;  5DAB A;  4HZB B;  1RN7 A;  3EN1 B;  2VKJ A;  5HWX A;  1DMQ A;  2JMH A;  3T8U A;  2BMQ B;  5LNK A;  5CLK A;  4H9Q C;  1YIJ 3;  2PZV A;  1SII A;  4EBG A;  4KBM B;  3UUL A;  3S67 A;  4GOU A;  5JDG A;  2XGN A;  5IG3 A;  4EOZ B;  2GEY A;  1DVC A;  5STD A;  2NP9 A;  4HM5 B;  3CML A;  3ZCJ A;  2OA5 A;  3BB9 A;  3RRW A;  4AQG A;  2E9X A;  2YU2 A;  3LZA A;  3WI3 A;  3LOY A;  1U4Q A;  2QIY A;  4I55 E;  4PK6 A;  2KWH A;  2L8K A;  1E97 A;  1O7M B;  4MMY B;  2FXT A;  2VKD A;  1RKY A;  1Q7Y 4;  2DNX A;  5J2T E;  5JR9 A;  3NM7 A;  3FBL A;  4MFR A;  4AKY A;  4IE7 A;  2GBW B;  2YIN A;  1E3V A;  1K41 A;  4QXC B;  4HM0 B;  1E3R A;  3IEE A;  1IAP A;  5JDH A;  4HYZ A;  4GB5 A;  3FBZ A;  3LK2 B;  4MLK A;  1LNH A;  3KFW X;  3AA6 B;  3R6N A;  4U72 A;  4H9S E;  3CCE 3;  3Q2P A;  1KSI A;  2WMN A;  2OOV A;  2E2T A;  1SQW A;  1EG9 B;  2WAU A;  4DMW A;  3K9M C;  3IPT A;  4PJJ A;  4BTX A;  3RC3 A;  5JPP A;  1HG5 A;  3CCS 3;  3RYI E;  2BMO B;  3G8Z A;  3GWH A;  2P38 A;  4O3V A;  3G4S 3;  1MNE A;  5J2U E;  2JMK A;  4O8S A;  3CWZ B;  5IG0 A;  3CMA 3;  2XFT A;  2GBX B;  1Y4K A;  5L3F B;  1HKX A;  2RA1 A;  1NAF A;  4F6R C;  4BJM A;  1ULI B;  3F9S A;  3JUP A;  4P0B A;  1W6Y A;  2Q07 A;  2JRK A;  5L3B B;  3GA8 A;  5FYM A;  1WYB A;  1W2B 2;  1YGE A;  4TX4 A;  1E1H B;  4ZI2 D;  3NBX X;  4TX5 A;  4O4J E;  2SBL A;  1N8R 4;  2HMK B;  1WTH A;  3EVY A;  5JQG E;  4X1K E;  2XH9 A;  2QA7 A;  4O02 B;  1HFA A;  1YKH B;  5ADX L;  3HR0 A;  2G0U A;  1JRQ A;  3SRZ A;  3PUA A;  5ETW A;  1JKG A;  3C4X A;  1W4N A;  4EAH A;  3DY5 A;  3OKQ A;  1VQ7 3;  4MBQ A;  3I1A A;  4XB5 A;  2LQV A;  2ES0 A;  2KND A;  1G96 A;  3O4X E;  1UCU A;  3UL5 A;  4CQI A;  2XEP A;  2V7L A;  3PU8 A;  3MKD A;  5M4Y A;  3CCU 3;  4QXH B;  2Q9Q A;  2MF7 A;  3V5U A;  3B4P A;  2ML6 A;  1D1A A;  3EDU A;  1SHZ C;  2YFL B;  5AEU B;  1MIY A;  2CXL A;  2K5B B;  3BNB A;  3FG3 A;  4ADZ A;  1QAF A;  2FGT A;  1W01 A;  4J9A A;  2IC9 A;  3PUQ A;  3T8N A;  3K3N A;  3CKD A;  4ANJ A;  2CWV A;  3CX8 B;  3EN8 A;  5JDL A;  3WOE B;  1K9M 4;  1L5G B;  4KZ1 A;  1VQ4 3;  2LT3 A;  2E9X B;  1WLX A;  3JC6 D;  3LJC A;  4IST A;  1UUW B;  3FF2 A;  4AKI A;  1OHP A;  1OH0 A;  1EZ3 A;  4EIW A;  4K1U A;  2YEV C;  4JUY A;  2P0X A;  1W2Z A;  2INX A;  2XGL A;  1PU4 A;  2NOX A;  2Y73 A;  2B1X B;  1BR0 A;  4DVD A;  1EKM A;  1IVV A;  2X67 A;  5LGT B;  4ZS3 A;  4FMC A;  5IF6 A;  1Q40 A;  2CH9 A;  2FNQ A;  