4OK0A

Crystal structure of putative nucleotidyltransferase from h. pylori
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
225
structure length
225
Chain Sequence
LSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative
publication title Crystal structure of JHP933 from Helicobacter pylori J99 shows two-domain architecture with a DUF1814 family nucleotidyl transferase domain and a helical bundle domain
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 73
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ok0A02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ok0A01
4OK0A 4O8SA
chains in the Genus database with same CATH superfamily
4YHHT 2I0MA 2XQ4A 3RRWA 4JEUB 4LF9T 3F31A 2Y6XA 2E2VA 2SPCA 3N2KE 1JN5A 3PJAJ 3OTOT 1HR0T 4LF5T 3LG7A 1E97A 5F5WA 3MPHA 3B57A 5AQLB 2FGTA 4AIUA 1W4NA 4AISA 3NWIA 2XAQB 4H3UA 1Q7Y4 4HFEA 4CCVA 5AQVB 3F7SA 2XSAA 1J2BA 2WWVA 2XFSA 1W02A 1BIRA 3OKQA 3CNXA 3AAAB 3ZG0A 4K0KT 3ESLA 4CI3B 4UV9B 3VU7H 2HMJB 5ADXL 3FSDA 4DBRA 3T8UA 2P05A 4EB6E 4H9PC 3PURA 2OTL3 5FL0A 3RGAA 1XWMA 4K90B 2CPTA 3UU3A 2YDQA 4EXTA 1FGQA 4QWTA 3ZYLA 2INXA 1BSBA 2DWGA 5LHGB 2ML6A 1JB4A 3TKLB 2YEVC 3ALAA 4FR9A 4FJOA 4IL9A 1Q40A 1C7HA 1IJ6A 3X41A 4LF4T 5LCYA 2X68A 4AQFC 2LM9A 2E2TA 2BDEA 3SS1A 2KWIB 5G1KA 2A72A 4A98A 4FI5A 2L1SA 3EHCA 5STDA 3B7CA 4U2ZA 2LEHA 4IDQA 4DV7T 3RLFF 2I6HA 3U97A 3K8PC 3ZT7A 3OWUA 3EJVA 4KFFA 4IDPA 2PG8A 3QNUA 2YFLB 1CQSA 2WO0A 4X66T 2XR8B 2XQ7A 1W5ZA 3CX6B 4JV5T 5IF6A 1ZGXA 5ELJA 3HI2A 4ZZCA 5IEOA 1WCRA 4P0AA 5EK3A 5IG4A 5LJNA 4L0RA 1U5PA 3E0ZA 4BJNA 3V92A 2XQYA 4BA9A 2WZIA 3P4PA 4FCJA 2H0HA 1L5GB 1DU2A 2XM1A 4N6OB 2V1DB 3LBXA 1SJWA 5FW5A 3UT5E 1A2KA 4ILUA 1AR0A 3CU3A 3LMLA 4LMIA 1XNRT 1MWUA 4I5QA 1YJW3 1HZ1A 3B5MA 4JI5T 4IT7A 4X64T 2YDRA 2JQHA 1BNEA 2OA5A 3DM8A 3D79A 2LJLA 1GOUA 2E9XC 4O4HE 1G8XA 1AV4A 4O2AE 2B76A 1EG9B 3ROBA 4IIAA 2DI4A 5E0OA 3SXXA 1DMMA 2ES0A 2V5DA 1LQGC 3CCR3 5HEHA 1Q824 5IW9A 4MBQA 5JRCB 3OWSA 3OW22 2XAGB 1VQ93 3RQWA 4ZZBA 2MAWA 2EHOC 4DV1T 4DR4T 1SHZC 1YVBI 4RZMA 1YKEB 3JUOA 2E5LT 1LVFA 4PJJA 2BIRA 1EA2A 3ER7A 3HKEE 2XQ9A 3AGNA 3Q2PA 4CPKA 2HN1A 3C4XA 3PUSA 2JQ5A 4IL4A 2C5KT 3PJAA 2ZMAA 1XMOT 1DMQA 1N5PA 4QHOA 2Z76A 3S29A 3MKIA 3NUVA 1VQM3 2E5VA 3EUHA 4N6LA 1D1BA 1BRHA 1E2AA 1UURA 3AHWA 3UFGA 2XPKA 3DTOA 4PW8A 3O8YA 2HPJA 2P09A 1YXRA 3F8XA 2R41A 4FCMA 1MWRA 1G96A 2W2CA 3FZHB 4K0UA 3AA0B 4N6TA 3LDQB 1V57A 3PYJA 2LQVA 1NWWA 2LRLA 2CX0A 2WY2A 4YLHA 5CK6A 1LOVA 2B24B 1HS7A 3AE3A 1EQKA 5D83A 4EAHA 1KD14 5HEGA 5LOVE 3AGOA 3J7Yd 3CCJ3 4U31A 2BMRB 3EHZA 3PUAA 2XGLA 4NHFA 3QC9A 4R4KA 3CMA3 2YDSA 4JBWF 1IYYA 4X1YE 4ZI7E 2GEYA 1BGSA 2CG0A 5DJQC 3ZEFB 4TV9E 4NIQA 5LC7A 4PK4A 2A15A 3Q1CA 5JRCA 4HKAA 3D0TA 3ZMVB 1T72A 1IV7A 2CH9A 1B2MA 2CLYB 4CDLA 4WNKA 3ZT6A 2B1EA 5CLKA 2MC8A 3N9NA 5AEUB 3Q3FA 1RHLA 1S35A 1HX8A 1MNDA 1IBLT 2LSYA 3UL5A 1JZDA 3EAMA 1BNIA 2FBWA 3D3LA 1XDOA 1T98A 4LFAT 2JRKA 1UI8A 4HFIA 2WDQA 3UUXB 5IYZE 3NXJA 5CF2A 1K41A 2UXBT 3X3ZA 1UUGB 4PJLA 1PYLA 3CCV3 2XY8B 4E7ZA 2ZL8A 4IE5A 3SYUA 3V5UA 4IHJE 3FG1A 5LA6E 2W9QA 1IBMT 1LOWA 4KZ1A 5CFBA 3F8HA 2E9XD 4MEIA 2A9UA 4XAXB 3FZLB 1HCIA 4O2BE 3FB2A 3M3ZB 3DXOA 3TLVA 1FGOA 3RI5A 1BNGA 5M19A 1OEDE 4YY3T 3AB3B 5HXRA 1LVKA 1ZKEA 5JTGA 1UUWB 1JNZA 4TWFA 1E3RA 2CC3A 2QGUA 1SIIA 3MG2A 3S4UA 2F99A 4ZI2C 5CF1A 2EHOD 3I553 1XDPA 2ZM8A 3K3OA 3GA8A 2I9WA 1IK3A 1MMNA 1IQXA 2D5UA 1YHQ3 3PTRB 2GU3A 4BJMA 2FJEA 2CWTA 3KVAA 2XQ5A 4EEDA 3ZN0B 1IQYA 1DE3A 4GSPA 3CCU3 3DH2A 3GZYB 5RNTA 3I0YA 2W0QA 1W0AA 3MSOA 3HR0A 3SRZA 1KNPA 1CH0A 4IDZA 2W67A 5DQVA 3LTBA 3H51A 1OGZA 2KMFA 4GL6A 4JYAT 3AE9A 5J2TE 1ZX2A 1BRSA 4UVCB 3MG3A 3A5XA 5FKYA 3WOEB 1YKHB 1NWMX 1RNTA 5JQGE 2K9AA 3VF1A 4JI7T 3P8CD 2C5JA 3EX9A 5GSPA 1BR1A 3WAKA 2K3WA 4H9OC 2VKDA 5ETWA 3JUNA 4LMKA 4V1Av 4K61A 4IE4A 3J9X1 1MGRA 4HM8B 2CMRA 1HTJF 1YQ4A 4I4KA 3M65A 3N2OA 5AIHA 5KP3A 1SARA 3AECA 2O9UX 1T2IA 1FGMA 2F86B 4BTXA 2UXXB 5J1GA 5A1LA 2F56A 2PTFA 3JUQA 4KT3B 3KV9A 5AQIB 3AA1B 1DETA 3LT9A 4ILCA 1RCLA 4IDOA 4I4TE 1GMRA 3RIAA 2YKSA 3SWHA 4EZHA 3PCRA 3PV0F 3ZMZB 5HYAA 2L3LA 2W56B 1R4YA 1BRNL 2UUGC 4UVAB 5FY7A 4HBRA 7RNTA 1SIHA 6GSPA 1BRGA 3RRCA 3C4ZA 2QEX3 3CCS3 3UU6A 1E3VA 3PU3A 4GIWA 3K9MC 1VQO3 2VURA 2YFJB 5BR8T 2WWUA 3LK2B 2CE7A 4H9SE 3WR2A 4GHOA 1BU4A 2FJBA 2WU2A 5FL1A 2CW9A 3I9WA 1KSIA 3E08A 3NVOA 3KKGA 3RPUA 3DMCA 3N9PA 1O7WB 2KZ7B 2NW7A 2GEXA 4YSXA 2V7IA 1I70A 4DIDB 4H9NC 5L2LA 3N9QA 4IREA 2RP4A 2Y48B 1RGAA 2CHOA 2PZVA 1A2VA 2LLYA 1IVUA 1I2EA 3IF8B 3WMDA 2IA7A 7STDA 4DR6T 3CPZA 4GK5E 3D5GA 3KV6A 4MALA 4IDNA 4X20E 1D6UA 3IEEA 4KVHA 4G2AA 5JDQA 2VWAA 2D2SA 5AIFA 1ZS7A 2XAFB 3O4XE 3S28A 2H0IA 2HMOB 1OEDB 5AQUB 3BQIA 1OACA 1RNBA 1OCVA 3AE4A 1WR6A 2E9XA 4KMCA 4JF8A 1JB2A 2FNQA 3FG3A 1JRQA 4EYYR 4ZI2D 4J5KA 4P1NA 5LG4A 4A56A 1GY5A 1W2ZA 4HFDA 1RN1A 3Q5DA 1XMQT 9RNTA 5G2GA 4XDVA 4U7YA 1VQ63 3B4PA 2Z6EA 2BKOA 4K1UA 4A97A 5HGRA 2EHOA 4XBFB 4JRFA 3O1JA 4CJNA 2LKGA 4DR1T 2QYWA 3PDYA 4CXXA 3AEAA 1VQL3 4HGAA 4B3ST 1JBTA 1QMAA 1R8IA 1KF6A 4LFBT 4ZM8A 3AEDA 2GXFA 2HMNB 3OX9A 2WM9A 5EEOA 4UIGA 3F2EA 5AI1A 1VQ43 2WAUA 4EIWA 1LOXA 4J9AA 3KCHA 4ASKA 1FUSA 3WOFB 3T1YT 3ANWA 1FIOA 5EK4A 1HKXA 3DGNA 1IV9A 4FMBA 5JDFA 5LHHB 1MGWA 3T1HT 4HN9A 3OJAA 3RYCE 1VQN3 1BNFA 4ILAA 2OCTA 3VRAA 3J7Yq 2CFGA 3G06A 3UL6A 3HL6A 3SOLA 4U2YA 1VQ83 1W0BA 2IMLA 3ETVA 3A5EA 2CLYC 1BUQA 1RN7A 1YQ3A 3CX7B 4R80A 2IDOB 1VQP3 3CKDA 3NV0B 3BNCA 1OEDA 3OBVE 2LT3A 1GOYA 1IU7A 4N6NB 3I563 1KK7A 3GMIA 2JMKA 4BTYA 1RTUA 3KV5A 2QGSA 3HIIA 5ELUA 4ISSA 4DVDA 4XBXA 2HHHT 4X1KE 1O3XA 4IIJE 3ZLIA 4Z91A 2AE9A 3NM2A 2LSGA 4X62T 3KFQC 3AEBA 4NPPA 1IVVA 1TIJA 3ZFZA 3IMAB 3AE7A 3ETUA 4WYKB 5JDGA 4O8SA 2WP9A 3RGLA 2UUCT 4HFBA 3N9OA 2ACZA 4AKZA 3ZC0A 4FMDA 1L0VA 3CIRA 3I0QA 4NREA 4N3VA 1HYFA 4HWHA 3B8LA 3DZLA 3KZTA 4AKIA 1M904 1W7CA 1VCSA 1S94A 4CI1B 2CWUA 4QX8B 4HM6B 1HNZT 2D0TA 5AQJB 4NXMT 4R1KA 1RLSA 2AAEA 4AQGA 3MG1A 2WQYA 1CYUA 3T8OA 1M9GA 2OWPA 4I55E 2CFLA 3P50A 4PNIA 1JV2B 3JC6D 1BRJA 4L8OA 4QWNB 1ZHCA 1FEWA 4TZ4C 1LNIA 1ULIB 1T2HA 4ANJA 3EDUA 2UXCT 2IUJA 4ADZA 2OTJ3 3Q9DA 2H88A 3LFMA 1UDII 2X67A 2IC6A 3ZPOA 4CI2B 1E1HB 1TP6A 4HE8A 4JI8T 1FGRA 1X1YA 1O7HB 1T7SA 4HZ9B 3C50A 4AI6A 1SPUA 3NV0A 4LFCT 4DR3T 2X66A 3ZYMA 4M1PA 3UNLA 1MIWA 5IG0A 2Q07A 1NAFA 1NEKA 3PXMA 1FGTA 5L3BB 2XEPA 3H3HA 2GBWB 1UGHI 1UUSA 2YU1A 2HOHA 1BR4A 1WR0A 4HM1B 3WA2X 5AYRB 2CX1A 4UEMA 1Q7HA 4BAYB 2BZBA 4MFRA 1M1K4 3JAFA 5KDMC 4WYKA 3FKAA 2VASA 4ILFA 5JDMA 2E2UA 5FVLA 1UUVB 1TFOA 4AKRB 1NENA 1KEYA 3DUKA 2KWHA 5BIRA 2NW8A 3PUQA 4HFVA 3KINB 1PU4A 5HWXA 2LRKA 3VR9A 2FXTA 5LBMA 5EVHA 5HXCA 4H9QC 4EYCA 1W09A 2GBXB 2JJ9A 4PJMA 4R9LA 2A3DA 3IBPA 1IAPA 1D1CA 5AQRB 3CCL3 2FJAA 4CN6A 4YTPA 4UF0B 5C3JA 4O02B 5JR9B 2UX0A 2GK9A 4L8PA 4HWDA 4Z8XA 4LF6T 2C10A 4EXRA 3ZSTA 2KCDA 3MYTA 4IT4A 4YTNA 2IY2A 3IPTA 1UCKA 5F3JA 2IAKA 3ZKRA 4BU4A 5H6RB 3LXUX 4R9KA 2XSBA 1I6ZA 5FMNA 3KV4A 2E8IA 2IYJA 4K1VA 1QVG2 3WDGB 4KBMB 4FMAA 3E99A 3PUZF 2IHR1 1G02A 3CPOA 4CQIA 4XM4A 3UUNA 3Q2MA 1GSPA 2IIUA 1Q814 1KFYA 5C8YE 3PS8A 1W6CA 2CM0A 1BAOA 3LK3B 2JDIH 4TUYE 4DV5T 4ZI3D 2N2NA 3LOYA 2KRTA 1NU3A 2XQ8A 1U8CB 4ZS3A 3CWZB 4P09A 4IPBA 2KNDA 5H6QB 4XBTA 2HN2A 4EOZB 1JNQA 5KP1A 1OEDC 2D42A 4PEJA 1W6YA 3ONXA 3PUWF 5BVBA 2KXPB 3FZMB 1GQEA 1RGKA 4TN7B 3OXAA 2WSSV 2DCFA 4L5GA 4DR2T 5BU4A 5BMVE 4X2HA 2M6BA 4EV5A 2D9DA 3LT8A 1OHPA 1CUNA 4J2CA 2BVLA 3O1HA 1M1XB 4L7KA 3R6NA 3ZYKA 2BO9B 3C4WA 4EV6A 1KC84 2XAJB 3P7IA 2PBIA 2MBGA 1G0TA 1KWIA 1NB5I 1NJI4 3ZJ1A 1BVIA 1GD4A 4DV6T 3HIGA 4BIRA 4EV2A 3UU4A 2R6GF 1RGEA 4DUYT 3G713 3CCQ3 2VB6A 5AQGB 1I2FA 3CNMA 1BNSA 3AEEA 4YHJA 2BG9E 3ONLC 3SOAA 3FZFB 4HZBB 1Y01A 4TNWA 1UK5A 2M7OA 1ULJB 3QRDA 4UF0A 2NOXA 3UUMA 4WBOA 5JR9A 4LF8T 3D5IA 1S723 4EGWA 1I3IA 5DREA 4AKLA 1BSEA 2ZHXB 1WRDA 3JUMA 4N6V0 1QAKA 3MA9A 4NXNT 