4OK0A

Crystal structure of putative nucleotidyltransferase from h. pylori
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
225
structure length
225
Chain Sequence
LSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of JHP933 from Helicobacter pylori J99 shows two-domain architecture with a DUF1814 family nucleotidyl transferase domain and a helical bundle domain
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords Putative
total genus 73
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ok0A02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ok0A01
4O8SA 4OK0A
chains in the Genus database with same CATH superfamily
4R9KA 1JB5A 2UXCT 5AQKB 3EI0A 5IWAT 1B2MA 5AQHB 3PYJA 5M4YA 3DXOA 3KVAA 3CKDA 2W0GA 2E2TA 3K3NA 1RSNA 1UGHI 4CZZB 2YDSA 1NU3A 3QB5K 3JVCA 4MMXB 2L9QA 1OGZA 2BKNA 5J2UE 3VRAA 4HFVA 4HWDA 2XGNA 4HJLB 2KF5A 1E3VA 4YTPA 2K54A 4A5XA 3FH1A 1M1XB 4IE5A 4O2HA 1VQN3 3K63A 1VQM3 3FB2A 4X62T 3AXJB 4TWDA 5D81A 3AE8A 3GAXA 3WHOA 2NW7A 2WCAA 1IQXA 4WZXA 1HG2A 4AKYA 3LK2B 3CX8B 3RYCE 3KFWX 5AI1A 2EHOC 1D6UA 5IYZE 4DMWA 2WZHA 4H63V 2CA5A 4K61A 2NWBA 3ZJ2A 2DWGA 3MXZA 4HWCA 1BNFA 2KF6A 1PFPA 3B8LA 1JBRA 1YJ93 1IQYA 2KSRA 1RTUA 6STDA 1VQ63 1B2UA 2E9XB 5IF6A 2C11A 5J0ZA 1J5ET 1BRSA 1JZDA 2MC8A 3S5CA 5HEGA 5LG4A 3CCU3 2E9XC 3F7XA 2CG0A 1L5GB 3Q5WA 1MIWA 1AY7A 3OWSA 3CQGB 4DV3T 3ZFZA 3EHZA 1RGAA 2I6HA 3CD63 2BVMA 1CQSA 3CNMA 2ML5A 2EHOD 3T1HT 1F8NA 1LOYA 5LG3A 1SJWA 5AIHA 5HEOA 4KFDA 5AQMB 2V7KA 4JI6T 5CA0E 5EVHA 3GRDA 1EUIC 1SQWA 2E9XD 3S4UA 1AVKA 5FKYA 4O8SA 4UVBB 3UUMA 4EBGA 5KX5E 1GY6A 3ZJ1A 5DJQC 2WDQA 3PURA 2M7OA 4ORLA 2FBWA 2CG1A 1BRIA 4WYKA 3AAEB 4JYAT 1BR2A 1GOYA 2NW9A 2P38A 2E5VA 4ASKA 1MNEA 2V6YB 2M67A 5BU4A 3U97A 3ABVA 3AXJA 3VHLA 1UUWB 5HXCA 1NB5I 3UL5A 1WR6A 3DTOA 3B4OA 5HXEA 1RGGA 1KNZA 1AV4A 1BRJA 5FP3A 1V74A 1Q814 2AXDS 5M19A 4H61A 4RZMA 1UX5A 3DZLA 4K0UA 4YSXA 3DGNA 4TX4A 3CCL3 1B7TA 4ADZA 3IMAB 4OVMA 4UEMA 4AKGA 4AKZA 3E99A 3RQUA 1FUSA 4BJNA 4DR1T 3D5IA 4OK0A 1XDPA 2HPLA 5HEUA 4WNKA 5DQVA 4BL2A 1ISKA 1BNGA 1UCIA 2QRXA 4FCZA 3JC6D 4FMCA 5AEUB 3RRCA 2X9XA 4HEAA 5AQUB 3R6NA 2LKGA 4HM5B 4DBQA 1BR1A 1BRHA 1ZGXA 2CKFB 4QX7B 1ZX2A 2IA7A 1UURA 3P4RA 4JF8A 2LKHA 3RIFA 1WMPA 5RNTA 1TJDA 3WAKA 2JDIH 9RNTA 4CI1B 4MALA 4GIWA 2W9PA 2CIUA 1HZ1A 2CFLA 2CX0A 4LGQA 5FNVE 4ANJA 4BTWA 3CXC2 1M62A 4EAHA 4DV2T 3IBPA 5HCMA 1STFI 3K7CA 1HX1B 2VQET 2OV9A 3ONXA 1X1YA 4KUMB 2LHNA 2ZDJA 2STDA 3UL6A 3LTCA 2WGOA 2B1XB 3OX9A 4CXXA 3LZAA 2OLTA 3CC23 3NM2A 2GXFA 5IEPA 2OWPA 5ELJA 5JREA 4E7SA 4EYCA 3GN5B 1RCKA 3DJBA 1OPYA 4HZ9B 3RH3A 3TLTA 3F40A 1FGOA 2PFVA 5CGMA 5AEWB 3FG1A 1SIHA 1T98A 3PTRB 2V5CA 4TX5A 1LNIA 2Z7AA 1XMQT 2O9UX 4PK4A 5ABGA 3R84B 4LF6T 3RRWA 1ZO2A 5CF2A 3PCRA 4NPPA 5LHIB 4I4TE 1VQ43 2NTXA 3RYIE 1MNDA 3X3YA 4DR5T 3GZRA 1JN5B 3H3MA 2CK3H 1X79A 2QA43 3AEEA 4UVCB 1HNZT 3A76A 3FZHB 2BMQB 2XSBA 4H9SE 2RGQA 2IAKA 3JADA 1OHSA 1JNZA 1UW1A 3ZT5A 2N9DA 2CFKA 1IVXA 1ULJB 5HGRA 3UQ4A 2ACZA 4DBRA 1VQ73 3FSDA 2ZHXB 1HNWT 1BVIA 2H89A 3CPZA 2KLQA 2XZEA 3V5UA 3AECA 3SOLA 3EX9A 3FBZA 2W67A 3EABA 1KWIA 4LF9T 2Y74A 1MNLA 3T0UA 1S5AA 1WLXA 3CX7B 3KN4A 2MOZA 1PU4A 3A5EA 5CXOA 5J1GA 5AQGB 5ABHA 2W04A 5BMVE 1GY5A 2VKHA 4N78D 1VQL3 3B13A 1VQQA 1AJ3A 3QK9A 4DR2T 5JDMA 2K3DA 3HOHA 4AI6A 1VQ53 1FMVA 1MGWA 3LTBA 1TFKA 1W0BA 3ALAA 3OPCA 3OWYA 1GD4A 1LOWA 1D1CA 4JLEA 1K9M4 3ONJA 2XASB 1V9DA 2IDOB 4XDVA 3EBTA 4QWTA 4L8OA 1I2EA 4XB5A 2RPAA 2BG9A 3RC8A 5JR9A 4WBNE 4FMDA 1ZEEA 4LZIA 4ZXLA 3K0ZA 2WOHA 3OVUA 3PUXF 1RN4A 2F4YA 2ODVA 1RN7A 1HG5A 3IEEA 4EZHA 3KDSE 3PV0F 1QAFA 4DV5T 2NW8A 3ROBA 2IUKA 1Q824 5F3JA 3KSED 4KZ1A 2VWAA 3LFMA 6GSPA 2P9BA 4IGUA 3AE9A 4K1VA 1NO3A 3UT5E 2HMJB 2YOEA 2UX0A 2WU2A 5JRCA 2VVNA 3L8RA 2F98A 3F7SA 4B3RT 4HGAA 3AA1B 2LEHA 3KV5A 3UUNA 1EKMA 1NEKA 2UUBT 1HFAA 5FY1A 3ETUA 4WP5A 2C0SA 3K1SA 4HVNA 2XQYA 4H9OC 4ILAA 2UU9T 4AEQA 2RSXA 1EZ3A 2E8IA 3BLZA 3DGYA 3NBJA 4DKIA 4KMCA 4O4HE 1KEYA 1WYBA 1GY7A 1XZYA 1OXZA 2XQ3A 4JBWF 2XQ7A 1DMMA 5BVBA 4P0BA 3ESLA 1KC84 1R4YA 1RJOA 3PUVF 1ROVA 2RP4A 3FZKB 2XSHB 1HTJF 2HN2A 1KF6A 3DMCA 2DWKA 1OWAA 3PUYF 4DV4T 3ZEFB 3Q9DA 2Y73A 3CVRA 1YNVX 2CRBA 4X20E 3RI5A 3EJVA 1FMWA 5BXQA 1LQGC 3ZN1B 4PFPA 2PNCA 4MMZB 3A7MA 3AB3B 2ZM2A 2Y8DA 5AIFA 5EK2A 3GSPA 4HFHA 2ZMAA 5BIRA 2BU4A 3G6E3 1YGWA 2LRLA 2BG9C 3WDGB 2FJDA 1HKXA 4HM8B 4ILFA 2XFTA 5LXTE 2P05A 3G0KA 3NBXX 2W0QA 5LOVE 3O1IA 1M9GA 1UGOA 5AQPB 5L4EA 5FVKA 3GN5A 3EQQB 3PXMA 3X40A 3PU8A 5L3DB 4QXBB 4YLHA 3I0YA 3IPTA 1J2BA 5CF1A 3QRDA 3C4WA 3JC6C 3RGRA 2OOVA 1BGSA 4HFCA 2L8KA 4I43B 2PBIA 2HHHT 1I0XA 4YSZA 2WO0A 1ZV4X 2GK9A 5FY7A 3BB9A 3TDGA 1UGIA 2IUBA 4EXTA 3CNXA 7RNTA 2OTL3 3Q2MA 4DR3T 4KI0F 3PGBA 1B3SA 1W4NA 3LK3B 3I9WA 5FYMA 1O7HB 5LMNT 2DCFA 2JIWA 2JQKA 3V92A 3AEFA 1I94T 5ABFB 5F8PA 2VVSA 3NV0A 1Z0PA 3CCJ3 5HEHA 3ZPOA 3U3IA 2FJAA 1W09A 3G713 3P7IA 4DV0T 1T2IA 2C4BA 1ULIB 2KWIB 2YDRA 2OOVC 4FMAA 1UUSA 2WB5A 2X0HA 2P09A 1VCTA 1B2SA 3L0RA 3MJXA 4AKIA 3VF1A 2BZBA 2FJBA 3ZMUB 2LLYA 2A3DA 2GSPA 3CK6A 1NB3I 1BANA 4LFCT 4XM4A 3WA2X 5JDHA 2AE9A 1WCRA 4EB6E 1X1WA 1N8QA 4FR9A 4ZI2C 2QYWA 3K3QC 2XQAA 4LF8T 2MF7A 3ZT6A 1I8VA 1RNBA 4NUUA 4IT4A 3I9YA 3NBRA 1I3IA 3A8YC 5KDMC 2CWUA 3UU5A 2D0UA 5JVDE 5IW9A 2MAWA 3DGOA 1UUGB 5CA1E 4ZOLE 2PJQA 3RQWA 4ILUA 5AQQB 3NWIA 3PJAJ 3ZLIA 2HH7A 1NNVA 2CM0A 4ISSA 3KZTA 1V57A 1B27A 2VB6A 4TV8E 3HKBE 2ZM0A 4QH4A 5KP3A 2Z6BA 1VRBA 1FYSA 4UV9B 3ECFA 3NXJA 2DL1A 1ZKEA 2E2VA 2CWTA 2HMLB 5C2TA 4HM2B 3SEDA 4WYVA 2XJ7A 4NXNT 2O3OA 3ZMSB 1I0VA 1GMRA 4JI0T 3PJAA 1US1A 4R9LA 4N6MA 5FXXA 3EBYA 5C8YE 1TFOA 1IU7A 1YQ4A 1EQKA 3N9NA 2W2UA 5JDGA 2KWHA 3FCSB 2V1LA 4J8TA 3H51A 3C50A 4N6OB 4DV7T 3P50A 5DRVA 3UFEA 2BHMA 4N3VA 3AHSA 2BMRB 3KINB 4UXNB 2DHRA 3N9LA 1ASKA 2WU5A 5TAOA 1JKGA 3QUJA 1IJ5A 2V7LA 1JV2B 2Q07A 3VGNA 2UXBT 1E1HB 1MMNA 3IA3A 1Q42A 1QVF2 4GKKT 3KKGA 1JRQA 2BBHA 4F6RC 1LVFA 1LXEA 1GOVA 2UGIA 3E22E 3MG1A 3CCE3 1QVG2 2D0TA 5JTGA 1T8BA 1HR0T 2M6BA 4EZ4A 2X51A 4DR6T 2SBLA 4QXCB 3MSOA 1FGMA 4STDA 2QEX3 1U8CB 3FZLB 1S723 1YHQ3 4I5QA 3F8XA 3ZYLA 1Q40A 1EA2A 4J9AA 1MIYA 1WYCA 3VR8A 4DIDB 3MKIA 2H3RA 3C4XA 3EAMA 2X9YA 4CN4A 3AE3A 1QJGA 3CME3 3X41A 1N36T 3WR2A 5A1LA 4LF7T 1LKXA 4H63H 3E08A 4IHJE 1VQK3 3ZMTB 1FGTA 3HK4A 4HM6B 2W62A 4QWNB 1NWWA 2DI4A 3EVYA 3H3HA 2KNDA 2XAQB 3IJEB 3KFQC 3NRXA 4DV1T 4JRFA 2WQYA 4OYKA 4DNDA 4H9QC 5CFBA 4CPKA 1BNIA 1Q9EA 2BO9B 4IE7A 1X1UA 5LNKA 2GEXA 2YFJB 3M65A 2LQVA 3HKEE 5L3GB 3D3LA 1LVKA 3CMA3 4FMBA 2CWOA 3G06A 4U2ZA 1N5PA 3Q3FA 3SYUA 3AGNA 1DVDA 2NP9A 3ANWB 5AQRB 1IBKT 1MMAA 3HIGA 1WMNA 4IIAA 2KINB 5LJMA 4J5GA 1B2ZA 3DGMA 1IDPA 2KF4A 1UCJA 3OW22 5L3BB 2MPKA 2CE7A 1TUHA 3OWUA 2D42A 1A2KA 1GSPA 3CQCB 2ES0A 5IUXA 1GMPA 1N33T 2A2FX 2RBIA 2XQ9A 1FUWA 1KSIA 4X65T 2CFGA 4CN1A 3N9MA 1FEWA 5AFUL 3X42A 3OYZA 2AADA 4CXYA 4MLKA 3AMOB 3RF1A 4DMVA 1N32T 5H6QB 3STDA 1T2HA 1BU4A 1PYLA 4XZCA 1Q40B 3K9MC 3UJMA 2AAEA 3NQZA 1MIVA 2UXXB 4C91A 1Z8UA 4NXMT 2XF3A 2OTJ3 3MG2A 4X2HA 3KBTA 5LC6A 3T8UA 1B21A 1D1AA 2IC6A 2D1WA 2H0IA 2PZVA 3FG4A 2X9HA 5KP4A 2KF3A 2UUCT 2BG9E 3ZC0A 3RHWA 1IV9A 1I3FA 4Z91A 2XR8B 1C54A 1QSDA 5JR9B 4EXRA 3I0QA 5LBMA 4PK5A 5IG4A 4JI3T 5AQTB 2F86B 4U3CA 5EEOA 1N34T 3BQKA 5C3JA 3AEDA 3VSYA 4YSYA 1RLSA 1GS3A 3BNCA 5TGNA 1A2VA 4Q25A 2XQ6A 4X5TA 1RGCA 1MGRA 4EYYR 4YFSA 4O4LE 1RRLA 5IENA 2Q9QB 5ETWA 3ETVA 4LFBT 4ZZCA 1RGHA 4B6XA 4AQGA 2PTFA 3VR9A 1E97A 2X66A 1QALA 3V5SA 3D9RA 4LFAT 4AIUA 4L7KA 1TRQA 4FCJA 5DREA 4WW0A 3MG3A 3PUWF 4KBMB 4AXPA 4UV8B 2GU3A 1RNTA 4EEBA 3N9OA 3BQIA 1YKEB 3N2OA 2J8XB 1XMOT 1J1JA 4HWHA 1N8R4 3LJCA 1GQEA 4UELA 4XBFB 2VK9A 4L0RA 2J1DG 2CH9A 1T72A 2Q9QD 5FL1A 5FXWA 2LYXA 1W0AA 4ZI3D 1JBSA 3D5GA 1GYBA 1UDII 3HKDE 3HR0A 4EYUA 1X9BA 1V58A 2CEAA 5LMUT 5LGNB 3LBXA 2HMMB 5D83A 3CCV3 2LM9A 4BL3A 3CWZB 1YKHB 2F5MA 3T1YT 1QMAA 2CHOA 1CHUA 