4OK0A

Crystal structure of putative nucleotidyltransferase from h. pylori
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
225
structure length
225
Chain Sequence
LSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative
publication title Crystal structure of JHP933 from Helicobacter pylori J99 shows two-domain architecture with a DUF1814 family nucleotidyl transferase domain and a helical bundle domain
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 73
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ok0A02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ok0A01
4OK0A 4O8SA
chains in the Genus database with same CATH superfamily
5JBSA 1YKEB 3OYZA 4UVCB 1I2EA 2KF6A 1J2BA 5KMGP 1DVCA 3FCSB 5AFUL 1UX5A 3N2KE 3K0ZA 1HNXT 3VU7H 4MBQA 5IG4A 1Q42A 2DWKA 3SYUA 3STDA 2E9XC 2W67A 1D1CA 3CQXC 4O3VA 2A72A 3M8CA 3ALAA 1BNGA 1SHZC 5CLKA 3PU3A 4HBRA 2BBHA 1A2PA 2CLYC 2ZMAA 2LT3A 2XAJB 5J2TE 1KSIA 1RGCA 2GSPA 3CC73 4HM6B 3ZG0A 2BKPA 3H51A 1US7B 1W0BA 2XQ7A 3LYGA 3O4XE 2P05A 4JEHB 2CW9A 2IHR1 1FMWA 4KFDA 2LM9A 3O1HA 1DMMA 5CFBA 2YINA 3DUKA 3CCV3 1BUJA 2VB6A 3ETUA 1FYSA 4HM3B 3EC9A 5LBMA 3CQGB 2CEAA 5AQIB 1XWMA 3VR8A 5LXTE 2WWVA 5FY1A 3A5EA 2RA1A 2W56B 2UXNB 1OACA 3TLWA 1ZHCA 3CVRA 2ML6A 4E7ZA 2W9QA 4QHOA 3NZPA 2ACXA 5AQFB 2E2TA 1UGIA 4IT4A 5LB7B 3KV5A 4QH5A 2V7MA 4I55E 3UQ4A 3WOEB 3I9WA 1FJGT 3JUMA 2ML5A 1ROAA 1V58A 3SLUA 2M6IA 1TRQA 8CHOA 7RNTA 2XQAA 4I0UA 3FZMB 3K63A 2CG0A 4XDWA 1WR0A 1SE7A 4LMIA 4N6LA 1M7KA 5KDMC 2IAKA 1UI8A 2K3WA 3ZYKA 4BJMA 5FL0A 1Y01A 3H3HA 3RQUA 1K41A 4JV5T 2LQVA 3NZQA 2K3DA 1DVDA 2FJBA 2YDSA 4GKJT 4NUUA 3MACA 2QIYA 5JRCB 4ISTA 4P1NA 4YHHT 3CK6A 3MKDA 4KHZF 5DQVA 3LMLA 4HWDA 1BRKA 4EV6A 3SXXA 3RLFF 3PUQA 3P4SA 4G1MB 3AVRA 1UW1A 2CBIA 1QAKA 1VQ73 3D79A 5AQNB 2XF3A 5EK3A 3P50A 3DY5A 4Q25A 3O1JA 2CC3A 3UB1A 2V8SV 5AQHB 1WMOA 2Q9QD 1SPUA 2W2CA 1E3RA 5LJNA 5ELJA 1YVBI 2CFGA 3B57A 4KI0F 3N8BA 4I50E 3FLJA 1I2GA 1BNRA 4MJDA 1RHLA 4Z8XA 5D82A 3FKAA 1OXZA 3RH3A 5AQUB 4AKZA 1CH0A 2KMFA 4ILFA 2C4BA 5LNKA 2YDQA 1ZS7A 3F7SA 5IENA 2SBLA 1VRBA 5LC6A 5FGOA 5TGNA 1B21A 1JN5A 2H88A 3JUPA 4PEJA 3RGAA 4EGWA 2KXGA 5J2UE 2IMLA 2ACZA 1I2FA 3ZMTB 4N6TA 1A2VA 1HU9A 1Z8UA 4CXYA 2VL8A 1SIHA 1FZUA 2DWGA 1FIOA 3QRDA 6GSPA 2RPAA 3N5LA 1OPYA 1RCLA 2N1GA 3E22E 2RGQA 4U7IA 7GSPA 1HS7A 2KF3A 1RNTA 1XDOA 1CHUA 2X66A 2NR4A 4M1PA 2OTJ3 4I4KA 2WOFA 3E0ZA 4IL9A 3KINB 1IQYA 3VR9A 3CMA3 2KT9A 3PUWF 5FY0A 1TRPA 4R9KA 2JMHA 3UU5A 3LDQB 1GOVA 5L47A 2SPCA 1JV2B 4JI3T 2W00A 3U1WA 2WCAA 1CQSA 3TKLB 2H89A 3NQYA 1E2AA 2BNGA 3AGOA 1WR6A 2XFSA 4WBNE 5FL1A 3I0QA 4IE0A 3HA4A 3SOAA 2X67A 2WDVA 3G6E3 3OYXA 1D0ZA 1S5AA 1HZ1A 4E7SA 5L3DB 3CMLA 2Z7AA 2WQYA 3C4ZA 3G06A 1BVIA 3D5IA 3QB5K 7STDA 4ZI3C 1Q7Y4 4FCZA 3ZG5A 4LFCT 1STFI 4JI6T 5TAOA 4N6NB 2MC8A 4GSPA 3BNDA 1N8QA 5FXVA 2QA7A 1QVG2 4PAGA 1MGWA 4O4LE 4XBFB 2V1LA 3ZJ1A 4TWFA 4GYRA 2M67A 3PUXF 3OWSA 1UUVB 2YU1A 2OQEC 5J0ZA 1CYVA 1WQLB 1NEKA 5IEPA 4LF5T 4XBTA 1JN5B 4AI6A 5LOVE 2X0LB 2CWOA 4TNVA 1B2ZA 1NENA 4ZI7E 3W15B 3IMAB 3JADA 1H7CA 1R4CA 2WSSV 4MMYB 2HN1A 2XGLA 4LFAT 3RKGA 4DBRA 4DO0A 3MG1A 1FGMA 3SOLA 3ZYLA 4PJJA 2CFLA 2YN6A 3SRZA 3PJAJ 1N36T 4HM4B 4P0AA 2UXXB 1TIJA 1BRHA 2XQ4A 1EQKA 3RIUC 3SEDA 4EEBA 5JR9A 4GOUA 3RPUA 4CN1A 3AEEA 3KKGA 1GMRA 4EC6A 1HG5A 4X2OA 3NV0A 3EN1B 3AAIA 2OV9A 3ZN0B 4YXDA 4UIGA 4BA9A 4JI0T 5CXOA 5AQMB 2C5KT 4MFRA 2UUGC 2ZM6T 4KVHA 4X1YE 5GONE 1W02A 3FZFB 2LEHA 2VK9A 4TV9E 3PXMA 4ZM8A 4JUYA 2WMOA 2OOVC 4IDOA 3PUZF 2AXDS 2W03A 2W9PA 3PUSA 3RHWA 3WA3A 3ZC0A 2QVAA 3CD63 2DCFA 4G63A 2JJ9A 4BU4A 2LM2A 2D0UA 2FBWA 3ZSSA 5DABA 1GY7A 2X51A 4LF9T 4HM8B 4GYSA 5IWAT 4UXNB 4R80A 3LT8A 1UURA 3O9XA 1UDII 2H0GA 3X40A 1VQ83 4NREA 1RLSA 3AA0B 1Q824 1VQL3 3I0YA 4L7KA 4JRFA 4NXMT 1Y64B 2G0UA 2J8XB 2O3OA 1NAFA 2D0TA 2EHOC 4HWHA 2XR8B 2BG9C 1HNWT 3I9YA 4Z91A 3WMDA 3EUHA 2HMNB 4TV8E 3DXOA 2XUEA 1JKGA 4BL2A 2PG8A 5LA6E 1NB3I 2RP4A 4HFVA 5CJ5A 2HMKB 2J47A 4CPKA 3FHNA 3Q2MA 1WLXA 3WHOA 1IK3A 2BMQB 4HKVB 5JDFA 1XMOT 1IV9A 1OEDA 3N9NA 5EK2A 4KHPT 1IT8A 1FGTA 3J7Yq 2K0MA 3MHEA 2P0XA 2XGNA 1OUNA 3WI3A 5IEOA 1YHQ3 2BO9B 4R4KA 1RGFA 1S94A 3AECA 1GMPA 1Q864 3TLTA 4XBYA 3ONLC 3PCSA 3KFQC 4O02B 5BU4A 4CZZB 2YKSA 2DI4A 3A5XA 5AQSB 3UUMA 5D81A 4UF0B 5HGRA 4HWCA 4UEMA 2Q9QA 4IDZA 1KC84 5JPUA 2A15A 3C4XA 3E99A 1Q7HA 5KP1A 1I0VA 2CWVA 3RKOA 3RGRA 1LKXA 1E7PA 4YLHA 3ONXA 3K1SA 5C3JA 2K48A 1HFAA 3GZRA 2CXLA 3EX9A 5F8PA 3NRXA 3KN4A 1BRSA 2GEXA 2BBJA 4P0BA 1MIWA 2BS3A 2XTLA 3CX8B 5IG5A 2KF4A 4EV2A 4C91A 4U72A 3GSPA 3A7MA 2MTQA 4A56A 2CWYA 1OGXA 1JZDA 3N9HA 1Q9EA 3V98A 1T2IA 4LF6T 1S35A 4ASKA 3N9PA 2JMKA 3ETVA 4RBNA 4EXTA 4KFEA 5AIGA 4JI1T 4DR2T 3Q9DA 5DRVA 3PUAA 4YSXA 2KLQA 2NW8A 2Y74A 4YFSA 2YEVC 3S67A 5RNTA 2GU1A 1RSNA 1DETA 3MPHA 4LYLB 4NXNT 1JNZA 3G0KA 4YTMA 3BIRA 4OYKA 1SIIA 3NQZA 2OA5A 1ZKEA 3OBVE 3IJEB 3N2OA 3JCFA 1YXRA 3CCQ3 4H3UA 4O2AE 3AHSA 1ZV4X 5FYMA 2YDRA 3N9LA 5BXQA 2CXFA 1Q40A 5FVKA 5M18A 2Y48B 3OWUA 3J7Yd 3WR2A 1EKMA 5JTGA 4ZS2A 4JI5T 4BTWA 1BANA 5LCYA 1F8NA 3LOYA 4U2ZA 3HKCE 3RYIE 4IE7A 1ZOYA 3AEFA 4OFZA 1TUHA 4HFIA 3LK42 3CPW2 1DYUA 5BMVE 4QXBB 1RJOA 2YOEA 4BIRA 1RDSA 1UCIA 1HX8A 1W00A 1S723 2XEPA 1BR4A 3OX9A 5AQLB 3RIFA 1T72A 2LSYA 2V6YA 3NRYA 2BS4A 1RKYA 1PFPA 2Y73A 4B3TT 4A5XA 2SARA 2WWUA 1A2KA 3PUYF 4ZI2D 3SOYA 3FBZA 4XZCA 3SWHA 5G2GA 1KNZA 4AISA 4AKRB 5ABFA 2KRTA 4K61A 1EZ3A 1OF5A 4AQFA 1Y4KA 1OWAA 4X5TA 5AQPB 4HZBB 4KX6A 2LSKA 2R41A 3KDSE 1A90A 4JI4T 4OX9T 4TWDA 3PUGA 5JDQA 1BR1A 2HMMB 3PZWA 3LG7A 1JB5A 4DBQA 4DV3T 3F7XA 4IE4A 3D3LA 1CUNA 1N8R4 3CCE3 2PTFA 3AXJB 3KFWX 4O8SA 4XB5A 2LJLA 4H63H 4TWHA 5AEUB 2CWTA 3ZMZB 1WNHA 3N9QA 2ZM0A 4CDLA 1IV7A 1V74A 3GMIA 1FA3A 1W0AA 3AE8A 1KD14 2XSBA 3HI7A 4QWTA 1K9M4 4WYKA 3EABA 3B4PA 1BNEA 3F8XA 1TTOA 2H7VC 4R1KA 4WZXA 1I3FA 2MPKA 5LHGB 3A76A 2IUKA 2CHNA 3K5TA 3SX1A 3B7CA 2IYJA 3T8UA 1NNVA 3DGNA 3R6NA 1I8VA 2ES0A 3UUBA 3ANWA 2XH9A 3SS1A 