1FJGT 1T8BA 1X9BA 3EI0A 2DHRA 1RN4A 5L3GB 2W6JH 5L3DB 2M6IA 3HKCE 3OYZA 3O9XA 4LEHA 3FBZA 3CQXC 3GAXA 5LGNB 2KLQA 4ZOLE 3CC43 1N34T 1MNEA 5L4HA 3HKBE 3MKDA 3NBRA 3BQLA 3G6E3 1BR0A 4BL3A 4YSYA 2CWOA 2HMLB 2XUEA 2AXDS 4HM0B 2K3DA 2UUAT 2IW5B 3FF0A 3FF2A 4AKYA 2J62A 4YTMA 5HEOA 1VRBA 2W61A 4X2OA 3C51A 3AXJB 1AVLA 1I0XA 4CXYA 3QUJA 2W2UA 4U72A 4HWFA 5HWYA 1AJ3A 2X0HA 3KN4A 3KBUA 4EEBA 3ONJA 2GSPA 4RBNA 2BBJA 3UULA 3BB9A 2JQQA 4X65T 1WNHA 2J8XB 5LYJE 2WMNA 1GY6A 2CFDA 3P4QA 1U5OA 4MJDA 4HFCA 4LMJA 1NDOB 2Q9QD 1IT8A 4O4LE 4LMLA 2WU5A 2UUBT 1YJ93 1C54A 1HU9A 1U4QA 1FZUA 1GYBA 3JADA 5LMUT 1FUTA 5DRVA 2STDA 5HXSA 4O4JE 4U7IA 4JLEA 1OGXA 1BOXA 5AFUL 4L9IA 3OV4A 5JVDE 2CG1A 4ZEYA 4LSOA 1BR2A 4DKIA 2V8SV 1GMQA 3SLUA 4XZCA 3RC8A 2PNCA 3F7XA 1K8A4 1JBRA 1YW0A 3CQCB 5HEUA 2UGIA 2C4BA 1DYUA 3BK9A 5KXJA 3Q5WA 1O7PB 2WOFA 4DUZT 1B2ZA 1N8R4 5JH7E 5LGTB 5G1LA 2IUBA 5AEWB 3FHNA 3CQGB 4U3CA 4ZHQE 3X42A 1RSNA 2HMKB 1GY7A 2D1WA 2XQAA 4HKVB 4ERRA 5AQMB 4GKJT 2KT9A 1Y64B 2V5CA 5DQWA 3G0KA 3L3PA 4HFHA 4HM2B 3FZKB 2MPKA 3EF8A 2BBHA 3X1DA 5IG5A 2CRBA 4KUMB 3ZSSA 3JAEA 1IJ5A 1N9JA 2FJDA 1I8VA 1YVSA 3FLJA 2ACXA 3AXJA 2Y73A 4QXBB 3EVYA 1JNRA 2O3OA 2VL0A 2K54A 1X79A 4JI1T 2VVNA 3D4AA 1RDSA 4TX4A 2Q9QB 1VCTA 4GOUA 2BG9B 1B3SA 1OUNA 3EN8A 4FCZA 3QOFA 2F4VT 3HX8A 1EUIC 1UCUA 5D81A 3D9RA 3UUBA 2W4XA 3T8NA 2ODUA 4UR9A 3A76A 2XZEA 1FMWA 4H61A 1N8QA 3ZMTB 1J5ET 3L8RA 3S5CA 5JPUA 2X9YA 1K9M4 2GU1A 3DJBA 5AQNB 4HJLB 2NW9A 1Z1SA 4IGUA 5ABGA 4QH1A 2XJ7A 3G8ZA 4O4IE 4DV4T 1RGFA 2LOPA 4CXWA 5IG3A 2VL8A 1D0ZA 5C2TA 3F40A 1FW7A 5JDLA 3BIRA 1Q864 3EDVA 1CEWI 1OHOA 1YNVX 2C5IT 2VK9A 5LB7B 4HOHA 5DABA 2SARA 1D0XA 5D82A 3RYFE 4FMCA 4MMZB 2L8KA 1UX5A 1ZEEA 2OV9A 3MK7C 1VQ73 4AKHA 6RNTA 1OWAA 3JC6C 1CHUA 4BL2A 3GN5B 3NM7A 1A67A 4HEAA 1TU5A 2H0GA 3RGRA 5FXXA 3AAEB 3RQUA 3QB5K 3ZCIA 3IHRA 1AQZA 5JR9C 4G63A 1DMNA 3ABVA 1RGLA 1NNVA 3UU5A 2QA7A 1W00A 4I43B 2P38A 3BU4A 2H7VC 2W56A 1TUHA 1T5YA 2VQET 1TRPA 1TTOA 5AQKB 1I0VA 4WZXA 3DGOA 4A5XA 2WBLA 1GS3A 2CWVA 4DV3T 3MXZA 4JI3T 1RMSA 2ML5A 1F8NA 1DVCA 1QAFA 2V1LA 3NHXA 1D6ZA 4JI6T 1IT7A 3LYGA 1UCIA 3N9MA 1QUUA 3EE1A 2ZLYA 1BNJA 2NWBA 2W66A 4COFA 4RNYA 3PGBA 4XB5A 2LHNA 2RBIA 3EN1B 2Q9QA 3GWHA 3S27A 4LGQA 2BG9A 1W9RA 3GRDA 2CFWA 2OOVA 3TLUA 4UVBB 4PFOA 5IUXA 3KIIA 4G1MB 3KE7A 3LSVA 5IENA 1A90A 5A0OB 3JUPA 3K63A 2CXLA 3NBXX 3DP7A 5CB4E 1FMVA 4OFZA 3CME3 2Z6BA 6STDA 2HPLA 4CN4A 1GD3A 1HX1B 2Y8DA 2V7JA 2VKJA 2P0MA 3AEFA 2OQEA 2W62A 1US1A 1RCKA 3SEDA 1BNRA 2IMJA 3EB8A 3GZRA 4N6MA 3V98A 5AYSC 2XQ6A 5IERA 4IE6A 1W01A 2X9WA 3CK6A 1Q42A 1Z8UA 1SA0E 2W00A 5CA0E 3WAJA 1JJ22 4AQYT 3CC73 4DR5T 1H7CA 2CHNA 4PK5A 1R4CA 5AQTB 2ZDJA 3RIUA 2V7LA 2QRXA 2DLRA 4PAGA 4F8HA 4UV8B 2X0YA 2P0XA 2J47A 4X5TA 1CYVA 2KF4A 4HAAA 2RSXA 3MHEA 2XSHB 1X1WA 4H9RC 2NTXA 3LBXB 4DV2T 3RHWA 2MOZA 2UXDT 4ZI3C 5LBQB 4KHPT 2ODVA 5FVKA 3SFDA 1A2PA 3NRXA 2V6YB 5LMNT 2IC9A 1US7B 1JKGB 4MHCA 2KF3A 4WBNE 2K24A 5FXVA 3AA6B 1AVKA 1Q9EA 1TFKA 1UCJA 2WCAA 4UELA 3RC3A 4UXNB 1V74A 5AQOB 1HG2A 4Q25A 4CN1A 2X51A 4DMVA 1SE7A 2XAHB 4I50E 4MMYB 1Z0PA 3IJEB 2UU9T 5I97A 2VVSA 3CCE3 5HEJA 3NKZA 3ZMUB 2Y74A 3KFWX 2B1XB 3F57A 4XBYA 2N9DA 5L4EA 3LTAA 2CCQA 1O7NB 2V7KA 4GK0E 3GZBA 3UTKA 2A2FX 4C90A 1QVF2 1ZV4X 2L9QA 5JDNA 3Q5XA 3HK4A 2LSJA 5L3CB 3PCSA 3MACA 1PFPA 2RPAA 4U33A 2NTYA 2WDRA 2Z7AA 3X3YA 1RRLA 3FBLA 3FH1A 3F14A 2WDVA 4ORLA 3RDEA 4KP3C 3V99A 3B13A 3AEGA 3FCSB 2LYXA 4HM4B 5J2UE 2L4VA 4NUUA 3NZQA 2LOSA 2IUKA 2X9XA 1OXZA 5FNVE 1RJOA 4LF7T 1GOVA 1K734 2LKHA 4N78D 3ZG5A 4RNTA 1IVXA 1X1UA 5BXQA 2CHCA 3NQYA 3S67A 3NQZA 1I94T 1RKYA 2ZA4A 3AE2A 5LJMA 2YOEA 1B2UA 1BSAA 5AQPB 5JREA 2XF3A 3K5TA 3RYHE 1QALA 3RNTA 1MIVA 1ZO2A 3GSPA 4KHZF 1B2XA 1WQLB 1BUJA 2KINB 2V6YA 5M1AA 2LE8A 3AE5A 3K0ZA 2BHMA 1K28A 1JKGA 3Q5EA 3CVRA 4MLKA 4C91A 1UI7A 4DV0T 2CKFB 2ZM2A 4TV8E 3NBBA 3MJXA 2BKNA 3EQQB 2XRXB 1N9EA 3N8BA 3H3AA 1JZOA 3WHOA 3CXC2 2WB5A 3CMLA 4DNDA 4QKNA 4TX5A 3PUGA 4I0UA 1D1AA 2CXFA 4GYRA 5EZYE 4AXPA 3RKGA 3KVBA 2OLTA 2Q9QC 4STDA 4QX7B 1UX4A 1WTHA 4U13A 2BG9C 2CXDA 1HF8A 1I2GA 1YGWA 5EQLA 4EC6A 3RH3A 2OOVC 7GSPA 5HCJA 1E7PA 1ZOYA 2RA1A 4KFEA 3TLSA 4Z90A 1LNHA 3HKDE 1Y4KA 3STDA 4QH4A 3I9YA 5AQFB 4OK0A 3X3XA 2XQ3A 3AE1A 3ZT5A 1IQ8A 4HWIB 3WI3A 3L0RA 2WMOA 5KMGP 5JBSA 3UU8A 2OQEC 1BSDA 4X1IE 5AQSB 1OF5B 1ROVA 5HXEA 5CXOA 2N1GA 2LM2A 2VKOA 3EABA 3LK42 3A7MA 1VQK3 2HMMB 1KNRA 3RYIE 2VQFT 3FGYA 3JCFA 2BNGA 2JPFA 4NPBA 1STDA 2V26A 5ABEA 3ZC1A 4B6XA 3I0OA 2VKHA 5M18A 3RIUC 4KI0F 1PY3A 3TLTA 2V6XA 2C0SA 1KNZA 1B20A 1TRQA 2BMOB 2QVAA 2RFRA 3PU8A 1MIYA 2NR4A 3U1WA 1FYSA 4OUQA 3AHSA 3LTDA 1XZYA 2FUPA 3ZMSB 4O2HA 3QB5A 5AQHB 3K3NA 4IE7A 1AY7A 5LNKA 4LYLB 3SX1A 3H3MA 3ZN1B 4N6UA 1B2SA 3QK6A 3VGNA 2V7MA 3ZCJA 4WFOA 4EW5A 4KFDA 4B3MT 4Q53A 2JQ9A 3LZAA 4WHAA 4TWHA 1YIJ3 3AE8A 2CFKA 2QIYA 4AEQA 4IE0A 4P0BA 2E2AA 1RGGA 1MMGA 3UJMA 3AMOB 4OVMA 3AVRA 5HCMA 4H63H 4YJ2E 4DBQA 4EYUA 4EZ4A 2M67A 2XGNA 2YFIB 3B4OA 3BNBA 1BANA 4DO0A 1D0YA 4JI4T 2XM2A 2YX9A 3SOYA 1V9DA 2PJQA 2W63A 3PZWA 3OWYA 1NB3I 2H7OA 4XDWA 2SBLA 3DY5A 1HNWT 3HOHA 1N32T 3GWRA 4O3VA 1M62A 2XASB 3T0UA 3X40A 1MWTA 3K3QC 3HI7A 4WYVA 1VZZA 2WS3A 1UW1A 2J1DG 3VRBA 2MTQA 1LRZA 1OF5A 2CA5A 2CBJA 3I1AA 1HNXT 1M7KA 4F6RC 1ISKA 1B7TA 3NRYA 3N5LA 2CIUA 5FYMA 4GYSA 5HOHA 4WP5A 2KAAA 5IEPA 2H89A 2LHRA 3KSED 3OVUA 4ZS2A 5ABFB 3E22E 5LP6E 3VSYA 4PFPA 3RX6A 2I59A 3UFEA 3LTCA 2YK0A 1BRKA 3TDGA 1RRHA 2R4IA 8RNTA 1JBSA 4DMWA 4U74A 3AVSA 5IHYA 2YINA 5AIIA 5LHIB 1V58A 4GB5A 3WA3A 2AADA 4HYZA 3RKOA 2XH9A 4OYKA 5AQQB 3LH4A 1LKXA 4JI2T 3C98B 4ISTA 2K48A 1RGCA 3C64A 5FP3A 4J5GA 2K5BB 1JB5A 3CPW2 3CC23 5FY0A 3FXEB 3DGLA 1FA3A 2ZM0A 4BTWA 3N9HA 3FXDB 1B27A 1MOLA 3P4WA 3SFEA 2XTLA 4ZXLA 4AKGA 3IA3A 3G4S3 3VKHA 3QK9A 2BS3A 1O7GB 1WFDA 1WMOA 2LSKA 3AA7B 4OX9T 1N33T 4TNVA 3AMOA 3K1SA 3DGYA 4YT0A 3OPCA 1NO3A 2UXNB 2W04A 2CK3H 2Z77A 5CA1E 4ILBA 3K7CA 3HZPA 1T3BA 2KF5A 2KXGA 3MWZA 3N9LA 2D0UA 1J1JA 2X0LB 3PUVF 4H63V 1MWSA 5J0ZA 4HM5B 1W2B2 3HA4A 2E9XB 1YD8G 3PUXF 1FUWA 3P4RA 5LGUB 3FZWA 3WODG 4E7SA 2MYSA 3V5SA 1LVNA 3KSPA 3DGMA 1YJN3 4HM3B 3RIFA 1N36T 2F5WA 1SQWA 2HH7A 2EHOB 1UCLA 4YJ3E 5LC6A 3N54B 1W6GA 3F9SA 2BT3A 4JUYA 3OYXA 1I3FA 3W15B 4MMXB 3AE6A 1MMAA 5ABFA 2F98A 3URPA 3BNDA 2RCDA 2NP9A 1ASKA 1MNLA 4HWCA 4WW0A 2DWKA 1O7MB 2W9PA 1LOYA 3CD63 4AQFA 3R84B 1J5WA 2WOHA 5KP4A 1EZ3A 2ZM6T 1DVDA 1WYCA 2CEAA 3M8CA 1QSDA 3ANWB 1LQMB 4LZIA 4B3RT 2RNTA 2QA43 3UQ7A 5KX5E 2BS2A 3VHLA 5AIGA 4QH5A 5EK2A 2BVMA 1UGIA 3NX0A 5CJ5A 1QLBA 1XNQT 1WYBA 4DR7T 3EBYA 1N5HA 1EEJA 4KX6A 4JEHB 5FY1A 3L39A 1WLXA 2XHEB 4CZZB 5JDHA 1VOMA 5FXZA 1LXEA 2CBIA 5L3EB 1RGHA 4B3TT 2W03A 2YU2A 5M4YA 3Q90A 3AAIA 5LXTE 3VR8A 3PE0A 1X1XA 2XSOB 2MF7A 3RF1A 2BU4A 2WGQA 3EBTA 3N2GE 2J4GA 3NZPA 2DNXA 4PK6A 4GKKT 1KQS2 2C11A 5LG3A 2JQKA 1HFAA 3L09A 1IBKT 2XFTA 3NBJA 1YIT3 4YFSA 1OHSA 1JN5B 5FGOA 3SVAA 2KF6A 2JMHA 1LRAA 3TLWA 1SUMB 1ROAA 4WWUC 3KBTA 3UQ4A 2JIWA 2LSIA 2X9HA 3U78A 5CGMA 2WGOA 4HVNA 5JPPA 3JVCA 2BKPA 5TGNA 2K0MA 2PFVA 4JI0T 2P9BA 5ABHA 2KSRA 4TWDA 1BSCA 1UGOA 2W0GA 3KDSE 1QJGA 4YXDA 1WMPA 8CHOA 5HXHA 1HG5A 3FG4A 4RNZA 3U3IA 4NUVA 3P4SA 2BMQB 1EKMA 3A8YC 5L3FB 4OHFA 1B21A 1YGEA 2F4YA 1G73A 3O1IA 1VQQA 2G0UA 2CWYA 1OPYA 3LJCA 1GMPA 1Q40B 2WZHA 4HTEA 5HAXA 2BS4A 3VKGA 2DL1A 2H3RA 4YSZA 1YI23 2F5MA 3BLZA 3ECFA 4PJNA 5TAOA 1D6YA 3ZJ2A 4HM7B 1BRIA 3GZXB 3PUYF 1S5AA 5IWAT 1STFI 1VQ53 3UB1A 2YN6A 1OH0A 4EBGA 1IZNB 4QXHB 1MMDA 5F8PA 4J8TA 3CX8B 3MZKB 3BQKA 3EC9A 3GN5A 3BNEA 5GONE 1ZP0A 1IVWA 3CCM3 3G16A 4OYJA 5FXWA 1TJDA 1IDPA 1WMNA 5L47A 3H37A 4QXCB 2RGQA
chains in the Genus database with same CATH topology