4JUYA 3ZKRA 4XBYA 3CX6B 1O7WB 2E9XA 2QGSA 1FZUA 2WDVA 2LSYA 1C7HA 4B3MT 1A90A 5FVLA 1OEDA 3M8CA 6RNTA 3N8BA 3B4PA 5KXJA 2B24B 3F8HA 2BS3A 3FXEB 2HOHA 5LBQB 4EV2A 3VU7H 3RGLA 2L3LA 1BNJA 2JPFA 2XSOB 4KX6A 2EHOA 3ZCJA 7GSPA 1DVCA 3JUQA 4LMKA 1KD14 4V1Av 5EZYE 1HYFA 2XHEB 3CCQ3 3PCSA 4AQYT 3EN1B 4NPBA 3DH2A 3HZPA 4TUYE 4ZI7E 1T5YA 3GA8A 1UCLA 4ZEYA 5STDA 2A9UA 1YW0A 3P4PA 2FGTA 1W2B2 4U13A 1SA0E 4O02B 3ZSTA 4L9IA 2RCDA 3PU3A 2H7OA 5FL0A 1LNHA 1EG9B 2N2NA 2I9WA 2A72A 3BNDA 2XTLA 1LOVA 3KSPA 1H7CA 1WNHA 4U31A 4QX8B 2CXDA 1VQ83 3KCHA 5JQGE 1G8XA 4AKLA 4PJJA 3BQLA 4QH5A 2IIUA 3X3XA 1BNSA 5AQJB 3LK42 1D6YA 3TLVA 3GWRA 3UULA 1OGXA 4X1KE 2KXPB 3FGYA 4R4KA 3N9PA 4DVDA 3LTAA 2H0GA 1BNEA 2XGLA 4PEJA 4CI2B 2KT9A 2VKOA 4IDNA 3NV0B 4HM0B 1OACA 4CN6A 5ABFA 2VL0A 1MMDA 1NJI4 1I2GA 1FGQA 2XAFB 5AIIA 3RIUA 1CUNA 2V8SV 1D1BA 3EB8A 3PUSA 3W15B 3RDEA 4Q53A 2K3WA 4ZI2D 1MMGA 4A98A 3RX6A 4ZS2A 4JI8T 5L3FB 4OHFA 5I97A 3AVRA 3P4QA 5LCYA 3UB1A 3ZYMA 2C10A 3RYFE 5DQWA 1VQ93 3SWHA 3F31A 2B1EA 4U33A 2Q9QC 1LQMB 4E7ZA 1L0VA 4O3VA 4EC6A 3LDQB 1T7SA 1YXRA 3WOFB 4O2BE 2CPTA 4U7YA 2V1DB 1DU2A 3JAFA 4GHOA 3HKCE 4WYKB 4U7IA 4N6V0 3O8YA 3AE4A 1WFDA 1D0ZA 4CCVA 2XQ4A 4AQFA 1MOLA 4I50E 3QNUA 5LC7A 3SFDA 3GZBA 5IG3A 1JBTA 2CMRA 3K5TA 4P0AA 5JH7E 3HI2A 4JEUB 3CC43 2KCDA 2JQQA 1M904 3AA7B 5LYJE 5M1AA 3O4XE 3G8ZA 1YQ3A 2I0MA 4GK0E 1AVLA 2SPCA 2FXTA 3PZWA 2XM1A 2D2SA 1BOXA 3RPUA 4TWFA 3DUKA 2K5BB 5FMNA 1DYUA 4F8HA 2ZM6T 3AMOA 4O4IE 1GD3A 3NUVA 2VKJA 2CLYC 1YIT3 4IDOA 3C98B 2LJLA 3FZWA 4PW8A 1D6ZA 1ZOYA 4RNTA 4I4KA 4RNYA 1FA3A 4IT7A 3LG7A 4MHCA 2CLYB 1BSEA 2V7JA 1TTOA 3MYTA 4RNZA 1Q7Y4 5L4HA 1VCSA 4KFEA 2K48A 3LT9A 4K1UA 3TLSA 3K3OA 2UUGC 1NENA 2YU1A 3ZMZB 3QK6A 5EK3A 4U2YA 2YX9A 3SRZA 1U4QA 1UI8A 1W2ZA 2MTQA 1IBLT 4BTYA 5AQIB 4CQIA 3Q5XA 3OTOT 5JRCB 4KT3B 5FGOA 2ACXA 1OF5B 2QVAA 1NDOB 1E7PA 4GOUA 2XM2A 1XNRT 3VKHA 2QGUA 3AE2A 4GKJT 5GSPA 4WFOA 3SXXA 3B7CA 3I1AA 4CI3B 5JDNA 4OYJA 1U5OA 2WSSV 1VZZA 3DP7A 4BTXA 3ZCIA 5DABA 4FJOA 3ZG0A 1IAPA 1OEDE 1WTHA 2YINA 4G2AA 1QUUA 1BSBA 3UNLA 2NR4A 3E0ZA 2LOPA 2E5LT 3N2GE 3UUBA 3GMIA 3OXAA 4AQFC 2HPJA 2VL8A 3FZMB 5JBSA 1RRHA 4X2OA 3UU6A 1RGLA 3FHNA 4IL9A 4C90A 1ZHCA 3D4AA 2LSGA 3QC9A 1WQLB 2X0YA 3CCS3 4TZ4C 3P8CD 2VASA 4LMLA 4N6UA 1MWTA 3VRBA 4DR4T 4U74A 1UX4A 4ILCA 3NBBA 1S35A 1E2AA 2NTYA 3F2EA 2D5UA 4CXWA 2WY2A 3CQXC 1NWMX 4JI2T 3JCFA 3PUGA 1XNQT 2Y6XA 3RYHE 1YVBI 3UTKA 1JKGB 4WHAA 1KK7A 1JJ22 1K41A 3MWZA 2W56A 2JQ5A 2J47A 2E2UA 4HZBB 4DV6T 3BNBA 4K0KT 1UI7A 2ML6A 3N9QA 3EF8A 8RNTA 3HI7A 2JQ9A 3CMLA 3N2KE 3N54B 5HEJA 5G1KA 3LTDA 3MKDA 4MBQA 1BR4A 4KP3C 4DR7T 2GBXB 4YXDA 3UQ7A 1B20A 2FUPA 8CHOA 1AQZA 4R80A 4GYRA 4JI1T 5H6RB 2XQ8A 1A67A 1WRDA 3PDYA 3EN8A 2NOXA 3S67A 3J7Yd 3D0TA 2UXDT 4PJLA 2XEPA 1JN5A 1IZNB 3Q5DA 2R41A 3ZSSA 1TU5A 3BNEA 4PNIA 4ZS3A 1G02A 3NRYA 4HOHA 4IPBA 2XFSA 2BBJA 1CEWI 3AEAA 3OYXA 3NZPA 4IL4A 1RHLA 4EOZB 3U1WA 2CBJA 2XH9A 3Q1CA 5JPUA 2YU2A 4HN9A 4XDWA 4X66T 3KE7A 7STDA 3F57A 4IDQA 2LSKA 1RKYA 2W66A 3WI3A 2ZL8A 5BR8T 4YTMA 1DE3A 2F56A 1W7CA 5ELUA 3Q90A 1Y64B 4TWHA 5HWXA 3RKOA 2P0MA 2Q9QA 1YGEA 1AR0A 2YFIB 3FLJA 4NHFA 3NKZA 2LSIA 3ZC1A 3SOYA 3KV4A 2DLRA 3FF2A 3NZQA 3AHWA 2V7IA 2RFRA 1IV7A 2J62A 4IIJE 2XAHB 1SUMB 3H37A 4QHOA 1JB4A 3NHXA 4IE6A 1YJW3 1MWSA 4GL6A 3EE1A 2CXLA 4YHHT 3OKQA 3ANWA 4DUYT 4HM4B 1OHPA 1MWUA 4J2CA 4PJMA 3MHEA 2BNGA 3DGLA 4MMYB 2LOSA 4EW5A 3HL6A 2MBGA 5JDFA 3RKGA 2G0UA 3EDUA 2IUJA 4NREA 4JI4T 1IBMT 3EUHA 1VQO3 1K8A4 3UU4A 5FXZA 3RIUC 1D0YA 1O7GB 5HOHA 1IJ6A 2IMLA 3N5LA 4LYLB 5CK6A 3AAAB 1G96A 2QA7A 4IDZA 1VQP3 5G2GA 4IDPA 2N1GA 3MPHA 1E3RA 4YY3T 2W56B 1YJN3 2BVLA 1FUTA 5AQVB 4ILBA 5LA6E 1O7NB 3LXUX 2DNXA 2CBIA 2V5DA 2IHR1 2RA1A 1HNXT 3ONLC 2D9DA 4JEHB 1YIJ3 4AISA 4MFRA 2IW5B 1KNRA 3PS8A 4L8PA 2J4GA 3M3ZB 1JNQA 4UF0A 2BDEA 2CHCA 3S27A 5D82A 3VKGA 5EQLA 1W02A 1N9JA 1O7MB 4UR9A 1CYUA 4HTEA 2IC9A 3J7Yq 1DMQA 3LH4A 3EHCA 4QXHB 2ODUA 2OQEC 3FZFB 3UFGA 1KFYA 5JDQA 4ZHQE 2MYSA 4ZM8A 4ZI3C 4HYZA 1OCVA 4B3TT 4KHPT 1K28A 4LF4T 2K0MA 5AYRB 1LVNA 3EDVA 2XPKA 5IEOA 1YD8G 2C5IT 3SFEA 4CDLA 3WODG 1BRNL 2E2AA 4ISTA 1D0XA 5CLKA 4N6TA 1LRAA 1S94A 1SARA 3RC3A 1WR0A 3NQYA 2X9WA 3U78A 2X67A 3A5XA 2HMNB 3QB5A 2WMNA 4IREA 3NX0A 1YI23 2W9QA 2WGQA 1BNRA 4BIRA 4N6LA 3C64A 2X68A 1OUNA 4O4JE 2LSJA 1JB2A 1BIRA 5HCJA 2JJ9A 3QOFA 1IT7A 2VQFT 4HE8A 3WAJA 2JQHA 4K90B 2W03A 2F4VT 1HS7A 3KIIA 2CHNA 2V26A 4G1MB 2WM9A 1I6ZA 2W2CA 4UF0B 5LGUB 2LT3A 4J5KA 2JMHA 3AE1A 3FKAA 2OA5A 1KQS2 4YT0A 2PG8A 2YEVC 2GBWB 1QLBA 5LB7B 2YN6A 3LOYA 1BSCA 3G16A 2KZ7B 1BRKA 3F14A 1K734 5AQLB 3L39A 5CJ5A 4TN7B 3GWHA 3JUOA 4HFIA 2I59A 2BG9B 5HXRA 2YK0A 1N5HA 1GMQA 1BSDA 4YJ2E 1W9RA 2CFDA 1J5WA 4EV5A 1O7PB 4HKVB 4OX9T 2W4XA 4ERRA 5J2TE 2YDQA 2UUAT 4ZZBA 3UUXB 2V7MA 3MK7C 4BA9A 2K9AA 1BR0A 1US7B 2WMOA 4G63A 3B5MA 4YTNA 1Q7HA 1SE7A 2KAAA 2OQEA 5AIGA 2Z77A 1X1XA 3GZYB 1SPUA 4P09A 4WBOA 2BS4A 3C4ZA 2W00A 3PE0A 3CPOA 2CFWA 1TP6A 3TLWA 5AQFB 3AEBA 4I0UA 3EC9A 1G73A 2XAGB 3LSVA 4LF5T 2GEYA 5L3EB 2F5WA 1PY3A 5LHHB 1B2XA 3ZN0B 1DMNA 2XUEA 1U5PA 3MZKB 4GYSA 4PAGA 2V6XA 4BAYB 2WDRA 5LHGB 2VKDA 3CCR3 3PUQA 1SHZC 4B3ST 2ZA4A 3MACA 5IG0A 2LM2A 4HBRA 2WWUA 3V98A 1MWRA 1BUJA 3G4S3 2KRTA 1RCLA 2XQ5A 4P1NA 3CU3A 4OUQA 2CWYA 3SS1A 4JI5T 1WMOA 2JMKA 4YHJA 1ROAA 1UCKA 1W6GA 5JPPA 2KXGA 3J9X1 4H9RC 4PFOA 4IE0A 4KFFA 4DUZT 3H3AA 2LE8A 4Z90A 1CYVA 4MEIA 3C51A 3X1DA 2XRXB 3Q2PA 4GK5E 4NIQA 2L4VA 1KNPA 4AKHA 1FIOA 2CX1A 2WP9A 3RNTA 1SIIA 4BJMA 2KMFA 5IG5A 4HWFA 2WS3A 1UUVB 3SX1A 4N6NB 3D79A 3N9HA 2ZM8A 2XAJB 1QAKA 1OEDC 3F9SA 4XBTA 1YVSA 1W5ZA 3SOAA 3V99A 5IHYA 3AE7A 5HYAA 4UIGA 3BU4A 1OEDB 1FW7A 1LRZA 2WWVA 2UXNB 3RLFF 3CPW2 2R6GF 3UU8A 2W63A 1OHOA 1GOUA 2LHRA 1FGRA 4FI5A 1NAFA 3SVAA 1BSAA 2CW9A 4X1IE 1UCUA 1EEJA 2LRKA 2C5JA 5JR9C 3FBLA 1RN1A 2HMKB 3T8NA 2EHOB 2HMOB 4EV6A 5FW5A 4X1YE 4XAXB 2K24A 4KHZF 4HAAA 1RDSA 3WOEB 3O1HA 2F99A 3KVBA 4HM3B 1CH0A 2BKOA 5LP6E 3HA4A 4LMIA 1W6YA 1HCIA 4H3UA 4BU4A 3OJAA 5AQNB 4HM1B 2WZIA 2CXFA 2JRKA 4WWUC 1LOXA 2V6YA 3BK9A 1IVVA 2YKSA 5E0OA 4DO0A 4PJNA 3I563 3FG3A 4X64T 2P0XA 4GB5A 4AKRB 3LYGA 3IF8B 1OH0A 5EK4A 4HKAA 3T8OA 3RIAA 2RNTA 2Z6EA 1IT8A 4KVHA 2XY8B 1W01A 3GZXB 4XBXA 1W00A 4H9PC 2R4IA 1UK5A 4A97A 4EIWA 1M7KA 3O1JA 3FXDB 2C5KT 3TKLB 3JUNA 1IVUA 3I553 3CIRA 1RGKA 2HN1A 5GONE 1O3XA 4L5GA 2BT3A 5FXVA 3ZG5A 3LBXB 4JV5T 3AA6B 4OFZA 2W6JH 3B57A 4RBNA 1G0TA 4JI7T 4YJ3E 4UVAB 2H7VC 3OBVE 4HM7B 1HF8A 1STDA 1DETA 1HU9A 3ZYKA 5F5WA 1Z1SA 5HXHA 4HFBA 4I55E 1N9EA 2L1SA 3DM8A 5LGTB 2QIYA 1ZS7A 4LSOA 1JZOA 3K8PC 3NM7A 2CCQA 2B76A 3AGOA 3KV6A 1IK3A 3S28A 1JNRA 1XWMA 4Z8XA 3CCM3 4EEDA 5M18A 5AQOB 1RMSA 2BIRA 4LEHA 5LJNA 3AAIA 4TNVA 1R4CA 5IERA 4QKNA 4CJNA 3Q5EA 4TNWA 3URPA 2BMOB 1IYYA 3WMDA 1A2PA 5AQSB 3TLUA 2BKPA 1BAOA 3KBUA 3RGAA 4FCMA 4MJDA 3NVOA 4GSPA 1I70A 4LMJA 2SARA 3IHRA 3AE6A 4NUVA 3AEGA 5L2LA 3P4SA 2Y48B 2IMJA 3UU3A 1IVWA 2W61A 3I0OA 3WA3A 2FJEA 4QH1A 3OV4A 5G1LA 2CWVA 5L3CB 3FF0A 3DY5A 4HWIB 2OCTA 2WAUA 3JUPA 1I2FA 2M6IA 2VURA 3PUAA 2H0HA 1OF5A 4COFA 4EGWA 5KP1A 2GU1A 2ZLYA 3HX8A 1FJGT 2BS2A 2H88A 1TRPA 3X3ZA 5ADXL 3ER7A 1T3BA 1R8IA 2IY2A 4R1KA 3SLUA 5HXSA 3AE5A 3O9XA 3BIRA 3MA9A 2WBLA 2YFLB 3P4WA 5ABEA 2X0LB 4H9NC 3ZT7A 3L3PA 1RGFA 4M1PA 5HAXA 1XDOA 3JUMA 4IE4A 1W6CA 2IYJA 3LMLA 3AA0B 2A15A 3PUZF 1RGEA 3KV9A 3ZMVB 3AVSA 3LT8A 3CC73 2INXA 1IQ8A 1Y4KA 4A56A 1TIJA 5JDLA 1Y01A 5FY0A 2CC3A 5HWYA 5CB4E 1VOMA 2WOFA 1ZP0A 1Q864 4TV9E 3HIIA 3S29A 4HFEA 2XSAA 4U72A 5KMGP 5A0OB 1M1K4 1HX8A 4PK6A 5L47A 5AYSC 4HFDA 1BRGA 4O2AE 3L09A 2FNQA 1BUQA 3JAEA 2Z76A
chains in the Genus database with same CATH topology
4R9KA 1JB5A 3PYJA 5M4YA 3DXOA 3KVAA 3CKDA 2W0GA 2E2TA 3K3NA 4CZZB 1NU3A 3JVCA 4MMXB 2L9QA 1OGZA 5J2UE 4HFVA 2XGNA 4HJLB 1E3VA 2K54A 3FH1A 1M1XB 4IE5A 4O2HA 1VQN3 3K63A 1VQM3 3FB2A 5D81A 3GAXA 2NW7A 1IQXA 1HG2A 4AKYA 3LK2B 3CX8B 3RYCE 3KFWX 5AI1A 2EHOC 1D6UA 5IYZE 4DMWA 4H63V 2CA5A 4K61A 2NWBA 3ZJ2A 2DWGA 3MXZA 3B8LA 1PFPA 1YJ93 1IQYA 6STDA 1VQ63 2E9XB 5IF6A 2C11A 2MC8A 3S5CA 5LG4A 3CCU3 2E9XC 3F7XA 2CG0A 1L5GB 3Q5WA 1MIWA 3OWSA 3CQGB 3CD63 2BVMA 1CQSA 3CNMA 2ML5A 2EHOD 1F8NA 5AIHA 1SJWA 4KFDA 2V7KA 5CA0E 5EVHA 3GRDA 1SQWA 2E9XD 3S4UA 1AVKA 4O8SA 4UVBB 3UUMA 4EBGA 5KX5E 1GY6A 3ZJ1A 5DJQC 3PURA 2M7OA 4ORLA 2CG1A 4WYKA 3AAEB 1BR2A 2P38A 2NW9A 4ASKA 1MNEA 2M67A 3U97A 3VHLA 1UUWB 1NB5I 5HXCA 3UL5A 1WR6A 3DTOA 3B4OA 5HXEA 1KNZA 1AV4A 5FP3A 1V74A 1Q814 4H61A 4RZMA 1UX5A 3DZLA 4K0UA 3DGNA 4TX4A 3CCL3 1B7TA 4ADZA 3IMAB 4OVMA 4UEMA 4AKGA 4AKZA 3E99A 4BJNA 4OK0A 2HPLA 4WNKA 5DQVA 1ISKA 4FCZA 3JC6D 4FMCA 5AEUB 3RRCA 2X9XA 4HEAA 3R6NA 4HM5B 4DBQA 1BR1A 2CKFB 4QX7B 1ZX2A 2IA7A 4JF8A 1WMPA 3WAKA 2JDIH 4CI1B 4MALA 4GIWA 2W9PA 2CIUA 2CFLA 4LGQA 5FNVE 4ANJA 4BTWA 3CXC2 4EAHA 3IBPA 1STFI 3K7CA 3ONXA 3UL6A 4KUMB 2LHNA 2ZDJA 2STDA 3LTCA 2WGOA 2B1XB 3OX9A 4CXXA 3LZAA 3CC23 3NM2A 2GXFA 5IEPA 2OWPA 5ELJA 5JREA 4E7SA 4EYCA 3GN5B 3DJBA 1OPYA 4HZ9B 3RH3A 3F40A 1FGOA 2PFVA 5AEWB 3FG1A 1SIHA 1T98A 3PTRB 4TX5A 2Z7AA 2O9UX 4PK4A 3R84B 3RRWA 1ZO2A 5CF2A 3PCRA 5LHIB 4I4TE 1VQ43 2NTXA 3RYIE 1MNDA 3X3YA 3GZRA 1JN5B 2CK3H 1X79A 2QA43 4UVCB 3A76A 2BMQB 4H9SE 2RGQA 2IAKA 1OHSA 1UW1A 2N9DA 2CFKA 1IVXA 1ULJB 5HGRA 4DBRA 1VQ73 3FSDA 3CPZA 2KLQA 3V5UA 3SOLA 3EX9A 3FBZA 1KWIA 2Y74A 1MNLA 3T0UA 1S5AA 1WLXA 3CX7B 3KN4A 2MOZA 1PU4A 5CXOA 5J1GA 2W04A 5BMVE 1GY5A 2VKHA 4N78D 1VQL3 3B13A 1AJ3A 3QK9A 5JDMA 4AI6A 1VQ53 1FMVA 3LTBA 1TFKA 3ALAA 3OWYA 1GD4A 1D1CA 4JLEA 1K9M4 2XASB 1V9DA 4XDVA 3EBTA 4QWTA 4L8OA 4XB5A 3RC8A 5JR9A 4WBNE 4FMDA 1ZEEA 4LZIA 3K0ZA 2WOHA 2ODVA 1RN7A 1HG5A 3IEEA 4EZHA 3KDSE 1QAFA 2NW8A 3ROBA 2IUKA 1Q824 5F3JA 3KSED 4KZ1A 2VWAA 3LFMA 2P9BA 4IGUA 4K1VA 1NO3A 3UT5E 2HMJB 2UX0A 5JRCA 2F98A 3F7SA 4HGAA 3AA1B 2LEHA 3KV5A 3UUNA 1EKMA 1HFAA 5FY1A 3ETUA 4WP5A 2C0SA 4HVNA 2XQYA 4H9OC 4AEQA 2RSXA 1EZ3A 2E8IA 3BLZA 3NBJA 4KMCA 4O4HE 1WYBA 1GY7A 1OXZA 1DMMA 5BVBA 4P0BA 3ESLA 1KC84 1RJOA 1ROVA 2RP4A 2XSHB 1HTJF 3DMCA 2DWKA 1OWAA 3ZEFB 3Q9DA 2Y73A 3CVRA 4X20E 3EJVA 1FMWA 5BXQA 3ZN1B 4PFPA 2PNCA 4MMZB 3AB3B 2ZM2A 2Y8DA 5AIFA 5EK2A 2ZMAA 3G6E3 3WDGB 1HKXA 4HM8B 2XFTA 5LXTE 2P05A 3G0KA 3NBXX 2W0QA 5LOVE 3O1IA 1M9GA 3GN5A 3EQQB 3PXMA 3X40A 3PU8A 5L3DB 4QXBB 4YLHA 3I0YA 3IPTA 1J2BA 5CF1A 3QRDA 3C4WA 3JC6C 3RGRA 2OOVA 2L8KA 4I43B 2PBIA 2WO0A 1ZV4X 2GK9A 5FY7A 3BB9A 3TDGA 4EXTA 3CNXA 2OTL3 3Q2MA 3PGBA 1W4NA 3LK3B 3I9WA 5FYMA 1O7HB 2DCFA 3V92A 5F8PA 3NV0A 1Z0PA 3CCJ3 3ZPOA 3U3IA 3G713 3P7IA 1ULIB 2KWIB 2OOVC 4FMAA 2P09A 3L0RA 3MJXA 4AKIA 3VF1A 2BZBA 3ZMUB 2A3DA 1NB3I 4XM4A 3WA2X 5JDHA 4EB6E 1N8QA 4FR9A 4ZI2C 3K3QC 2MF7A 4NUUA 3I9YA 3NBRA 5KDMC 2CWUA 2D0UA 5JVDE 5IW9A 3DGOA 5CA1E 4ZOLE 2PJQA 4ILUA 3ZLIA 2HH7A 2CM0A 4ISSA 3KZTA 2VB6A 4TV8E 3HKBE 2ZM0A 5KP3A 2Z6BA 1VRBA 4UV9B 3NXJA 3ECFA 1ZKEA 2E2VA 2CWTA 2HMLB 4HM2B 3SEDA 2O3OA 3ZMSB 1US1A 4R9LA 4N6MA 5FXXA 3EBYA 5C8YE 1TFOA 1IU7A 1EQKA 3N9NA 5JDGA 2KWHA 3FCSB 4J8TA 3H51A 3C50A 4N6OB 5DRVA 3UFEA 2BHMA 4N3VA 2BMRB 3KINB 4UXNB 2DHRA 3N9LA 1ASKA 5TAOA 1JKGA 3QUJA 1IJ5A 2V7LA 2Q07A 1JV2B 3VGNA 1E1HB 1MMNA 1Q42A 1QVF2 3KKGA 1JRQA 4F6RC 1LVFA 1LXEA 3E22E 3MG1A 3CCE3 1QVG2 2D0TA 4EZ4A 2X51A 2SBLA 4QXCB 3MSOA 1FGMA 4STDA 2QEX3 1U8CB 1S723 1YHQ3 3F8XA 3ZYLA 1Q40A 1EA2A 4J9AA 1MIYA 1WYCA 3MKIA 2H3RA 3C4XA 2X9YA 3CME3 1QJGA 3X41A 5A1LA 1LKXA 4H63H 3E08A 4IHJE 1VQK3 3ZMTB 1FGTA 3HK4A 4HM6B 2W62A 4QWNB 1NWWA 2DI4A 3EVYA 3H3HA 2KNDA 2XAQB 3IJEB 3KFQC 3NRXA 4JRFA 4OYKA 4DNDA 4H9QC 2BO9B 4IE7A 5LNKA 2GEXA 2YFJB 3M65A 2LQVA 3HKEE 5L3GB 3D3LA 1LVKA 3CMA3 4FMBA 2CWOA 1N5PA 1DVDA 2NP9A 3ANWB 1MMAA 3HIGA 1WMNA 4IIAA 2KINB 5LJMA 3DGMA 1IDPA 3OW22 5L3BB 2CE7A 1TUHA 3OWUA 2D42A 1A2KA 3CQCB 2ES0A 2A2FX 1FUWA 1KSIA 2CFGA 3N9MA 1FEWA 5AFUL 3X42A 3OYZA 3AMOB 4MLKA 4CXYA 4DMVA 5H6QB 3STDA 3UJMA 4XZCA 1Q40B 3K9MC 3NQZA 1MIVA 2UXXB 4C91A 2XF3A 2OTJ3 3MG2A 4X2HA 3KBTA 5LC6A 3T8UA 1D1AA 2IC6A 2D1WA 2PZVA 3FG4A 2X9HA 5KP4A 3ZC0A 1IV9A 2XR8B 1QSDA 5JR9B 4EXRA 3I0QA 5LBMA 4PK5A 5IG4A 2F86B 5EEOA 3BQKA 3VSYA 1GS3A 3BNCA 5TGNA 1A2VA 4EYYR 4YFSA 4O4LE 1RRLA 5IENA 2Q9QB 5ETWA 3ETVA 4B6XA 4AQGA 1E97A 2X66A 1QALA 3V5SA 3D9RA 4L7KA 4FCJA 5DREA 4WW0A 3MG3A 4KBMB 4AXPA 4UV8B 2GU3A 3N9OA 3BQIA 1YKEB 3N2OA 1N8R4 3LJCA 4XBFB 4UELA 2VK9A 4L0RA 2J1DG 2CH9A 2Q9QD 5FXWA 2LYXA 4ZI3D 1GYBA 3HKDE 3HR0A 4EYUA 2CEAA 5LGNB 3LBXA 2HMMB 5D83A 3CCV3 2LM9A 3CWZB 1YKHB 1QMAA 4JUYA 4XBYA 3CX6B 1O7WB 2E9XA 2QGSA 2LSYA 1C7HA 1A90A 3M8CA 3N8BA 3B4PA 2B24B 3F8HA 3FXEB 5LBQB 4EV2A 3VU7H 2L3LA 2XSOB 2JPFA 2EHOA 3ZCJA 1DVCA 3JUQA 1KD14 4V1Av 5EZYE 2XHEB 3CCQ3 3PCSA 3EN1B 3HZPA 4TUYE 4ZI7E 1T5YA 3GA8A 5STDA 1YW0A 2FGTA 1W2B2 4U13A 1SA0E 4O02B 4L9IA 2RCDA 3PU3A 2H7OA 1LNHA 1EG9B 2N2NA 2I9WA 2A72A 3BNDA 2XTLA 3KSPA 1H7CA 1WNHA 4QX8B 2CXDA 1VQ83 5JQGE 1G8XA 4AKLA 4PJJA 3BQLA 3X3XA 3LK42 1D6YA 3GWRA 3UULA 1OGXA 4X1KE 2KXPB 3FGYA 4R4KA 3N9PA 4DVDA 3LTAA 2XGLA 4PEJA 4CI2B 2KT9A 2VKOA 4HM0B 3NV0B 1OACA 1MMDA 1NJI4 1FGQA 2XAFB 5AIIA 1CUNA 1D1BA 3EB8A 3PUSA 3W15B 3RDEA 4Q53A 4ZI2D 1MMGA 3RX6A 4ZS2A 5L3FB 4OHFA 5I97A 3AVRA 5LCYA 3UB1A 3ZYMA 2C10A 3RYFE 5DQWA 1VQ93 3SWHA 3F31A 2B1EA 2Q9QC 4E7ZA 4EC6A 4O3VA 3WOFB 4O2BE 2V1DB 3HKCE 4WYKB 4N6V0 3O8YA 1D0ZA 4CCVA 1MOLA 4AQFA 4I50E 5LC7A 3GZBA 5IG3A 2CMRA 3K5TA 4P0AA 5JH7E 3HI2A 4JEUB 3CC43 2KCDA 2JQQA 1M904 3AA7B 5LYJE 3O4XE 3G8ZA 4GK0E 1AVLA 2SPCA 2FXTA 3PZWA 2D2SA 3RPUA 3DUKA 2K5BB 5FMNA 1DYUA 3AMOA 4O4IE 1GD3A 3NUVA 2VKJA 2CLYC 1YIT3 3C98B 2LJLA 3FZWA 4PW8A 1D6ZA 4I4KA 4RNYA 1FA3A 4IT7A 3LG7A 4MHCA 2CLYB 2V7JA 3MYTA 4RNZA 1Q7Y4 4KFEA 2K48A 3LT9A 4K1UA 3K3OA 2YU1A 3ZMZB 3QK6A 5EK3A 2YX9A 3SRZA 1U4QA 1W2ZA 1UI8A 2MTQA 4BTYA 4CQIA 3Q5XA 5JRCB 5FGOA 2ACXA 1OF5B 1NDOB 4GOUA 2QGUA 3VKHA 3SXXA 4WFOA 3B7CA 3I1AA 4CI3B 5JDNA 4OYJA 1U5OA 2WSSV 1VZZA 3DP7A 4BTXA 3ZCIA 5DABA 4FJOA 1IAPA 1WTHA 2YINA 4G2AA 1QUUA 3UNLA 3E0ZA 2LOPA 3N2GE 3GMIA 3OXAA 4AQFC 2HPJA 2VL8A 5JBSA 1RRHA 4X2OA 3FHNA 4C90A 1ZHCA 2LSGA 3QC9A 1WQLB 3CCS3 4TZ4C 3P8CD 2VASA 4N6UA 4U74A 1UX4A 3NBBA 1S35A 2NTYA 3F2EA 2D5UA 4CXWA 3CQXC 1NWMX 3PUGA 2Y6XA 3RYHE 1YVBI 3UTKA 1JKGB 4WHAA 1KK7A 1JJ22 1K41A 3MWZA 2W56A 2JQ5A 2E2UA 4HZBB 3BNBA 1UI7A 2ML6A 3N9QA 3EF8A 3HI7A 3CMLA 3N54B 3N2KE 3LTDA 3MKDA 4MBQA 1BR4A 4KP3C 2GBXB 8CHOA 4R80A 4GYRA 5H6RB 1A67A 1WRDA 3PDYA 3EN8A 2NOXA 3S67A 3J7Yd 3D0TA 4PJLA 2XEPA 1JN5A 1IZNB 1TU5A 3BNEA 4PNIA 4ZS3A 3NRYA 4IPBA 2XFSA 1CEWI 3OYXA 3NZPA 4EOZB 3U1WA 2XH9A 3Q1CA 5JPUA 2YU2A 4HN9A 4XDWA 3KE7A 7STDA 3F57A 2LSKA 1RKYA 3WI3A 2ZL8A 1W7CA 5ELUA 3Q90A 1Y64B 5HWXA 3RKOA 2P0MA 2Q9QA 1YGEA 1AR0A 2YFIB 3FLJA 4NHFA 2LSIA 3ZC1A 3SOYA 3KV4A 2DLRA 3FF2A 3NZQA 2V7IA 2RFRA 1IV7A 4IIJE 2XAHB 4QHOA 3H37A 1JB4A 3NHXA 4IE6A 1YJW3 4GL6A 3EE1A 2CXLA 3OKQA 4HM4B 3ANWA 1OHPA 4J2CA 4PJMA 3MHEA 2BNGA 3DGLA 4MMYB 2LOSA 3HL6A 2MBGA 5JDFA 2G0UA 3EDUA 2IUJA 4NREA 3EUHA 1VQO3 1K8A4 5FXZA 1D0YA 1O7GB 1IJ6A 3N5LA 5CK6A 3AAAB 1G96A 2QA7A 4IDZA 1VQP3 5G2GA 2N1GA 3MPHA 1E3RA 2W56B 1YJN3 2BVLA 5LA6E 1O7NB 3LXUX 2DNXA 2RA1A 4JEHB 1YIJ3 4MFRA 2IW5B 3PS8A 4L8PA 1JNQA 4UF0A 2BDEA 2CHCA 3S27A 5D82A 3VKGA 5EQLA 1W02A 1N9JA 1O7MB 1CYUA 4HTEA 2IC9A 3J7Yq 1DMQA 3LH4A 3EHCA 4QXHB 2ODUA 2OQEC 5JDQA 4ZHQE 2MYSA 4ZM8A 4ZI3C 4HYZA 1OCVA 1K28A 2K0MA 5AYRB 1LVNA 3EDVA 5IEOA 1YD8G 2C5IT 4CDLA 3WODG 4ISTA 1D0XA 5CLKA 4N6TA 1S94A 3RC3A 3NQYA 2X9WA 3U78A 2X67A 3A5XA 2HMNB 2WMNA 3NX0A 1YI23 2W9QA 2WGQA 4N6LA 3C64A 2X68A 1OUNA 4O4JE 2LSJA 1JB2A 2JJ9A 1IT7A 4HE8A 3WAJA 4K90B 2W03A 1HS7A 3KIIA 2V26A 4G1MB 2WM9A 2W2CA 4UF0B 5LGUB 2LT3A 2JMHA 3FKAA 1KQS2 2OA5A 2PG8A 2YEVC 2GBWB 3LOYA 3G16A 2KZ7B 3F14A 1K734 4TN7B 3GWHA 3JUOA 2I59A 5HXRA 2YK0A 1N5HA 