1S5A A;  2VK9 A;  2IC6 A;  3N2G E;  5FXX A;  1EA2 A;  3MK7 C;  4IHJ E;  1JJ2 2;  4TV9 E;  1OAC A;  2HPJ A;  3RC8 A;  3PE0 A;  4O4H E;  5CXO A;  4A56 A;  2DHR A;  4WNK A;  2W63 A;  1IQY A;  3MAC A;  3VHL A;  1OGZ A;  3QUJ A;  4K90 B;  3MPH A;  2C10 A;  4K61 A;  3V98 A;  2K0M A;  1OPY A;  2XAJ B;  4JEU B;  3T8O A;  2I59 A;  5HGR A;  3OW2 2;  2M7O A;  3D3L A;  3DXO A;  2IUK A;  2ODV A;  2CLY C;  1HCI A;  1DMM A;  3OWS A;  1JB2 A;  4CI1 B;  4NRE A;  1HF8 A;  4V1A v;  1U5O A;  3LT9 A;  5DQV A;  5CA1 E;  3PCR A;  1ROA A;  4XBF B;  3OX9 A;  3SWH A;  4E7S A;  4MMZ B;  4UXN B;  2D0U A;  3RH3 A;  4HFV A;  5LHI B;  1YVB I;  4EV5 A;  5HYA A;  4GYR A;  1FEW A;  3KSP A;  3JUM A;  2K54 A;  4IIJ E;  2ML5 A;  3DP7 A;  1FGO A;  4EB6 E;  1VQN 3;  5AII A;  5AFU L;  4L9I A;  2CLY B;  3CQX C;  4IGU A;  3ZN0 B;  5CA0 E;  4ILU A;  2HMJ B;  3ZYK A;  5BXQ A;  3LG7 A;  4N78 D;  2IMJ A;  3UNL A;  4EV2 A;  3PTR B;  3O8Y A;  2XUE A;  1CEW I;  1A2K A;  2JPF A;  4IT7 A;  3N9M A;  3I0O A;  4AKL A;  5EK4 A;  3N8B A;  3D9R A;  3DMC A;  3QK6 A;  2Z76 A;  1W5Z A;  4R1K A;  3FGY A;  1UX5 A;  2VWA A;  3UB1 A;  3ZMZ B;  1HX8 A;  5LGN B;  2JJ9 A;  1NDO B;  3W15 B;  2HML B;  4P0A A;  3HX8 A;  1LOX A;  4KUM B;  2W0Q A;  3H51 A;  4HM8 B;  1KNZ A;  1IQX A;  3EE1 A;  3F40 A;  2W9P A;  4WBN E;  2D5U A;  3DGM A;  2CFL A;  1Y64 B;  1IT7 A;  3NZP A;  1VRB A;  2V7I A;  1YD8 G;  4HKA A;  4J8T A;  1SPU A;  3NV0 B;  3GZY B;  1NWW A;  3SLU A;  3LBX A;  3FKA A;  3WDG B;  1D0Y A;  3ZC0 A;  3CPO A;  2IUJ A;  4GK5 E;  5ELU A;  2RSX A;  4PJN A;  5I97 A;  3AMO A;  3BQL A;  4CXW A;  3E08 A;  4CI2 B;  5L3C B;  4EYY R;  1W6G A;  1VQ9 3;  4DO0 A;  3AA7 B;  3ER7 A;  1D1B A;  3R84 B;  2E2U A;  5TGN A;  4EC6 A;  2W9Q A;  2KXG A;  3S28 A;  4C90 A;  2CC3 A;  1YJ9 3;  1GY5 A;  3ESL A;  4JEH B;  2KWI B;  3IJE B;  2YFI B;  3PGB A;  2Q9Q B;  3WAK A;  2MC8 A;  1YHQ 3;  3MXZ A;  4HM4 B;  2XSH B;  2W00 A;  5EQL A;  3GWR A;  1B7T A;  2C5I T;  3EB8 A;  4WYK A;  1VQ8 3;  2LE8 A;  1BR4 A;  3RRC A;  1NO3 A;  3DTO A;  3X40 A;  8CHO A;  5JDQ A;  4O4L E;  5D82 A;  4O4I E;  5HXS A;  3KN4 A;  3CQG B;  3NM2 A;  2W62 A;  5KX5 E;  3KBT A;  3TDG A;  3PUS A;  4I4T E;  3NBJ A;  1LRZ A;  2WOF A;  3DGL A;  3IMA B;  4CDL A;  1FUW A;  4NHF A;  1CYU A;  3X3X A;  4EXR A;  1N5H A;  1J2B A;  3OWU A;  4YJ2 E;  2Q9Q C;  5L3E B;  4FCJ A;  1ROV A;  2HMO B;  1FA3 A;  3FSD A;  1QVG 2;  3EF8 