5F3JA 4A98A 4XDVA 4PNIA 2W04A 4U74A 3FGYA 2IUJA 3BQIA 3HK4A 4CQIA 1MMDA 1RTUA 4IREA 3NM7A 5ADXL 3NVOA 4I43B 3F14A 3AA1B 4OVMA 1NB5I 2KWIB 1VQ63 4EOZB 3FZWA 5L3BB 1RN7A 1MNLA 3AGNA 4PW8A 2X9YA 5LGTB 4AKLA 5L3FB 2RCDA 4PK6A 1I3IA 3PYJA 2VL0A 4LF4T 4IDPA 4JI7T 3ZKRA 2H0HA 1X1XA 2LRKA 4AKIA 3QNUA 2UUAT 2X9HA 2Z76A 1BAOA 3PURA 3ZSTA 2Y6XA 2LE8A 2OCTA 1ZGXA 4HFBA 4WNKA 5ABFB 1JNQA 4I5QA 2CM0A 2W0QA 3AAEB 3DM8A 3LJCA 4CI1B 5AIIA 2E9XD 2WP9A 4J8TA 1RMSA 3R84B 3KCHA 4ZHQE 4NIQA 1NJI4 1ZO2A 2IC6A 2D1WA 2F4VT 1JNRA 1MMGA 4HFCA 1GD4A 3CPOA 4J9AA 1W5ZA 2QYWA 2UUCT 2CCQA 1X1YA 2X68A 3ZCJA 1T8BA 3S28A 4K1VA 3MK7C 3OKQA 2M6BA 5HXCA 4NPPA 2VKHA 3UNLA 4DIDB 5CK6A 2VKJA 4PJLA 5L4HA 1IDPA 4DNDA 2HHHT 1UCKA 4WYKB 3S27A 4COFA 2GK9A 2XQ9A 3I563 2OWPA 3FZLB 3WDGB 3AEBA 4K0KT 2D2SA 3PS8A 1FGOA 1SJWA 1BU4A 1BNFA 1HKXA 4PJMA 5C8YE 1G0TA 1AV4A 4HM2B 3MWZA 2WU2A 2B1EA 1XNQT 2L1SA 3IBPA 5AQJB 2WU5A 2BKNA 4HVNA 1BUQA 3T0UA 4DV1T 3CCJ3 4ILAA 1VCTA 1VQQA 1M62A 4BJNA 3CCR3 1BOXA 4DUZT 5EK4A 1LNHA 2BT3A 2NWBA 2HH7A 2XHEB 4DR4T 4IPBA 4N3VA 4H9QC 3JUQA 1D1AA 2EHOA 5AI1A 4EB6E 3X42A 1I70A 5L4EA 3UFGA 3X3ZA 4TN7B 1YQ3A 5HOHA 3FSDA 3LTBA 5LG4A 3N9OA 4X65T 3HX8A 3SVAA 1JBSA 4LFBT 1LRZA 4HFDA 1N33T 4L8OA 1UCJA 4L8PA 2N2NA 3OTOT 1BNJA 4ZS3A 3HIGA 5LJMA 4YTPA 2C0SA 1PU4A 2ODVA 1O7PB 4B6XA 3X41A 1G96A 1W6GA 2WDRA 4AXPA 2QA43 4JLEA 3RYCE 1YD8G 3AE1A 1UGOA 4JEUB 1HF8A 3MYTA 1RNBA 1YJW3 1O7NB 1B2UA 3NBJA 3H37A 2BZBA 3LXUX 1MIYA 1U5OA 3LBXA 2XPKA 5AIFA 4L9IA 3P4QA 2VQFT 4CCVA 4X64T 5CA1E 2CXDA 4IIJE 1IVVA 1PYLA 3I553 2LKHA 4EYYR 2JPFA 2CFKA 4FCMA 4ZOLE 3IF8B 3P4PA 6RNTA 1ZEEA 3GRDA 3RYHE 3BB9A 1SQWA 1YGWA 4H9OC 4LSOA 4GHOA 2BHMA 2RSXA 5AQVB 4MEIA 3AE4A 1A67A 2XQ5A 3OJAA 2F99A 1C7HA 4PJNA 3AEDA 1AJ3A 2GEYA 1UGHI 1KF6A 3JC6C 5FP3A 2LOPA 5IUXA 3JVCA 1MWUA 3DGLA 4H61A 1V57A 2CPTA 2L8KA 1J5WA 1MIVA 3CU3A 4L0RA 2FJDA 3HKEE 1IJ6A 3IA3A 4EIWA 4PFPA 1DMNA 3MG2A 1ULIB 3B4OA 5HXHA 2W6JH 3N2GE 3VRBA 3E08A 3WODG 2WM9A 2NTXA 2XSHB 1D0YA 3HIIA 3LK3B 4X62T 2IA7A 5HXSA 2L3LA 4FI5A 1IQ8A 5FXWA 4Z90A 4DR6T 1OCVA 4BTYA 3EAMA 4KT3B 1J5ET 3GN5A 1O7HB 2GBXB 3AMOA 3RC3A 3ZN1B 5HAXA 2M7OA 2YX9A 1NWMX 4RNYA 2BMRB 1HR0T 2W2UA 1QVF2 1FGQA 3RYFE 2WGOA 5CGMA 1R4YA 1TFKA 1QSDA 1N9JA 3UUXB 5AQQB 4O4IE 3O1IA 3VKGA 4TZ4C 1KFYA 4DR7T 4QXCB 5FXZA 4V1Av 1FW7A 3AVSA 1RN1A 4WP5A 4ZI3D 3WAJA 1Z1SA 2BG9E 2JRKA 4YT0A 3X3XA 1AVKA 3S5CA 3KBTA 5ETWA 3RRCA 3EHZA 2MAWA 4G2AA 1O3XA 3V92A 2D9DA 1N34T 1N5HA 4B3MT 3Q5EA 1KK7A 2FGTA 3TDGA 4HM7B 5HXEA 4JBWF 3FXDB 5KP3A 6STDA 5IHYA 2I59A 5L2LA 3S4UA 2UXDT 4LEHA 1W6CA 1YIT3 2CA5A 4EW5A 3FG1A 5KP4A 4N6MA 1E97A 1VQN3 1D6ZA 5JQGE 1SUMB 4O4HE 1BRIA 1W09A 1FEWA 2F5WA 4KZ1A 2Z77A 3FB2A 4HJLB 1OH0A 3EDVA 5LMNT 4YTNA 3CCM3 5IYZE 3TLSA 1NU3A 3LZAA 3FG3A 3MG3A 3UL6A 9RNTA 5D83A 3ZLIA 3NM2A 4QH1A 3AE9A 5HEGA 2QRXA 3GWHA 2V5DA 2V6XA 3HI2A 5FY7A 5KX5E 1B20A 5AYRB 3KZTA 1UCUA 2ZLYA 1G02A 2V7LA 2E9XA 1YI23 4TNWA 1QLBA 3DGYA 3KBUA 1SARA 1B2SA 4UELA 3BNCA 3KV6A 2CHCA 3RNTA 1STDA 1IAPA 5AQKB 5G1LA 4HN9A 3L09A 3PCRA 1MMNA 2WY2A 3ZMUB 5G1KA 2QGSA 2WZIA 1RRLA 5CF1A 1GSPA 1SA0E 4LMJA 4FCJA 3DZLA 5JR9B 3OWYA 2WGQA 1LVNA 4IL4A 2MBGA 3GZYB 3NV0B 3WA2X 1RGAA 3OXAA 1YJN3 2NP9A 3UT5E 2MF7A 4AKGA 3AAAB 5M19A 2K9AA 4OUQA 2AAEA 1YIJ3 4AKHA 4K1UA 5GSPA 5L3CB 2JQ5A 4HE8A 4IE6A 1MGRA 5AQTB 1UUWB 2CH9A 4HM1B 3AE5A 3U97A 3H3MA 2E2VA 2PZVA 4DMWA 5JREA 2EHOD 2VURA 3D4AA 2XQYA 4J5GA 4XAXB 1X1UA 1FUSA 5FXXA 2A2FX 2UX0A 4U13A 2A3DA 3EDUA 4MHCA 1K8A4 2MOZA 1YJ93 2X9WA 2NW9A 1DMQA 1W01A 1U4QA 3K9MC 5LHHB 1OHSA 4DV2T 1LOYA 4QWNB 1W9RA 5AIHA 1UCLA 2I6HA 1O7GB 1UX4A 2ZA4A 3KVAA 1IBMT 1BR0A 4UVAB 2RNTA 3KV9A 5EEOA 1JB4A 1M9GA 3NWIA 1JKGB 3WAKA 4KUMB 2NOXA 4O4JE 3HKDE 3RC8A 2XQ6A 1LRAA 2P09A 3QK9A 3B13A 3HR0A 2ZM2A 2L9QA 1M1K4 1FMVA 2W0GA 3ZC1A 2P9BA 5HEUA 2HPLA 4YHJA 3JUOA 3U78A 4X20E 4F8HA 3UU6A 2D42A 1OEDB 3Q1CA 1JRQA 1YVSA 2P38A 3AEAA 3CQCB 5HCJA 3EQQB 5L3GB 1K28A 4BL3A 2RFRA 4DV0T 4X2HA 1VQ93 1RGLA 3G4S3 3URPA 3F40A 1HTJF 3SFDA 2K24A 3EBYA 4U7YA 2F86B 4GIWA 1V9DA 4H9SE 1IVXA 4NUVA 1W6YA 3CWZB 3I1AA 5A1LA 1WTHA 3ABVA 2Q9QB 4MMXB 4HAAA 2KNDA 1KNRA 2YU2A 4DUYT 2Q07A 2KF5A 5FKYA 5JR9C 2F5MA 3DP7A 1JBTA 3ESLA 2CRBA 4X1IE 3RIAA 1RRHA 2JQHA 5HEHA 3D5GA 1FGRA 2W56A 1D6UA 2WBLA 1YW0A 3DTOA 4U31A 2CX1A 3V5UA 2FJEA 3EVYA 3DH2A 3CPZA 3G16A 3T1HT 4PFOA 5L3EB 3ZMSB 3F31A 1YKHB 5FMNA 1K734 4NPBA 4TX5A 4HWFA 5A0OB 4U33A 3F9SA 2J62A 2CBJA 3Q5XA 2STDA 3UJMA 2WZHA 2W4XA 4FR9A 1VQ43 2ZHXB 1XNRT 3X3YA 3ZPOA 5AQRB 1BSDA 2C5IT 2XZEA 3RRWA 2JQQA 3D0TA 3PU8A 2IMJA 1IYYA 1HNZT 5BR8T 3F8HA 3JAEA 2UUBT 4KMCA 5CF2A 2LYXA 3OW22 3DJBA 2W62A 3AE3A 4BAYB 1QJGA 4PK5A 2KSRA 5LBQB 5AQOB 3BU4A 2FXTA 1IU7A 2UGIA 1RGKA 4IIAA 4LGQA 4EAHA 1GY5A 5FNVE 2E5VA 2VVNA 2HMLB 3Q5DA 2R4IA 3ECFA 3Q3FA 4WFOA 2E5LT 5JRCA 5STDA 3P4WA 3VHLA 1YQ4A 2VQET 2OLTA 1HX1B 2HN2A 1Q40B 1KEYA 3EF8A 1FUWA 1LOWA 3CCS3 2X0HA 4KP3C 4EYCA 4EYUA 4OHFA 3P7IA 3UL5A 2V7IA 4TUYE 3PGBA 3F2EA 1RGEA 1D0XA 1WYCA 1JB2A 1Z0PA 4GK0E 4YSZA 3NBBA 4AEQA 2VKDA 4N6V0 3CCL3 2OQEA 4BTXA 1OEDC 5IG0A 4ADZA 1VQ53 4GL6A 1GQEA 1GD3A 1LVFA 2DLRA 5BVBA 1N5PA 4GK5E 2V6YB 2CE7A 3HKBE 2CX0A 4B3RT 2HOHA 1VCSA 2ZL8A 5BIRA 5JDHA 3B8LA 1BRNL 1MWTA 1B27A 1E3VA 3O8YA 1WCRA 4LMKA 5H6RB 3UU4A 2KZ7B 2LHNA 2HMJB 3MXZA 3DGOA 2Q9QC 2BVMA 4L5GA 1OF5B 3UFEA 4HEAA 1BIRA 3FBLA 4XBXA 4YY3T 2F56A 1D6YA 5JDMA 4CN6A 1XDPA 5LHIB 3RIUA 1HCIA 2VKOA 3MA9A 1T7SA 3Q90A 4UR9A 2E2AA 1G73A 2YFLB 3VF1A 4OK0A 1UUGB 3MZKB 2HMOB 3V5SA 1GOYA 3DGMA 1B2MA 2IW5B 1BNSA 4AKYA 2FJAA 4UVBB 1BGSA 1OHPA 3HOHA 3K3NA 5DREA 3A8YC 4QKNA 2OOVA 2F98A 2BS2A 3CX6B 4HYZA 5C2TA 3BNEA 2XSOB 4EZHA 4DR3T 2B76A 2X9XA 3J9X1 4F6RC 4DR5T 4ANJA 1NDOB 3G8ZA 1WRDA 3AE6A 1KWIA 2DNXA 2CKFB 3CIRA 3BLZA 3NBXX 3Q2PA 1WFDA 3HZPA 4X66T 2KCDA 3ANWB 4K0UA 5LGNB 4A97A 1EUIC 1G8XA 2VASA 4DV5T 5JDGA 1MOLA 1B2XA 2YFJB 3KV4A 1B3SA 4H9NC 5EVHA 2V7JA 2B24B 2WB5A 2YFIB 