3RRWA 4JEUB 3F31A 2Y6XA 2E2VA 2SPCA 3N2KE 1JN5A 3LG7A 1E97A 3MPHA 3B57A 2FGTA 1W4NA 2XAQB 4H3UA 1Q7Y4 4CCVA 3F7SA 1J2BA 2XFSA 1W02A 3OKQA 3CNXA 3AAAB 3ESLA 4CI3B 4UV9B 3VU7H 2HMJB 5ADXL 3FSDA 4DBRA 3T8UA 2P05A 4EB6E 4H9PC 3PURA 2OTL3 3RGAA 4K90B 4EXTA 1FGQA 4QWTA 3ZYLA 2INXA 2DWGA 5LHGB 2ML6A 1JB4A 3TKLB 2YEVC 3ALAA 4FR9A 4FJOA 1Q40A 1C7HA 1IJ6A 3X41A 5LCYA 2X68A 4AQFC 2LM9A 2E2TA 2BDEA 3SS1A 2KWIB 2A72A 3EHCA 4FI5A 5STDA 3B7CA 2LEHA 3U97A 3K8PC 3OWUA 3EJVA 4KFFA 2PG8A 2YFLB 1CQSA 2WO0A 2XR8B 1W5ZA 3CX6B 5IF6A 5ELJA 3HI2A 5IEOA 4P0AA 5EK3A 5IG4A 5LJNA 4L0RA 1U5PA 3E0ZA 4BJNA 3V92A 2XQYA 4BA9A 4FCJA 1L5GB 4N6OB 2V1DB 3LBXA 1SJWA 5FW5A 3UT5E 1A2KA 4ILUA 1AR0A 3CU3A 3LMLA 4LMIA 1YJW3 4IT7A 2OA5A 3DM8A 2LJLA 2E9XC 4O4HE 1G8XA 1AV4A 4O2AE 1EG9B 3ROBA 4IIAA 2DI4A 5E0OA 3SXXA 1DMMA 2ES0A 3CCR3 1Q824 5IW9A 4MBQA 5JRCB 3OWSA 3OW22 2XAGB 1VQ93 2EHOC 1SHZC 1YVBI 4RZMA 1YKEB 3JUOA 1LVFA 4PJJA 1EA2A 3ER7A 3HKEE 3Q2PA 3C4XA 3PUSA 2JQ5A 2C5KT 2ZMAA 1DMQA 1N5PA 4QHOA 2Z76A 3S29A 3MKIA 3NUVA 1VQM3 3EUHA 4N6LA 1D1BA 3DTOA 4PW8A 3O8YA 2HPJA 2P09A 3F8XA 4FCMA 1G96A 2W2CA 4K0UA 3AA0B 4N6TA 3PYJA 2LQVA 1NWWA 4YLHA 5CK6A 1HS7A 1EQKA 5D83A 4EAHA 1KD14 5LOVE 3J7Yd 3CCJ3 2BMRB 3PUAA 2XGLA 4NHFA 3QC9A 4R4KA 3CMA3 4X1YE 4ZI7E 2GEYA 2CG0A 5DJQC 3ZEFB 4TV9E 5LC7A 4PK4A 2A15A 3Q1CA 5JRCA 4HKAA 3D0TA 3ZMVB 1IV7A 2CH9A 2CLYB 4CDLA 4WNKA 2B1EA 5CLKA 2MC8A 3N9NA 5AEUB 1S35A 1HX8A 1MNDA 2LSYA 3UL5A 3D3LA 1T98A 2JRKA 1UI8A 3UUXB 5IYZE 3NXJA 5CF2A 1K41A 3X3ZA 4PJLA 3CCV3 4E7ZA 2ZL8A 4IE5A 3V5UA 4IHJE 3FG1A 5LA6E 2W9QA 4KZ1A 3F8HA 2E9XD 4MEIA 4XAXB 4O2BE 1HCIA 3FB2A 3DXOA 1FGOA 3AB3B 5HXRA 1LVKA 1ZKEA 1UUWB 1E3RA 2CC3A 2QGUA 3MG2A 1SIIA 3S4UA 2F99A 4ZI2C 5CF1A 2EHOD 3I553 2ZM8A 3K3OA 3GA8A 2I9WA 1IK3A 1MMNA 1IQXA 2D5UA 1YHQ3 3PTRB 2GU3A 4BJMA 2CWTA 3KVAA 3ZN0B 1IQYA 3CCU3 3GZYB 3I0YA 2W0QA 3MSOA 3HR0A 3SRZA 4IDZA 5DQVA 3LTBA 3H51A 1OGZA 2KMFA 4GL6A 5J2TE 1ZX2A 4UVCB 3MG3A 3A5XA 3WOEB 1YKHB 1NWMX 5JQGE 2K9AA 3VF1A 3P8CD 2C5JA 3EX9A 1BR1A 3WAKA 4H9OC 2VKDA 5ETWA 3JUNA 4K61A 4V1Av 4IE4A 3J9X1 4HM8B 2CMRA 1HTJF 4I4KA 3M65A 3N2OA 5KP3A 2O9UX 1FGMA 2F86B 4BTXA 2UXXB 5J1GA 5A1LA 3JUQA 3KV9A 3AA1B 3LT9A 4I4TE 3SWHA 4EZHA 3PCRA 3ZMZB 5HYAA 2L3LA 2W56B 4UVAB 5FY7A 4HBRA 1SIHA 3RRCA 3C4ZA 2QEX3 3CCS3 1E3VA 3PU3A 3K9MC 4GIWA 1VQO3 2YFJB 2WWUA 3LK2B 2CE7A 4H9SE 2CW9A 3I9WA 1KSIA 3E08A 3KKGA 3RPUA 3DMCA 3N9PA 1O7WB 2KZ7B 2NW7A 2GEXA 2V7IA 4H9NC 5L2LA 3N9QA 2RP4A 2Y48B 2PZVA 1A2VA 1IVUA 3WMDA 3IF8B 2IA7A 7STDA 3CPZA 4GK5E 3KV6A 4MALA 4X20E 1D6UA 3IEEA 4KVHA 4G2AA 5JDQA 2VWAA 2D2SA 5AIFA 2XAFB 3O4XE 3S28A 2HMOB 3BQIA 1OACA 1OCVA 1WR6A 2E9XA 4KMCA 4JF8A 1JB2A 2FNQA 3FG3A 1JRQA 4EYYR 4ZI2D 5LG4A 4A56A 1GY5A 1W2ZA 5G2GA 4XDVA 1VQ63 3B4PA 2Z6EA 4K1UA 5HGRA 2EHOA 4XBFB 4JRFA 3O1JA 3PDYA 4CXXA 1VQL3 4HGAA 1QMAA 4ZM8A 2GXFA 2HMNB 3OX9A 2WM9A 5EEOA 4UIGA 3F2EA 5AI1A 1VQ43 2WAUA 4EIWA 1LOXA 4J9AA 4ASKA 3WOFB 3ANWA 1FIOA 5EK4A 1HKXA 3DGNA 1IV9A 4FMBA 5JDFA 5LHHB 4HN9A 3OJAA 3RYCE 1VQN3 2OCTA 3J7Yq 2CFGA 3UL6A 3HL6A 3SOLA 1VQ83 3ETVA 2CLYC 1BUQA 1RN7A 3CX7B 4R80A 1VQP3 3CKDA 3NV0B 3BNCA 3OBVE 2LT3A 1IU7A 4N6NB 3I563 1KK7A 3GMIA 2JMKA 4BTYA 3KV5A 2QGSA 3HIIA 5ELUA 4ISSA 4DVDA 4XBXA 4X1KE 1O3XA 4IIJE 3ZLIA 3NM2A 2LSGA 3KFQC 1IVVA 1TIJA 3IMAB 4WYKB 3ETUA 5JDGA 4O8SA 3N9OA 4AKZA 3ZC0A 4FMDA 3I0QA 4NREA 4N3VA 3B8LA 3DZLA 3KZTA 4AKIA 1M904 1W7CA 1S94A 4CI1B 2CWUA 4QX8B 4HM6B 2D0TA 4R1KA 4AQGA 3MG1A 1CYUA 3T8OA 1M9GA 2OWPA 4I55E 2CFLA 4PNIA 1JV2B 3JC6D 4L8OA 4QWNB 1ZHCA 1FEWA 4TZ4C 1ULIB 4ANJA 3EDUA 2IUJA 2OTJ3 4ADZA 3Q9DA 3LFMA 2X67A 2IC6A 3ZPOA 4CI2B 1E1HB 1TP6A 4HE8A 1FGRA 1O7HB 4HZ9B 3C50A 4AI6A 1SPUA 3NV0A 2X66A 3ZYMA 4M1PA 3UNLA 1MIWA 5IG0A 2Q07A 1NAFA 3PXMA 1FGTA 5L3BB 2XEPA 3H3HA 2GBWB 4HM1B 2YU1A 1BR4A 3WA2X 5AYRB 4UEMA 4BAYB 2BZBA 4MFRA 1M1K4 5KDMC 4WYKA 3FKAA 2VASA 5JDMA 2E2UA 1UUVB 1TFOA 4AKRB 3DUKA 2KWHA 2NW8A 3PUQA 4HFVA 3KINB 1PU4A 5HWXA 2FXTA 5LBMA 5EVHA 5HXCA 4H9QC 4EYCA 2GBXB 2JJ9A 4PJMA 4R9LA 2A3DA 3IBPA 1IAPA 1D1CA 3CCL3 4O02B 4UF0B 5JR9B 2UX0A 2GK9A 4L8PA 4Z8XA 4EXRA 2C10A 2KCDA 3MYTA 3IPTA 5F3JA 2IAKA 5H6RB 3LXUX 4R9KA 5FMNA 3KV4A 2E8IA 4K1VA 1QVG2 3WDGB 4KBMB 4FMAA 3E99A 3CPOA 4CQIA 4XM4A 3UUNA 3Q2MA 1Q814 5C8YE 3PS8A 1W6CA 2CM0A 3LK3B 2JDIH 4TUYE 4ZI3D 2N2NA 3LOYA 2KRTA 1NU3A 1U8CB 4ZS3A 3CWZB 4P09A 4IPBA 2KNDA 5H6QB 4XBTA 4EOZB 1JNQA 5KP1A 2D42A 4PEJA 1W6YA 3ONXA 5BVBA 2KXPB 4TN7B 3OXAA 2WSSV 2DCFA 4L5GA 5BMVE 4X2HA 4EV5A 3LT8A 1OHPA 1CUNA 4J2CA 2BVLA 3O1HA 1M1XB 4L7KA 3R6NA 3ZYKA 2BO9B 3C4WA 1KC84 2XAJB 3P7IA 2PBIA 2MBGA 1KWIA 1NB5I 1NJI4 3ZJ1A 1GD4A 3HIGA 4EV2A 3G713 3CCQ3 2VB6A 3CNMA 4YHJA 3SOAA 4HZBB 2M7OA 1ULJB 3QRDA 4UF0A 2NOXA 3UUMA 4WBOA 5JR9A 1S723 5DREA 4AKLA 1WRDA 3JUMA 4N6V0 1QAKA 3MA9A 2DHRA 5L3GB 2W6JH 5L3DB 3HKCE 3OYZA 3O9XA 4LEHA 3FBZA 3CQXC 3GAXA 5LGNB 2KLQA 4ZOLE 3CC43 1MNEA 3HKBE 3MKDA 3NBRA 3BQLA 3G6E3 1BR0A 2HMLB 2CWOA 2XUEA 4HM0B 2IW5B 3FF0A 3FF2A 4AKYA 1VRBA 2W61A 4X2OA 3C51A 1AVLA 4CXYA 3QUJA 4U72A 5HWYA 1AJ3A 3KN4A 3KBUA 4RBNA 3UULA 3BB9A 2JQQA 1WNHA 5LYJE 2WMNA 1GY6A 2CFDA 1U5OA 4MJDA 1NDOB 2Q9QD 1IT8A 4O4LE 1YJ93 1HU9A 1U4QA 1GYBA 5DRVA 2STDA 5HXSA 4O4JE 4JLEA 1OGXA 5AFUL 4L9IA 3OV4A 5JVDE 2CG1A 4LSOA 1BR2A 3SLUA 4XZCA 3RC8A 2PNCA 3F7XA 1K8A4 1YW0A 3CQCB 1DYUA 3BK9A 3Q5WA 1O7PB 2WOFA 1N8R4 5JH7E 5LGTB 5AEWB 3FHNA 3CQGB 4ZHQE 3X42A 2HMKB 1GY7A 2D1WA 4HKVB 4ERRA 2KT9A 1Y64B 5DQWA 3G0KA 3L3PA 4HM2B 3EF8A 5IG5A 4KUMB 1IJ5A 1N9JA 3FLJA 2ACXA 2Y73A 4QXBB 3EVYA 2O3OA 2K54A 1X79A 4TX4A 2Q9QB 4GOUA 1OUNA 3EN8A 4FCZA 3HX8A 1UCUA 5D81A 3D9RA 3T8NA 2ODUA 3A76A 1FMWA 4H61A 1N8QA 3ZMTB 3S5CA 5JPUA 2X9YA 1K9M4 2GU1A 3DJBA 4HJLB 2NW9A 1Z1SA 4IGUA 3G8ZA 4O4IE 2LOPA 4CXWA 5IG3A 2VL8A 1D0ZA 3F40A 5JDLA 1Q864 3EDVA 1CEWI 1OHOA 2C5IT 2VK9A 5DABA 1D0XA 5D82A 3RYFE 4FMCA 4MMZB 2L8KA 1UX5A 1ZEEA 3MK7C 1VQ73 4AKHA 1OWAA 3JC6C 1A67A 3GN5B 3NM7A 4HEAA 1TU5A 3RGRA 5FXXA 3AAEB 3IHRA 3ZCIA 5JR9C 4G63A 1DMNA 2QA7A 1W00A 4I43B 2P38A 2H7VC 2W56A 1TUHA 1T5YA 3DGOA 2WBLA 1GS3A 2CWVA 3MXZA 2ML5A 1F8NA 1DVCA 1QAFA 2V1LA 3NHXA 1D6ZA 1IT7A 3LYGA 3N9MA 1QUUA 3EE1A 2ZLYA 2NWBA 4RNYA 3PGBA 4XB5A 2LHNA 3EN1B 2Q9QA 3GWHA 3S27A 4LGQA 3GRDA 2CFWA 2OOVA 4UVBB 4PFOA 3KIIA 4G1MB 3KE7A 5IENA 1A90A 5A0OB 3JUPA 3K63A 2CXLA 3NBXX 3DP7A 5CB4E 1FMVA 4OFZA 3CME3 2Z6BA 6STDA 2HPLA 1GD3A 2Y8DA 2V7JA 2VKJA 2P0MA 2OQEA 2W62A 1US1A 3SEDA 2IMJA 3EB8A 3GZRA 4N6MA 3V98A 5AYSC 5IERA 4IE6A 1W01A 2X9WA 1Q42A 1SA0E 2W00A 5CA0E 3WAJA 1JJ22 3CC73 1H7CA 4PK5A 1R4CA 2ZDJA 2V7LA 4PAGA 2DLRA 4UV8B 2P0XA 1CYVA 2RSXA 3MHEA 2XSHB 4H9RC 2NTXA 3LBXB 2MOZA 4ZI3C 5LBQB 2ODVA 3NRXA 2IC9A 1US7B 1JKGB 4MHCA 4WBNE 2K24A 5FXVA 3AA6B 1AVKA 1TFKA 4UELA 3RC3A 4UXNB 1V74A 1HG2A 2X51A 4DMVA 2XAHB 4I50E 4MMYB 1Z0PA 3IJEB 5I97A 3CCE3 3ZMUB 2Y74A 3KFWX 2B1XB 3F57A 4XBYA 2N9DA 3LTAA 2CCQA 1O7NB 2V7KA 4GK0E 3GZBA 3UTKA 2A2FX 4C90A 1QVF2 1ZV4X 2L9QA 5JDNA 3Q5XA 3HK4A 2LSJA 5L3CB 3PCSA 3MACA 1PFPA 2NTYA 2Z7AA 3X3YA 1RRLA 3FBLA 3FH1A 3F14A 4ORLA 3RDEA 4KP3C 3V99A 3B13A 3FCSB 2LYXA 4HM4B 5J2UE 2L4VA 4NUUA 3NZQA 2LOSA 2IUKA 2X9XA 1OXZA 5FNVE 1RJOA 1K734 4N78D 1IVXA 5BXQA 2CHCA 3NQYA 3S67A 3NQZA 1RKYA 5LJMA 5JREA 2XF3A 3K5TA 3RYHE 1QALA 1MIVA 1ZO2A 1WQLB 2KINB 2LE8A 3K0ZA 2BHMA 1K28A 1JKGA 3CVRA 4MLKA 4C91A 1UI7A 2CKFB 2ZM2A 4TV8E 3NBBA 3MJXA 3EQQB 2XRXB 1N9EA 3N8BA 3H3AA 3CXC2 3CMLA 4DNDA 4QKNA 4TX5A 3PUGA 1D1AA 2CXFA 4GYRA 5EZYE 4AXPA 3KVBA 2Q9QC 4STDA 4QX7B 1UX4A 1WTHA 4U13A 2CXDA 1HF8A 5EQLA 4EC6A 3RH3A 2OOVC 2RA1A 4KFEA 1LNHA 3HKDE 1Y4KA 3STDA 3I9YA 3X3XA 4OK0A 1IQ8A 3WI3A 3L0RA 2WMOA 5KMGP 5JBSA 2OQEC 4X1IE 1OF5B 1ROVA 5HXEA 5CXOA 2N1GA 2VKOA 3LK42 1VQK3 2HMMB 3RYIE 3FGYA 2BNGA 2JPFA 1STDA 2V26A 3ZC1A 4B6XA 3I0OA 2VKHA 2C0SA 1KNZA 2BMOB 2RFRA 3PU8A 1MIYA 3U1WA 4OUQA 3LTDA 3ZMSB 4O2HA 3K3NA 4IE7A 5LNKA 3SX1A 3ZN1B 4N6UA 3QK6A 3VGNA 2V7MA 3ZCJA 4WFOA 4KFDA 4Q53A 3LZAA 4WHAA 1YIJ3 2CFKA 2QIYA 4AEQA 4IE0A 4P0BA 1MMGA 3UJMA 3AMOB 4OVMA 3AVRA 