4YJ2E 2CFDA 4EV5A 1O7PB 4HKVB 4ERRA 5J2TE 3UUXB 2V7MA 3MK7C 4BA9A 2K9AA 1BR0A 1US7B 2WMOA 4G63A 2OQEA 5AIGA 2Z77A 3GZYB 1SPUA 4P09A 4WBOA 3C4ZA 2W00A 3PE0A 3CPOA 2CFWA 1TP6A 3EC9A 1G73A 2XAGB 2GEYA 5L3EB 5LHHB 3ZN0B 1DMNA 2XUEA 1U5PA 3MZKB 4GYSA 4PAGA 4BAYB 5LHGB 2VKDA 3CCR3 3PUQA 1SHZC 3MACA 5IG0A 4HBRA 2WWUA 3V98A 3G4S3 2KRTA 3CU3A 4OUQA 2CWYA 3SS1A 1WMOA 2JMKA 4YHJA 1ROAA 1W6GA 5JPPA 2KXGA 3J9X1 4H9RC 4PFOA 4IE0A 4KFFA 3H3AA 2LE8A 1CYVA 4MEIA 3C51A 2XRXB 3Q2PA 4GK5E 2L4VA 4AKHA 1FIOA 1SIIA 4BJMA 2KMFA 5IG5A 1UUVB 3SX1A 4N6NB 3N9HA 2ZM8A 2XAJB 1QAKA 3F9SA 4XBTA 1W5ZA 3SOAA 3V99A 5IHYA 5HYAA 4UIGA 1LRZA 2UXNB 3CPW2 2W63A 1OHOA 2LHRA 1FGRA 4FI5A 1NAFA 3SVAA 2CW9A 4X1IE 1UCUA 2C5JA 5JR9C 3FBLA 2HMKB 3T8NA 2EHOB 2HMOB 5FW5A 4X1YE 4XAXB 2K24A 3WOEB 3O1HA 4HM3B 2F99A 3KVBA 5LP6E 3HA4A 4LMIA 1W6YA 1HCIA 4H3UA 3OJAA 4HM1B 2CXFA 2JRKA 4WWUC 1LOXA 3BK9A 1IVVA 5E0OA 4DO0A 4PJNA 3I563 3FG3A 2P0XA 4GB5A 4AKRB 3LYGA 3IF8B 1OH0A 5EK4A 4HKAA 3T8OA 2Z6EA 1IT8A 4KVHA 1W01A 3GZXB 4XBXA 1W00A 4H9PC 2R4IA 4EIWA 3O1JA 3FXDB 2C5KT 3TKLB 3JUNA 1IVUA 3I553 5GONE 1O3XA 4L5GA 2BT3A 5FXVA 3LBXB 3AA6B 4OFZA 2W6JH 3B57A 4RBNA 4YJ3E 4UVAB 2H7VC 3OBVE 4HM7B 1HF8A 1STDA 1HU9A 3ZYKA 1Z1SA 5HXHA 4I55E 1N9EA 3DM8A 5LGTB 2QIYA 4LSOA 3K8PC 3NM7A 2CCQA 3KV6A 1IK3A 3S28A 4Z8XA 3CCM3 4LEHA 5LJNA 3AAIA 1R4CA 5IERA 4QKNA 2BMOB 3WMDA 3KBUA 3RGAA 4FCMA 4MJDA 3IHRA 4NUVA 5L2LA 2Y48B 2IMJA 1IVWA 2W61A 3I0OA 3WA3A 3OV4A 2CWVA 5L3CB 3FF0A 3DY5A 2OCTA 2WAUA 3JUPA 3PUAA 1OF5A 5KP1A 2GU1A 2ZLYA 3HX8A 3X3ZA 5ADXL 3ER7A 3SLUA 4R1KA 5HXSA 3O9XA 3MA9A 2WBLA 2YFLB 2X0LB 4H9NC 3L3PA 4M1PA 5HAXA 3JUMA 4IE4A 1W6CA 3LMLA 3AA0B 2A15A 3KV9A 3ZMVB 3AVSA 3LT8A 3CC73 2INXA 1IQ8A 1Y4KA 4A56A 1TIJA 5JDLA 5FY0A 2CC3A 5HWYA 5CB4E 1VOMA 2WOFA 1Q864 4TV9E 3HIIA 3S29A 4U72A 5KMGP 5A0OB 1M1K4 1HX8A 4PK6A 5AYSC 4O2AE 3L09A 2FNQA 1BUQA 2V1LA 2Z76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O8S A;  4OK0 A; 
#chains in the Genus database with same CATH topology
 4R9K A;  1JB5 A;  2UXC T;  5AQK B;  3EI0 A;  5IWA T;  1B2M A;  5AQH B;  3PYJ A;  5M4Y A;  3DXO A;  3KVA A;  3CKD A;  2W0G A;  2E2T A;  3K3N A;  1RSN A;  1UGH I;  4CZZ B;  2YDS A;  1NU3 A;  3QB5 K;  3JVC A;  4MMX B;  2L9Q A;  1OGZ A;  2BKN A;  5J2U E;  3VRA A;  4HFV A;  4HWD A;  2XGN A;  4HJL B;  2KF5 A;  1E3V A;  4YTP A;  2K54 A;  4A5X A;  3FH1 A;  1M1X B;  4IE5 A;  4O2H A;  1VQN 3;  3K63 A;  1VQM 3;  3FB2 A;  4X62 T;  3AXJ B;  4TWD A;  5D81 A;  3AE8 A;  3GAX A;  3WHO A;  2NW7 A;  2WCA A;  1IQX A;  4WZX A;  1HG2 A;  4AKY A;  3LK2 B;  3CX8 B;  3RYC E;  3KFW X;  5AI1 A;  2EHO C;  1D6U A;  5IYZ E;  4DMW A;  2WZH A;  4H63 V;  2CA5 A;  4K61 A;  2NWB A;  3ZJ2 A;  2DWG A;  3MXZ A;  4HWC A;  1BNF A;  2KF6 A;  1PFP A;  3B8L A;  1JBR A;  1YJ9 3;  1IQY A;  2KSR A;  1RTU A;  6STD A;  1VQ6 3;  1B2U A;  2E9X B;  5IF6 A;  2C11 A;  5J0Z A;  1J5E T;  1BRS A;  1JZD A;  2MC8 A;  3S5C A;  5HEG A;  5LG4 A;  3CCU 3;  2E9X C;  3F7X A;  2CG0 A;  1L5G B;  3Q5W A;  1MIW A;  1AY7 A;  3OWS A;  3CQG B;  4DV3 T;  3ZFZ A;  3EHZ A;  1RGA A;  2I6H A;  3CD6 3;  2BVM A;  1CQS A;  3CNM A;  2ML5 A;  2EHO D;  3T1H T;  1F8N A;  1LOY A;  5LG3 A;  1SJW A;  5AIH A;  5HEO A;  4KFD A;  5AQM B;  2V7K A;  4JI6 T;  5CA0 E;  5EVH A;  3GRD A;  1EUI C;  1SQW A;  2E9X D;  3S4U A;  1AVK A;  5FKY A;  4O8S A;  4UVB B;  3UUM A;  4EBG A;  5KX5 E;  1GY6 A;  3ZJ1 A;  5DJQ C;  2WDQ A;  3PUR A;  2M7O A;  4ORL A;  2FBW A;  2CG1 A;  1BRI A;  4WYK A;  3AAE B;  4JYA T;  1BR2 A;  1GOY A;  2NW9 A;  2P38 A;  2E5V A;  4ASK A;  1MNE A;  2V6Y B;  2M67 A;  5BU4 A;  3U97 A;  3ABV A;  3AXJ A;  3VHL A;  1UUW B;  5HXC A;  1NB5 I;  3UL5 A;  1WR6 A;  3DTO A;  3B4O A;  5HXE A;  1RGG A;  1KNZ A;  1AV4 A;  1BRJ A;  5FP3 A;  1V74 A;  1Q81 4;  2AXD S;  5M19 A;  4H61 A;  4RZM A;  1UX5 A;  3DZL A;  4K0U A;  4YSX A;  3DGN A;  4TX4 A;  3CCL 3;  1B7T A;  4ADZ A;  3IMA B;  4OVM A;  4UEM A;  4AKG A;  4AKZ A;  3E99 A;  3RQU A;  1FUS A;  4BJN A;  4DR1 T;  3D5I A;  4OK0 A;  1XDP A;  2HPL A;  5HEU A;  4WNK A;  5DQV A;  4BL2 A;  1ISK A;  1BNG A;  1UCI A;  2QRX A;  4FCZ A;  3JC6 D;  4FMC A;  5AEU B;  3RRC A;  2X9X A;  4HEA A;  5AQU B;  3R6N A;  2LKG A;  4HM5 B;  4DBQ A;  1BR1 A;  1BRH A;  1ZGX A;  2CKF B;  4QX7 B;  1ZX2 A;  2IA7 A;  1UUR A;  3P4R A;  4JF8 A;  2LKH A;  3RIF A;  1WMP A;  5RNT A;  1TJD A;  3WAK A;  2JDI H;  9RNT A;  4CI1 B;  4MAL A;  4GIW A;  2W9P A;  2CIU A;  1HZ1 A;  2CFL A;  2CX0 A;  4LGQ A;  5FNV E;  4ANJ A;  4BTW A;  3CXC 2;  1M62 A;  4EAH A;  4DV2 T;  3IBP A;  5HCM A;  1STF I;  3K7C A;  1HX1 B;  2VQE T;  2OV9 A;  3ONX A;  1X1Y A;  4KUM B;  2LHN A;  2ZDJ A;  2STD A;  3UL6 A;  3LTC A;  2WGO A;  2B1X B;  3OX9 A;  4CXX A;  3LZA A;  2OLT A;  3CC2 3;  3NM2 A;  2GXF A;  5IEP A;  2OWP A;  5ELJ A;  5JRE A;  4E7S A;  4EYC A;  3GN5 B;  1RCK A;  3DJB A;  1OPY A;  4HZ9 B;  3RH3 A;  3TLT A;  3F40 A;  1FGO A;  2PFV A;  5CGM A;  5AEW B;  3FG1 A;  1SIH A;  1T98 A;  3PTR B;  2V5C A;  4TX5 A;  1LNI A;  2Z7A A;  1XMQ T;  2O9U X;  4PK4 A;  5ABG A;  3R84 B;  4LF6 T;  3RRW A;  1ZO2 A;  5CF2 A;  3PCR A;  4NPP A;  5LHI B;  4I4T E;  1VQ4 3;  2NTX A;  3RYI E;  1MND A;  3X3Y A;  4DR5 T;  3GZR A;  1JN5 B;  3H3M A;  2CK3 H;  1X79 A;  2QA4 3;  3AEE A;  4UVC B;  1HNZ T;  3A76 A;  3FZH B;  2BMQ B;  2XSB A;  4H9S E;  2RGQ A;  2IAK A;  3JAD A;  1OHS A;  1JNZ A;  1UW1 A;  3ZT5 A;  2N9D A;  2CFK A;  1IVX A;  1ULJ B;  5HGR A;  3UQ4 A;  2ACZ A;  4DBR A;  1VQ7 3;  3FSD A;  2ZHX B;  1HNW T;  1BVI A;  2H89 A;  3CPZ A;  2KLQ A;  2XZE A;  3V5U A;  3AEC A;  3SOL A;  3EX9 A;  3FBZ A;  2W67 A;  3EAB A;  1KWI A;  4LF9 T;  2Y74 A;  1MNL A;  3T0U A;  1S5A A;  1WLX A;  3CX7 B;  3KN4 A;  2MOZ A;  1PU4 A;  3A5E A;  5CXO A;  5J1G A;  5AQG B;  5ABH A;  2W04 A;  5BMV E;  1GY5 A;  2VKH A;  4N78 D;  1VQL 3;  3B13 A;  1VQQ A;  1AJ3 A;  3QK9 A;  4DR2 T;  5JDM A;  2K3D A;  3HOH A;  4AI6 A;  1VQ5 3;  1FMV A;  1MGW A;  3LTB A;  1TFK A;  1W0B A;  3ALA A;  3OPC A;  3OWY A;  1GD4 A;  1LOW A;  1D1C A;  4JLE A;  1K9M 4;  3ONJ A;  2XAS B;  1V9D A;  2IDO B;  4XDV A;  3EBT A;  4QWT A;  4L8O A;  1I2E A;  4XB5 A;  2RPA A;  2BG9 A;  3RC8 A;  5JR9 A;  4WBN E;  4FMD A;  1ZEE A;  4LZI A;  4ZXL A;  3K0Z A;  2WOH A;  3OVU A;  3PUX F;  1RN4 A;  2F4Y A;  2ODV A;  1RN7 A;  1HG5 A;  3IEE A;  4EZH A;  3KDS E;  3PV0 F;  1QAF A;  4DV5 T;  2NW8 A;  3ROB A;  2IUK A;  1Q82 4;  5F3J A;  3KSE D;  4KZ1 A;  2VWA A;  3LFM A;  6GSP A;  2P9B A;  4IGU A;  3AE9 A;  4K1V A;  1NO3 A;  3UT5 E;  2HMJ B;  2YOE A;  2UX0 A;  2WU2 A;  5JRC A;  2VVN A;  3L8R A;  2F98 A;  3F7S A;  4B3R T;  4HGA A;  3AA1 B;  2LEH A;  3KV5 A;  3UUN A;  1EKM A;  1NEK A;  2UUB T;  1HFA A;  5FY1 A;  3ETU A;  4WP5 A;  2C0S A;  3K1S A;  4HVN A;  2XQY A;  4H9O C;  4ILA A;  2UU9 T;  4AEQ A;  2RSX A;  1EZ3 A;  2E8I A;  3BLZ A;  3DGY A;  3NBJ A;  4DKI A;  4KMC A;  4O4H E;  1KEY A;  1WYB A;  1GY7 A;  1XZY A;  1OXZ A;  2XQ3 A;  4JBW F;  2XQ7 A;  1DMM A;  5BVB A;  4P0B A;  3ESL A;  1KC8 4;  1R4Y A;  1RJO A;  3PUV F;  1ROV A;  2RP4 A;  3FZK B;  2XSH B;  1HTJ F;  2HN2 A;  1KF6 A;  3DMC A;  2DWK A;  1OWA A;  3PUY F;  4DV4 T;  3ZEF B;  3Q9D A;  2Y73 A;  3CVR A;  1YNV X;  2CRB A;  4X20 E;  3RI5 A;  3EJV A;  1FMW A;  5BXQ A;  1LQG C;  3ZN1 B;  4PFP A;  2PNC A;  4MMZ B;  3A7M A;  3AB3 B;  2ZM2 A;  2Y8D A;  5AIF A;  5EK2 A;  3GSP A;  4HFH A;  2ZMA A;  5BIR A;  2BU4 A;  3G6E 3;  1YGW A;  2LRL A;  2BG9 C;  3WDG B;  2FJD A;  1HKX A;  4HM8 B;  4ILF A;  2XFT A;  5LXT E;  2P05 A;  3G0K A;  3NBX X;  2W0Q A;  5LOV E;  3O1I A;  1M9G A;  1UGO A;  5AQP B;  5L4E A;  5FVK A;  3GN5 A;  3EQQ B;  3PXM A;  3X40 A;  3PU8 A;  5L3D B;  4QXB B;  4YLH A;  3I0Y A;  3IPT A;  1J2B A;  5CF1 A;  3QRD A;  3C4W