2OTL3 5ABHA 3LH4A 3FXEB 4MALA 3QK6A 2XAHB 1U8CB 1IJ5A 2KXPB 4ILUA 2KAAA 2XAQB 2BG9A 4LMLA 1QUUA 3L3PA 3M65A 4O2HA 5LP6E 1VQP3 5ELUA 4FMBA 3C50A 1W4NA 4EBGA 4ZZCA 2PJQA 3LK2B 2DL1A 5JPPA 3KIIA 2JQ9A 2XM2A 2GU3A 2WOHA 4J5KA 1RGGA 1L0VA 2WO0A 3NX0A 8RNTA 1WYBA 3LTCA 3I0OA 2GXFA 3OVUA 4CJNA 5KXJA 1IZNB 2I9WA 3CNXA 3D9RA 1MWSA 3B5MA 3AA6B 1LOXA 1BSEA 2BIRA 3S29A 1KNPA 5J1GA 1O7WB 3C51A 4GKKT 3QB5A 1L5GB 4QH4A 1T5YA 2YK0A 1VQO3 4AQYT 4FMDA 4O2BE 4AQFC 2AADA 3IHRA 2CIUA 3CCU3 4N6OB 1TJDA 1XMQT 2JDIH 2ZM8A 1MNEA 2CG1A 2J1DG 2P0MA 1ASKA 3BK9A 3LSVA 5JH7E 1ULJB 2PFVA 4UV9B 3UU8A 5HXRA 3LTDA 3ZT6A 4K90B 4UV8B 1BSBA 2LSGA 5ABGA 4MLKA 1I94T 5HEJA 3U3IA 3Q5WA 2J4GA 2IIUA 1EA2A 5AYSC 5M1AA 2XY8B 3GA8A 2BKOA 3FF0A 1QALA 5FW5A 3LFMA 1MNDA 3GAXA 3AA7B 1HYFA 4HM0B 1TP6A 1E1HB 1WMNA 4YJ2E 2R6GF 5IERA 2IC9A 4ZEYA 2WDQA 4HFEA 3RX6A 2LKGA 4H9PC 2A9UA 5EZYE 3TLVA 2UXBT 2EHOB 1HG2A 2BG9B 2LRLA 3K8PC 2XQ8A 1AVLA 5F5WA 1GS3A 2UXCT 3DMCA 4GB5A 2XASB 3P8CD 4YJ3E 2BVLA 3GZXB 3M3ZB 4C90A 4DVDA 1GYBA 1RN4A 4KFFA 2QEX3 1VQM3 1TU5A 1M904 1MWRA 3KVBA 4EV5A 1AQZA 3RQWA 5HCMA 3ER7A 4R9LA 5DJQC 3ZFZA 3PJAA 2E2UA 1ZP0A 4Q53A 3CME3 2FNQA 3ZMVB 1X79A 3GWRA 3LT9A 1LQGC 3MJXA 4J2CA 3BQLA 3CX7B 3RF1A 2ZDJA 3FF2A 2XRXB 4ORLA 1JBRA 2IY2A 3LBXB 4CI3B 3FH1A 4JF8A 1LVKA 3JC6D 2LOSA 4CI2B 2VWAA 1W7CA 4LZIA 2E8IA 2C11A 3K7CA 3KSED 1LXEA 5JDNA 3PUVF 4KBMB 2KWHA 2I0MA 3ZT5A 2HPJA 3L39A 2LSJA 1J1JA 4UF0A 4DR1T 2XM1A 4U3CA 3X1DA 3C98B 1M1XB 4STDA 2CFDA 3EE1A 3FZHB 3BNBA 3JUNA 3ZYMA 4ILCA 2XJ7A 1BNIA 4WYVA 1Q814 2INXA 2BDEA 3AE7A 3ZT7A 1IBLT 4ERRA 2KINB 5LC7A 3MKIA 1XZYA 2B1XB 1NWWA 2F4YA 1UUSA 4ZXLA 1IT7A 5LGUB 3EI0A 4P09A 3HL6A 1BR2A 1N32T 2PBIA 1IQXA 4DV7T 1RGHA 3IPTA 3AHWA 1X9BA 5LMUT 1YGEA 2BU4A 5AEWB 4MMZB 5CA0E 1ISKA 2L4VA 3C4WA 3UUNA 2JIWA 4N78D 2W61A 3SFEA 4ILBA 4WHAA 4IE5A 4U2YA 4CN4A 3GN5B 4H63V 4I4TE 3ONJA 3AMOB 2NW7A 5FVLA 2FUPA 5LG3A 5H6QB 2V5CA 1B7TA 2W63A 1UI7A 4QXHB 2DHRA 4EXRA 3WOFB 1N9EA 1VZZA 3NHXA 2V26A 3NXJA 5AQGB 2XQ3A 3QUJA 2V7KA 4DMVA 4DV4T 2O9UX 5IF6A 5JDLA 3IEEA 5DQWA 3L0RA 2V1DB 5ABEA 1FUTA 4DKIA 2CK3H 1C54A 3K3QC 5HWXA 5HEOA 4IDQA 1YNVX 2UU9T 3VRAA 3PTRB 4EEDA 4LF7T 4AQGA 3PV0F 2QGUA 3EJVA 1EG9B 3RDEA 1W2B2 3L8RA 3AE2A 3EHCA 3OV4A 4XM4A 2JQKA 1U5PA 4B3ST 1PY3A 3KE7A 4CXXA 2XAGB 1LOVA 1IVWA 3UQ7A 4ISSA 5HYAA 3CC43 3QOFA 2WAUA 2XFTA 2H0IA 3G713 3MSOA 2NTYA 4WW0A 2MYSA 3CNMA 4IDNA 4RNZA 2IDOB 3AEGA 1BSAA 4HFHA 4TX4A 1OHOA 2N9DA 1EEJA 1CEWI 1IBKT 1ZX2A 2H7OA 1T3BA 4AIUA 3UULA 1LNIA 5IW9A 3H3AA 3FZKB 4ZZBA 1CYUA 1OGZA 1R8IA 3AB3B 1AR0A 1I6ZA 3EN8A 3PDYA 5EQLA 2E9XB 4HZ9B 2VVSA 4YSYA 3F57A 3VSYA 3UTKA 4OYJA 3NUVA 4JI2T 3ROBA 2CLYB 4FMCA 1UK5A 4JI8T 5IG3A 4HM5B 3VGNA 3AXJA 3KSPA 4ZI2C 1TFOA 3JAFA 1T2HA 4FJOA 2W66A 2RBIA 4HGAA 4H9RC 3EB8A 2Y8DA 1RCKA 1VQK3 4EZ4A 4HWIB 4HOHA 4RZMA 3CXC2 3RGLA 1US1A 2K5BB 1D1BA 1BRJA 3ZCIA 3ZJ2A 1T98A 4PK4A 2CHOA 3UU3A 3FG4A 3NKZA 5CB4E 2Z6EA 1VOMA 1BRGA 3NBRA 3RI5A 1LQMB 3CC23 1NO3A 3VKHA 2CMRA 2CWUA 5LYJE 3GZBA 1KQS2 1QMAA 4N6UA 4LF8T 1GOUA 2IUBA 3C64A 3T8OA 2C5JA 4WBOA 1ROVA 2Z6BA 2BMOB 4X1KE 1IVUA 1W2ZA 3LTAA 2PNCA 1MMAA 5JVDE 2K54A 5HWYA 1GMQA 1WMPA 2WS3A 5E0OA 2C10A 4NHFA 3K3OA 4DV6T 4HTEA 3V99A 1JJ22 3T1YT 4JYAT 4QX8B 1GY6A 5I97A 2LLYA 2X0YA 3BQKA 4FMAA 4QX7B 3TLUA 4IT7A 2WMNA 5M4YA 4RNTA 3P4RA 3QC9A 4CXWA 1DU2A 1AY7A 2CFWA 3N54B 1O7MB 2LHRA 3CKDA 1BSCA 2AE9A 2XSAA 1OEDE 1X1WA 4IGUA 3PE0A 3T8NA 2GBWB 3EBTA 4WWUC 2D5UA 3ZEFB 2ODUA 1DE3A 2H3RA 3OPCA 2XAFB 1QAFA 1JZOA 2LSIA 4IHJE 1I0XA 3N9MA 4HKAA
chains in the Genus database with same CATH topology
5JBSA 1YKEB 3OYZA 4UVCB 1J2BA 5KMGP 1DVCA 3FCSB 5AFUL 1UX5A 3N2KE 3K0ZA 3VU7H 4MBQA 5IG4A 1Q42A 2DWKA 3STDA 2E9XC 1D1CA 3CQXC 4O3VA 2A72A 3M8CA 3ALAA 1SHZC 5CLKA 3PU3A 4HBRA 2CLYC 2ZMAA 2LT3A 2XAJB 5J2TE 1KSIA 3CC73 4HM6B 3H51A 1US7B 3LYGA 3O4XE 2P05A 4JEHB 2CW9A 1FMWA 4KFDA 2LM9A 3O1HA 1DMMA 2YINA 3DUKA 3CCV3 2VB6A 3ETUA 4HM3B 3EC9A 5LBMA 3CQGB 2CEAA 5LXTE 5FY1A 2RA1A 2W56B 2UXNB 1OACA 1ZHCA 3CVRA 2ML6A 4E7ZA 2W9QA 4QHOA 3NZPA 2ACXA 2E2TA 3KV5A 2V7MA 4I55E 3WOEB 3I9WA 3JUMA 2ML5A 1ROAA 3SLUA 8CHOA 3K63A 2CG0A 4XDWA 4LMIA 4N6LA 5KDMC 2IAKA 1UI8A 3ZYKA 4BJMA 3H3HA 1K41A 2LQVA 3NZQA 1DVDA 4NUUA 3MACA 2QIYA 5JRCB 4ISTA 3MKDA 5DQVA 3LMLA 3SXXA 3PUQA 4G1MB 3AVRA 1UW1A 1QAKA 1VQ73 2XF3A 5EK3A 3DY5A 3O1JA 2CC3A 3UB1A 1WMOA 2Q9QD 1SPUA 2W2CA 1E3RA 5LJNA 5ELJA 1YVBI 2CFGA 3B57A 3N8BA 4I50E 3FLJA 4MJDA 4Z8XA 5D82A 3FKAA 1OXZA 3RH3A 4AKZA 2KMFA 5LNKA 3F7SA 5IENA 2SBLA 1VRBA 5LC6A 5FGOA 5TGNA 1JN5A 3JUPA 4PEJA 3RGAA 2KXGA 5J2UE 3ZMTB 4N6TA 1A2VA 1HU9A 4CXYA 2VL8A 1SIHA 2DWGA 1FIOA 3QRDA 3N5LA 1OPYA 2N1GA 3E22E 2RGQA 1HS7A 2OTJ3 2X66A 4M1PA 4I4KA 2WOFA 3E0ZA 3KINB 1IQYA 3CMA3 2KT9A 5FY0A 4R9KA 2JMHA 2SPCA 1JV2B 2W00A 3U1WA 1CQSA 3TKLB 3NQYA 2BNGA 1WR6A 2XFSA 4WBNE 3I0QA 4IE0A 3HA4A 3SOAA 2X67A 3G6E3 3OYXA 1D0ZA 1S5AA 4E7SA 5L3DB 3CMLA 2Z7AA 3C4ZA 7STDA 4ZI3C 1Q7Y4 4FCZA 1STFI 5TAOA 4N6NB 2MC8A 3BNDA 1N8QA 5FXVA 2QA7A 1QVG2 4PAGA 4O4LE 4XBFB 2V1LA 3ZJ1A 4GYRA 2M67A 3OWSA 1UUVB 2YU1A 2OQEC 1CYVA 1WQLB 5IEPA 4XBTA 1JN5B 4AI6A 5LOVE 2X0LB 2CWOA 4ZI7E 3W15B 3IMAB 1H7CA 1R4CA 2WSSV 4MMYB 2XGLA 4DBRA 4DO0A 3MG1A 1FGMA 3SOLA 3ZYLA 4PJJA 2CFLA 3SRZA 4HM4B 4P0AA 2UXXB 1TIJA 1EQKA 3SEDA 5JR9A 4GOUA 3RPUA 3KKGA 4EC6A 1HG5A 4X2OA 3NV0A 3EN1B 3AAIA 3ZN0B 4UIGA 4BA9A 5CXOA 2C5KT 4MFRA 4KVHA 4X1YE 5GONE 1W02A 2LEHA 2VK9A 4TV9E 3PXMA 4ZM8A 4JUYA 2WMOA 2OOVC 2W03A 2W9PA 3PUSA 3WA3A 3ZC0A 3CD63 2DCFA 4G63A 2JJ9A 2D0UA 5DABA 1GY7A 2X51A 4HM8B 4GYSA 4UXNB 4R80A 3LT8A 3O9XA 3X40A 1VQ83 4NREA 3AA0B 1Q824 1VQL3 3I0YA 4L7KA 4JRFA 1Y64B 2G0UA 2O3OA 1NAFA 2D0TA 2EHOC 2XR8B 3I9YA 3WMDA 3EUHA 2HMNB 4TV8E 3DXOA 2XUEA 1JKGA 2PG8A 5LA6E 1NB3I 2RP4A 4HFVA 2HMKB 3FHNA 3Q2MA 1WLXA 1IK3A 2BMQB 4HKVB 5JDFA 1IV9A 3N9NA 5EK2A 1IT8A 1FGTA 3J7Yq 2K0MA 3MHEA 2P0XA 2XGNA 1OUNA 3WI3A 5IEOA 1YHQ3 2BO9B 4R4KA 1S94A 