4H63H 4YJ2E 4DBQA 4EYUA 4EZ4A 2M67A 2XGNA 2YFIB 3B4OA 3BNBA 4DO0A 1D0YA 2YX9A 3SOYA 1V9DA 2PJQA 2W63A 3PZWA 3OWYA 1NB3I 2H7OA 4XDWA 2SBLA 3DY5A 3GWRA 4O3VA 2XASB 3T0UA 3X40A 3K3QC 3HI7A 1VZZA 1UW1A 2J1DG 1LRZA 2MTQA 1OF5A 2CA5A 3I1AA 4F6RC 1ISKA 1B7TA 3NRYA 3N5LA 2CIUA 5FYMA 4GYSA 4WP5A 5IEPA 2LHRA 3KSED 4ZS2A 3E22E 5LP6E 3VSYA 4PFPA 3RX6A 2I59A 3UFEA 3LTCA 2YK0A 3TDGA 1RRHA 2R4IA 4DMWA 4U74A 3AVSA 5IHYA 2YINA 5AIIA 5LHIB 4GB5A 3WA3A 4HYZA 3RKOA 2XH9A 4OYKA 3LH4A 1LKXA 3C98B 4ISTA 2K48A 3C64A 5FP3A 2K5BB 1JB5A 3CPW2 3CC23 5FY0A 3FXEB 3DGLA 1FA3A 2ZM0A 4BTWA 3N9HA 3FXDB 1MOLA 2XTLA 4AKGA 3G4S3 3VKHA 3QK9A 1O7GB 1WMOA 2LSKA 3AA7B 3AMOA 1NO3A 2UXNB 2W04A 2CK3H 2Z77A 5CA1E 3K7CA 3HZPA 2KXGA 3MWZA 3N9LA 2D0UA 2X0LB 4H63V 4HM5B 1W2B2 3HA4A 2E9XB 1YD8G 1FUWA 5LGUB 3FZWA 3WODG 4E7SA 2MYSA 3V5SA 1LVNA 3KSPA 3DGMA 1YJN3 4HM3B 1SQWA 2HH7A 2EHOB 4YJ3E 5LC6A 3N54B 1W6GA 3F9SA 2BT3A 4JUYA 3OYXA 3W15B 4MMXB 1MMAA 2F98A 3BNDA 2RCDA 2NP9A 1ASKA 1MNLA 4WW0A 2DWKA 1O7MB 2W9PA 3CD63 4AQFA 3R84B 2WOHA 5KP4A 1EZ3A 1DVDA 1WYCA 2CEAA 3M8CA 1QSDA 3ANWB 4LZIA 2QA43 5KX5E 3VHLA 5AIGA 5EK2A 2BVMA 3NX0A 1WYBA 3EBYA 1N5HA 4JEHB 5FY1A 1WLXA 2XHEB 4CZZB 5JDHA 1VOMA 5FXZA 1LXEA 5L3EB 2W03A 2YU2A 5M4YA 3Q90A 3AAIA 5LXTE 3PE0A 2XSOB 2MF7A 2WGQA 3EBTA 3N2GE 3NZPA 2DNXA 4PK6A 1KQS2 2C11A 1HFAA 3L09A 2XFTA 3NBJA 1YIT3 4YFSA 1OHSA 1JN5B 5FGOA 3SVAA 2JMHA 1ROAA 4WWUC 3KBTA 2LSIA 2X9HA 3U78A 2WGOA 4HVNA 5JPPA 3JVCA 5TGNA 2K0MA 2PFVA 2P9BA 2W0GA 1QJGA 3KDSE 1WMPA 8CHOA 5HXHA 1HG5A 3FG4A 4RNZA 3U3IA 4NUVA 2BMQB 1EKMA 5L3FB 4OHFA 1YGEA 1G73A 3O1IA 2G0UA 2CWYA 1OPYA 3LJCA 1Q40B 4HTEA 5HAXA 3VKGA 2H3RA 1YI23 3BLZA 3ECFA 4PJNA 5TAOA 1D6YA 3ZJ2A 4HM7B 3GZXB 1S5AA 1STFI 1VQ53 3UB1A 1OH0A 4EBGA 1IZNB 4QXHB 1MMDA 5F8PA 4J8TA 3CX8B 3MZKB 3BQKA 3EC9A 3GN5A 3BNEA 5GONE 1IVWA 3CCM3 3G16A 4OYJA 5FXWA 4QXCB 1IDPA 1WMNA 5AIHA 3H37A 2B24B 2RGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OK0 A;  4O8S A; 
#chains in the Genus database with same CATH topology
 4YHH T;  2I0M A;  2XQ4 A;  3RRW A;  4JEU B;  4LF9 T;  3F31 A;  2Y6X A;  2E2V A;  2SPC A;  3N2K E;  1JN5 A;  3PJA J;  3OTO T;  1HR0 T;  4LF5 T;  3LG7 A;  1E97 A;  5F5W A;  3MPH A;  3B57 A;  5AQL B;  2FGT A;  4AIU A;  1W4N A;  4AIS A;  3NWI A;  2XAQ B;  4H3U A;  1Q7Y 4;  4HFE A;  4CCV A;  5AQV B;  3F7S A;  2XSA A;  1J2B A;  2WWV A;  2XFS A;  1W02 A;  1BIR A;  3OKQ A;  3CNX A;  3AAA B;  3ZG0 A;  4K0K T;  3ESL A;  4CI3 B;  4UV9 B;  3VU7 H;  2HMJ B;  5ADX L;  3FSD A;  4DBR A;  3T8U A;  2P05 A;  4EB6 E;  4H9P C;  3PUR A;  2OTL 3;  5FL0 A;  3RGA A;  1XWM A;  4K90 B;  2CPT A;  3UU3 A;  2YDQ A;  4EXT A;  1FGQ A;  4QWT A;  3ZYL A;  2INX A;  1BSB A;  2DWG A;  5LHG B;  2ML6 A;  1JB4 A;  3TKL B;  2YEV C;  3ALA A;  4FR9 A;  4FJO A;  4IL9 A;  1Q40 A;  1C7H A;  1IJ6 A;  3X41 A;  4LF4 T;  5LCY A;  2X68 A;  4AQF C;  2LM9 A;  2E2T A;  2BDE A;  3SS1 A;  2KWI B;  5G1K A;  2A72 A;  4A98 A;  4FI5 A;  2L1S A;  3EHC A;  5STD A;  3B7C A;  4U2Z A;  2LEH A;  4IDQ A;  4DV7 T;  3RLF F;  2I6H A;  3U97 A;  3K8P C;  3ZT7 A;  3OWU A;  3EJV A;  4KFF A;  4IDP A;  2PG8 A;  3QNU A;  2YFL B;  1CQS A;  2WO0 A;  4X66 T;  2XR8 B;  2XQ7 A;  1W5Z A;  3CX6 B;  4JV5 T;  5IF6 A;  1ZGX A;  5ELJ A;  3HI2 A;  4ZZC A;  5IEO A;  1WCR A;  4P0A A;  5EK3 A;  5IG4 A;  5LJN A;  4L0R A;  1U5P A;  3E0Z A;  4BJN A;  3V92 A;  2XQY A;  4BA9 A;  2WZI A;  3P4P A;  4FCJ A;  2H0H A;  1L5G B;  1DU2 A;  2XM1 A;  4N6O B;  2V1D B;  3LBX A;  1SJW A;  5FW5 A;  3UT5 E;  1A2K A;  4ILU A;  1AR0 A;  3CU3 A;  3LML A;  4LMI A;  1XNR T;  1MWU A;  4I5Q A;  1YJW 3;  1HZ1 A;  3B5M A;  4JI5 T;  4IT7 A;  4X64 T;  2YDR A;  2JQH A;  1BNE A;  2OA5 A;  3DM8 A;  3D79 A;  2LJL A;  1GOU A;  2E9X C;  4O4H E;  1G8X A;  1AV4 A;  4O2A E;  2B76 A;  1EG9 B;  3ROB A;  4IIA A;  2DI4 A;  5E0O A;  3SXX A;  1DMM A;  2ES0 A;  2V5D A;  1LQG C;  3CCR 3;  5HEH A;  1Q82 4;  5IW9 A;  4MBQ A;  5JRC B;  3OWS A;  3OW2 2;  2XAG B;  1VQ9 3;  3RQW A;  4ZZB A;  2MAW A;  2EHO C;  4DV1 T;  4DR4 T;  1SHZ C;  1YVB I;  4RZM A;  1YKE B;  3JUO A;  2E5L T;  1LVF A;  4PJJ A;  2BIR A;  1EA2 A;  3ER7 A;  3HKE E;  2XQ9 A;  3AGN A;  3Q2P A;  4CPK A;  2HN1 A;  3C4X A;  3PUS A;  2JQ5 A;  4IL4 A;  2C5K T;  3PJA A;  2ZMA A;  1XMO T;  1DMQ A;  1N5P A;  4QHO A;  2Z76 A;  3S29 A;  3MKI A;  3NUV A;  1VQM 3;  2E5V A;  3EUH A;  4N6L A;  1D1B A;  1BRH A;  1E2A A;  1UUR A;  3AHW A;  3UFG A;  2XPK A;  3DTO A;  4PW8 A;  3O8Y A;  2HPJ A;  2P09 A;  1YXR A;  3F8X A;  2R41 A;  4FCM A;  1MWR A;  1G96 A;  2W2C A;  3FZH B;  4K0U A;  3AA0 B;  4N6T A;  3LDQ B;  1V57 A;  3PYJ A;  2LQV A;  1NWW A;  2LRL A;  2CX0 A;  2WY2 A;  4YLH A;  5CK6 A;  1LOV A;  2B24 B;  1HS7 A;  3AE3 A;  1EQK A;  5D83 A;  4EAH A;  1KD1 4;  5HEG A;  5LOV E;  3AGO A;  3J7Y d;  3CCJ 3;  4U31 A;  2BMR B;  3EHZ A;  3PUA A;  2XGL A;  4NHF A;  3QC9 A;  4R4K A;  3CMA 3;  2YDS A;  4JBW F;  1IYY A;  4X1Y E;  4ZI7 E;  2GEY A;  1BGS A;  2CG0 A;  5DJQ C;  3ZEF B;  4TV9 E;  4NIQ A;  5LC7 A;  4PK4 A;  2A15 A;  3Q1C A;  5JRC A;  4HKA A;  3D0T A;  3ZMV B;  1T72 A;  1IV7 A;  2CH9 A;  1B2M A;  2CLY B;  4CDL A;  4WNK A;  3ZT6 A;  2B1E A;  5CLK A;  2MC8 A;  3N9N A;  5AEU B;  3Q3F A;  1RHL A;  1S35 A;  1HX8 A;  1MND A;  1IBL T;  2LSY A;  3UL5 A;  1JZD A;  3EAM A;  1BNI A;  2FBW A;  3D3L A;  1XDO A;  1T98 A;  4LFA T;  2JRK A;  1UI8 A;  4HFI A;  2WDQ A;  3UUX B;  5IYZ E;  3NXJ A;  5CF2 A;  1K41 A;  2UXB T;  3X3Z A;  1UUG B;  4PJL A;  1PYL A;  3CCV 3;  2XY8 B;  4E7Z A;  2ZL8 A;  4IE5 A;  3SYU A;  3V5U A;  4IHJ E;  3FG1 A;  5LA6 E;  2W9Q A;  1IBM T;  1LOW A;  4KZ1 A;  5CFB A;  3F8H A;  2E9X D;  4MEI A;  2A9U A;  4XAX B;  3FZL B;  1HCI A;  4O2B E;  3FB2 A;  3M3Z B;  3DXO A;  3TLV A;  1FGO A;  3RI5 A;  1BNG A;  5M19 A;  1OED E;  4YY3 T;  3AB3 B;  5HXR A;  1LVK A;  1ZKE A;  5JTG A;  1UUW B;  1JNZ A;  4TWF A;  1E3R A;  2CC3 A;  2QGU A;  1SII A;  3MG2 A;  3S4U A;  2F99 A;  4ZI2 C;  5CF1 A;  2EHO D;  3I55 3;  1XDP A;  2ZM8 A;  3K3O A;  3GA8 A;  2I9W A;  1IK3 A;  1MMN A;  1IQX A;  2D5U A;  1YHQ 3;  3PTR B;  2GU3 A;  4BJM A;  2FJE A;  2CWT A;  3KVA A;  2XQ5 A;  4EED A;  3ZN0 B;  1IQY A;  1DE3 A;  4GSP A;  3CCU 3;  3DH2 A;  3GZY B;  5RNT A;  3I0Y A;  2W0Q A;  1W0A A;  3MSO A;  3HR0 A;  3SRZ A;  1KNP A;  1CH0 A;  4IDZ A;  2W67 A;  5DQV A;  3LTB A;  3H51 A;  1OGZ A;  2KMF A;  4GL6 A;  4JYA T;  3AE9 A;  5J2T E;  1ZX2 A;  1BRS A;  4UVC B;  3MG3 A;  3A5X A;  5FKY A;  3WOE B;  1YKH B;  1NWM X;  1RNT A;  5JQG E;  2K9A A;  3VF1 A;  4JI7 T;  3P8C D;  2C5J A;  3EX9 A;  5GSP A;  1BR1 A;  3WAK A;  2K3W A;  4H9O C;  2VKD A;  5ETW A;  3JUN A;  4LMK A;  4V1A v;  4K61 A;  4IE4 A;  3J9X 1;  1MGR A;  4HM8 B;  2CMR A;  1HTJ F;  1YQ4 A;  4I4K A;  3M65 A;  3N2O A;  5AIH A;  5KP3 A;  1SAR A;  3AEC A;  2O9U X;  1T2I A;  1FGM A;  2F86 B;  4BTX A;  2UXX B;  5J1G A;  5A1L A;  2F56 A;  2PTF A;  3JUQ A;  4KT3 B;  3KV9 A;  5AQI B;  3AA1 B;  1DET A;  3LT9 A;  4ILC A;  1RCL A;  4IDO A;  4I4T E;  1GMR A;  3RIA A;  2YKS A;  3SWH A;  4EZH A;  3PCR A;  3PV0 F;  3ZMZ B;  5HYA A;  2L3L A;  2W56 B;  1R4Y A;  1BRN L;  2UUG C;  4UVA B;  5FY7 A;  4HBR A;  7RNT A;  1SIH A;  6GSP A;  1BRG A;  3RRC A;  3C4Z A;  2QEX 3;  3CCS 3;  3UU6 A;  1E3V A;  3PU3 A;  4GIW A;  3K9M C;  1VQO 3;  2VUR A;  2YFJ B;  5BR8 T;  2WWU A;  3LK2 B;  2CE7 A;  4H9S E;  3WR2 A;  4GHO A;  1BU4 A;  2FJB A;  2WU2 A;  5FL1 A;  2CW9 A;  3I9W A;  1KSI A;  3E08 A;  3NVO A;  3KKG A;  3RPU A;  3DMC A;  3N9P A;  1O7W B;  2KZ7 B;  2NW7 A;  2GEX A;  4YSX A;  2V7I A;  1I70 A;  4DID B;  4H9N C;  5L2L A;  3N9Q A;  4IRE A;  2RP4 A;  2Y48 B;  1RGA A;  2CHO A;  2PZV A;  1A2V A;  2LLY A;  1IVU A;  1I2E A;  3IF8 B;  3WMD A;  2IA7 A;  7STD A;  4DR6 T;  3CPZ A;  4GK5 E;  3D5G A;  3KV6 A;  4MAL A;  4IDN A;  4X20 E;  1D6U A;  3IEE A;  4KVH A;  4G2A A;  5JDQ A;  2VWA A;  2D2S A;  5AIF A;  1ZS7 A;  2XAF B;  3O4X E;  3S28 A;  2H0I A;  2HMO B;  1OED B;  5AQU B;  3BQI A;  1OAC A;  1RNB A;  1OCV A;  3AE4 A;  1WR6 A;  2E9X A;  4KMC A;  4JF8 A;  1JB2 A;  2FNQ A;  3FG3 A;  1JRQ A;  4EYY R;  4ZI2 D;  4J5K A;  4P1N A;  5LG4 A;  4A56 A;  1GY5 A;  1W2Z A;  4HFD A;  1RN1 A;  3Q5D A;  1XMQ T;  9RNT A;  5G2G A;  4XDV A;  4U7Y A;  1VQ6 3;  3B4P A;  2Z6E A;  2BKO A;  4K1U A;  4A97 A;  5HGR A;  2EHO A;  4XBF B;  4JRF A;  3O1J A;  4CJN A;  2LKG A;  4DR1 T;  2QYW A;  3PDY A;  4CXX A;  3AEA A;  1VQL 3;  4HGA A;  4B3S T;  1JBT A;  1QMA A;  1R8I A;  1KF6 A;  4LFB T;  4ZM8 A;  3AED A;  2GXF A;  2HMN B;  3OX9 A;  2WM9 A;  5EEO A;  4UIG A;  3F2E A;  5AI1 A;  1VQ4 3;  2WAU A;  4EIW A;  1LOX A;  4J9A A;  3KCH A;  4ASK A;  1FUS A;  3WOF B;  3T1Y T;  3ANW A;  1FIO A;  5EK4 A;  1HKX A;  3DGN A;  1IV9 A;  4FMB A;  5JDF A;  5LHH B;  1MGW A;  3T1H T;  4HN9 A;  3OJA A;  3RYC E;  1VQN 3;  1BNF A;  4ILA A;  2OCT A;  3VRA A;  3J7Y q;  2CFG A;  3G06 A;  3UL6 A;  3HL6 A;  3SOL A;  4U2Y A;  1VQ8 3;  1W0B A;  2IML A;  3ETV A;  3A5E A;  2CLY C;  1BUQ A;  1RN7 A;  1YQ3 A;  3CX7 B;  4R80 A;  2IDO B;  1VQP 3;  3CKD A;  3NV0 B;  3BNC A;  1OED A;  3OBV E;  2LT3 A;  1GOY A;  1IU7 A;  4N6N B;  3I56 3;  1KK7 A;  3GMI A;  2JMK A;  4BTY A;  1RTU A;  3KV5 A;  2QGS A;  3HII A;  5ELU A;  4ISS A;  4DVD A;  4XBX A;  2HHH T;  4X1K E;  1O3X A;  4IIJ E;  3ZLI A;  4Z91 A;  2AE9 A;  3NM2 A;  2LSG A;  4X62 T;  3KFQ C;  3AEB A;  4NPP A;  1IVV A;  1TIJ A;  3ZFZ A;  3IMA B;  3AE7 A;  3ETU A;  4WYK B;  5JDG A;  4O8S A;  2WP9 A;  3RGL A;  2UUC T;  4HFB A;  3N9O A;  2ACZ A;  4AKZ A;  3ZC0 A;  4FMD A;  1L0V A;  3CIR A;  3I0Q A;  4NRE A;  4N3V A;  1HYF A;  4HWH A;  3B8L A;  3DZL A;  3KZT A;  4AKI A;  1M90 4;  1W7C A;  1VCS A;  1S94 A;  4CI1 B;  2CWU A;  4QX8 B;  4HM6 B;  1HNZ T;  2D0T A;  5AQJ B;  4NXM T;  4R1K A;  1RLS A;  2AAE A;  4AQG A;  3MG1 A;  2WQY A;  1CYU A;  3T8O A;  1M9G A;  2OWP A;  4I55 E;  2CFL A;  3P50 A;  4PNI A;  1JV2 B;  3JC6 D;  1BRJ A;  4L8O A;  4QWN B;  1ZHC A;  1FEW A;  4TZ4 C;  1LNI A;  1ULI B;  1T2H A;  4ANJ A;  3EDU A;  2UXC T;  2IUJ A;  4ADZ A;  2OTJ 3;  3Q9D A;  2H88 A;  3LFM A;  1UDI I;  2X67 A;  2IC6 A;  3ZPO A;  4CI2 B;  1E1H B;  1TP6 A;  4HE8 A;  4JI8 T;  1FGR A;  1X1Y A;  1O7H B;  1T7S A;  4HZ9 B;  3C50 A;  4AI6 A;  1SPU A;  3NV0 A;  4LFC T;  4DR3 T;  2X66 A;  3ZYM A;  4M1P A;  3UNL A;  1MIW A;  5IG0 A;  2Q07 A;  1NAF A;  1NEK A;  3PXM A;  1FGT A;  5L3B B;  2XEP A;  3H3H A;  2GBW B;  1UGH I;  1UUS A;  2YU1 A;  2HOH A;  1BR4 A;  1WR0 A;  4HM1 B;  3WA2 X;  5AYR B;  2CX1 A;  4UEM A;  1Q7H A;  4BAY B;  2BZB A;  4MFR A;  1M1K 4;  3JAF A;  5KDM C;  4WYK A;  3FKA A;  2VAS A;  4ILF A;  5JDM A;  2E2U A;  5FVL A;  1UUV B;  1TFO A;  4AKR B;  1NEN A;  1KEY A;  3DUK A;  2KWH A;  5BIR A;  2NW8 A;  3PUQ A;  4HFV A;  3KIN B;  1PU4 A;  5HWX A;  2LRK A;  3VR9 A;  2FXT A;  5LBM A;  5EVH A;  5HXC A;  4H9Q C;  4EYC A;  1W09 A;  2GBX B;  2JJ9 A;  4PJM A;  4R9L A;  2A3D A;  3IBP A;  1IAP A;  1D1C A;  5AQR B;  3CCL 3;  2FJA A;  4CN6 A;  4YTP A;  4UF0 B;  5C3J A;  4O02 B;  5JR9 B;  2UX0 A;  2GK9 A;  4L8P A;  4HWD A;  4Z8X A;  4LF6 T;  2C10 A;  4EXR A;  3ZST A;  2KCD A;  3MYT A;  4IT4 A;  4YTN A;  2IY2 A;  3IPT A;  1UCK A;  5F3J A;  2IAK A;  3ZKR A;  4BU4 A;  5H6R B;  3LXU X;  4R9K A;  2XSB A;  1I6Z A;  5FMN A;  3KV4 A;  2E8I A;  2IYJ A;  4K1V A;  1QVG 2;  3WDG B;  4KBM B;  4FMA A;  3E99 A;  3PUZ F;  2IHR 1;  1G02 A;  3CPO A;  4CQI A;  4XM4 A;  3UUN A;  3Q2M A;  1GSP A;  2IIU A;  1Q81 4;  1KFY A;  5C8Y E;  3PS8 A;  1W6C A;  2CM0 A;  1BAO A;  3LK3 B;  2JDI H;  4TUY E;  4DV5 T;  4ZI3 D;  2N2N A;  3LOY A;  2KRT A;  1NU3 A;  2XQ8 A;  1U8C B;  4ZS3 A;  3CWZ B;  4P09 A;  4IPB A;  2KND A;  5H6Q B;  4XBT A;  2HN2 A;  4EOZ B;  1JNQ A;  5KP1 A;  1OED C;  2D42 A;  4PEJ A;  1W6Y A;  3ONX A;  3PUW F;  5BVB A;  2KXP B;  3FZM B;  1GQE A;  1RGK A;  4TN7 B;  3OXA A;  2WSS V;  2DCF A;  4L5G A;  4DR2 T;  5BU4 A;  5BMV E;  4X2H A;  2M6B A;  4EV5 A;  2D9D A;  3LT8 A;  1OHP A;  1CUN A;  4J2C A;  2BVL A;  3O1H A;  1M1X B;  4L7K A;  3R6N A;  3ZYK A;  2BO9 B;  3C4W A;  4EV6 A;  1KC8 4;  2XAJ B;  3P7I A;  2PBI A;  2MBG A;  1G0T A;  1KWI A;  1NB5 I;  1NJI 4;  3ZJ1 A;  1BVI A;  1GD4 A;  4DV6 T;  3HIG A;  4BIR A;  4EV2 A;  3UU4 A;  2R6G F;  1RGE A;  4DUY T;  3G71 3;  3CCQ 3;  2VB6 A;  5AQG B;  1I2F A;  3CNM A;  1BNS A;  3AEE A;  4YHJ A;  2BG9 E;  3ONL C;  3SOA A;  3FZF B;  4HZB B;  1Y01 A;  4TNW A;  1UK5 A;  2M7O A;  1ULJ B;  3QRD A;  4UF0 A;  2NOX A;  3UUM A;  4WBO A;  5JR9 A;  4LF8 T;  3D5I A;  1S72 3;  4EGW A;  1I3I A;  5DRE A;  4AKL A;  1BSE A;  2ZHX B;  1WRD A;  3JUM A;  4N6V 0;  1QAK A;  3MA9 A;  4NXN T;  1FJG T;  1T8B A;  1X9B A;  3EI0 A;  2DHR A;  1RN4 A;  5L3G B;  2W6J H;  5L3D B;  2M6I A;  3HKC E;  3OYZ A;  3O9X A;  4LEH A;  3FBZ A;  3CQX C;  3GAX A;  5LGN B;  2KLQ A;  4ZOL E;  3CC4 3;  1N34 T;  1MNE A;  5L4H A;  3HKB E;  3MKD A;  3NBR A;  3BQL A;  3G6E 3;  1BR0 A;  4BL3 A;  4YSY A;  2CWO A;  2HML B;  2XUE A;  2AXD S;  4HM0 B;  2K3D A;  2UUA T;  2IW5 B;  3FF0 A;  3FF2 A;  4AKY A;  2J62 A;  4YTM A;  5HEO A;  1VRB A;  2W61 A;  4X2O A;  3C51 A;  3AXJ B;  1AVL A;  1I0X A;  4CXY A;  3QUJ A;  2W2U A;  4U72 A;  4HWF A;  5HWY A;  1AJ3 A;  2X0H A;  3KN4 A;  3KBU A;  4EEB A;  3ONJ A;  2GSP A;  4RBN A;  2BBJ A;  3UUL A;  3BB9 A;  2JQQ A;  4X65 T;  1WNH A;  2J8X B;  5LYJ E;  2WMN A;  1GY6 A;  2CFD A;  3P4Q A;  1U5O A;  4MJD A;  4HFC A;  4LMJ A;  1NDO B;  2Q9Q D;  1IT8 A;  4O4L E;  4LML A;  2WU5 A;  2UUB T;  1YJ9 3;  1C54 A;  1HU9 A;  1U4Q A;  1FZU A;  1GYB A;  3JAD A;  5LMU T;  1FUT A;  5DRV A;  2STD A;  5HXS A;  4O4J E;  4U7I A;  4JLE A;  1OGX A;  1BOX A;  5AFU L;  4L9I A;  3OV4 A;  5JVD E;  2CG1 A;  4ZEY A;  4LSO A;  1BR2 A;  4DKI A;  2V8S V;  1GMQ A;  3SLU A;  4XZC A;  3RC8 A;  2PNC A;  3F7X A;  1K8A 4;  1JBR A;  1YW0 A;  3CQC B;  5HEU A;  2UGI A;  2C4B A;  1DYU A;  3BK9 A;  5KXJ A;  3Q5W A;  1O7P B;  2WOF A;  4DUZ T;  1B2Z A;  1N8R 4;  5JH7 E;  5LGT B;  5G1L A;  2IUB A;  5AEW B;  3FHN A;  3CQG B;  4U3C A;  4ZHQ E;  3X42 A;  1RSN A;  2HMK B;  1GY7 A;  2D1W A;  2XQA A;  4HKV B;  4ERR A;  5AQM B;  4GKJ T;  2KT9 A;  1Y64 B;  2V5C A;  5DQW A;  3G0K A;  3L3P A;  4HFH A;  4HM2 B;  3FZK B;  2MPK A;  3EF8 A;  2BBH A;  3X1D A;  5IG5 A;  2CRB A;  4KUM B;  3ZSS A;  3JAE A;  1IJ5 A;  1N9J A;  2FJD A;  1I8V A;  1YVS A;  3FLJ A;  2ACX A;  3AXJ A;  2Y73 A;  4QXB B;  3EVY A;  1JNR A;  2O3O A;  2VL0 A;  2K54 A;  1X79 A;  4JI1 T;  2VVN A;  3D4A A;  1RDS A;  4TX4 A;  2Q9Q B;  1VCT A;  4GOU A;  2BG9 B;  1B3S A;  1OUN A;  3EN8 A;  4FCZ A;  3QOF A;  2F4V T;  3HX8 A;  1EUI C;  1UCU A;  5D81 A;  3D9R A;  3UUB A;  2W4X A;  3T8N A;  2ODU A;  4UR9 A;  3A76 A;  2XZE A;  1FMW A;  4H61 A;  1N8Q A;  3ZMT B;  1J5E T;  3L8R A;  3S5C A;  5JPU A;  2X9Y A;  1K9M 4;  2GU1 A;  3DJB A;  5AQN B;  4HJL B;  2NW9 A;  1Z1S A;  4IGU A;  5ABG A;  4QH1 A;  2XJ7 A;  3G8Z A;  4O4I E;  4DV4 T;  1RGF A;  2LOP A;  4CXW A;  5IG3 A;  2VL8 A;  1D0Z A;  5C2T A;  3F40 A;  1FW7 A;  5JDL A;  3BIR A;  1Q86 4;  3EDV A;  1CEW I;  1OHO A;  1YNV X;  2C5I T;  2VK9 A;  5LB7 B;  4HOH A;  5DAB A;  2SAR A;  1D0X A;  5D82 A;  3RYF E;  4FMC A;  4MMZ B;  2L8K A;  1UX5 A;  1ZEE A;  2OV9 A;  3MK7 C;  1VQ7 3;  4AKH A;  6RNT A;  1OWA A;  3JC6 C;  1CHU A;  4BL2 A;  3GN5 B;  3NM7 A;  1A67 A;  4HEA A;  1TU5 A;  2H0G A;  3RGR A;  5FXX A;  3AAE B;  3RQU A;  3QB5 K;  3ZCI A;  3IHR A;  1AQZ A;  5JR9 C;  4G63 A;  1DMN A;  3ABV A;  1RGL A;  1NNV A;  3UU5 A;  2QA7 A;  1W00 A;  4I43 B;  2P38 