A;  3JC6 C;  3RGR A;  2OOV A;  1BGS A;  4HFC A;  2L8K A;  4I43 B;  2PBI A;  2HHH T;  1I0X A;  4YSZ A;  2WO0 A;  1ZV4 X;  2GK9 A;  5FY7 A;  3BB9 A;  3TDG A;  1UGI A;  2IUB A;  4EXT A;  3CNX A;  7RNT A;  2OTL 3;  3Q2M A;  4DR3 T;  4KI0 F;  3PGB A;  1B3S A;  1W4N A;  3LK3 B;  3I9W A;  5FYM A;  1O7H B;  5LMN T;  2DCF A;  2JIW A;  2JQK A;  3V92 A;  3AEF A;  1I94 T;  5ABF B;  5F8P A;  2VVS A;  3NV0 A;  1Z0P A;  3CCJ 3;  5HEH A;  3ZPO A;  3U3I A;  2FJA A;  1W09 A;  3G71 3;  3P7I A;  4DV0 T;  1T2I A;  2C4B A;  1ULI B;  2KWI B;  2YDR A;  2OOV C;  4FMA A;  1UUS A;  2WB5 A;  2X0H A;  2P09 A;  1VCT A;  1B2S A;  3L0R A;  3MJX A;  4AKI A;  3VF1 A;  2BZB A;  2FJB A;  3ZMU B;  2LLY A;  2A3D A;  2GSP A;  3CK6 A;  1NB3 I;  1BAN A;  4LFC T;  4XM4 A;  3WA2 X;  5JDH A;  2AE9 A;  1WCR A;  4EB6 E;  1X1W A;  1N8Q A;  4FR9 A;  4ZI2 C;  2QYW A;  3K3Q C;  2XQA A;  4LF8 T;  2MF7 A;  3ZT6 A;  1I8V A;  1RNB A;  4NUU A;  4IT4 A;  3I9Y A;  3NBR A;  1I3I A;  3A8Y C;  5KDM C;  2CWU A;  3UU5 A;  2D0U A;  5JVD E;  5IW9 A;  2MAW A;  3DGO A;  1UUG B;  5CA1 E;  4ZOL E;  2PJQ A;  3RQW A;  4ILU A;  5AQQ B;  3NWI A;  3PJA J;  3ZLI A;  2HH7 A;  1NNV A;  2CM0 A;  4ISS A;  3KZT A;  1V57 A;  1B27 A;  2VB6 A;  4TV8 E;  3HKB E;  2ZM0 A;  4QH4 A;  5KP3 A;  2Z6B A;  1VRB A;  1FYS A;  4UV9 B;  3ECF A;  3NXJ A;  2DL1 A;  1ZKE A;  2E2V A;  2CWT A;  2HML B;  5C2T A;  4HM2 B;  3SED A;  4WYV A;  2XJ7 A;  4NXN T;  2O3O A;  3ZMS B;  1I0V A;  1GMR A;  4JI0 T;  3PJA A;  1US1 A;  4R9L A;  4N6M A;  5FXX A;  3EBY A;  5C8Y E;  1TFO A;  1IU7 A;  1YQ4 A;  1EQK A;  3N9N A;  2W2U A;  5JDG A;  2KWH A;  3FCS B;  2V1L A;  4J8T A;  3H51 A;  3C50 A;  4N6O B;  4DV7 T;  3P50 A;  5DRV A;  3UFE A;  2BHM A;  4N3V A;  3AHS A;  2BMR B;  3KIN B;  4UXN B;  2DHR A;  3N9L A;  1ASK A;  2WU5 A;  5TAO A;  1JKG A;  3QUJ A;  1IJ5 A;  2V7L A;  1JV2 B;  2Q07 A;  3VGN A;  2UXB T;  1E1H B;  1MMN A;  3IA3 A;  1Q42 A;  1QVF 2;  4GKK T;  3KKG A;  1JRQ A;  2BBH A;  4F6R C;  1LVF A;  1LXE A;  1GOV A;  2UGI A;  3E22 E;  3MG1 A;  3CCE 3;  1QVG 2;  2D0T A;  5JTG A;  1T8B A;  1HR0 T;  2M6B A;  4EZ4 A;  2X51 A;  4DR6 T;  2SBL A;  4QXC B;  3MSO A;  1FGM A;  4STD A;  2QEX 3;  1U8C B;  3FZL B;  1S72 3;  1YHQ 3;  4I5Q A;  3F8X A;  3ZYL A;  1Q40 A;  1EA2 A;  4J9A A;  1MIY A;  1WYC A;  3VR8 A;  4DID B;  3MKI A;  2H3R A;  3C4X A;  3EAM A;  2X9Y A;  4CN4 A;  3AE3 A;  1QJG A;  3CME 3;  3X41 A;  1N36 T;  3WR2 A;  5A1L A;  4LF7 T;  1LKX A;  4H63 H;  3E08 A;  4IHJ E;  1VQK 3;  3ZMT B;  1FGT A;  3HK4 A;  4HM6 B;  2W62 A;  4QWN B;  1NWW A;  2DI4 A;  3EVY A;  3H3H A;  2KND A;  2XAQ B;  3IJE B;  3KFQ C;  3NRX A;  4DV1 T;  4JRF A;  2WQY A;  4OYK A;  4DND A;  4H9Q C;  5CFB A;  4CPK A;  1BNI A;  1Q9E A;  2BO9 B;  4IE7 A;  1X1U A;  5LNK A;  2GEX A;  2YFJ B;  3M65 A;  2LQV A;  3HKE E;  5L3G B;  3D3L A;  1LVK A;  3CMA 3;  4FMB A;  2CWO A;  3G06 A;  4U2Z A;  1N5P A;  3Q3F A;  3SYU A;  3AGN A;  1DVD A;  2NP9 A;  3ANW B;  5AQR B;  1IBK T;  1MMA A;  3HIG A;  1WMN A;  4IIA A;  2KIN B;  5LJM A;  4J5G A;  1B2Z A;  3DGM A;  1IDP A;  2KF4 A;  1UCJ A;  3OW2 2;  5L3B B;  2MPK A;  2CE7 A;  1TUH A;  3OWU A;  2D42 A;  1A2K A;  1GSP A;  3CQC B;  2ES0 A;  5IUX A;  1GMP A;  1N33 T;  2A2F X;  2RBI A;  2XQ9 A;  1FUW A;  1KSI A;  4X65 T;  2CFG A;  4CN1 A;  3N9M A;  1FEW A;  5AFU L;  3X42 A;  3OYZ A;  2AAD A;  4CXY A;  4MLK A;  3AMO B;  3RF1 A;  4DMV A;  1N32 T;  5H6Q B;  3STD A;  1T2H A;  1BU4 A;  1PYL A;  4XZC A;  1Q40 B;  3K9M C;  3UJM A;  2AAE A;  3NQZ A;  1MIV A;  2UXX B;  4C91 A;  1Z8U A;  4NXM T;  2XF3 A;  2OTJ 3;  3MG2 A;  4X2H A;  3KBT A;  5LC6 A;  3T8U A;  1B21 A;  1D1A A;  2IC6 A;  2D1W A;  2H0I A;  2PZV A;  3FG4 A;  2X9H A;  5KP4 A;  2KF3 A;  2UUC T;  2BG9 E;  3ZC0 A;  3RHW A;  1IV9 A;  1I3F A;  4Z91 A;  2XR8 B;  1C54 A;  1QSD A;  5JR9 B;  4EXR A;  3I0Q A;  5LBM A;  4PK5 A;  5IG4 A;  4JI3 T;  5AQT B;  2F86 B;  4U3C A;  5EEO A;  1N34 T;  3BQK A;  5C3J A;  3AED A;  3VSY A;  4YSY A;  1RLS A;  1GS3 A;  3BNC A;  5TGN A;  1A2V A;  4Q25 A;  2XQ6 A;  4X5T A;  1RGC A;  1MGR A;  4EYY R;  4YFS A;  4O4L E;  1RRL A;  5IEN A;  2Q9Q B;  5ETW A;  3ETV A;  4LFB T;  4ZZC A;  1RGH A;  4B6X A;  4AQG A;  2PTF A;  3VR9 A;  1E97 A;  2X66 A;  1QAL A;  3V5S A;  3D9R A;  4LFA T;  4AIU A;  4L7K A;  1TRQ A;  4FCJ A;  5DRE A;  4WW0 A;  3MG3 A;  3PUW F;  4KBM B;  4AXP A;  4UV8 B;  2GU3 A;  1RNT A;  4EEB A;  3N9O A;  3BQI A;  1YKE B;  3N2O A;  2J8X B;  1XMO T;  1J1J A;  4HWH A;  1N8R 4;  3LJC A;  1GQE A;  4UEL A;  4XBF B;  2VK9 A;  4L0R A;  2J1D G;  2CH9 A;  1T72 A;  2Q9Q D;  5FL1 A;  5FXW A;  2LYX A;  1W0A A;  4ZI3 D;  1JBS A;  3D5G A;  1GYB A;  1UDI I;  3HKD E;  3HR0 A;  4EYU A;  1X9B A;  1V58 A;  2CEA A;  5LMU T;  5LGN B;  3LBX A;  2HMM B;  5D83 A;  3CCV 3;  2LM9 A;  4BL3 A;  3CWZ B;  1YKH B;  2F5M A;  3T1Y T;  1QMA A;  2CHO A;  1CHU A;  4JUY A;  3ZKR A;  4XBY A;  3CX6 B;  1O7W B;  2E9X A;  2QGS A;  1FZU A;  2WDV A;  2LSY A;  1C7H A;  4B3M T;  1A90 A;  5FVL A;  1OED A;  3M8C A;  6RNT A;  3N8B A;  3B4P A;  5KXJ A;  2B24 B;  3F8H A;  2BS3 A;  3FXE B;  2HOH A;  5LBQ B;  4EV2 A;  3VU7 H;  3RGL A;  2L3L A;  1BNJ A;  2JPF A;  2XSO B;  4KX6 A;  2EHO A;  3ZCJ A;  7GSP A;  1DVC A;  3JUQ A;  4LMK A;  1KD1 4;  4V1A v;  5EZY E;  1HYF A;  2XHE B;  3CCQ 3;  3PCS A;  4AQY T;  3EN1 B;  4NPB A;  3DH2 A;  3HZP A;  4TUY E;  4ZI7 E;  1T5Y A;  3GA8 A;  1UCL A;  4ZEY A;  5STD A;  2A9U A;  1YW0 A;  3P4P A;  2FGT A;  1W2B 2;  4U13 A;  1SA0 E;  4O02 B;  3ZST A;  4L9I A;  2RCD A;  3PU3 A;  2H7O A;  5FL0 A;  1LNH A;  1EG9 B;  2N2N A;  2I9W A;  2A72 A;  3BND A;  2XTL A;  1LOV A;  3KSP A;  1H7C A;  1WNH A;  4U31 A;  4QX8 B;  2CXD A;  1VQ8 3;  3KCH A;  5JQG E;  1G8X A;  4AKL A;  4PJJ A;  3BQL A;  4QH5 A;  2IIU A;  3X3X A;  1BNS A;  5AQJ B;  3LK4 2;  1D6Y A;  3TLV A;  3GWR A;  3UUL A;  1OGX A;  4X1K E;  2KXP B;  3FGY A;  4R4K A;  3N9P A;  4DVD A;  3LTA A;  2H0G A;  1BNE A;  2XGL A;  4PEJ A;  4CI2 B;  2KT9 A;  2VKO A;  4IDN A;  3NV0 B;  4HM0 B;  1OAC A;  4CN6 A;  5ABF A;  2VL0 A;  1MMD A;  1NJI 4;  1I2G A;  1FGQ A;  2XAF B;  5AII A;  3RIU A;  1CUN A;  2V8S V;  1D1B A;  3EB8 A;  3PUS A;  3W15 B;  3RDE A;  4Q53 A;  2K3W A;  4ZI2 D;  1MMG A;  4A98 A;  3RX6 A;  4ZS2 A;  4JI8 T;  5L3F B;  4OHF A;  5I97 A;  3AVR A;  3P4Q A;  5LCY A;  3UB1 A;  3ZYM A;  2C10 A;  3RYF E;  5DQW A;  1VQ9 3;  3SWH A;  3F31 A;  2B1E A;  4U33 A;  2Q9Q C;  1LQM B;  4E7Z A;  1L0V A;  4O3V A;  4EC6 A;  3LDQ B;  1T7S A;  1YXR A;  3WOF B;  4O2B E;  2CPT A;  4U7Y A;  2V1D B;  1DU2 A;  3JAF A;  4GHO A;  3HKC E;  4WYK B;  4U7I A;  4N6V 0;  3O8Y A;  3AE4 A;  1WFD A;  1D0Z A;  4CCV A;  2XQ4 A;  4AQF A;  1MOL A;  4I50 E;  3QNU A;  5LC7 A;  3SFD A;  3GZB A;  5IG3 A;  1JBT A;  2CMR A;  3K5T A;  4P0A A;  5JH7 E;  3HI2 A;  4JEU B;  3CC4 3;  2KCD A;  2JQQ A;  1M90 4;  3AA7 B;  5LYJ E;  5M1A A;  3O4X E;  3G8Z A;  1YQ3 A;  2I0M A;  4GK0 E;  1AVL A;  2SPC A;  2FXT A;  3PZW A;  2XM1 A;  2D2S A;  1BOX A;  3RPU A;  4TWF A;  3DUK A;  2K5B B;  5FMN A;  1DYU A;  4F8H A;  2ZM6 T;  3AMO A;  4O4I E;  1GD3 A;  3NUV A;  2VKJ A;  2CLY C;  1YIT 3;  4IDO A;  3C98 B;  2LJL A;  3FZW A;  4PW8 A;  1D6Z A;  1ZOY A;  4RNT A;  4I4K A;  4RNY A;  1FA3 A;  4IT7 A;  3LG7 A;  4MHC A;  2CLY B;  1BSE A;  2V7J A;  1TTO A;  3MYT A;  4RNZ A;  1Q7Y 4;  5L4H A;  1VCS A;  4KFE A;  2K48 A;  3LT9 A;  4K1U A;  3TLS A;  3K3O A;  2UUG C;  1NEN A;  2YU1 A;  3ZMZ B;  3QK6 A;  5EK3 A;  4U2Y A;  2YX9 A;  3SRZ A;  1U4Q A;  1UI8 A;  1W2Z A;  2MTQ A;  1IBL T;  4BTY A;  5AQI B;  4CQI A;  3Q5X A;  3OTO T;  5JRC B;  4KT3 B;  5FGO A;  2ACX A;  1OF5 B;  2QVA A;  1NDO B;  1E7P A;  4GOU A;  2XM2 A;  1XNR T;  3VKH A;  2QGU A;  3AE2 A;  4GKJ T;  5GSP