1Q864 4XBYA 3PCSA 3KFQC 4O02B 4CZZB 3A5XA 2DI4A 3UUMA 5D81A 4UF0B 5HGRA 4UEMA 2Q9QA 4IDZA 1KC84 5JPUA 2A15A 3C4XA 3E99A 5KP1A 2CWVA 3RKOA 3RGRA 1LKXA 4YLHA 3ONXA 2K48A 1HFAA 3GZRA 2CXLA 3EX9A 5F8PA 3NRXA 3KN4A 2GEXA 4P0BA 1MIWA 2XTLA 3CX8B 5IG5A 4EV2A 4C91A 4U72A 2MTQA 4A56A 2CWYA 1OGXA 3N9HA 3V98A 1S35A 4ASKA 3N9PA 2JMKA 3ETVA 4RBNA 4EXTA 4KFEA 5AIGA 3Q9DA 5DRVA 3PUAA 2KLQA 2NW8A 2Y74A 4YFSA 2YEVC 3S67A 2GU1A 3MPHA 3G0KA 4OYKA 1SIIA 3NQZA 2OA5A 1ZKEA 3OBVE 3IJEB 3N2OA 3CCQ3 4H3UA 4O2AE 1ZV4X 5FYMA 3N9LA 5BXQA 2CXFA 1Q40A 2Y48B 3OWUA 3J7Yd 1EKMA 4ZS2A 4BTWA 5LCYA 1F8NA 3LOYA 3HKCE 3RYIE 4IE7A 4OFZA 1TUHA 3LK42 3CPW2 1DYUA 5BMVE 4QXBB 1RJOA 1HX8A 1W00A 1S723 2XEPA 1BR4A 3OX9A 2LSYA 3NRYA 1RKYA 1PFPA 2Y73A 2WWUA 1A2KA 4ZI2D 3SOYA 3FBZA 4XZCA 3SWHA 5G2GA 1KNZA 4AKRB 2KRTA 4K61A 1EZ3A 1OF5A 4AQFA 1Y4KA 1OWAA 4HZBB 2LSKA 3KDSE 1A90A 3PUGA 5JDQA 1BR1A 2HMMB 3PZWA 3LG7A 1JB5A 4DBQA 3F7XA 4IE4A 3D3LA 1CUNA 1N8R4 3CCE3 3KFWX 4O8SA 4XB5A 2LJLA 4H63H 5AEUB 2CWTA 3ZMZB 1WNHA 3N9QA 2ZM0A 4CDLA 1IV7A 1V74A 3GMIA 1FA3A 1KD14 3HI7A 4QWTA 1K9M4 4WYKA 3B4PA 3F8XA 2H7VC 4R1KA 5LHGB 3A76A 2IUKA 3K5TA 3SX1A 3B7CA 3T8UA 3DGNA 3R6NA 2ES0A 3ANWA 2XH9A 3SS1A 5F3JA 4XDVA 4PNIA 2W04A 4U74A 3FGYA 2IUJA 3BQIA 3HK4A 4CQIA 1MMDA 3NM7A 5ADXL 4I43B 3F14A 3AA1B 4OVMA 1NB5I 2KWIB 1VQ63 4EOZB 3FZWA 5L3BB 1RN7A 1MNLA 4PW8A 2X9YA 5LGTB 4AKLA 5L3FB 2RCDA 4PK6A 3PYJA 4AKIA 2X9HA 2Z76A 3PURA 2Y6XA 2LE8A 2OCTA 4WNKA 1JNQA 2CM0A 2W0QA 3AAEB 3DM8A 3LJCA 4CI1B 5AIIA 2E9XD 4J8TA 3R84B 4ZHQE 1NJI4 1ZO2A 2IC6A 2D1WA 1MMGA 1GD4A 4J9AA 3CPOA 1W5ZA 2CCQA 2X68A 3ZCJA 3S28A 4K1VA 3MK7C 3OKQA 5HXCA 2VKHA 3UNLA 5CK6A 2VKJA 4PJLA 1IDPA 4DNDA 4WYKB 3S27A 2GK9A 3I563 2OWPA 3WDGB 2D2SA 3PS8A 1FGOA 1SJWA 1HKXA 4PJMA 5C8YE 1AV4A 4HM2B 3MWZA 2B1EA 3IBPA 4HVNA 1BUQA 3T0UA 3CCJ3 4BJNA 3CCR3 5EK4A 1LNHA 2BT3A 2NWBA 2HH7A 2XHEB 4IPBA 4N3VA 4H9QC 3JUQA 1D1AA 2EHOA 5AI1A 4EB6E 3X42A 3X3ZA 4TN7B 3FSDA 3LTBA 5LG4A 3N9OA 3HX8A 3SVAA 1LRZA 4L8OA 4L8PA 2N2NA 4ZS3A 3HIGA 5LJMA 2C0SA 1PU4A 2ODVA 1O7PB 4B6XA 3X41A 1G96A 1W6GA 4AXPA 2QA43 4JLEA 3RYCE 1YD8G 4JEUB 1HF8A 3MYTA 1YJW3 1O7NB 3NBJA 3H37A 2BZBA 3LXUX 1MIYA 1U5OA 3LBXA 5AIFA 4L9IA 4CCVA 5CA1E 2CXDA 4IIJE 1IVVA 3I553 4EYYR 2JPFA 2CFKA 4FCMA 4ZOLE 3IF8B 1ZEEA 3GRDA 3RYHE 3BB9A 1SQWA 4H9OC 4LSOA 2BHMA 2RSXA 4MEIA 1A67A 2F99A 3OJAA 1C7HA 4PJNA 1AJ3A 2GEYA 3JVCA 3JC6C 5FP3A 2LOPA 3DGLA 4H61A 2L8KA 1MIVA 3CU3A 4L0RA 3HKEE 1IJ6A 4EIWA 4PFPA 1DMNA 3MG2A 1ULIB 3B4OA 5HXHA 2W6JH 3N2GE 3E08A 3WODG 2WM9A 2NTXA 2XSHB 1D0YA 3HIIA 3LK3B 2IA7A 5HXSA 2L3LA 4FI5A 1IQ8A 5FXWA 1OCVA 4BTYA 3GN5A 1O7HB 2GBXB 3AMOA 3RC3A 3ZN1B 5HAXA 2M7OA 2YX9A 1NWMX 4RNYA 2BMRB 1QVF2 1FGQA 3RYFE 2WGOA 1TFKA 1QSDA 1N9JA 3UUXB 4O4IE 3O1IA 3VKGA 4TZ4C 4QXCB 5FXZA 4V1Av 3AVSA 4WP5A 4ZI3D 3WAJA 1Z1SA 2JRKA 3X3XA 1AVKA 3S5CA 3KBTA 5ETWA 3RRCA 4G2AA 1O3XA 3V92A 1N5HA 1KK7A 2FGTA 3TDGA 4HM7B 5HXEA 3FXDB 5KP3A 6STDA 5IHYA 2I59A 5L2LA 3S4UA 4LEHA 1W6CA 1YIT3 2CA5A 3FG1A 5KP4A 4N6MA 1E97A 1VQN3 1D6ZA 5JQGE 4O4HE 1FEWA 4KZ1A 2Z77A 3FB2A 4HJLB 1OH0A 3EDVA 3CCM3 5IYZE 1NU3A 3LZAA 3FG3A 3MG3A 3UL6A 5D83A 3ZLIA 3NM2A 3GWHA 3HI2A 5FY7A 5KX5E 5AYRB 3KZTA 1UCUA 2ZLYA 2V7LA 2E9XA 1YI23 3KBUA 3BNCA 4UELA 3KV6A 2CHCA 1STDA 1IAPA 4HN9A 3L09A 3PCRA 1MMNA 3ZMUB 2QGSA 1RRLA 5CF1A 1SA0E 4FCJA 3DZLA 5JR9B 3OWYA 2WGQA 1LVNA 2MBGA 3GZYB 3NV0B 3WA2X 3OXAA 1YJN3 2NP9A 3UT5E 2MF7A 4AKGA 3AAAB 2K9AA 4OUQA 1YIJ3 4AKHA 4K1UA 5L3CB 2JQ5A 4HE8A 4IE6A 1UUWB 2CH9A 4HM1B 3U97A 2E2VA 2PZVA 4DMWA 5JREA 2EHOD 2XQYA 4XAXB 5FXXA 2A2FX 2UX0A 4U13A 2A3DA 3EDUA 4MHCA 1K8A4 2MOZA 1YJ93 2X9WA 2NW9A 1DMQA 1W01A 1U4QA 3K9MC 5LHHB 1OHSA 4QWNB 5AIHA 1O7GB 1UX4A 3KVAA 1BR0A 4UVAB 3KV9A 5EEOA 1JB4A 1M9GA 1JKGB 3WAKA 4KUMB 2NOXA 4O4JE 3HKDE 3RC8A 2P09A 3QK9A 3B13A 3HR0A 2ZM2A 2L9QA 1M1K4 1FMVA 2W0GA 3ZC1A 2P9BA 2HPLA 4YHJA 3JUOA 3U78A 4X20E 2D42A 3Q1CA 1JRQA 2P38A 3CQCB 3EQQB 5L3GB 1K28A 2RFRA 4X2HA 1VQ93 3G4S3 3F40A 1HTJF 2K24A 3EBYA 2F86B 4GIWA 1V9DA 4H9SE 1IVXA 4NUVA 1W6YA 3CWZB 3I1AA 5A1LA 1WTHA 2Q9QB 4MMXB 2KNDA 2YU2A 2Q07A 5JR9C 3DP7A 3ESLA 4X1IE 1RRHA 1FGRA 2W56A 1D6UA 2WBLA 1YW0A 3DTOA 3V5UA 3EVYA 3CPZA 3G16A 4PFOA 5L3EB 3ZMSB 3F31A 1YKHB 5FMNA 1K734 4TX5A 5A0OB 3F9SA 3UJMA 2STDA 3Q5XA 4FR9A 1VQ43 3X3YA 3ZPOA 2C5IT 3RRWA 2JQQA 3D0TA 3PU8A 2IMJA 3F8HA 4KMCA 5CF2A 2LYXA 3OW22 3DJBA 2W62A 4BAYB 1QJGA 4PK5A 5LBQB 2FXTA 1IU7A 4LGQA 4IIAA 4EAHA 1GY5A 5FNVE 2HMLB 2R4IA 3ECFA 4WFOA 5JRCA 5STDA 3VHLA 1Q40B 3EF8A 1FUWA 3CCS3 4KP3C 4EYCA 4EYUA 4OHFA 3P7IA 3UL5A 2V7IA 4TUYE 3PGBA 3F2EA 1D0XA 1WYCA 1JB2A 1Z0PA 4GK0E 4AEQA 3NBBA 2VKDA 4N6V0 3CCL3 2OQEA 4BTXA 5IG0A 4ADZA 1VQ53 4GL6A 1GD3A 1LVFA 2DLRA 5BVBA 1N5PA 4GK5E 2CE7A 3HKBE 2ZL8A 5JDHA 3B8LA 1E3VA 3O8YA 5H6RB 2KZ7B 2LHNA 2HMJB 3MXZA 3DGOA 2Q9QC 2BVMA 4L5GA 1OF5B 3UFEA 4HEAA 3FBLA 4XBXA 1D6YA 5JDMA 5LHIB 1HCIA 2VKOA 3MA9A 3Q90A 1G73A 2YFLB 3VF1A 4OK0A 3MZKB 2HMOB 3V5SA 3DGMA 2IW5B 4AKYA 4UVBB 1OHPA 3K3NA 5DREA 2OOVA 4QKNA 2F98A 3CX6B 4HYZA 3BNEA 2XSOB 4EZHA 2X9XA 3J9X1 4F6RC 4ANJA 1NDOB 3G8ZA 1WRDA 1KWIA 2DNXA 2CKFB 3BLZA 3NBXX 3Q2PA 3HZPA 2KCDA 3ANWB 4K0UA 5LGNB 1G8XA 2VASA 5JDGA 1MOLA 2YFJB 3KV4A 5EVHA 4H9NC 2V7JA 2B24B 2YFIB 2OTL3 3LH4A 1U8CB 3FXEB 3QK6A 2XAHB 4MALA 1IJ5A 2KXPB 4ILUA 2XAQB 1QUUA 3L3PA 3M65A 4O2HA 5LP6E 1VQP3 5ELUA 4FMBA 3C50A 1W4NA 4EBGA 2PJQA 3LK2B 5JPPA 3KIIA 2GU3A 2WOHA 2WO0A 3NX0A 1WYBA 3LTCA 3I0OA 2GXFA 1IZNB 2I9WA 3CNXA 3D9RA 3AA6B 1LOXA 3S29A 5J1GA 1O7WB 3C51A 1L5GB 1T5YA 2YK0A 1VQO3 4FMDA 4O2BE 4AQFC 3IHRA 2CIUA 3CCU3 4N6OB 2JDIH 2ZM8A 1MNEA 2CG1A 2J1DG 2P0MA 1ASKA 3BK9A 1ULJB 5JH7E 2PFVA 4UV9B 5HXRA 3LTDA 4K90B 4UV8B 2LSGA 4MLKA 3U3IA 3Q5WA 1EA2A 5AYSC 3GA8A 3FF0A 1QALA 5FW5A 3LFMA 1MNDA 3GAXA 3AA7B 4HM0B 1TP6A 1E1HB 1WMNA 4YJ2E 5IERA 2IC9A 3RX6A 4H9PC 5EZYE 2EHOB 1HG2A 3K8PC 1AVLA 1GS3A 3DMCA 4GB5A 2XASB 3P8CD 4YJ3E 2BVLA 3GZXB 4C90A 1GYBA 