A;  3BU4 A;  2H7V C;  2W56 A;  1TUH A;  1T5Y A;  2VQE T;  1TRP A;  1TTO A;  5AQK B;  1I0V A;  4WZX A;  3DGO A;  4A5X A;  2WBL A;  1GS3 A;  2CWV A;  4DV3 T;  3MXZ A;  4JI3 T;  1RMS A;  2ML5 A;  1F8N A;  1DVC A;  1QAF A;  2V1L A;  3NHX A;  1D6Z A;  4JI6 T;  1IT7 A;  3LYG A;  1UCI A;  3N9M A;  1QUU A;  3EE1 A;  2ZLY A;  1BNJ A;  2NWB A;  2W66 A;  4COF A;  4RNY A;  3PGB A;  4XB5 A;  2LHN A;  2RBI A;  3EN1 B;  2Q9Q A;  3GWH A;  3S27 A;  4LGQ A;  2BG9 A;  1W9R A;  3GRD A;  2CFW A;  2OOV A;  3TLU A;  4UVB B;  4PFO A;  5IUX A;  3KII A;  4G1M B;  3KE7 A;  3LSV A;  5IEN A;  1A90 A;  5A0O B;  3JUP A;  3K63 A;  2CXL A;  3NBX X;  3DP7 A;  5CB4 E;  1FMV A;  4OFZ A;  3CME 3;  2Z6B A;  6STD A;  2HPL A;  4CN4 A;  1GD3 A;  1HX1 B;  2Y8D A;  2V7J A;  2VKJ A;  2P0M A;  3AEF A;  2OQE A;  2W62 A;  1US1 A;  1RCK A;  3SED A;  1BNR A;  2IMJ A;  3EB8 A;  3GZR A;  4N6M A;  3V98 A;  5AYS C;  2XQ6 A;  5IER A;  4IE6 A;  1W01 A;  2X9W A;  3CK6 A;  1Q42 A;  1Z8U A;  1SA0 E;  2W00 A;  5CA0 E;  3WAJ A;  1JJ2 2;  4AQY T;  3CC7 3;  4DR5 T;  1H7C A;  2CHN A;  4PK5 A;  1R4C A;  5AQT B;  2ZDJ A;  3RIU A;  2V7L A;  2QRX A;  2DLR A;  4PAG A;  4F8H A;  4UV8 B;  2X0Y A;  2P0X A;  2J47 A;  4X5T A;  1CYV A;  2KF4 A;  4HAA A;  2RSX A;  3MHE A;  2XSH B;  1X1W A;  4H9R C;  2NTX A;  3LBX B;  4DV2 T;  3RHW A;  2MOZ A;  2UXD T;  4ZI3 C;  5LBQ B;  4KHP T;  2ODV A;  5FVK A;  3SFD A;  1A2P A;  3NRX A;  2V6Y B;  5LMN T;  2IC9 A;  1US7 B;  1JKG B;  4MHC A;  2KF3 A;  4WBN E;  2K24 A;  5FXV A;  3AA6 B;  1AVK A;  1Q9E A;  1TFK A;  1UCJ A;  2WCA A;  4UEL A;  3RC3 A;  4UXN B;  1V74 A;  5AQO B;  1HG2 A;  4Q25 A;  4CN1 A;  2X51 A;  4DMV A;  1SE7 A;  2XAH B;  4I50 E;  4MMY B;  1Z0P A;  3IJE B;  2UU9 T;  5I97 A;  2VVS A;  3CCE 3;  5HEJ A;  3NKZ A;  3ZMU B;  2Y74 A;  3KFW X;  2B1X B;  3F57 A;  4XBY A;  2N9D A;  5L4E A;  3LTA A;  2CCQ A;  1O7N B;  2V7K A;  4GK0 E;  3GZB A;  3UTK A;  2A2F X;  4C90 A;  1QVF 2;  1ZV4 X;  2L9Q A;  5JDN A;  3Q5X A;  3HK4 A;  2LSJ A;  5L3C B;  3PCS A;  3MAC A;  1PFP A;  2RPA A;  4U33 A;  2NTY A;  2WDR A;  2Z7A A;  3X3Y A;  1RRL A;  3FBL A;  3FH1 A;  3F14 A;  2WDV A;  4ORL A;  3RDE A;  4KP3 C;  3V99 A;  3B13 A;  3AEG A;  3FCS B;  2LYX A;  4HM4 B;  5J2U E;  2L4V A;  4NUU A;  3NZQ A;  2LOS A;  2IUK A;  2X9X A;  1OXZ A;  5FNV E;  1RJO A;  4LF7 T;  1GOV A;  1K73 4;  2LKH A;  4N78 D;  3ZG5 A;  4RNT A;  1IVX A;  1X1U A;  5BXQ A;  2CHC A;  3NQY A;  3S67 A;  3NQZ A;  1I94 T;  1RKY A;  2ZA4 A;  3AE2 A;  5LJM A;  2YOE A;  1B2U A;  1BSA A;  5AQP B;  5JRE A;  2XF3 A;  3K5T A;  3RYH E;  1QAL A;  3RNT A;  1MIV A;  1ZO2 A;  3GSP A;  4KHZ F;  1B2X A;  1WQL B;  1BUJ A;  2KIN B;  2V6Y A;  5M1A A;  2LE8 A;  3AE5 A;  3K0Z A;  2BHM A;  1K28 A;  1JKG A;  3Q5E A;  3CVR A;  4MLK A;  4C91 A;  1UI7 A;  4DV0 T;  2CKF B;  2ZM2 A;  4TV8 E;  3NBB A;  3MJX A;  2BKN A;  3EQQ B;  2XRX B;  1N9E A;  3N8B A;  3H3A A;  1JZO A;  3WHO A;  3CXC 2;  2WB5 A;  3CML A;  4DND A;  4QKN A;  4TX5 A;  3PUG A;  4I0U A;  1D1A A;  2CXF A;  4GYR A;  5EZY E;  4AXP A;  3RKG A;  3KVB A;  2OLT A;  2Q9Q C;  4STD A;  4QX7 B;  1UX4 A;  1WTH A;  4U13 A;  2BG9 C;  2CXD A;  1HF8 A;  1I2G A;  1YGW A;  5EQL A;  4EC6 A;  3RH3 A;  2OOV C;  7GSP A;  5HCJ A;  1E7P A;  1ZOY A;  2RA1 A;  4KFE A;  3TLS A;  4Z90 A;  1LNH A;  3HKD E;  1Y4K A;  3STD A;  4QH4 A;  3I9Y A;  5AQF B;  4OK0 A;  3X3X A;  2XQ3 A;  3AE1 A;  3ZT5 A;  1IQ8 A;  4HWI B;  3WI3 A;  3L0R A;  2WMO A;  5KMG P;  5JBS A;  3UU8 A;  2OQE C;  1BSD A;  4X1I E;  5AQS B;  1OF5 B;  1ROV A;  5HXE A;  5CXO A;  2N1G A;  2LM2 A;  2VKO A;  3EAB A;  3LK4 2;  3A7M A;  1VQK 3;  2HMM B;  1KNR A;  3RYI E;  2VQF T;  3FGY A;  3JCF A;  2BNG A;  2JPF A;  4NPB A;  1STD A;  2V26 A;  5ABE A;  3ZC1 A;  4B6X A;  3I0O A;  2VKH A;  5M18 A;  3RIU C;  4KI0 F;  1PY3 A;  3TLT A;  2V6X A;  2C0S A;  1KNZ A;  1B20 A;  1TRQ A;  2BMO B;  2QVA A;  2RFR A;  3PU8 A;  1MIY A;  2NR4 A;  3U1W A;  1FYS A;  4OUQ A;  3AHS A;  3LTD A;  1XZY A;  2FUP A;  3ZMS B;  4O2H A;  3QB5 A;  5AQH B;  3K3N A;  4IE7 A;  1AY7 A;  5LNK A;  4LYL B;  3SX1 A;  3H3M A;  3ZN1 B;  4N6U A;  1B2S A;  3QK6 A;  3VGN A;  2V7M A;  3ZCJ A;  4WFO A;  4EW5 A;  4KFD A;  4B3M T;  4Q53 A;  2JQ9 A;  3LZA A;  4WHA A;  4TWH A;  1YIJ 3;  3AE8 A;  2CFK A;  2QIY A;  4AEQ A;  4IE0 A;  4P0B A;  2E2A A;  1RGG A;  1MMG A;  3UJM A;  3AMO B;  4OVM A;  3AVR A;  5HCM A;  4H63 H;  4YJ2 E;  4DBQ A;  4EYU A;  4EZ4 A;  2M67 A;  2XGN A;  2YFI B;  3B4O A;  3BNB A;  1BAN A;  4DO0 A;  1D0Y A;  4JI4 T;  2XM2 A;  2YX9 A;  3SOY A;  1V9D A;  2PJQ A;  2W63 A;  3PZW A;  3OWY A;  1NB3 I;  2H7O A;  4XDW A;  2SBL A;  3DY5 A;  1HNW T;  3HOH A;  1N32 T;  3GWR A;  4O3V A;  1M62 A;  2XAS B;  3T0U A;  3X40 A;  1MWT A;  3K3Q C;  3HI7 A;  4WYV A;  1VZZ A;  2WS3 A;  1UW1 A;  2J1D G;  3VRB A;  2MTQ A;  1LRZ A;  1OF5 A;  2CA5 A;  2CBJ A;  3I1A A;  1HNX T;  1M7K A;  4F6R C;  1ISK A;  1B7T A;  3NRY A;  3N5L A;  2CIU A;  5FYM A;  4GYS A;  5HOH A;  4WP5 A;  2KAA A;  5IEP A;  2H89 A;  2LHR A;  3KSE D;  3OVU A;  4ZS2 A;  5ABF B;  3E22 E;  5LP6 E;  3VSY A;  4PFP A;  3RX6 A;  2I59 A;  3UFE A;  3LTC A;  2YK0 A;  1BRK A;  3TDG A;  1RRH A;  2R4I A;  8RNT A;  1JBS A;  4DMW A;  4U74 A;  3AVS A;  5IHY A;  2YIN A;  5AII A;  5LHI B;  1V58 A;  4GB5 A;  3WA3 A;  2AAD A;  4HYZ A;  3RKO A;  2XH9 A;  4OYK A;  5AQQ B;  3LH4 A;  1LKX A;  4JI2 T;  3C98 B;  4IST A;  2K48 A;  1RGC A;  3C64 A;  5FP3 A;  4J5G A;  2K5B B;  1JB5 A;  3CPW 2;  3CC2 3;  5FY0 A;  3FXE B;  3DGL A;  1FA3 A;  2ZM0 A;  4BTW A;  3N9H A;  3FXD B;  1B27 A;  1MOL A;  3P4W A;  3SFE A;  2XTL A;  4ZXL A;  4AKG A;  3IA3 A;  3G4S 3;  3VKH A;  3QK9 A;  2BS3 A;  1O7G B;  1WFD A;  1WMO A;  2LSK A;  3AA7 B;  4OX9 T;  1N33 T;  4TNV A;  3AMO A;  3K1S A;  3DGY A;  4YT0 A;  3OPC A;  1NO3 A;  2UXN B;  2W04 A;  2CK3 H;  2Z77 A;  5CA1 E;  4ILB A;  3K7C A;  3HZP A;  1T3B A;  2KF5 A;  2KXG A;  3MWZ A;  3N9L A;  2D0U A;  1J1J A;  2X0L B;  3PUV F;  4H63 V;  1MWS A;  5J0Z A;  4HM5 B;  1W2B 2;  3HA4 A;  2E9X B;  1YD8 G;  3PUX F;  1FUW A;  3P4R A;  5LGU B;  3FZW A;  3WOD G;  4E7S A;  2MYS A;  3V5S A;  1LVN A;  3KSP A;  3DGM A;  1YJN 3;  4HM3 B;  3RIF A;  1N36 T;  2F5W A;  1SQW A;  2HH7 A;  2EHO B;  1UCL A;  4YJ3 E;  5LC6 A;  3N54 B;  1W6G A;  3F9S A;  2BT3 A;  4JUY A;  3OYX A;  1I3F A;  3W15 B;  4MMX B;  3AE6 A;  1MMA A;  5ABF A;  2F98 A;  3URP A;  3BND A;  2RCD A;  2NP9 A;  1ASK A;  1MNL A;  4HWC A;  4WW0 A;  2DWK A;  1O7M B;  2W9P A;  1LOY A;  3CD6 3;  4AQF A;  3R84 B;  1J5W A;  2WOH A;  5KP4 A;  1EZ3 A;  2ZM6 T;  1DVD A;  1WYC A;  2CEA A;  3M8C A;  1QSD A;  3ANW B;  1LQM B;  4LZI A;  4B3R T;  2RNT A;  2QA4 3;  3UQ7 A;  5KX5 E;  2BS2 A;  3VHL A;  5AIG A;  4QH5 A;  5EK2 A;  2BVM A;  1UGI A;  3NX0 A;  5CJ5 A;  1QLB A;  1XNQ T;  1WYB A;  4DR7 T;  3EBY A;  1N5H A;  1EEJ A;  4KX6 A;  4JEH B;  5FY1 A;  3L39 A;  1WLX A;  2XHE B;  4CZZ B;  5JDH A;  1VOM A;  5FXZ A;  1LXE A;  2CBI A;  5L3E B;  1RGH A;  4B3T T;  2W03 A;  2YU2 A;  5M4Y A;  3Q90 A;  3AAI A;  5LXT E;  3VR8 A;  3PE0 A;  1X1X A;  2XSO B;  2MF7 A;  3RF1 A;  2BU4 A;  2WGQ A;  3EBT A;  3N2G E;  2J4G A;  3NZP A;  2DNX A;  4PK6 A;  4GKK T;  1KQS 2;  2C11 A;  5LG3 A;  2JQK A;  1HFA A;  3L09 A;  1IBK T;  2XFT A;  3NBJ A;  1YIT 3;  4YFS A;  1OHS A;  1JN5 B;  5FGO A;  3SVA A;  2KF6 A;  2JMH A;  1LRA A;  3TLW A;  1SUM B;  1ROA A;  4WWU C;  3KBT A;  3UQ4 A;  2JIW A;  2LSI A;  2X9H A;  3U78 A;  5CGM A;  2WGO A;  4HVN A;  5JPP A;  3JVC A;  2BKP A;  5TGN A;  2K0M A;  2PFV A;  4JI0 T;  2P9B A;  5ABH A;  2KSR A;  4TWD A;  1BSC A;  1UGO A;  2W0G A;  3KDS E;  1QJG A;  4YXD A;  1WMP A;  8CHO A;  5HXH A;  1HG5 A;  3FG4 A;  4RNZ A;  3U3I A;  4NUV A;  3P4S A;  2BMQ B;  1EKM A;  3A8Y C;  5L3F B;  4OHF A;  1B21 A;  1YGE A;  2F4Y A;  1G73 A;  3O1I A;  1VQQ A;  2G0U A;  2CWY A;  1OPY A;  3LJC A;  1GMP A;  1Q40 B;  2WZH A;  4HTE A;  5HAX A;  2BS4 A;  3VKG A;  2DL1 A;  2H3R A;  4YSZ A;  1YI2 3;  2F5M A;  3BLZ A;  3ECF A;  4PJN A;  5TAO A;  1D6Y A;  3ZJ2 A;  4HM7 B;  1BRI A;  3GZX B;  3PUY F;  1S5A A;  5IWA T;  1STF I;  1VQ5 3;  3UB1 A;  2YN6 A;  1OH0 A;  4EBG A;  1IZN B;  4QXH B;  1MMD A;  5F8P A;  4J8T A;  3CX8 B;  3MZK B;  3BQK A;  3EC9 A;  3GN5 A;  3BNE A;  5GON E;  1ZP0 A;  1IVW A;  3CCM 3;  3G16 A;  4OYJ A;  5FXW A;  1TJD A;  1IDP A;  1WMN A;  5L47 A;  3H37 A;  4QXC B;  2RGQ A; 