A;  4WFO A;  3SXX A;  3B7C A;  3I1A A;  4CI3 B;  5JDN A;  4OYJ A;  1U5O A;  2WSS V;  1VZZ A;  3DP7 A;  4BTX A;  3ZCI A;  5DAB A;  4FJO A;  3ZG0 A;  1IAP A;  1OED E;  1WTH A;  2YIN A;  4G2A A;  1QUU A;  1BSB A;  3UNL A;  2NR4 A;  3E0Z A;  2LOP A;  2E5L T;  3N2G E;  3UUB A;  3GMI A;  3OXA A;  4AQF C;  2HPJ A;  2VL8 A;  3FZM B;  5JBS A;  1RRH A;  4X2O A;  3UU6 A;  1RGL A;  3FHN A;  4IL9 A;  4C90 A;  1ZHC A;  3D4A A;  2LSG A;  3QC9 A;  1WQL B;  2X0Y A;  3CCS 3;  4TZ4 C;  3P8C D;  2VAS A;  4LML A;  4N6U A;  1MWT A;  3VRB A;  4DR4 T;  4U74 A;  1UX4 A;  4ILC A;  3NBB A;  1S35 A;  1E2A A;  2NTY A;  3F2E A;  2D5U A;  4CXW A;  2WY2 A;  3CQX C;  1NWM X;  4JI2 T;  3JCF A;  3PUG A;  1XNQ T;  2Y6X A;  3RYH E;  1YVB I;  3UTK A;  1JKG B;  4WHA A;  1KK7 A;  1JJ2 2;  1K41 A;  3MWZ A;  2W56 A;  2JQ5 A;  2J47 A;  2E2U A;  4HZB B;  4DV6 T;  3BNB A;  4K0K T;  1UI7 A;  2ML6 A;  3N9Q A;  3EF8 A;  8RNT A;  3HI7 A;  2JQ9 A;  3CML A;  3N2K E;  3N54 B;  5HEJ A;  5G1K A;  3LTD A;  3MKD A;  4MBQ A;  1BR4 A;  4KP3 C;  4DR7 T;  2GBX B;  4YXD A;  3UQ7 A;  1B20 A;  2FUP A;  8CHO A;  1AQZ A;  4R80 A;  4GYR A;  4JI1 T;  5H6R B;  2XQ8 A;  1A67 A;  1WRD A;  3PDY A;  3EN8 A;  2NOX A;  3S67 A;  3J7Y d;  3D0T A;  2UXD T;  4PJL A;  2XEP A;  1JN5 A;  1IZN B;  3Q5D A;  2R41 A;  3ZSS A;  1TU5 A;  3BNE A;  4PNI A;  4ZS3 A;  1G02 A;  3NRY A;  4HOH A;  4IPB A;  2XFS A;  2BBJ A;  1CEW I;  3AEA A;  3OYX A;  3NZP A;  4IL4 A;  1RHL A;  4EOZ B;  3U1W A;  2CBJ A;  2XH9 A;  3Q1C A;  5JPU A;  2YU2 A;  4HN9 A;  4XDW A;  4X66 T;  3KE7 A;  7STD A;  3F57 A;  4IDQ A;  2LSK A;  1RKY A;  2W66 A;  3WI3 A;  2ZL8 A;  5BR8 T;  4YTM A;  1DE3 A;  2F56 A;  1W7C A;  5ELU A;  3Q90 A;  1Y64 B;  4TWH A;  5HWX A;  3RKO A;  2P0M A;  2Q9Q A;  1YGE A;  1AR0 A;  2YFI B;  3FLJ A;  4NHF A;  3NKZ A;  2LSI A;  3ZC1 A;  3SOY A;  3KV4 A;  2DLR A;  3FF2 A;  3NZQ A;  3AHW A;  2V7I A;  2RFR A;  1IV7 A;  2J62 A;  4IIJ E;  2XAH B;  1SUM B;  3H37 A;  4QHO A;  1JB4 A;  3NHX A;  4IE6 A;  1YJW 3;  1MWS A;  4GL6 A;  3EE1 A;  2CXL A;  4YHH T;  3OKQ A;  3ANW A;  4DUY T;  4HM4 B;  1OHP A;  1MWU A;  4J2C A;  4PJM A;  3MHE A;  2BNG A;  3DGL A;  4MMY B;  2LOS A;  4EW5 A;  3HL6 A;  2MBG A;  5JDF A;  3RKG A;  2G0U A;  3EDU A;  2IUJ A;  4NRE A;  4JI4 T;  1IBM T;  3EUH A;  1VQO 3;  1K8A 4;  3UU4 A;  5FXZ A;  3RIU C;  1D0Y A;  1O7G B;  5HOH A;  1IJ6 A;  2IML A;  3N5L A;  4LYL B;  5CK6 A;  3AAA B;  1G96 A;  2QA7 A;  4IDZ A;  1VQP 3;  5G2G A;  4IDP A;  2N1G A;  3MPH A;  1E3R A;  4YY3 T;  2W56 B;  1YJN 3;  2BVL A;  1FUT A;  5AQV B;  4ILB A;  5LA6 E;  1O7N B;  3LXU X;  2DNX A;  2CBI A;  2V5D A;  2IHR 1;  2RA1 A;  1HNX T;  3ONL C;  2D9D A;  4JEH B;  1YIJ 3;  4AIS A;  4MFR A;  2IW5 B;  1KNR A;  3PS8 A;  4L8P A;  2J4G A;  3M3Z B;  1JNQ A;  4UF0 A;  2BDE A;  2CHC A;  3S27 A;  5D82 A;  3VKG A;  5EQL A;  1W02 A;  1N9J A;  1O7M B;  4UR9 A;  1CYU A;  4HTE A;  2IC9 A;  3J7Y q;  1DMQ A;  3LH4 A;  3EHC A;  4QXH B;  2ODU A;  2OQE C;  3FZF B;  3UFG A;  1KFY A;  5JDQ A;  4ZHQ E;  2MYS A;  4ZM8 A;  4ZI3 C;  4HYZ A;  1OCV A;  4B3T T;  4KHP T;  1K28 A;  4LF4 T;  2K0M A;  5AYR B;  1LVN A;  3EDV A;  2XPK A;  5IEO A;  1YD8 G;  2C5I T;  3SFE A;  4CDL A;  3WOD G;  1BRN L;  2E2A A;  4IST A;  1D0X A;  5CLK A;  4N6T A;  1LRA A;  1S94 A;  1SAR A;  3RC3 A;  1WR0 A;  3NQY A;  2X9W A;  3U78 A;  2X67 A;  3A5X A;  2HMN B;  3QB5 A;  2WMN A;  4IRE A;  3NX0 A;  1YI2 3;  2W9Q A;  2WGQ A;  1BNR A;  4BIR A;  4N6L A;  3C64 A;  2X68 A;  1OUN A;  4O4J E;  2LSJ A;  1JB2 A;  1BIR A;  5HCJ A;  2JJ9 A;  3QOF A;  1IT7 A;  2VQF T;  4HE8 A;  3WAJ A;  2JQH A;  4K90 B;  2W03 A;  2F4V T;  1HS7 A;  3KII A;  2CHN A;  2V26 A;  4G1M B;  2WM9 A;  1I6Z A;  2W2C A;  4UF0 B;  5LGU B;  2LT3 A;  4J5K A;  2JMH A;  3AE1 A;  3FKA A;  2OA5 A;  1KQS 2;  4YT0 A;  2PG8 A;  2YEV C;  2GBW B;  1QLB A;  5LB7 B;  2YN6 A;  3LOY A;  1BSC A;  3G16 A;  2KZ7 B;  1BRK A;  3F14 A;  1K73 4;  5AQL B;  3L39 A;  5CJ5 A;  4TN7 B;  3GWH A;  3JUO A;  4HFI A;  2I59 A;  2BG9 B;  5HXR A;  2YK0 A;  1N5H A;  1GMQ A;  1BSD A;  4YJ2 E;  1W9R A;  2CFD A;  1J5W A;  4EV5 A;  1O7P B;  4HKV B;  4OX9 T;  2W4X A;  4ERR A;  5J2T E;  2YDQ A;  2UUA T;  4ZZB A;  3UUX B;  2V7M A;  3MK7 C;  4BA9 A;  2K9A A;  1BR0 A;  1US7 B;  2WMO A;  4G63 A;  3B5M A;  4YTN A;  1Q7H A;  1SE7 A;  2KAA A;  2OQE A;  5AIG A;  2Z77 A;  1X1X A;  3GZY B;  1SPU A;  4P09 A;  4WBO A;  2BS4 A;  3C4Z A;  2W00 A;  3PE0 A;  3CPO A;  2CFW A;  1TP6 A;  3TLW A;  5AQF B;  3AEB A;  4I0U A;  3EC9 A;  1G73 A;  2XAG B;  3LSV A;  4LF5 T;  2GEY A;  5L3E B;  2F5W A;  1PY3 A;  5LHH B;  1B2X A;  3ZN0 B;  1DMN A;  2XUE A;  1U5P A;  3MZK B;  4GYS A;  4PAG A;  2V6X A;  4BAY B;  2WDR A;  5LHG B;  2VKD A;  3CCR 3;  3PUQ A;  1SHZ C;  4B3S T;  2ZA4 A;  3MAC A;  5IG0 A;  2LM2 A;  4HBR A;  2WWU A;  3V98 A;  1MWR A;  1BUJ A;  3G4S 3;  2KRT A;  1RCL A;  2XQ5 A;  4P1N A;  3CU3 A;  4OUQ A;  2CWY A;  3SS1 A;  4JI5 T;  1WMO A;  2JMK A;  4YHJ A;  1ROA A;  1UCK A;  1W6G A;  5JPP A;  2KXG A;  3J9X 1;  4H9R C;  4PFO A;  4IE0 A;  4KFF A;  4DUZ T;  3H3A A;  2LE8 A;  4Z90 A;  1CYV A;  4MEI A;  3C51 A;  3X1D A;  2XRX B;  3Q2P A;  4GK5 E;  4NIQ A;  2L4V A;  1KNP A;  4AKH A;  1FIO A;  2CX1 A;  2WP9 A;  3RNT A;  1SII A;  4BJM A;  2KMF A;  5IG5 A;  4HWF A;  2WS3 A;  1UUV B;  3SX1 A;  4N6N B;  3D79 A;  3N9H A;  2ZM8 A;  2XAJ B;  1QAK A;  1OED C;  3F9S A;  4XBT A;  1YVS A;  1W5Z A;  3SOA A;  3V99 A;  5IHY A;  3AE7 A;  5HYA A;  4UIG A;  3BU4 A;  1OED B;  1FW7 A;  1LRZ A;  2WWV A;  2UXN B;  3RLF F;  3CPW 2;  2R6G F;  3UU8 A;  2W63 A;  1OHO A;  1GOU A;  2LHR A;  1FGR A;  4FI5 A;  1NAF A;  3SVA A;  1BSA A;  2CW9 A;  4X1I E;  1UCU A;  1EEJ A;  2LRK A;  2C5J A;  5JR9 C;  3FBL A;  1RN1 A;  2HMK B;  3T8N A;  2EHO B;  2HMO B;  4EV6 A;  5FW5 A;  4X1Y E;  4XAX B;  2K24 A;  4KHZ F;  4HAA A;  1RDS A;  3WOE B;  3O1H A;  2F99 A;  3KVB A;  4HM3 B;  1CH0 A;  2BKO A;  5LP6 E;  3HA4 A;  4LMI A;  1W6Y A;  1HCI A;  4H3U A;  4BU4 A;  3OJA A;  5AQN B;  4HM1 B;  2WZI A;  2CXF A;  2JRK A;  4WWU C;  1LOX A;  2V6Y A;  3BK9 A;  1IVV A;  2YKS A;  5E0O A;  4DO0 A;  4PJN A;  3I56 3;  3FG3 A;  4X64 T;  2P0X A;  4GB5 A;  4AKR B;  3LYG A;  3IF8 B;  1OH0 A;  5EK4 A;  4HKA A;  3T8O A;  3RIA A;  2RNT A;  2Z6E A;  1IT8 A;  4KVH A;  2XY8 B;  1W01 A;  3GZX B;  4XBX A;  1W00 A;  4H9P C;  2R4I A;  1UK5 A;  4A97 A;  4EIW A;  1M7K A;  3O1J A;  3FXD B;  2C5K T;  3TKL B;  3JUN A;  1IVU A;  3I55 3;  3CIR A;  1RGK A;  2HN1 A;  5GON E;  1O3X A;  4L5G A;  2BT3 A;  5FXV A;  3ZG5 A;  3LBX B;  4JV5 T;  3AA6 B;  4OFZ A;  2W6J H;  3B57 A;  4RBN A;  1G0T A;  4JI7 T;  4YJ3 E;  4UVA B;  2H7V C;  3OBV E;  4HM7 B;  1HF8 A;  1STD A;  1DET A;  1HU9 A;  3ZYK A;  5F5W A;  1Z1S A;  5HXH A;  4HFB A;  4I55 E;  1N9E A;  2L1S A;  3DM8 A;  5LGT B;  2QIY A;  1ZS7 A;  4LSO A;  1JZO A;  3K8P C;  3NM7 A;  2CCQ A;  2B76 A;  3AGO A;  3KV6 A;  1IK3 A;  3S28 A;  1JNR A;  1XWM A;  4Z8X A;  3CCM 3;  4EED A;  5M18 A;  5AQO B;  1RMS A;  2BIR A;  4LEH A;  5LJN A;  3AAI A;  4TNV A;  1R4C A;  5IER A;  4QKN A;  4CJN A;  3Q5E A;  4TNW A;  3URP A;  2BMO B;  1IYY A;  3WMD A;  1A2P A;  5AQS B;  3TLU A;  2BKP A;  1BAO A;  3KBU A;  3RGA A;  4FCM A;  4MJD A;  3NVO A;  4GSP A;  1I70 A;  4LMJ A;  2SAR A;  3IHR A;  3AE6 A;  4NUV A;  3AEG A;  5L2L A;  3P4S A;  2Y48 B;  2IMJ A;  3UU3 A;  1IVW A;  2W61 A;  3I0O A;  3WA3 A;  2FJE A;  4QH1 A;  3OV4 A;  5G1L A;  2CWV A;  5L3C B;  3FF0 A;  3DY5 A;  4HWI B;  2OCT A;  2WAU A;  3JUP A;  1I2F A;  2M6I A;  2VUR A;  3PUA A;  2H0H A;  1OF5 A;  4COF A;  4EGW A;  5KP1 A;  2GU1 A;  2ZLY A;  3HX8 A;  1FJG T;  2BS2 A;  2H88 A;  1TRP A;  3X3Z A;  5ADX L;  3ER7 A;  1T3B A;  1R8I A;  2IY2 A;  4R1K A;  3SLU A;  5HXS A;  3AE5 A;  3O9X A;  3BIR A;  3MA9 A;  2WBL A;  2YFL B;  3P4W A;  5ABE A;  2X0L B;  4H9N C;  3ZT7 A;  3L3P A;  1RGF A;  4M1P A;  5HAX A;  1XDO A;  3JUM A;  4IE4 A;  1W6C A;  2IYJ A;  3LML A;  3AA0 B;  2A15 A;  3PUZ F;  1RGE A;  3KV9 A;  3ZMV B;  3AVS A;  3LT8 A;  3CC7 3;  2INX A;  1IQ8 A;  1Y4K A;  4A56 A;  1TIJ A;  5JDL A;  1Y01 A;  5FY0 A;  2CC3 A;  5HWY A;  5CB4 E;  1VOM A;  2WOF A;  1ZP0 A;  1Q86 4;  4TV9 E;  3HII A;  3S29 A;  4HFE A;  2XSA A;  4U72 A;  5KMG P;  5A0O B;  1M1K 4;  1HX8 A;  4PK6 A;  5L47 A;  5AYS C;  4HFD A;  1BRG A;  4O2A E;  3L09 A;  2FNQ A;  1BUQ A;  3JAE A;  2Z76 A; 