4DVDA 4KFFA 2QEX3 1VQM3 1TU5A 1M904 3KVBA 4EV5A 3ER7A 4R9LA 5DJQC 2E2UA 4Q53A 3CME3 2FNQA 3ZMVB 1X79A 3GWRA 3LT9A 3MJXA 4J2CA 3BQLA 3CX7B 2ZDJA 3FF2A 2XRXB 4ORLA 3LBXB 4CI3B 3FH1A 4JF8A 1LVKA 3JC6D 2LOSA 4CI2B 2VWAA 1W7CA 4LZIA 2E8IA 2C11A 3K7CA 3KSED 1LXEA 5JDNA 4KBMB 2KWHA 2HPJA 2LSJA 4UF0A 4STDA 3C98B 1M1XB 2CFDA 3EE1A 3BNBA 3JUNA 3ZYMA 1Q814 2INXA 2BDEA 4ERRA 2KINB 5LC7A 3MKIA 2B1XB 1NWWA 1IT7A 5LGUB 4P09A 3HL6A 1BR2A 2PBIA 1IQXA 3IPTA 1YGEA 5AEWB 4MMZB 5CA0E 1ISKA 2L4VA 3C4WA 3UUNA 4N78D 2W61A 4WHAA 4IE5A 3GN5B 4H63V 4I4TE 3AMOB 2NW7A 5H6QB 1B7TA 2W63A 1UI7A 4QXHB 2DHRA 4EXRA 3WOFB 1N9EA 1VZZA 3NHXA 2V26A 3NXJA 3QUJA 2V7KA 4DMVA 2O9UX 5IF6A 5JDLA 3IEEA 5DQWA 3L0RA 2V1DB 2CK3H 3K3QC 5HWXA 3PTRB 4AQGA 2QGUA 3EJVA 1EG9B 3RDEA 1W2B2 3EHCA 3OV4A 4XM4A 1U5PA 3KE7A 4CXXA 2XAGB 1IVWA 4ISSA 5HYAA 3CC43 2WAUA 2XFTA 3G713 3MSOA 2NTYA 4WW0A 2MYSA 3CNMA 4RNZA 4TX4A 1OHOA 2N9DA 1CEWI 1ZX2A 2H7OA 3UULA 5IW9A 3H3AA 1CYUA 1OGZA 3AB3B 1AR0A 3EN8A 3PDYA 5EQLA 2E9XB 4HZ9B 3F57A 3VSYA 3UTKA 4OYJA 3NUVA 3ROBA 2CLYB 4FMCA 5IG3A 4HM5B 3VGNA 3KSPA 4ZI2C 1TFOA 4FJOA 4HGAA 4H9RC 3EB8A 2Y8DA 1VQK3 4EZ4A 3CXC2 4RZMA 1US1A 2K5BB 1D1BA 3ZCIA 1T98A 4PK4A 3ZJ2A 3FG4A 5CB4E 2Z6EA 1VOMA 3NBRA 3CC23 1NO3A 3VKHA 2CMRA 2CWUA 5LYJE 3GZBA 1KQS2 1QMAA 4N6UA 3C64A 3T8OA 2C5JA 4WBOA 1ROVA 2Z6BA 2BMOB 4X1KE 1IVUA 1W2ZA 3LTAA 2PNCA 1MMAA 5JVDE 2K54A 5HWYA 1WMPA 5E0OA 2C10A 4NHFA 3K3OA 3V99A 4HTEA 1JJ22 4QX8B 1GY6A 5I97A 3BQKA 4FMAA 4QX7B 4IT7A 2WMNA 5M4YA 3QC9A 4CXWA 2CFWA 3N54B 1O7MB 2LHRA 3CKDA 4IGUA 3PE0A 3T8NA 2GBWB 3EBTA 4WWUC 2D5UA 3ZEFB 2ODUA 2H3RA 2XAFB 1QAFA 2LSIA 4IHJE 3N9MA 4HKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OK0 A;  4O8S A; 
#chains in the Genus database with same CATH topology
 5JBS A;  1YKE B;  3OYZ A;  4UVC B;  1I2E A;  2KF6 A;  1J2B A;  5KMG P;  1DVC A;  3FCS B;  5AFU L;  1UX5 A;  3N2K E;  3K0Z A;  1HNX T;  3VU7 H;  4MBQ A;  5IG4 A;  1Q42 A;  2DWK A;  3SYU A;  3STD A;  2E9X C;  2W67 A;  1D1C A;  3CQX C;  4O3V A;  2A72 A;  3M8C A;  3ALA A;  1BNG A;  1SHZ C;  5CLK A;  3PU3 A;  4HBR A;  2BBH A;  1A2P A;  2CLY C;  2ZMA A;  2LT3 A;  2XAJ B;  5J2T E;  1KSI A;  1RGC A;  2GSP A;  3CC7 3;  4HM6 B;  3ZG0 A;  2BKP A;  3H51 A;  1US7 B;  1W0B A;  2XQ7 A;  3LYG A;  3O4X E;  2P05 A;  4JEH B;  2CW9 A;  2IHR 1;  1FMW A;  4KFD A;  2LM9 A;  3O1H A;  1DMM A;  5CFB A;  2YIN A;  3DUK A;  3CCV 3;  1BUJ A;  2VB6 A;  3ETU A;  1FYS A;  4HM3 B;  3EC9 A;  5LBM A;  3CQG B;  2CEA A;  5AQI B;  1XWM A;  3VR8 A;  5LXT E;  2WWV A;  5FY1 A;  3A5E A;  2RA1 A;  2W56 B;  2UXN B;  1OAC A;  3TLW A;  1ZHC A;  3CVR A;  2ML6 A;  4E7Z A;  2W9Q A;  4QHO A;  3NZP A;  2ACX A;  5AQF B;  2E2T A;  1UGI A;  4IT4 A;  5LB7 B;  3KV5 A;  4QH5 A;  2V7M A;  4I55 E;  3UQ4 A;  3WOE B;  3I9W A;  1FJG T;  3JUM A;  2ML5 A;  1ROA A;  1V58 A;  3SLU A;  2M6I A;  1TRQ A;  8CHO A;  7RNT A;  2XQA A;  4I0U A;  3FZM B;  3K63 A;  2CG0 A;  4XDW A;  1WR0 A;  1SE7 A;  4LMI A;  4N6L A;  1M7K A;  5KDM C;  2IAK A;  1UI8 A;  2K3W A;  3ZYK A;  4BJM A;  5FL0 A;  1Y01 A;  3H3H A;  3RQU A;  1K41 A;  4JV5 T;  2LQV A;  3NZQ A;  2K3D A;  1DVD A;  2FJB A;  2YDS A;  4GKJ T;  4NUU A;  3MAC A;  2QIY A;  5JRC B;  4IST A;  4P1N A;  4YHH T;  3CK6 A;  3MKD A;  4KHZ F;  5DQV A;  3LML A;  4HWD A;  1BRK A;  4EV6 A;  3SXX A;  3RLF F;  3PUQ A;  3P4S A;  4G1M B;  3AVR A;  1UW1 A;  2CBI A;  1QAK A;  1VQ7 3;  3D79 A;  5AQN B;  2XF3 A;  5EK3 A;  3P50 A;  3DY5 A;  4Q25 A;  3O1J A;  2CC3 A;  3UB1 A;  2V8S V;  5AQH B;  1WMO A;  2Q9Q D;  1SPU A;  2W2C A;  1E3R A;  5LJN A;  5ELJ A;  1YVB I;  2CFG A;  3B57 A;  4KI0 F;  3N8B A;  4I50 E;  3FLJ A;  1I2G A;  1BNR A;  4MJD A;  1RHL A;  4Z8X A;  5D82 A;  3FKA A;  1OXZ A;  3RH3 A;  5AQU B;  4AKZ A;  1CH0 A;  2KMF A;  4ILF A;  2C4B A;  5LNK A;  2YDQ A;  1ZS7 A;  3F7S A;  5IEN A;  2SBL A;  1VRB A;  5LC6 A;  5FGO A;  5TGN A;  1B21 A;  1JN5 A;  2H88 A;  3JUP A;  4PEJ A;  3RGA A;  4EGW A;  2KXG A;  5J2U E;  2IML A;  2ACZ A;  1I2F A;  3ZMT B;  4N6T A;  1A2V A;  1HU9 A;  1Z8U A;  4CXY A;  2VL8 A;  1SIH A;  1FZU A;  2DWG A;  1FIO A;  3QRD A;  6GSP A;  2RPA A;  3N5L A;  1OPY A;  1RCL A;  2N1G A;  3E22 E;  2RGQ A;  4U7I A;  7GSP A;  1HS7 A;  2KF3 A;  1RNT A;  1XDO A;  1CHU A;  2X66 A;  2NR4 A;  4M1P A;  2OTJ 3;  4I4K A;  2WOF A;  3E0Z A;  4IL9 A;  3KIN B;  1IQY A;  3VR9 A;  3CMA 3;  2KT9 A;  3PUW F;  5FY0 A;  1TRP A;  4R9K A;  2JMH A;  3UU5 A;  3LDQ B;  1GOV A;  5L47 A;  2SPC A;  1JV2 B;  4JI3 T;  2W00 A;  3U1W A;  2WCA A;  1CQS A;  3TKL B;  2H89 A;  3NQY A;  1E2A A;  2BNG A;  3AGO A;  1WR6 A;  2XFS A;  4WBN E;  5FL1 A;  3I0Q A;  4IE0 A;  3HA4 A;  3SOA A;  2X67 A;  2WDV A;  3G6E 3;  3OYX A;  1D0Z A;  1S5A A;  1HZ1 A;  4E7S A;  5L3D B;  3CML A;  2Z7A A;  2WQY A;  3C4Z A;  3G06 A;  1BVI A;  3D5I A;  3QB5 K;  7STD A;  4ZI3 C;  1Q7Y 4;  4FCZ A;  3ZG5 A;  4LFC T;  1STF I;  4JI6 T;  5TAO A;  4N6N B;  2MC8 A;  4GSP A;  3BND A;  1N8Q A;  5FXV A;  2QA7 A;  1QVG 2;  4PAG A;  1MGW A;  4O4L E;  4XBF B;  2V1L A;  3ZJ1 A;  4TWF A;  4GYR A;  2M67 A;  3PUX F;  3OWS A;  1UUV B;  2YU1 A;  2OQE C;  5J0Z A;  1CYV A;  1WQL B;  1NEK A;  5IEP A;  4LF5 T;  4XBT A;  1JN5 B;  4AI6 A;  5LOV E;  2X0L B;  2CWO A;  4TNV A;  1B2Z A;  1NEN A;  4ZI7 E;  3W15 B;  3IMA B;  3JAD A;  1H7C A;  1R4C A;  2WSS V;  4MMY B;  2HN1 A;  2XGL A;  4LFA T;  3RKG A;  4DBR A;  4DO0 A;  3MG1 A;  1FGM A;  3SOL A;  3ZYL A;  4PJJ A;  2CFL A;  2YN6 A;  3SRZ A;  3PJA J;  1N36 T;  4HM4 B;  4P0A A;  2UXX B;  1TIJ A;  1BRH A;  2XQ4 A;  1EQK A;  3RIU C;  3SED A;  4EEB A;  5JR9 A;  4GOU A;  3RPU A;  4CN1 A;  3AEE A;  3KKG A;  1GMR A;  4EC6 A;  1HG5 A;  4X2O A;  3NV0 A;  3EN1 B;  3AAI A;  2OV9 A;  3ZN0 B;  4YXD A;  4UIG A;  4BA9 A;  4JI0 T;  5CXO A;  5AQM B;  2C5K T;  4MFR A;  2UUG C;  2ZM6 T;  4KVH A;  4X1Y E;  5GON E;  1W02 A;  3FZF B;  