#chains in the Genus database with same CATH homology
 3RRW A;  4JEU B;  3F31 A;  2Y6X A;  2E2V A;  2SPC A;  3N2K E;  1JN5 A;  3LG7 A;  1E97 A;  3MPH A;  3B57 A;  2FGT A;  1W4N A;  2XAQ B;  4H3U A;  1Q7Y 4;  4CCV A;  3F7S A;  1J2B A;  2XFS A;  1W02 A;  3OKQ A;  3CNX A;  3AAA B;  3ESL A;  4CI3 B;  4UV9 B;  3VU7 H;  2HMJ B;  5ADX L;  3FSD A;  4DBR A;  3T8U A;  2P05 A;  4EB6 E;  4H9P C;  3PUR A;  2OTL 3;  3RGA A;  4K90 B;  4EXT A;  1FGQ A;  4QWT A;  3ZYL A;  2INX A;  2DWG A;  5LHG B;  2ML6 A;  1JB4 A;  3TKL B;  2YEV C;  3ALA A;  4FR9 A;  4FJO A;  1Q40 A;  1C7H A;  1IJ6 A;  3X41 A;  5LCY A;  2X68 A;  4AQF C;  2LM9 A;  2E2T A;  2BDE A;  3SS1 A;  2KWI B;  2A72 A;  3EHC A;  4FI5 A;  5STD A;  3B7C A;  2LEH A;  3U97 A;  3K8P C;  3OWU A;  3EJV A;  4KFF A;  2PG8 A;  2YFL B;  1CQS A;  2WO0 A;  2XR8 B;  1W5Z A;  3CX6 B;  5IF6 A;  5ELJ A;  3HI2 A;  5IEO A;  4P0A A;  5EK3 A;  5IG4 A;  5LJN A;  4L0R A;  1U5P A;  3E0Z A;  4BJN A;  3V92 A;  2XQY A;  4BA9 A;  4FCJ A;  1L5G B;  4N6O B;  2V1D B;  3LBX A;  1SJW A;  5FW5 A;  3UT5 E;  1A2K A;  4ILU A;  1AR0 A;  3CU3 A;  3LML A;  4LMI A;  1YJW 3;  4IT7 A;  2OA5 A;  3DM8 A;  2LJL A;  2E9X C;  4O4H E;  1G8X A;  1AV4 A;  4O2A E;  1EG9 B;  3ROB A;  4IIA A;  2DI4 A;  5E0O A;  3SXX A;  1DMM A;  2ES0 A;  3CCR 3;  1Q82 4;  5IW9 A;  4MBQ A;  5JRC B;  3OWS A;  3OW2 2;  2XAG B;  1VQ9 3;  2EHO C;  1SHZ C;  1YVB I;  4RZM A;  1YKE B;  3JUO A;  1LVF A;  4PJJ A;  1EA2 A;  3ER7 A;  3HKE E;  3Q2P A;  3C4X A;  3PUS A;  2JQ5 A;  2C5K T;  2ZMA A;  1DMQ A;  1N5P A;  4QHO A;  2Z76 A;  3S29 A;  3MKI A;  3NUV A;  1VQM 3;  3EUH A;  4N6L A;  1D1B A;  3DTO A;  4PW8 A;  3O8Y A;  2HPJ A;  2P09 A;  3F8X A;  4FCM A;  1G96 A;  2W2C A;  4K0U A;  3AA0 B;  4N6T A;  3PYJ A;  2LQV A;  1NWW A;  4YLH A;  5CK6 A;  1HS7 A;  1EQK A;  5D83 A;  4EAH A;  1KD1 4;  5LOV E;  3J7Y d;  3CCJ 3;  2BMR B;  3PUA A;  2XGL A;  4NHF A;  3QC9 A;  4R4K A;  3CMA 3;  4X1Y E;  4ZI7 E;  2GEY A;  2CG0 A;  5DJQ C;  3ZEF B;  4TV9 E;  5LC7 A;  4PK4 A;  2A15 A;  3Q1C A;  5JRC A;  4HKA A;  3D0T A;  3ZMV B;  1IV7 A;  2CH9 A;  2CLY B;  4CDL A;  4WNK A;  2B1E A;  5CLK A;  2MC8 A;  3N9N A;  5AEU B;  1S35 A;  1HX8 A;  1MND A;  2LSY A;  3UL5 A;  3D3L A;  1T98 A;  2JRK A;  1UI8 A;  3UUX B;  5IYZ E;  3NXJ A;  5CF2 A;  1K41 A;  3X3Z A;  4PJL A;  3CCV 3;  4E7Z A;  2ZL8 A;  4IE5 A;  3V5U A;  4IHJ E;  3FG1 A;  5LA6 E;  2W9Q A;  4KZ1 A;  3F8H A;  2E9X D;  4MEI A;  4XAX B;  4O2B E;  1HCI A;  3FB2 A;  3DXO A;  1FGO A;  3AB3 B;  5HXR A;  1LVK A;  1ZKE A;  1UUW B;  1E3R A;  2CC3 A;  2QGU A;  3MG2 A;  1SII A;  3S4U A;  2F99 A;  4ZI2 C;  5CF1 A;  2EHO D;  3I55 3;  2ZM8 A;  3K3O A;  3GA8 A;  2I9W A;  1IK3 A;  1MMN A;  1IQX A;  2D5U A;  1YHQ 3;  3PTR B;  2GU3 A;  4BJM A;  2CWT A;  3KVA A;  3ZN0 B;  1IQY A;  3CCU 3;  3GZY B;  3I0Y A;  2W0Q A;  3MSO A;  3HR0 A;  3SRZ A;  4IDZ A;  5DQV A;  3LTB A;  3H51 A;  1OGZ A;  2KMF A;  4GL6 A;  5J2T E;  1ZX2 A;  4UVC B;  3MG3 A;  3A5X A;  3WOE B;  1YKH B;  1NWM X;  5JQG E;  2K9A A;  3VF1 A;  3P8C D;  2C5J A;  3EX9 A;  1BR1 A;  3WAK A;  4H9O C;  2VKD A;  5ETW A;  3JUN A;  4K61 A;  4V1A v;  4IE4 A;  3J9X 1;  4HM8 B;  2CMR A;  1HTJ F;  4I4K A;  3M65 A;  3N2O A;  5KP3 A;  2O9U X;  1FGM A;  2F86 B;  4BTX A;  2UXX B;  5J1G A;  5A1L A;  3JUQ A;  3KV9 A;  3AA1 B;  3LT9 A;  4I4T E;  3SWH A;  4EZH A;  3PCR A;  3ZMZ B;  5HYA A;  2L3L A;  2W56 B;  4UVA B;  5FY7 A;  4HBR A;  1SIH A;  3RRC A;  3C4Z A;  2QEX 3;  3CCS 3;  1E3V A;  3PU3 A;  3K9M C;  4GIW A;  1VQO 3;  2YFJ B;  2WWU A;  3LK2 B;  2CE7 A;  4H9S E;  2CW9 A;  3I9W A;  1KSI A;  3E08 A;  3KKG A;  3RPU A;  3DMC A;  3N9P A;  1O7W B;  2KZ7 B;  2NW7 A;  2GEX A;  2V7I A;  4H9N C;  5L2L A;  3N9Q A;  2RP4 A;  2Y48 B;  2PZV A;  1A2V A;  1IVU A;  3WMD A;  3IF8 B;  2IA7 A;  7STD A;  3CPZ A;  4GK5 E;  3KV6 A;  4MAL A;  4X20 E;  1D6U A;  3IEE A;  4KVH A;  4G2A A;  5JDQ A;  2VWA A;  2D2S A;  5AIF A;  2XAF B;  3O4X E;  3S28 A;  2HMO B;  3BQI A;  1OAC A;  1OCV A;  1WR6 A;  2E9X A;  4KMC A;  4JF8 A;  1JB2 A;  2FNQ A;  3FG3 A;  1JRQ A;  4EYY R;  4ZI2 D;  5LG4 A;  4A56 A;  1GY5 A;  1W2Z A;  5G2G A;  4XDV A;  1VQ6 3;  3B4P A;  2Z6E A;  4K1U A;  5HGR A;  2EHO A;  4XBF B;  4JRF A;  3O1J A;  3PDY A;  4CXX A;  1VQL 3;  4HGA A;  1QMA A;  4ZM8 A;  2GXF A;  2HMN B;  3OX9 A;  2WM9 A;  5EEO A;  4UIG A;  3F2E A;  5AI1 A;  1VQ4 3;  2WAU A;  4EIW A;  1LOX A;  4J9A A;  4ASK A;  3WOF B;  3ANW A;  1FIO A;  5EK4 A;  1HKX A;  3DGN A;  1IV9 A;  4FMB A;  5JDF A;  5LHH B;  4HN9 A;  3OJA A;  3RYC E;  1VQN 3;  2OCT A;  3J7Y q;  2CFG A;  3UL6 A;  3HL6 A;  3SOL A;  1VQ8 3;  3ETV A;  2CLY C;  1BUQ A;  1RN7 A;  3CX7 B;  4R80 A;  1VQP 3;  3CKD A;  3NV0 B;  3BNC A;  3OBV E;  2LT3 A;  1IU7 A;  4N6N B;  3I56 3;  1KK7 A;  3GMI A;  2JMK A;  4BTY A;  3KV5 A;  2QGS A;  3HII A;  5ELU A;  4ISS A;  4DVD A;  4XBX A;  4X1K E;  1O3X A;  4IIJ E;  3ZLI A;  3NM2 A;  2LSG A;  3KFQ C;  1IVV A;  1TIJ A;  3IMA B;  4WYK B;  3ETU A;  5JDG A;  4O8S A;  3N9O A;  4AKZ A;  3ZC0 A;  4FMD A;  3I0Q A;  4NRE A;  4N3V A;  3B8L A;  3DZL A;  3KZT A;  4AKI A;  1M90 4;  1W7C A;  1S94 A;  4CI1 B;  2CWU A;  4QX8 B;  4HM6 B;  2D0T A;  4R1K A;  4AQG A;  3MG1 A;  1CYU A;  3T8O A;  1M9G A;  2OWP A;  4I55 E;  2CFL A;  4PNI A;  1JV2 B;  3JC6 D;  4L8O A;  4QWN B;  1ZHC A;  1FEW A;  4TZ4 C;  1ULI B;  4ANJ A;  3EDU A;  2IUJ A;  2OTJ 3;  4ADZ A;  3Q9D A;  3LFM A;  2X67 A;  2IC6 A;  3ZPO A;  4CI2 B;  1E1H B;  1TP6 A;  4HE8 A;  1FGR A;  1O7H B;  4HZ9 B;  3C50 A;  4AI6 A;  1SPU A;  3NV0 A;  2X66 A;  3ZYM A;  4M1P A;  3UNL A;  1MIW A;  5IG0 A;  2Q07 A;  1NAF A;  3PXM A;  1FGT A;  5L3B B;  2XEP A;  3H3H A;  2GBW B;  4HM1 B;  2YU1 A;  1BR4 A;  3WA2 X;  5AYR B;  4UEM A;  4BAY B;  2BZB A;  4MFR A;  1M1K 4;  5KDM C;  4WYK A;  3FKA A;  2VAS A;  5JDM A;  2E2U A;  1UUV B;  1TFO A;  4AKR B;  3DUK A;  2KWH A;  2NW8 A;  3PUQ A;  4HFV A;  3KIN B;  1PU4 A;  5HWX A;  2FXT A;  5LBM A;  5EVH A;  5HXC A;  4H9Q C;  4EYC A;  2GBX B;  2JJ9 A;  4PJM A;  4R9L A;  2A3D A;  3IBP A;  1IAP A;  1D1C A;  3CCL 3;  4O02 B;  4UF0 B;  5JR9 B;  2UX0 A;  2GK9 A;  4L8P A;  4Z8X A;  4EXR A;  2C10 A;  2KCD A;  3MYT A;  3IPT A;  5F3J A;  2IAK A;  5H6R B;  3LXU X;  4R9K A;  5FMN A;  3KV4 A;  2E8I A;  4K1V A;  1QVG 2;  3WDG B;  4KBM B;  4FMA A;  3E99 A;  3CPO A;  4CQI A;  4XM4 A;  3UUN A;  3Q2M A;  1Q81 4;  5C8Y E;  3PS8 A;  1W6C A;  2CM0 A;  3LK3 B;  2JDI H;  4TUY E;  4ZI3 D;  2N2N A;  3LOY A;  2KRT A;  1NU3 A;  1U8C B;  4ZS3 A;  3CWZ B;  4P09 A;  4IPB A;  2KND A;  5H6Q B;  4XBT A;  4EOZ B;  1JNQ A;  5KP1 A;  2D42 A;  4PEJ A;  1W6Y A;  3ONX A;  5BVB A;  2KXP B;  4TN7 B;  3OXA A;  2WSS V;  2DCF A;  4L5G A;  5BMV E;  4X2H A;  4EV5 A;  3LT8 A;  1OHP A;  1CUN A;  4J2C A;  2BVL A;  3O1H A;  1M1X B;  4L7K A;  3R6N A;  3ZYK A;  2BO9 B;  3C4W A;  1KC8 4;  2XAJ B;  3P7I A;  2PBI A;  2MBG A;  1KWI A;  1NB5 I;  1NJI 4;  3ZJ1 A;  1GD4 A;  3HIG A;  4EV2 A;  3G71 3;  3CCQ 3;  2VB6 A;  3CNM A;  4YHJ A;  3SOA A;  4HZB B;  2M7O A;  1ULJ B;  3QRD A;  4UF0 A;  2NOX A;  3UUM A;  4WBO A;  5JR9 