#chains in the Genus database with same CATH homology
 4R9K A;  1JB5 A;  3PYJ A;  5M4Y A;  3DXO A;  3KVA A;  3CKD A;  2W0G A;  2E2T A;  3K3N A;  4CZZ B;  1NU3 A;  3JVC A;  4MMX B;  2L9Q A;  1OGZ A;  5J2U E;  4HFV A;  2XGN A;  4HJL B;  1E3V A;  2K54 A;  3FH1 A;  1M1X B;  4IE5 A;  4O2H A;  1VQN 3;  3K63 A;  1VQM 3;  3FB2 A;  5D81 A;  3GAX A;  2NW7 A;  1IQX A;  1HG2 A;  4AKY A;  3LK2 B;  3CX8 B;  3RYC E;  3KFW X;  5AI1 A;  2EHO C;  1D6U A;  5IYZ E;  4DMW A;  4H63 V;  2CA5 A;  4K61 A;  2NWB A;  3ZJ2 A;  2DWG A;  3MXZ A;  3B8L A;  1PFP A;  1YJ9 3;  1IQY A;  6STD A;  1VQ6 3;  2E9X B;  5IF6 A;  2C11 A;  2MC8 A;  3S5C A;  5LG4 A;  3CCU 3;  2E9X C;  3F7X A;  2CG0 A;  1L5G B;  3Q5W A;  1MIW A;  3OWS A;  3CQG B;  3CD6 3;  2BVM A;  1CQS A;  3CNM A;  2ML5 A;  2EHO D;  1F8N A;  5AIH A;  1SJW A;  4KFD A;  2V7K A;  5CA0 E;  5EVH A;  3GRD A;  1SQW A;  2E9X D;  3S4U A;  1AVK A;  4O8S A;  4UVB B;  3UUM A;  4EBG A;  5KX5 E;  1GY6 A;  3ZJ1 A;  5DJQ C;  3PUR A;  2M7O A;  4ORL A;  2CG1 A;  4WYK A;  3AAE B;  1BR2 A;  2P38 A;  2NW9 A;  4ASK A;  1MNE A;  2M67 A;  3U97 A;  3VHL A;  1UUW B;  1NB5 I;  5HXC A;  3UL5 A;  1WR6 A;  3DTO A;  3B4O A;  5HXE A;  1KNZ A;  1AV4 A;  5FP3 A;  1V74 A;  1Q81 4;  4H61 A;  4RZM A;  1UX5 A;  3DZL A;  4K0U A;  3DGN A;  4TX4 A;  3CCL 3;  1B7T A;  4ADZ A;  3IMA B;  4OVM A;  4UEM A;  4AKG A;  4AKZ A;  3E99 A;  4BJN A;  4OK0 A;  2HPL A;  4WNK A;  5DQV A;  1ISK A;  4FCZ A;  3JC6 D;  4FMC A;  5AEU B;  3RRC A;  2X9X A;  4HEA A;  3R6N A;  4HM5 B;  4DBQ A;  1BR1 A;  2CKF B;  4QX7 B;  1ZX2 A;  2IA7 A;  4JF8 A;  1WMP A;  3WAK A;  2JDI H;  4CI1 B;  4MAL A;  4GIW A;  2W9P A;  2CIU A;  2CFL A;  4LGQ A;  5FNV E;  4ANJ A;  4BTW A;  3CXC 2;  4EAH A;  3IBP A;  1STF I;  3K7C A;  3ONX A;  3UL6 A;  4KUM B;  2LHN A;  2ZDJ A;  2STD A;  3LTC A;  2WGO A;  2B1X B;  3OX9 A;  4CXX A;  3LZA A;  3CC2 3;  3NM2 A;  2GXF A;  5IEP A;  2OWP A;  5ELJ A;  5JRE A;  4E7S A;  4EYC A;  3GN5 B;  3DJB A;  1OPY A;  4HZ9 B;  3RH3 A;  3F40 A;  1FGO A;  2PFV A;  5AEW B;  3FG1 A;  1SIH A;  1T98 A;  3PTR B;  4TX5 A;  2Z7A A;  2O9U X;  4PK4 A;  3R84 B;  3RRW A;  1ZO2 A;  5CF2 A;  3PCR A;  5LHI B;  4I4T E;  1VQ4 3;  2NTX A;  3RYI E;  1MND A;  3X3Y A;  3GZR A;  1JN5 B;  2CK3 H;  1X79 A;  2QA4 3;  4UVC B;  3A76 A;  2BMQ B;  4H9S E;  2RGQ A;  2IAK A;  1OHS A;  1UW1 A;  2N9D A;  2CFK A;  1IVX A;  1ULJ B;  5HGR A;  4DBR A;  1VQ7 3;  3FSD A;  3CPZ A;  2KLQ A;  3V5U A;  3SOL A;  3EX9 A;  3FBZ A;  1KWI A;  2Y74 A;  1MNL A;  3T0U A;  1S5A A;  1WLX A;  3CX7 B;  3KN4 A;  2MOZ A;  1PU4 A;  5CXO A;  5J1G A;  2W04 A;  5BMV E;  1GY5 A;  2VKH A;  4N78 D;  1VQL 3;  3B13 A;  1AJ3 A;  3QK9 A;  5JDM A;  4AI6 A;  1VQ5 3;  1FMV A;  3LTB A;  1TFK A;  3ALA A;  3OWY A;  1GD4 A;  1D1C A;  4JLE A;  1K9M 4;  2XAS B;  1V9D A;  4XDV A;  3EBT A;  4QWT A;  4L8O A;  4XB5 A;  3RC8 A;  5JR9 A;  4WBN E;  4FMD A;  1ZEE A;  4LZI A;  3K0Z A;  2WOH A;  2ODV A;  1RN7 A;  1HG5 A;  3IEE A;  4EZH A;  3KDS E;  1QAF A;  2NW8 A;  3ROB A;  2IUK A;  1Q82 4;  5F3J A;  3KSE D;  4KZ1 A;  2VWA A;  3LFM A;  2P9B A;  4IGU A;  4K1V A;  1NO3 A;  3UT5 E;  2HMJ B;  2UX0 A;  5JRC A;  2F98 A;  3F7S A;  4HGA A;  3AA1 B;  2LEH A;  3KV5 A;  3UUN A;  1EKM A;  1HFA A;  5FY1 A;  3ETU A;  4WP5 A;  2C0S A;  4HVN A;  2XQY A;  4H9O C;  4AEQ A;  2RSX A;  1EZ3 A;  2E8I A;  3BLZ A;  3NBJ A;  4KMC A;  4O4H E;  1WYB A;  1GY7 A;  1OXZ A;  1DMM A;  5BVB A;  4P0B A;  3ESL A;  1KC8 4;  1RJO A;  1ROV A;  2RP4 A;  2XSH B;  1HTJ F;  3DMC A;  2DWK A;  1OWA A;  3ZEF B;  3Q9D A;  2Y73 A;  3CVR A;  4X20 E;  3EJV A;  1FMW A;  5BXQ A;  3ZN1 B;  4PFP A;  2PNC A;  4MMZ B;  3AB3 B;  2ZM2 A;  2Y8D A;  5AIF A;  5EK2 A;  2ZMA A;  3G6E 3;  3WDG B;  1HKX A;  4HM8 B;  2XFT A;  5LXT E;  2P05 A;  3G0K A;  3NBX X;  2W0Q A;  5LOV E;  3O1I A;  1M9G A;  3GN5 A;  3EQQ B;  3PXM A;  3X40 A;  3PU8 A;  5L3D B;  4QXB B;  4YLH A;  3I0Y A;  3IPT A;  1J2B A;  5CF1 A;  3QRD A;  3C4W A;  3JC6 C;  3RGR A;  2OOV A;  2L8K A;  4I43 B;  2PBI A;  2WO0 A;  1ZV4 X;  2GK9 A;  5FY7 A;  3BB9 A;  3TDG A;  4EXT A;  3CNX A;  2OTL 3;  3Q2M A;  3PGB A;  1W4N A;  3LK3 B;  3I9W A;  5FYM A;  1O7H B;  2DCF A;  3V92 A;  5F8P A;  3NV0 A;  1Z0P A;  3CCJ 3;  3ZPO A;  3U3I A;  3G71 3;  3P7I A;  1ULI B;  2KWI B;  2OOV C;  4FMA A;  2P09 A;  3L0R A;  3MJX A;  4AKI A;  3VF1 A;  2BZB A;  3ZMU B;  2A3D A;  1NB3 I;  4XM4 A;  3WA2 X;  5JDH A;  4EB6 E;  1N8Q A;  4FR9 A;  4ZI2 C;  3K3Q C;  2MF7 A;  4NUU A;  3I9Y A;  3NBR A;  5KDM C;  2CWU A;  2D0U A;  5JVD E;  5IW9 A;  3DGO A;  5CA1 E;  4ZOL E;  2PJQ A;  4ILU A;  3ZLI A;  2HH7 A;  2CM0 A;  4ISS A;  3KZT A;  2VB6 A;  4TV8 E;  3HKB E;  2ZM0 A;  5KP3 A;  2Z6B A;  1VRB A;  4UV9 B;  3NXJ A;  3ECF A;  1ZKE A;  2E2V A;  2CWT A;  2HML B;  4HM2 B;  3SED A;  2O3O A;  3ZMS B;  1US1 A;  4R9L A;  4N6M A;  5FXX A;  3EBY A;  5C8Y E;  1TFO A;  1IU7 A;  1EQK A;  3N9N A;  5JDG A;  2KWH A;  3FCS B;  4J8T A;  3H51 A;  3C50 A;  4N6O B;  5DRV A;  3UFE A;  2BHM A;  4N3V A;  2BMR B;  3KIN B;  4UXN B;  2DHR A;  3N9L A;  1ASK A;  5TAO A;  1JKG A;  3QUJ A;  1IJ5 A;  2V7L A;  2Q07 A;  1JV2 B;  3VGN A;  1E1H B;  1MMN A;  1Q42 A;  1QVF 2;  3KKG A;  1JRQ A;  4F6R C;  1LVF A;  1LXE A;  3E22 E;  3MG1 A;  3CCE 3;  1QVG 2;  2D0T A;  4EZ4 A;  2X51 A;  2SBL A;  4QXC B;  3MSO A;  1FGM A;  4STD A;  2QEX 3;  1U8C B;  1S72 3;  1YHQ 3;  3F8X A;  3ZYL A;  1Q40 A;  1EA2 A;  4J9A A;  1MIY A;  1WYC A;  3MKI A;  2H3R A;  3C4X A;  2X9Y A;  3CME 3;  1QJG A;  3X41 A;  5A1L A;  1LKX A;  4H63 H;  3E08 A;  4IHJ E;  1VQK 3;  3ZMT B;  1FGT A;  3HK4 A;  4HM6 B;  2W62 A;  4QWN B;  1NWW A;  2DI4 A;  3EVY A;  3H3H A;  2KND A;  2XAQ B;  3IJE B;  3KFQ C;  3NRX A;  4JRF A;  4OYK A;  4DND A;  4H9Q C;  2BO9 B;  4IE7 A;  5LNK A;  2GEX A;  2YFJ B;  3M65 A;  2LQV A;  3HKE E;  5L3G B;  3D3L A;  1LVK A;  3CMA 3;  4FMB A;  2CWO A;  1N5P A;  1DVD A;  2NP9 A;  3ANW B;  1MMA A;  3HIG A;  1WMN A;  4IIA A;  2KIN B;  5LJM A;  3DGM A;  1IDP A;  3OW2 2;  5L3B B;  2CE7 A;  1TUH A;  3OWU A;  2D42 A;  1A2K A;  3CQC B;  2ES0 A;  2A2F X;  1FUW A;  1KSI A;  2CFG A;  3N9M A;  1FEW A;  5AFU L;  3X42 A;  3OYZ A;  3AMO B;  4MLK A;  4CXY A;  4DMV A;  5H6Q B;  3STD A;  3UJM A;  4XZC A;  1Q40 B;  3K9M C;  3NQZ A;  1MIV A;  2UXX B;  4C91 A;  2XF3 A;  2OTJ 3;  3MG2 A;  4X2H A;  3KBT A;  5LC6 A;  3T8U A;  1D1A A;  2IC6 A;  2D1W A;  2PZV A;  3FG4 A;  2X9H A;  5KP4 A;  3ZC0 A;  1IV9 A;  2XR8 B;  1QSD A;  5JR9 B;  4EXR A;  3I0Q A;  5LBM A;  4PK5 A;  5IG4 A;  2F86 B;  5EEO A;  3BQK A;  3VSY A;  1GS3 A;  3BNC A;  5TGN A;  1A2V A;  4EYY R;  4YFS A;  4O4L E;  1RRL A;  5IEN A;  2Q9Q B;  5ETW A;  3ETV A;  4B6X A;  4AQG A;  1E97 A;  2X66 A;  1QAL A;  3V5S A;  3D9R A;  4L7K A;  4FCJ A;  5DRE A;  4WW0 A;  3MG3 A;  4KBM B;  4AXP A;  4UV8 B;  2GU3 A;  3N9O A;  3BQI A;  1YKE B;  3N2O A;  1N8R 4;  3LJC A;  4XBF B;  4UEL A;  2VK9 A;  4L0R A;  2J1D G;  2CH9 A;  2Q9Q D;  5FXW A;  2LYX A;  4ZI3 D;  1GYB A;  3HKD E;  3HR0 A;  4EYU A;  2CEA A;  5LGN B;  3LBX A;  2HMM B;  5D83 A;  3CCV 3;  2LM9 A;  3CWZ B;  1YKH B;  