2LEH A;  2VK9 A;  4TV9 E;  3PXM A;  4ZM8 A;  4JUY A;  2WMO A;  2OOV C;  4IDO A;  3PUZ F;  2AXD S;  2W03 A;  2W9P A;  3PUS A;  3RHW A;  3WA3 A;  3ZC0 A;  2QVA A;  3CD6 3;  2DCF A;  4G63 A;  2JJ9 A;  4BU4 A;  2LM2 A;  2D0U A;  2FBW A;  3ZSS A;  5DAB A;  1GY7 A;  2X51 A;  4LF9 T;  4HM8 B;  4GYS A;  5IWA T;  4UXN B;  4R80 A;  3LT8 A;  1UUR A;  3O9X A;  1UDI I;  2H0G A;  3X40 A;  1VQ8 3;  4NRE A;  1RLS A;  3AA0 B;  1Q82 4;  1VQL 3;  3I0Y A;  4L7K A;  4JRF A;  4NXM T;  1Y64 B;  2G0U A;  2J8X B;  2O3O A;  1NAF A;  2D0T A;  2EHO C;  4HWH A;  2XR8 B;  2BG9 C;  1HNW T;  3I9Y A;  4Z91 A;  3WMD A;  3EUH A;  2HMN B;  4TV8 E;  3DXO A;  2XUE A;  1JKG A;  4BL2 A;  2PG8 A;  5LA6 E;  1NB3 I;  2RP4 A;  4HFV A;  5CJ5 A;  2HMK B;  2J47 A;  4CPK A;  3FHN A;  3Q2M A;  1WLX A;  3WHO A;  1IK3 A;  2BMQ B;  4HKV B;  5JDF A;  1XMO T;  1IV9 A;  1OED A;  3N9N A;  5EK2 A;  4KHP T;  1IT8 A;  1FGT A;  3J7Y q;  2K0M A;  3MHE A;  2P0X A;  2XGN A;  1OUN A;  3WI3 A;  5IEO A;  1YHQ 3;  2BO9 B;  4R4K A;  1RGF A;  1S94 A;  3AEC A;  1GMP A;  1Q86 4;  3TLT A;  4XBY A;  3ONL C;  3PCS A;  3KFQ C;  4O02 B;  5BU4 A;  4CZZ B;  2YKS A;  2DI4 A;  3A5X A;  5AQS B;  3UUM A;  5D81 A;  4UF0 B;  5HGR A;  4HWC A;  4UEM A;  2Q9Q A;  4IDZ A;  1KC8 4;  5JPU A;  2A15 A;  3C4X A;  3E99 A;  1Q7H A;  5KP1 A;  1I0V A;  2CWV A;  3RKO A;  3RGR A;  1LKX A;  1E7P A;  4YLH A;  3ONX A;  3K1S A;  5C3J A;  2K48 A;  1HFA A;  3GZR A;  2CXL A;  3EX9 A;  5F8P A;  3NRX A;  3KN4 A;  1BRS A;  2GEX A;  2BBJ A;  4P0B A;  1MIW A;  2BS3 A;  2XTL A;  3CX8 B;  5IG5 A;  2KF4 A;  4EV2 A;  4C91 A;  4U72 A;  3GSP A;  3A7M A;  2MTQ A;  4A56 A;  2CWY A;  1OGX A;  1JZD A;  3N9H A;  1Q9E A;  3V98 A;  1T2I A;  4LF6 T;  1S35 A;  4ASK A;  3N9P A;  2JMK A;  3ETV A;  4RBN A;  4EXT A;  4KFE A;  5AIG A;  4JI1 T;  4DR2 T;  3Q9D A;  5DRV A;  3PUA A;  4YSX A;  2KLQ A;  2NW8 A;  2Y74 A;  4YFS A;  2YEV C;  3S67 A;  5RNT A;  2GU1 A;  1RSN A;  1DET A;  3MPH A;  4LYL B;  4NXN T;  1JNZ A;  3G0K A;  4YTM A;  3BIR A;  4OYK A;  1SII A;  3NQZ A;  2OA5 A;  1ZKE A;  3OBV E;  3IJE B;  3N2O A;  3JCF A;  1YXR A;  3CCQ 3;  4H3U A;  4O2A E;  3AHS A;  1ZV4 X;  5FYM A;  2YDR A;  3N9L A;  5BXQ A;  2CXF A;  1Q40 A;  5FVK A;  5M18 A;  2Y48 B;  3OWU A;  3J7Y d;  3WR2 A;  1EKM A;  5JTG A;  4ZS2 A;  4JI5 T;  4BTW A;  1BAN A;  5LCY A;  1F8N A;  3LOY A;  4U2Z A;  3HKC E;  3RYI E;  4IE7 A;  1ZOY A;  3AEF A;  4OFZ A;  1TUH A;  4HFI A;  3LK4 2;  3CPW 2;  1DYU A;  5BMV E;  4QXB B;  1RJO A;  2YOE A;  4BIR A;  1RDS A;  1UCI A;  1HX8 A;  1W00 A;  1S72 3;  2XEP A;  1BR4 A;  3OX9 A;  5AQL B;  3RIF A;  1T72 A;  2LSY A;  2V6Y A;  3NRY A;  2BS4 A;  1RKY A;  1PFP A;  2Y73 A;  4B3T T;  4A5X A;  2SAR A;  2WWU A;  1A2K A;  3PUY F;  4ZI2 D;  3SOY A;  3FBZ A;  4XZC A;  3SWH A;  5G2G A;  1KNZ A;  4AIS A;  4AKR B;  5ABF A;  2KRT A;  4K61 A;  1EZ3 A;  1OF5 A;  4AQF A;  1Y4K A;  1OWA A;  4X5T A;  5AQP B;  4HZB B;  4KX6 A;  2LSK A;  2R41 A;  3KDS E;  1A90 A;  4JI4 T;  4OX9 T;  4TWD A;  3PUG A;  5JDQ A;  1BR1 A;  2HMM B;  3PZW A;  3LG7 A;  1JB5 A;  4DBQ A;  4DV3 T;  3F7X A;  4IE4 A;  3D3L A;  1CUN A;  1N8R 4;  3CCE 3;  2PTF A;  3AXJ B;  3KFW X;  4O8S A;  4XB5 A;  2LJL A;  4H63 H;  4TWH A;  5AEU B;  2CWT A;  3ZMZ B;  1WNH A;  3N9Q A;  2ZM0 A;  4CDL A;  1IV7 A;  1V74 A;  3GMI A;  1FA3 A;  1W0A A;  3AE8 A;  1KD1 4;  2XSB A;  3HI7 A;  4QWT A;  1K9M 4;  4WYK A;  3EAB A;  3B4P A;  1BNE A;  3F8X A;  1TTO A;  2H7V C;  4R1K A;  4WZX A;  1I3F A;  2MPK A;  5LHG B;  3A76 A;  2IUK A;  2CHN A;  3K5T A;  3SX1 A;  3B7C A;  2IYJ A;  3T8U A;  1NNV A;  3DGN A;  3R6N A;  1I8V A;  2ES0 A;  3UUB A;  3ANW A;  2XH9 A;  3SS1 A;  5F3J A;  4A98 A;  4XDV A;  4PNI A;  2W04 A;  4U74 A;  3FGY A;  2IUJ A;  3BQI A;  3HK4 A;  4CQI A;  1MMD A;  1RTU A;  4IRE A;  3NM7 A;  5ADX L;  3NVO A;  4I43 B;  3F14 A;  3AA1 B;  4OVM A;  1NB5 I;  2KWI B;  1VQ6 3;  4EOZ B;  3FZW A;  5L3B B;  1RN7 A;  1MNL A;  3AGN A;  4PW8 A;  2X9Y A;  5LGT B;  4AKL A;  5L3F B;  2RCD A;  4PK6 A;  1I3I A;  3PYJ A;  2VL0 A;  4LF4 T;  4IDP A;  4JI7 T;  3ZKR A;  2H0H A;  1X1X A;  2LRK A;  4AKI A;  3QNU A;  2UUA T;  2X9H A;  2Z76 A;  1BAO A;  3PUR A;  3ZST A;  2Y6X A;  2LE8 A;  2OCT A;  1ZGX A;  4HFB A;  4WNK A;  5ABF B;  1JNQ A;  4I5Q A;  2CM0 A;  2W0Q A;  3AAE B;  3DM8 A;  3LJC A;  4CI1 B;  5AII A;  2E9X D;  2WP9 A;  4J8T A;  1RMS A;  3R84 B;  3KCH A;  4ZHQ E;  4NIQ A;  1NJI 4;  1ZO2 A;  2IC6 A;  2D1W A;  2F4V T;  1JNR A;  1MMG A;  4HFC A;  1GD4 A;  3CPO A;  4J9A A;  1W5Z A;  2QYW A;  2UUC T;  2CCQ A;  1X1Y A;  2X68 A;  3ZCJ A;  1T8B A;  3S28 A;  4K1V A;  3MK7 C;  3OKQ A;  2M6B A;  5HXC A;  4NPP A;  2VKH A;  3UNL A;  4DID B;  5CK6 A;  2VKJ A;  4PJL A;  5L4H A;  1IDP A;  4DND A;  2HHH T;  1UCK A;  4WYK B;  3S27 A;  4COF A;  2GK9 A;  2XQ9 A;  3I56 3;  2OWP A;  3FZL B;  3WDG B;  3AEB A;  4K0K T;  2D2S A;  3PS8 A;  1FGO A;  1SJW A;  1BU4 A;  1BNF A;  1HKX A;  4PJM A;  5C8Y E;  1G0T A;  1AV4 A;  4HM2 B;  3MWZ A;  2WU2 A;  2B1E A;  1XNQ T;  2L1S A;  3IBP A;  5AQJ B;  2WU5 A;  2BKN A;  4HVN A;  1BUQ A;  3T0U A;  4DV1 T;  3CCJ 3;  4ILA A;  1VCT A;  1VQQ A;  1M62 A;  4BJN A;  3CCR 3;  1BOX A;  4DUZ T;  5EK4 A;  1LNH A;  2BT3 A;  2NWB A;  2HH7 A;  2XHE B;  4DR4 T;  4IPB A;  4N3V A;  4H9Q C;  3JUQ A;  1D1A A;  2EHO A;  5AI1 A;  4EB6 E;  3X42 A;  1I70 A;  5L4E A;  3UFG A;  3X3Z A;  4TN7 B;  1YQ3 A;  5HOH A;  3FSD A;  3LTB A;  5LG4 A;  3N9O A;  4X65 T;  3HX8 A;  3SVA A;  1JBS A;  4LFB T;  1LRZ A;  4HFD A;  1N33 T;  4L8O A;  1UCJ A;  4L8P A;  2N2N A;  3OTO T;  1BNJ A;  4ZS3 A;  3HIG A;  5LJM A;  4YTP A;  2C0S A;  1PU4 A;  2ODV A;  1O7P B;  4B6X A;  3X41 A;  1G96 A;  1W6G A;  2WDR A;  4AXP A;  2QA4 3;  4JLE A;  3RYC E;  1YD8 G;  3AE1 A;  1UGO A;  4JEU B;  1HF8 A;  3MYT A;  1RNB A;  1YJW 3;  1O7N B;  1B2U A;  3NBJ A;  3H37 A;  2BZB A;  