A;  3JC6 C;  5JVD E;  5JRC A;  1W02 A;  2KIN B;  2YU1 A;  3U3I A;  3FG4 A;  4H63 H;  1N5P A;  3ANW A;  3X41 A;  2Q9Q D;  2BZB A;  4PAG A;  1QJG A;  3J7Y d;  3SX1 A;  3EC9 A;  3K3O A;  3EHC A;  4HN9 A;  1W7C A;  1M9G A;  2WGQ A;  1OXZ A;  5LBQ B;  1Q86 4;  3ZCI A;  4ZS2 A;  3SOL A;  1AJ3 A;  3VU7 H;  3FH1 A;  2LHR A;  4K1V A;  3PUG A;  1O7W B;  3N54 B;  3FB2 A;  4X2H A;  3V99 A;  4PK5 A;  3SED A;  1DVD A;  3S29 A;  4N6N B;  4WBO A;  2A72 A;  3IF8 B;  3A5X A;  2A15 A;  2OTL 3;  4RZM A;  2JQ5 A;  5F8P A;  3FG1 A;  3ZYL A;  3EDV A;  5HWY A;  3WOD G;  1WMO A;  5HXH A;  1ZEE A;  3KVB A;  5LP6 E;  7STD A;  1JKG B;  3CX6 B;  3NBR A;  3A76 A;  4HM3 B;  1NWM X;  5FMN A;  3F7S A;  3KSE D;  3U1W A;  2LOP A;  1A2V A;  1LKX A;  4WP5 A;  3MSO A;  2DLR A;  1US7 B;  3AB3 B;  4HEA A;  4QKN A;  1OHS A;  4I50 E;  5CB4 E;  3Q2M A;  2BHM A;  1D6U A;  4Z8X A;  1D0X A;  4O2H A;  2ZM0 A;  2X9H A;  3DGO A;  2BO9 B;  1KD1 4;  4EXT A;  5E0O A;  3EUH A;  3PDY A;  3ALA A;  2XF3 A;  1A67 A;  4KP3 C;  2DWK A;  2E9X D;  2V1D B;  5D81 A;  1M1K 4;  4PNI A;  3JUO A;  1FGM A;  2BVL A;  2P0M A;  2CG1 A;  3CNM A;  1FGR A;  5LJN A;  4MEI A;  5AIG A;  3AAE B;  3I0Y A;  1LVK A;  2MOZ A;  4MMX B;  5DQW A;  1SIH A;  3EJV A;  1MMD A;  1S35 A;  1A90 A;  4PFP A;  5C8Y E;  4UVC B;  3Q1C A;  2CWY A;  3KFQ C;  3B57 A;  3I9Y A;  4JF8 A;  4EZ4 A;  3ZMV B;  4XZC A;  3BLZ A;  3X42 A;  2P05 A;  1SA0 E;  3SOY A;  2CCQ A;  3ETV A;  3E22 E;  2H7O A;  3F57 A;  4C91 A;  3AVS A;  4H61 A;  1BR1 A;  4G1M B;  4ZM8 A;  3Q5X A;  3KIN B;  2GU1 A;  1IDP A;  2CIU A;  3C64 A;  2F99 A;  4E7Z A;  5FY0 A;  3NX0 A;  3HKB E;  3S4U A;  4XAX B;  2C5J A;  2YFJ B;  2MBG A;  5FGO A;  3LH4 A;  4MHC A;  4PK4 A;  4XBY A;  2JDI H;  3HKE E;  3AMO B;  5EEO A;  3RYH E;  3RYF E;  2V7K A;  3K5T A;  2XR8 B;  3ZJ2 A;  3UL6 A;  2ZDJ A;  2K9A A;  3WOF B;  5FXV A;  2CK3 H;  4OK0 A;  2E9X C;  1MMN A;  4DBQ A;  2YX9 A;  2WSS V;  3LTA A;  2NWB A;  2XQY A;  2NTY A;  4MJD A;  3B13 A;  3LYG A;  3F8H A;  3LK4 2;  2KZ7 B;  1UX4 A;  3F31 A;  4G63 A;  1T5Y A;  2BVM A;  3PS8 A;  5EK3 A;  1RRH A;  4XBX A;  4KMC A;  1OGX A;  4FJO A;  3LFM A;  3Q5W A;  2Z6E A;  4IE0 A;  4CZZ B;  1FMV A;  2OWP A;  5CF1 A;  5L3D B;  3VSY A;  2CMR A;  3CQC B;  2R4I A;  2XAF B;  4CCV A;  1QAL A;  1HU9 A;  4FMB A;  1OHO A;  1K73 4;  4TUY E;  2W6J H;  1X79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...