A;  1S72 3;  5DRE A;  4AKL A;  1WRD A;  3JUM A;  4N6V 0;  1QAK A;  3MA9 A;  2DHR A;  5L3G B;  2W6J H;  5L3D B;  3HKC E;  3OYZ A;  3O9X A;  4LEH A;  3FBZ A;  3CQX C;  3GAX A;  5LGN B;  2KLQ A;  4ZOL E;  3CC4 3;  1MNE A;  3HKB E;  3MKD A;  3NBR A;  3BQL A;  3G6E 3;  1BR0 A;  2HML B;  2CWO A;  2XUE A;  4HM0 B;  2IW5 B;  3FF0 A;  3FF2 A;  4AKY A;  1VRB A;  2W61 A;  4X2O A;  3C51 A;  1AVL A;  4CXY A;  3QUJ A;  4U72 A;  5HWY A;  1AJ3 A;  3KN4 A;  3KBU A;  4RBN A;  3UUL A;  3BB9 A;  2JQQ A;  1WNH A;  5LYJ E;  2WMN A;  1GY6 A;  2CFD A;  1U5O A;  4MJD A;  1NDO B;  2Q9Q D;  1IT8 A;  4O4L E;  1YJ9 3;  1HU9 A;  1U4Q A;  1GYB A;  5DRV A;  2STD A;  5HXS A;  4O4J E;  4JLE A;  1OGX A;  5AFU L;  4L9I A;  3OV4 A;  5JVD E;  2CG1 A;  4LSO A;  1BR2 A;  3SLU A;  4XZC A;  3RC8 A;  2PNC A;  3F7X A;  1K8A 4;  1YW0 A;  3CQC B;  1DYU A;  3BK9 A;  3Q5W A;  1O7P B;  2WOF A;  1N8R 4;  5JH7 E;  5LGT B;  5AEW B;  3FHN A;  3CQG B;  4ZHQ E;  3X42 A;  2HMK B;  1GY7 A;  2D1W A;  4HKV B;  4ERR A;  2KT9 A;  1Y64 B;  5DQW A;  3G0K A;  3L3P A;  4HM2 B;  3EF8 A;  5IG5 A;  4KUM B;  1IJ5 A;  1N9J A;  3FLJ A;  2ACX A;  2Y73 A;  4QXB B;  3EVY A;  2O3O A;  2K54 A;  1X79 A;  4TX4 A;  2Q9Q B;  4GOU A;  1OUN A;  3EN8 A;  4FCZ A;  3HX8 A;  1UCU A;  5D81 A;  3D9R A;  3T8N A;  2ODU A;  3A76 A;  1FMW A;  4H61 A;  1N8Q A;  3ZMT B;  3S5C A;  5JPU A;  2X9Y A;  1K9M 4;  2GU1 A;  3DJB A;  4HJL B;  2NW9 A;  1Z1S A;  4IGU A;  3G8Z A;  4O4I E;  2LOP A;  4CXW A;  5IG3 A;  2VL8 A;  1D0Z A;  3F40 A;  5JDL A;  1Q86 4;  3EDV A;  1CEW I;  1OHO A;  2C5I T;  2VK9 A;  5DAB A;  1D0X A;  5D82 A;  3RYF E;  4FMC A;  4MMZ B;  2L8K A;  1UX5 A;  1ZEE A;  3MK7 C;  1VQ7 3;  4AKH A;  1OWA A;  3JC6 C;  1A67 A;  3GN5 B;  3NM7 A;  4HEA A;  1TU5 A;  3RGR A;  5FXX A;  3AAE B;  3IHR A;  3ZCI A;  5JR9 C;  4G63 A;  1DMN A;  2QA7 A;  1W00 A;  4I43 B;  2P38 A;  2H7V C;  2W56 A;  1TUH A;  1T5Y A;  3DGO A;  2WBL A;  1GS3 A;  2CWV A;  3MXZ A;  2ML5 A;  1F8N A;  1DVC A;  1QAF A;  2V1L A;  3NHX A;  1D6Z A;  1IT7 A;  3LYG A;  3N9M A;  1QUU A;  3EE1 A;  2ZLY A;  2NWB A;  4RNY A;  3PGB A;  4XB5 A;  2LHN A;  3EN1 B;  2Q9Q A;  3GWH A;  3S27 A;  4LGQ A;  3GRD A;  2CFW A;  2OOV A;  4UVB B;  4PFO A;  3KII A;  4G1M B;  3KE7 A;  5IEN A;  1A90 A;  5A0O B;  3JUP A;  3K63 A;  2CXL A;  3NBX X;  3DP7 A;  5CB4 E;  1FMV A;  4OFZ A;  3CME 3;  2Z6B A;  6STD A;  2HPL A;  1GD3 A;  2Y8D A;  2V7J A;  2VKJ A;  2P0M A;  2OQE A;  2W62 A;  1US1 A;  3SED A;  2IMJ A;  3EB8 A;  3GZR A;  4N6M A;  3V98 A;  5AYS C;  5IER A;  4IE6 A;  1W01 A;  2X9W A;  1Q42 A;  1SA0 E;  2W00 A;  5CA0 E;  3WAJ A;  1JJ2 2;  3CC7 3;  1H7C A;  4PK5 A;  1R4C A;  2ZDJ A;  2V7L A;  4PAG A;  2DLR A;  4UV8 B;  2P0X A;  1CYV A;  2RSX A;  3MHE A;  2XSH B;  4H9R C;  2NTX A;  3LBX B;  2MOZ A;  4ZI3 C;  5LBQ B;  2ODV A;  3NRX A;  2IC9 A;  1US7 B;  1JKG B;  4MHC A;  4WBN E;  2K24 A;  5FXV A;  3AA6 B;  1AVK A;  1TFK A;  4UEL A;  3RC3 A;  4UXN B;  1V74 A;  1HG2 A;  2X51 A;  4DMV A;  2XAH B;  4I50 E;  4MMY B;  1Z0P A;  3IJE B;  5I97 A;  3CCE 3;  3ZMU B;  2Y74 A;  3KFW X;  2B1X B;  3F57 A;  4XBY A;  2N9D A;  3LTA A;  2CCQ A;  1O7N B;  2V7K A;  4GK0 E;  3GZB A;  3UTK A;  2A2F X;  4C90 A;  1QVF 2;  1ZV4 X;  2L9Q A;  5JDN A;  3Q5X A;  3HK4 A;  2LSJ A;  5L3C B;  3PCS A;  3MAC A;  1PFP A;  2NTY A;  2Z7A A;  3X3Y A;  1RRL A;  3FBL A;  3FH1 A;  3F14 A;  4ORL A;  3RDE A;  4KP3 C;  3V99 A;  3B13 A;  3FCS B;  2LYX A;  4HM4 B;  5J2U E;  2L4V A;  4NUU A;  3NZQ A;  2LOS A;  2IUK A;  2X9X A;  1OXZ A;  5FNV E;  1RJO A;  1K73 4;  4N78 D;  1IVX A;  5BXQ A;  2CHC A;  3NQY A;  3S67 A;  3NQZ A;  1RKY A;  5LJM A;  5JRE A;  2XF3 A;  3K5T A;  3RYH E;  1QAL A;  1MIV A;  1ZO2 A;  1WQL B;  2KIN B;  2LE8 A;  3K0Z A;  2BHM A;  1K28 A;  1JKG A;  3CVR A;  4MLK A;  4C91 A;  1UI7 A;  2CKF B;  2ZM2 A;  4TV8 E;  3NBB A;  3MJX A;  3EQQ B;  2XRX B;  1N9E A;  3N8B A;  3H3A A;  3CXC 2;  3CML A;  4DND A;  4QKN A;  4TX5 A;  3PUG A;  1D1A A;  2CXF A;  4GYR A;  5EZY E;  4AXP A;  3KVB A;  2Q9Q C;  4STD A;  4QX7 B;  1UX4 A;  1WTH A;  4U13 A;  2CXD A;  1HF8 A;  5EQL A;  4EC6 A;  3RH3 A;  2OOV C;  2RA1 A;  4KFE A;  1LNH A;  3HKD E;  1Y4K A;  3STD A;  3I9Y A;  3X3X A;  4OK0 A;  1IQ8 A;  3WI3 A;  3L0R A;  2WMO A;  5KMG P;  5JBS A;  2OQE C;  4X1I E;  1OF5 B;  1ROV A;  5HXE A;  5CXO A;  2N1G A;  2VKO A;  3LK4 2;  1VQK 3;  2HMM B;  3RYI E;  3FGY A;  2BNG A;  2JPF A;  1STD A;  2V26 A;  3ZC1 A;  4B6X A;  3I0O A;  2VKH A;  2C0S A;  1KNZ A;  2BMO B;  2RFR A;  3PU8 A;  1MIY A;  3U1W A;  4OUQ A;  3LTD A;  3ZMS B;  4O2H A;  3K3N A;  4IE7 A;  5LNK A;  3SX1 A;  3ZN1 B;  4N6U A;  3QK6 A;  3VGN A;  2V7M A;  3ZCJ A;  4WFO A;  4KFD A;  4Q53 A;  3LZA A;  4WHA A;  1YIJ 3;  2CFK A;  2QIY A;  4AEQ A;  4IE0 A;  4P0B A;  1MMG A;  3UJM A;  3AMO B;  4OVM A;  3AVR A;  4H63 H;  4YJ2 E;  4DBQ A;  4EYU A;  4EZ4 A;  2M67 A;  2XGN A;  2YFI B;  3B4O A;  3BNB A;  4DO0 A;  1D0Y A;  2YX9 A;  3SOY A;  1V9D A;  2PJQ A;  2W63 A;  3PZW A;  3OWY A;  1NB3 I;  2H7O A;  4XDW A;  2SBL A;  3DY5 A;  3GWR A;  4O3V A;  2XAS B;  3T0U A;  3X40 A;  3K3Q C;  3HI7 A;  1VZZ A;  1UW1 A;  2J1D G;  1LRZ A;  2MTQ A;  1OF5 A;  2CA5 A;  3I1A A;  4F6R C;  1ISK A;  1B7T A;  3NRY A;  3N5L A;  2CIU A;  5FYM A;  4GYS A;  4WP5 A;  5IEP A;  2LHR A;  3KSE D;  4ZS2 A;  3E22 E;  5LP6 E;  3VSY A;  4PFP A;  3RX6 A;  2I59 A;  3UFE A;  3LTC A;  2YK0 A;  3TDG A;  1RRH A;  2R4I A;  4DMW A;  4U74 A;  3AVS A;  5IHY A;  2YIN A;  5AII A;  5LHI B;  4GB5 A;  3WA3 A;  4HYZ A;  3RKO A;  2XH9 A;  4OYK A;  3LH4 A;  1LKX A;  3C98 B;  4IST A;  2K48 A;  3C64 A;  5FP3 A;  2K5B B;  1JB5 A;  3CPW 2;  3CC2 3;  5FY0 A;  3FXE B;  3DGL A;  1FA3 A;  2ZM0 A;  4BTW A;  3N9H A;  3FXD B;  1MOL A;  2XTL A;  4AKG A;  3G4S 3;  3VKH A;  3QK9 A;  1O7G B;  1WMO A;  2LSK A;  3AA7 B;  3AMO A;  1NO3 A;  2UXN B;  2W04 A;  2CK3 H;  2Z77 A;  5CA1 E;  3K7C A;  3HZP A;  2KXG A;  3MWZ A;  3N9L A;  2D0U A;  2X0L B;  4H63 V;  4HM5 B;  1W2B 2;  3HA4 A;  2E9X B;  1YD8 G;  1FUW A;  5LGU B;  3FZW A;  3WOD G;  4E7S A;  2MYS A;  3V5S A;  1LVN A;  3KSP A;  3DGM A;  1YJN 3;  4HM3 B;  1SQW A;  2HH7 A;  2EHO B;  4YJ3 E;  5LC6 A;  3N54 B;  1W6G A;  3F9S A;  2BT3 A;  4JUY A;  3OYX A;  3W15 B;  4MMX B;  1MMA A;  2F98 A;  3BND A;  2RCD A;  2NP9 A;  1ASK A;  1MNL A;  4WW0 A;  2DWK A;  1O7M B;  2W9P A;  3CD6 3;  4AQF A;  3R84 B;  2WOH A;  5KP4 A;  1EZ3 A;  1DVD A;  1WYC A;  2CEA A;  3M8C A;  1QSD A;  3ANW B;  4LZI A;  2QA4 3;  5KX5 E;  3VHL A;  5AIG A;  5EK2 A;  2BVM A;  3NX0 A;  1WYB A;  3EBY A;  1N5H A;  4JEH B;  5FY1 A;  1WLX A;  2XHE B;  4CZZ B;  5JDH A;  1VOM A;  5FXZ A;  1LXE A;  5L3E B;  2W03 A;  2YU2 A;  5M4Y A;  3Q90 A;  3AAI A;  5LXT E;  3PE0 A;  2XSO B;  2MF7 A;  2WGQ A;  3EBT A;  3N2G E;  3NZP A;  2DNX A;  4PK6 A;  1KQS 2;  2C11 A;  1HFA A;  3L09 A;  2XFT A;  3NBJ A;  1YIT 3;  4YFS A;  1OHS A;  1JN5 B;  5FGO A;  3SVA A;  2JMH A;  1ROA A;  4WWU C;  3KBT A;  2LSI A;  2X9H A;  3U78 A;  2WGO A;  4HVN A;  5JPP A;  3JVC A;  5TGN A;  2K0M A;  2PFV A;  2P9B A;  2W0G A;  1QJG A;  3KDS E;  1WMP A;  8CHO A;  5HXH A;  1HG5 A;  3FG4 A;  4RNZ A;  3U3I A;  4NUV A;  2BMQ B;  1EKM A;  5L3F B;  4OHF A;  1YGE A;  1G73 A;  3O1I A;  2G0U A;  2CWY A;  1OPY A;  3LJC A;  1Q40 B;  4HTE A;  5HAX A;  3VKG A;  2H3R A;  1YI2 3;  3BLZ A;  3ECF A;  4PJN A;  5TAO A;  1D6Y A;  3ZJ2 A;  4HM7 B;  3GZX B;  1S5A A;  1STF I;  1VQ5 3;  3UB1 A;  1OH0 A;  4EBG A;  1IZN B;  4QXH B;  1MMD A;  5F8P A;  4J8T A;  3CX8 B;  3MZK B;  3BQK A;  3EC9 A;  3GN5 A;  3BNE A;  5GON E;  1IVW A;  3CCM 3;  3G16 A;  4OYJ A;  5FXW A;  4QXC B;  1IDP A;  1WMN A;  5AIH A;  3H37 A;  2B24 B;  2RGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...