3LXU X;  1MIY A;  1U5O A;  3LBX A;  2XPK A;  5AIF A;  4L9I A;  3P4Q A;  2VQF T;  4CCV A;  4X64 T;  5CA1 E;  2CXD A;  4IIJ E;  1IVV A;  1PYL A;  3I55 3;  2LKH A;  4EYY R;  2JPF A;  2CFK A;  4FCM A;  4ZOL E;  3IF8 B;  3P4P A;  6RNT A;  1ZEE A;  3GRD A;  3RYH E;  3BB9 A;  1SQW A;  1YGW A;  4H9O C;  4LSO A;  4GHO A;  2BHM A;  2RSX A;  5AQV B;  4MEI A;  3AE4 A;  1A67 A;  2XQ5 A;  3OJA A;  2F99 A;  1C7H A;  4PJN A;  3AED A;  1AJ3 A;  2GEY A;  1UGH I;  1KF6 A;  3JC6 C;  5FP3 A;  2LOP A;  5IUX A;  3JVC A;  1MWU A;  3DGL A;  4H61 A;  1V57 A;  2CPT A;  2L8K A;  1J5W A;  1MIV A;  3CU3 A;  4L0R A;  2FJD A;  3HKE E;  1IJ6 A;  3IA3 A;  4EIW A;  4PFP A;  1DMN A;  3MG2 A;  1ULI B;  3B4O A;  5HXH A;  2W6J H;  3N2G E;  3VRB A;  3E08 A;  3WOD G;  2WM9 A;  2NTX A;  2XSH B;  1D0Y A;  3HII A;  3LK3 B;  4X62 T;  2IA7 A;  5HXS A;  2L3L A;  4FI5 A;  1IQ8 A;  5FXW A;  4Z90 A;  4DR6 T;  1OCV A;  4BTY A;  3EAM A;  4KT3 B;  1J5E T;  3GN5 A;  1O7H B;  2GBX B;  3AMO A;  3RC3 A;  3ZN1 B;  5HAX A;  2M7O A;  2YX9 A;  1NWM X;  4RNY A;  2BMR B;  1HR0 T;  2W2U A;  1QVF 2;  1FGQ A;  3RYF E;  2WGO A;  5CGM A;  1R4Y A;  1TFK A;  1QSD A;  1N9J A;  3UUX B;  5AQQ B;  4O4I E;  3O1I A;  3VKG A;  4TZ4 C;  1KFY A;  4DR7 T;  4QXC B;  5FXZ A;  4V1A v;  1FW7 A;  3AVS A;  1RN1 A;  4WP5 A;  4ZI3 D;  3WAJ A;  1Z1S A;  2BG9 E;  2JRK A;  4YT0 A;  3X3X A;  1AVK A;  3S5C A;  3KBT A;  5ETW A;  3RRC A;  3EHZ A;  2MAW A;  4G2A A;  1O3X A;  3V92 A;  2D9D A;  1N34 T;  1N5H A;  4B3M T;  3Q5E A;  1KK7 A;  2FGT A;  3TDG A;  4HM7 B;  5HXE A;  4JBW F;  3FXD B;  5KP3 A;  6STD A;  5IHY A;  2I59 A;  5L2L A;  3S4U A;  2UXD T;  4LEH A;  1W6C A;  1YIT 3;  2CA5 A;  4EW5 A;  3FG1 A;  5KP4 A;  4N6M A;  1E97 A;  1VQN 3;  1D6Z A;  5JQG E;  1SUM B;  4O4H E;  1BRI A;  1W09 A;  1FEW A;  2F5W A;  4KZ1 A;  2Z77 A;  3FB2 A;  4HJL B;  1OH0 A;  3EDV A;  5LMN T;  4YTN A;  3CCM 3;  5IYZ E;  3TLS A;  1NU3 A;  3LZA A;  3FG3 A;  3MG3 A;  3UL6 A;  9RNT A;  5D83 A;  3ZLI A;  3NM2 A;  4QH1 A;  3AE9 A;  5HEG A;  2QRX A;  3GWH A;  2V5D A;  2V6X A;  3HI2 A;  5FY7 A;  5KX5 E;  1B20 A;  5AYR B;  3KZT A;  1UCU A;  2ZLY A;  1G02 A;  2V7L A;  2E9X A;  1YI2 3;  4TNW A;  1QLB A;  3DGY A;  3KBU A;  1SAR A;  1B2S A;  4UEL A;  3BNC A;  3KV6 A;  2CHC A;  3RNT A;  1STD A;  1IAP A;  5AQK B;  5G1L A;  4HN9 A;  3L09 A;  3PCR A;  1MMN A;  2WY2 A;  3ZMU B;  5G1K A;  2QGS A;  2WZI A;  1RRL A;  5CF1 A;  1GSP A;  1SA0 E;  4LMJ A;  4FCJ A;  3DZL A;  5JR9 B;  3OWY A;  2WGQ A;  1LVN A;  4IL4 A;  2MBG A;  3GZY B;  3NV0 B;  3WA2 X;  1RGA A;  3OXA A;  1YJN 3;  2NP9 A;  3UT5 E;  2MF7 A;  4AKG A;  3AAA B;  5M19 A;  2K9A A;  4OUQ A;  2AAE A;  1YIJ 3;  4AKH A;  4K1U A;  5GSP A;  5L3C B;  2JQ5 A;  4HE8 A;  4IE6 A;  1MGR A;  5AQT B;  1UUW B;  2CH9 A;  4HM1 B;  3AE5 A;  3U97 A;  3H3M A;  2E2V A;  2PZV A;  4DMW A;  5JRE A;  2EHO D;  2VUR A;  3D4A A;  2XQY A;  4J5G A;  4XAX B;  1X1U A;  1FUS A;  5FXX A;  2A2F X;  2UX0 A;  4U13 A;  2A3D A;  3EDU A;  4MHC A;  1K8A 4;  2MOZ A;  1YJ9 3;  2X9W A;  2NW9 A;  1DMQ A;  1W01 A;  1U4Q A;  3K9M C;  5LHH B;  1OHS A;  4DV2 T;  1LOY A;  4QWN B;  1W9R A;  5AIH A;  1UCL A;  2I6H A;  1O7G B;  1UX4 A;  2ZA4 A;  3KVA A;  1IBM T;  1BR0 A;  4UVA B;  2RNT A;  3KV9 A;  5EEO A;  1JB4 A;  1M9G A;  3NWI A;  1JKG B;  3WAK A;  4KUM B;  2NOX A;  4O4J E;  3HKD E;  3RC8 A;  2XQ6 A;  1LRA A;  2P09 A;  3QK9 A;  3B13 A;  3HR0 A;  2ZM2 A;  2L9Q A;  1M1K 4;  1FMV A;  2W0G A;  3ZC1 A;  2P9B A;  5HEU A;  2HPL A;  4YHJ A;  3JUO A;  3U78 A;  4X20 E;  4F8H A;  3UU6 A;  2D42 A;  1OED B;  3Q1C A;  1JRQ A;  1YVS A;  2P38 A;  3AEA A;  3CQC B;  5HCJ A;  3EQQ B;  5L3G B;  1K28 A;  4BL3 A;  2RFR A;  4DV0 T;  4X2H A;  1VQ9 3;  1RGL A;  3G4S 3;  3URP A;  3F40 A;  1HTJ F;  3SFD A;  2K24 A;  3EBY A;  4U7Y A;  2F86 B;  4GIW A;  1V9D A;  4H9S E;  1IVX A;  4NUV A;  1W6Y A;  3CWZ B;  3I1A A;  5A1L A;  1WTH A;  3ABV A;  2Q9Q B;  4MMX B;  4HAA A;  2KND A;  1KNR A;  2YU2 A;  4DUY T;  2Q07 A;  2KF5 A;  5FKY A;  5JR9 C;  2F5M A;  3DP7 A;  1JBT A;  3ESL A;  2CRB A;  4X1I E;  3RIA A;  1RRH A;  2JQH A;  5HEH A;  3D5G A;  1FGR A;  2W56 A;  1D6U A;  2WBL A;  1YW0 A;  3DTO A;  4U31 A;  2CX1 A;  3V5U A;  2FJE A;  3EVY A;  3DH2 A;  3CPZ A;  3G16 A;  3T1H T;  4PFO A;  5L3E B;  3ZMS B;  3F31 A;  1YKH B;  5FMN A;  1K73 4;  4NPB A;  4TX5 A;  4HWF A;  5A0O B;  4U33 A;  3F9S A;  2J62 A;  2CBJ A;  3Q5X A;  2STD A;  3UJM A;  2WZH A;  2W4X A;  4FR9 A;  1VQ4 3;  2ZHX B;  1XNR T;  3X3Y A;  3ZPO A;  5AQR B;  1BSD A;  2C5I T;  2XZE A;  3RRW A;  2JQQ A;  3D0T A;  3PU8 A;  2IMJ A;  1IYY A;  1HNZ T;  5BR8 T;  3F8H A;  3JAE A;  2UUB T;  4KMC A;  5CF2 A;  2LYX A;  3OW2 2;  3DJB A;  2W62 A;  3AE3 A;  4BAY B;  1QJG A;  4PK5 A;  2KSR A;  5LBQ B;  5AQO B;  3BU4 A;  2FXT A;  1IU7 A;  2UGI A;  1RGK A;  4IIA A;  4LGQ A;  4EAH A;  1GY5 A;  5FNV E;  2E5V A;  2VVN A;  2HML B;  3Q5D A;  2R4I A;  3ECF A;  3Q3F A;  4WFO A;  2E5L T;  5JRC A;  5STD A;  3P4W A;  3VHL A;  1YQ4 A;  2VQE T;  2OLT A;  1HX1 B;  2HN2 A;  1Q40 B;  1KEY A;  3EF8 A;  1FUW A;  1LOW A;  3CCS 3;  2X0H A;  4KP3 C;  4EYC A;  4EYU A;  4OHF A;  3P7I A;  3UL5 A;  2V7I A;  4TUY E;  3PGB A;  3F2E A;  1RGE A;  1D0X A;  1WYC A;  1JB2 A;  1Z0P A;  4GK0 E;  4YSZ A;  3NBB A;  4AEQ A;  2VKD A;  4N6V 0;  3CCL 3;  2OQE A;  4BTX A;  1OED C;  5IG0 A;  4ADZ A;  1VQ5 3;  4GL6 A;  1GQE A;  1GD3 A;  1LVF A;  2DLR A;  5BVB A;  1N5P A;  4GK5 E;  2V6Y B;  2CE7 A;  3HKB E;  2CX0 A;  4B3R T;  2HOH A;  1VCS A;  2ZL8 A;  5BIR A;  5JDH A;  3B8L A;  1BRN L;  1MWT A;  1B27 A;  1E3V A;  3O8Y A;  1WCR A;  4LMK A;  5H6R B;  3UU4 A;  2KZ7 B;  2LHN A;  2HMJ B;  3MXZ A;  3DGO A;  2Q9Q C;  2BVM A;  4L5G A;  1OF5 B;  3UFE A;  4HEA A;  1BIR A;  3FBL A;  4XBX A;  4YY3 T;  2F56 A;  1D6Y A;  5JDM A;  4CN6 A;  1XDP A;  5LHI B;  3RIU A;  1HCI A;  2VKO A;  3MA9 