1QMA A;  4JUY A;  4XBY A;  3CX6 B;  1O7W B;  2E9X A;  2QGS A;  2LSY A;  1C7H A;  1A90 A;  3M8C A;  3N8B A;  3B4P A;  2B24 B;  3F8H A;  3FXE B;  5LBQ B;  4EV2 A;  3VU7 H;  2L3L A;  2XSO B;  2JPF A;  2EHO A;  3ZCJ A;  1DVC A;  3JUQ A;  1KD1 4;  4V1A v;  5EZY E;  2XHE B;  3CCQ 3;  3PCS A;  3EN1 B;  3HZP A;  4TUY E;  4ZI7 E;  1T5Y A;  3GA8 A;  5STD A;  1YW0 A;  2FGT A;  1W2B 2;  4U13 A;  1SA0 E;  4O02 B;  4L9I A;  2RCD A;  3PU3 A;  2H7O A;  1LNH A;  1EG9 B;  2N2N A;  2I9W A;  2A72 A;  3BND A;  2XTL A;  3KSP A;  1H7C A;  1WNH A;  4QX8 B;  2CXD A;  1VQ8 3;  5JQG E;  1G8X A;  4AKL A;  4PJJ A;  3BQL A;  3X3X A;  3LK4 2;  1D6Y A;  3GWR A;  3UUL A;  1OGX A;  4X1K E;  2KXP B;  3FGY A;  4R4K A;  3N9P A;  4DVD A;  3LTA A;  2XGL A;  4PEJ A;  4CI2 B;  2KT9 A;  2VKO A;  4HM0 B;  3NV0 B;  1OAC A;  1MMD A;  1NJI 4;  1FGQ A;  2XAF B;  5AII A;  1CUN A;  1D1B A;  3EB8 A;  3PUS A;  3W15 B;  3RDE A;  4Q53 A;  4ZI2 D;  1MMG A;  3RX6 A;  4ZS2 A;  5L3F B;  4OHF A;  5I97 A;  3AVR A;  5LCY A;  3UB1 A;  3ZYM A;  2C10 A;  3RYF E;  5DQW A;  1VQ9 3;  3SWH A;  3F31 A;  2B1E A;  2Q9Q C;  4E7Z A;  4EC6 A;  4O3V A;  3WOF B;  4O2B E;  2V1D B;  3HKC E;  4WYK B;  4N6V 0;  3O8Y A;  1D0Z A;  4CCV A;  1MOL A;  4AQF A;  4I50 E;  5LC7 A;  3GZB A;  5IG3 A;  2CMR A;  3K5T A;  4P0A A;  5JH7 E;  3HI2 A;  4JEU B;  3CC4 3;  2KCD A;  2JQQ A;  1M90 4;  3AA7 B;  5LYJ E;  3O4X E;  3G8Z A;  4GK0 E;  1AVL A;  2SPC A;  2FXT A;  3PZW A;  2D2S A;  3RPU A;  3DUK A;  2K5B B;  5FMN A;  1DYU A;  3AMO A;  4O4I E;  1GD3 A;  3NUV A;  2VKJ A;  2CLY C;  1YIT 3;  3C98 B;  2LJL A;  3FZW A;  4PW8 A;  1D6Z A;  4I4K A;  4RNY A;  1FA3 A;  4IT7 A;  3LG7 A;  4MHC A;  2CLY B;  2V7J A;  3MYT A;  4RNZ A;  1Q7Y 4;  4KFE A;  2K48 A;  3LT9 A;  4K1U A;  3K3O A;  2YU1 A;  3ZMZ B;  3QK6 A;  5EK3 A;  2YX9 A;  3SRZ A;  1U4Q A;  1W2Z A;  1UI8 A;  2MTQ A;  4BTY A;  4CQI A;  3Q5X A;  5JRC B;  5FGO A;  2ACX A;  1OF5 B;  1NDO B;  4GOU A;  2QGU A;  3VKH A;  3SXX A;  4WFO A;  3B7C A;  3I1A A;  4CI3 B;  5JDN A;  4OYJ A;  1U5O A;  2WSS V;  1VZZ A;  3DP7 A;  4BTX A;  3ZCI A;  5DAB A;  4FJO A;  1IAP A;  1WTH A;  2YIN A;  4G2A A;  1QUU A;  3UNL A;  3E0Z A;  2LOP A;  3N2G E;  3GMI A;  3OXA A;  4AQF C;  2HPJ A;  2VL8 A;  5JBS A;  1RRH A;  4X2O A;  3FHN A;  4C90 A;  1ZHC A;  2LSG A;  3QC9 A;  1WQL B;  3CCS 3;  4TZ4 C;  3P8C D;  2VAS A;  4N6U A;  4U74 A;  1UX4 A;  3NBB A;  1S35 A;  2NTY A;  3F2E A;  2D5U A;  4CXW A;  3CQX C;  1NWM X;  3PUG A;  2Y6X A;  3RYH E;  1YVB I;  3UTK A;  1JKG B;  4WHA A;  1KK7 A;  1JJ2 2;  1K41 A;  3MWZ A;  2W56 A;  2JQ5 A;  2E2U A;  4HZB B;  3BNB A;  1UI7 A;  2ML6 A;  3N9Q A;  3EF8 A;  3HI7 A;  3CML A;  3N54 B;  3N2K E;  3LTD A;  3MKD A;  4MBQ A;  1BR4 A;  4KP3 C;  2GBX B;  8CHO A;  4R80 A;  4GYR A;  5H6R B;  1A67 A;  1WRD A;  3PDY A;  3EN8 A;  2NOX A;  3S67 A;  3J7Y d;  3D0T A;  4PJL A;  2XEP A;  1JN5 A;  1IZN B;  1TU5 A;  3BNE A;  4PNI A;  4ZS3 A;  3NRY A;  4IPB A;  2XFS A;  1CEW I;  3OYX A;  3NZP A;  4EOZ B;  3U1W A;  2XH9 A;  3Q1C A;  5JPU A;  2YU2 A;  4HN9 A;  4XDW A;  3KE7 A;  7STD A;  3F57 A;  2LSK A;  1RKY A;  3WI3 A;  2ZL8 A;  1W7C A;  5ELU A;  3Q90 A;  1Y64 B;  5HWX A;  3RKO A;  2P0M A;  2Q9Q A;  1YGE A;  1AR0 A;  2YFI B;  3FLJ A;  4NHF A;  2LSI A;  3ZC1 A;  3SOY A;  3KV4 A;  2DLR A;  3FF2 A;  3NZQ A;  2V7I A;  2RFR A;  1IV7 A;  4IIJ E;  2XAH B;  4QHO A;  3H37 A;  1JB4 A;  3NHX A;  4IE6 A;  1YJW 3;  4GL6 A;  3EE1 A;  2CXL A;  3OKQ A;  4HM4 B;  3ANW A;  1OHP A;  4J2C A;  4PJM A;  3MHE A;  2BNG A;  3DGL A;  4MMY B;  2LOS A;  3HL6 A;  2MBG A;  5JDF A;  2G0U A;  3EDU A;  2IUJ A;  4NRE A;  3EUH A;  1VQO 3;  1K8A 4;  5FXZ A;  1D0Y A;  1O7G B;  1IJ6 A;  3N5L A;  5CK6 A;  3AAA B;  1G96 A;  2QA7 A;  4IDZ A;  1VQP 3;  5G2G A;  2N1G A;  3MPH A;  1E3R A;  2W56 B;  1YJN 3;  2BVL A;  5LA6 E;  1O7N B;  3LXU X;  2DNX A;  2RA1 A;  4JEH B;  1YIJ 3;  4MFR A;  2IW5 B;  3PS8 A;  4L8P A;  1JNQ A;  4UF0 A;  2BDE A;  2CHC A;  3S27 A;  5D82 A;  3VKG A;  5EQL A;  1W02 A;  1N9J A;  1O7M B;  1CYU A;  4HTE A;  2IC9 A;  3J7Y q;  1DMQ A;  3LH4 A;  3EHC A;  4QXH B;  2ODU A;  2OQE C;  5JDQ A;  4ZHQ E;  2MYS A;  4ZM8 A;  4ZI3 C;  4HYZ A;  1OCV A;  1K28 A;  2K0M A;  5AYR B;  1LVN A;  3EDV A;  5IEO A;  1YD8 G;  2C5I T;  4CDL A;  3WOD G;  4IST A;  1D0X A;  5CLK A;  4N6T A;  1S94 A;  3RC3 A;  3NQY A;  2X9W A;  3U78 A;  2X67 A;  3A5X A;  2HMN B;  2WMN A;  3NX0 A;  1YI2 3;  2W9Q A;  2WGQ A;  4N6L A;  3C64 A;  2X68 A;  1OUN A;  4O4J E;  2LSJ A;  1JB2 A;  2JJ9 A;  1IT7 A;  4HE8 A;  3WAJ A;  4K90 B;  2W03 A;  1HS7 A;  3KII A;  2V26 A;  4G1M B;  2WM9 A;  2W2C A;  4UF0 B;  5LGU B;  2LT3 A;  2JMH A;  3FKA A;  1KQS 2;  2OA5 A;  2PG8 A;  2YEV C;  2GBW B;  3LOY A;  3G16 A;  2KZ7 B;  3F14 A;  1K73 4;  4TN7 B;  3GWH A;  3JUO A;  2I59 A;  5HXR A;  2YK0 A;  1N5H A;  4YJ2 E;  2CFD A;  4EV5 A;  1O7P B;  4HKV B;  4ERR A;  5J2T E;  3UUX B;  2V7M A;  3MK7 C;  4BA9 A;  2K9A A;  1BR0 A;  1US7 B;  2WMO A;  4G63 A;  2OQE A;  5AIG A;  2Z77 A;  3GZY B;  1SPU A;  4P09 A;  4WBO A;  3C4Z A;  2W00 A;  3PE0 A;  3CPO A;  2CFW A;  1TP6 A;  3EC9 A;  1G73 A;  2XAG B;  2GEY A;  5L3E B;  5LHH B;  3ZN0 B;  1DMN A;  2XUE A;  1U5P A;  3MZK B;  4GYS A;  4PAG A;  4BAY B;  5LHG B;  2VKD A;  3CCR 3;  3PUQ A;  1SHZ C;  3MAC A;  5IG0 A;  4HBR A;  2WWU A;  3V98 A;  3G4S 3;  2KRT A;  3CU3 A;  4OUQ A;  2CWY A;  3SS1 A;  1WMO A;  2JMK A;  4YHJ A;  1ROA A;  1W6G A;  5JPP A;  2KXG A;  3J9X 1;  4H9R C;  4PFO A;  4IE0 A;  4KFF A;  3H3A A;  2LE8 A;  1CYV A;  4MEI A;  3C51 A;  2XRX B;  3Q2P A;  4GK5 E;  2L4V A;  4AKH A;  1FIO A;  1SII A;  4BJM A;  2KMF A;  5IG5 A;  1UUV B;  3SX1 A;  4N6N B;  3N9H A;  2ZM8 A;  2XAJ B;  1QAK A;  3F9S A;  4XBT A;  1W5Z A;  3SOA A;  3V99 A;  5IHY A;  5HYA A;  4UIG A;  1LRZ A;  2UXN B;  3CPW 2;  2W63 A;  1OHO A;  2LHR A;  1FGR A;  4FI5 A;  1NAF A;  3SVA A;  2CW9 A;  4X1I E;  1UCU A;  2C5J A;  5JR9 C;  3FBL A;  2HMK B;  3T8N A;  2EHO B;  2HMO B;  5FW5 A;  4X1Y E;  4XAX B;  2K24 A;  3WOE B;  3O1H A;  4HM3 B;  2F99 A;  3KVB A;  5LP6 E;  3HA4 A;  4LMI A;  1W6Y A;  1HCI A;  4H3U A;  3OJA A;  4HM1 B;  2CXF A;  2JRK A;  4WWU C;  1LOX A;  3BK9 A;  1IVV A;  5E0O A;  4DO0 A;  4PJN A;  3I56 3;  3FG3 A;  2P0X A;  4GB5 A;  4AKR B;  3LYG A;  3IF8 B;  1OH0 A;  5EK4 A;  4HKA A;  3T8O A;  2Z6E A;  1IT8 A;  4KVH A;  1W01 A;  3GZX B;  4XBX A;  1W00 A;  4H9P C;  2R4I A;  4EIW A;  3O1J A;  3FXD B;  2C5K T;  3TKL B;  3JUN A;  1IVU A;  3I55 3;  5GON E;  1O3X A;  4L5G A;  2BT3 A;  5FXV A;  3LBX B;  3AA6 B;  4OFZ A;  2W6J H;  3B57 A;  4RBN A;  4YJ3 E;  4UVA B;  2H7V C;  3OBV E;  4HM7 B;  1HF8 A;  1STD A;  1HU9 A;  3ZYK A;  1Z1S A;  5HXH A;  4I55 E;  1N9E A;  3DM8 A;  5LGT B;  2QIY A;  4LSO A;  3K8P C;  3NM7 A;  2CCQ A;  3KV6 A;  1IK3 A;  3S28 A;  4Z8X A;  3CCM 3;  4LEH A;  5LJN A;  3AAI A;  1R4C A;  5IER A;  4QKN A;  2BMO B;  3WMD A;  3KBU A;  3RGA A;  4FCM A;  4MJD A;  3IHR A;  4NUV A;  5L2L A;  2Y48 B;  2IMJ A;  1IVW A;  2W61 A;  3I0O A;  3WA3 A;  3OV4 A;  2CWV A;  5L3C B;  3FF0 A;  3DY5 A;  2OCT A;  2WAU A;  3JUP A;  3PUA A;  1OF5 A;  5KP1 A;  2GU1 A;  2ZLY A;  3HX8 A;  3X3Z A;  5ADX L;  3ER7 A;  3SLU A;  4R1K A;  5HXS A;  3O9X A;  3MA9 A;  2WBL A;  2YFL B;  2X0L B;  4H9N C;  3L3P A;  4M1P A;  5HAX A;  3JUM A;  4IE4 A;  1W6C A;  3LML A;  3AA0 B;  2A15 A;  3KV9 A;  3ZMV B;  3AVS A;  3LT8 A;  3CC7 3;  2INX A;  1IQ8 A;  1Y4K A;  4A56 A;  1TIJ A;  5JDL A;  5FY0 A;  2CC3 A;  5HWY A;  5CB4 E;  1VOM A;  2WOF A;  1Q86 4;  4TV9 E;  3HII A;  3S29 A;  4U72 A;  5KMG P;  5A0O B;  1M1K 4;  1HX8 A;  4PK6 A;  5AYS C;  4O2A E;  3L09 A;  2FNQ A;  1BUQ A;  2V1L A;  2Z76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...