A;  1T7S A;  3Q90 A;  4UR9 A;  2E2A A;  1G73 A;  2YFL B;  3VF1 A;  4OK0 A;  1UUG B;  3MZK B;  2HMO B;  3V5S A;  1GOY A;  3DGM A;  1B2M A;  2IW5 B;  1BNS A;  4AKY A;  2FJA A;  4UVB B;  1BGS A;  1OHP A;  3HOH A;  3K3N A;  5DRE A;  3A8Y C;  4QKN A;  2OOV A;  2F98 A;  2BS2 A;  3CX6 B;  4HYZ A;  5C2T A;  3BNE A;  2XSO B;  4EZH A;  4DR3 T;  2B76 A;  2X9X A;  3J9X 1;  4F6R C;  4DR5 T;  4ANJ A;  1NDO B;  3G8Z A;  1WRD A;  3AE6 A;  1KWI A;  2DNX A;  2CKF B;  3CIR A;  3BLZ A;  3NBX X;  3Q2P A;  1WFD A;  3HZP A;  4X66 T;  2KCD A;  3ANW B;  4K0U A;  5LGN B;  4A97 A;  1EUI C;  1G8X A;  2VAS A;  4DV5 T;  5JDG A;  1MOL A;  1B2X A;  2YFJ B;  3KV4 A;  1B3S A;  4H9N C;  5EVH A;  2V7J A;  2B24 B;  2WB5 A;  2YFI B;  2OTL 3;  5ABH A;  3LH4 A;  3FXE B;  4MAL A;  3QK6 A;  2XAH B;  1U8C B;  1IJ5 A;  2KXP B;  4ILU A;  2KAA A;  2XAQ B;  2BG9 A;  4LML A;  1QUU A;  3L3P A;  3M65 A;  4O2H A;  5LP6 E;  1VQP 3;  5ELU A;  4FMB A;  3C50 A;  1W4N A;  4EBG A;  4ZZC A;  2PJQ A;  3LK2 B;  2DL1 A;  5JPP A;  3KII A;  2JQ9 A;  2XM2 A;  2GU3 A;  2WOH A;  4J5K A;  1RGG A;  1L0V A;  2WO0 A;  3NX0 A;  8RNT A;  1WYB A;  3LTC A;  3I0O A;  2GXF A;  3OVU A;  4CJN A;  5KXJ A;  1IZN B;  2I9W A;  3CNX A;  3D9R A;  1MWS A;  3B5M A;  3AA6 B;  1LOX A;  1BSE A;  2BIR A;  3S29 A;  1KNP A;  5J1G A;  1O7W B;  3C51 A;  4GKK T;  3QB5 A;  1L5G B;  4QH4 A;  1T5Y A;  2YK0 A;  1VQO 3;  4AQY T;  4FMD A;  4O2B E;  4AQF C;  2AAD A;  3IHR A;  2CIU A;  3CCU 3;  4N6O B;  1TJD A;  1XMQ T;  2JDI H;  2ZM8 A;  1MNE A;  2CG1 A;  2J1D G;  2P0M A;  1ASK A;  3BK9 A;  3LSV A;  5JH7 E;  1ULJ B;  2PFV A;  4UV9 B;  3UU8 A;  5HXR A;  3LTD A;  3ZT6 A;  4K90 B;  4UV8 B;  1BSB A;  2LSG A;  5ABG A;  4MLK A;  1I94 T;  5HEJ A;  3U3I A;  3Q5W A;  2J4G A;  2IIU A;  1EA2 A;  5AYS C;  5M1A A;  2XY8 B;  3GA8 A;  2BKO A;  3FF0 A;  1QAL A;  5FW5 A;  3LFM A;  1MND A;  3GAX A;  3AA7 B;  1HYF A;  4HM0 B;  1TP6 A;  1E1H B;  1WMN A;  4YJ2 E;  2R6G F;  5IER A;  2IC9 A;  4ZEY A;  2WDQ A;  4HFE A;  3RX6 A;  2LKG A;  4H9P C;  2A9U A;  5EZY E;  3TLV A;  2UXB T;  2EHO B;  1HG2 A;  2BG9 B;  2LRL A;  3K8P C;  2XQ8 A;  1AVL A;  5F5W A;  1GS3 A;  2UXC T;  3DMC A;  4GB5 A;  2XAS B;  3P8C D;  4YJ3 E;  2BVL A;  3GZX B;  3M3Z B;  4C90 A;  4DVD A;  1GYB A;  1RN4 A;  4KFF A;  2QEX 3;  1VQM 3;  1TU5 A;  1M90 4;  1MWR A;  3KVB A;  4EV5 A;  1AQZ A;  3RQW A;  5HCM A;  3ER7 A;  4R9L A;  5DJQ C;  3ZFZ A;  3PJA A;  2E2U A;  1ZP0 A;  4Q53 A;  3CME 3;  2FNQ A;  3ZMV B;  1X79 A;  3GWR A;  3LT9 A;  1LQG C;  3MJX A;  4J2C A;  3BQL A;  3CX7 B;  3RF1 A;  2ZDJ A;  3FF2 A;  2XRX B;  4ORL A;  1JBR A;  2IY2 A;  3LBX B;  4CI3 B;  3FH1 A;  4JF8 A;  1LVK A;  3JC6 D;  2LOS A;  4CI2 B;  2VWA A;  1W7C A;  4LZI A;  2E8I A;  2C11 A;  3K7C A;  3KSE D;  1LXE A;  5JDN A;  3PUV F;  4KBM B;  2KWH A;  2I0M A;  3ZT5 A;  2HPJ A;  3L39 A;  2LSJ A;  1J1J A;  4UF0 A;  4DR1 T;  2XM1 A;  4U3C A;  3X1D A;  3C98 B;  1M1X B;  4STD A;  2CFD A;  3EE1 A;  3FZH B;  3BNB A;  3JUN A;  3ZYM A;  4ILC A;  2XJ7 A;  1BNI A;  4WYV A;  1Q81 4;  2INX A;  2BDE A;  3AE7 A;  3ZT7 A;  1IBL T;  4ERR A;  2KIN B;  5LC7 A;  3MKI A;  1XZY A;  2B1X B;  1NWW A;  2F4Y A;  1UUS A;  4ZXL A;  1IT7 A;  5LGU B;  3EI0 A;  4P09 A;  3HL6 A;  1BR2 A;  1N32 T;  2PBI A;  1IQX A;  4DV7 T;  1RGH A;  3IPT A;  3AHW A;  1X9B A;  5LMU T;  1YGE A;  2BU4 A;  5AEW B;  4MMZ B;  5CA0 E;  1ISK A;  2L4V A;  3C4W A;  3UUN A;  2JIW A;  4N78 D;  2W61 A;  3SFE A;  4ILB A;  4WHA A;  4IE5 A;  4U2Y A;  4CN4 A;  3GN5 B;  4H63 V;  4I4T E;  3ONJ A;  3AMO B;  2NW7 A;  5FVL A;  2FUP A;  5LG3 A;  5H6Q B;  2V5C A;  1B7T A;  2W63 A;  1UI7 A;  4QXH B;  2DHR A;  4EXR A;  3WOF B;  1N9E A;  1VZZ A;  3NHX A;  2V26 A;  3NXJ A;  5AQG B;  2XQ3 A;  3QUJ A;  2V7K A;  4DMV A;  4DV4 T;  2O9U X;  5IF6 A;  5JDL A;  3IEE A;  5DQW A;  3L0R A;  2V1D B;  5ABE A;  1FUT A;  4DKI A;  2CK3 H;  1C54 A;  3K3Q C;  5HWX A;  5HEO A;  4IDQ A;  1YNV X;  2UU9 T;  3VRA A;  3PTR B;  4EED A;  4LF7 T;  4AQG A;  3PV0 F;  2QGU A;  3EJV A;  1EG9 B;  3RDE A;  1W2B 2;  3L8R A;  3AE2 A;  3EHC A;  3OV4 A;  4XM4 A;  2JQK A;  1U5P A;  4B3S T;  1PY3 A;  3KE7 A;  4CXX A;  2XAG B;  1LOV A;  1IVW A;  3UQ7 A;  4ISS A;  5HYA A;  3CC4 3;  3QOF A;  2WAU A;  2XFT A;  2H0I A;  3G71 3;  3MSO A;  2NTY A;  4WW0 A;  2MYS A;  3CNM A;  4IDN A;  4RNZ A;  2IDO B;  3AEG A;  1BSA A;  4HFH A;  4TX4 A;  1OHO A;  2N9D A;  1EEJ A;  1CEW I;  1IBK T;  1ZX2 A;  2H7O A;  1T3B A;  4AIU A;  3UUL A;  1LNI A;  5IW9 A;  3H3A A;  3FZK B;  4ZZB A;  1CYU A;  1OGZ A;  1R8I A;  3AB3 B;  1AR0 A;  1I6Z A;  3EN8 A;  3PDY A;  5EQL A;  2E9X B;  4HZ9 B;  2VVS A;  4YSY A;  3F57 A;  3VSY A;  3UTK A;  4OYJ A;  3NUV A;  4JI2 T;  3ROB A;  2CLY B;  4FMC A;  1UK5 A;  4JI8 T;  5IG3 A;  4HM5 B;  3VGN A;  3AXJ A;  3KSP A;  4ZI2 C;  1TFO A;  3JAF A;  1T2H A;  4FJO A;  2W66 A;  2RBI A;  4HGA A;  4H9R C;  3EB8 A;  2Y8D A;  1RCK A;  1VQK 3;  4EZ4 A;  4HWI B;  4HOH A;  4RZM A;  3CXC 2;  3RGL A;  1US1 A;  2K5B B;  1D1B A;  1BRJ A;  3ZCI A;  3ZJ2 A;  1T98 A;  4PK4 A;  2CHO A;  3UU3 A;  3FG4 A;  3NKZ A;  5CB4 E;  2Z6E A;  1VOM A;  1BRG A;  3NBR A;  3RI5 A;  1LQM B;  3CC2 3;  1NO3 A;  3VKH A;  2CMR A;  2CWU A;  5LYJ E;  3GZB A;  1KQS 2;  1QMA A;  4N6U A;  4LF8 T;  1GOU A;  2IUB A;  3C64 A;  3T8O A;  2C5J A;  4WBO A;  1ROV A;  2Z6B A;  2BMO B;  4X1K E;  1IVU A;  1W2Z A;  3LTA A;  2PNC A;  1MMA A;  5JVD E;  2K54 A;  5HWY A;  1GMQ A;  1WMP A;  2WS3 A;  5E0O A;  2C10 A;  4NHF A;  3K3O A;  4DV6 T;  4HTE A;  3V99 A;  1JJ2 2;  3T1Y T;  4JYA T;  4QX8 B;  1GY6 A;  5I97 A;  2LLY A;  2X0Y A;  3BQK A;  4FMA A;  4QX7 B;  3TLU A;  4IT7 A;  2WMN A;  5M4Y A;  4RNT A;  3P4R A;  3QC9 A;  4CXW A;  1DU2 A;  1AY7 A;  2CFW A;  3N54 B;  1O7M B;  2LHR A;  3CKD A;  1BSC A;  2AE9 A;  2XSA A;  1OED E;  1X1W A;  4IGU A;  3PE0 A;  3T8N A;  2GBW B;  3EBT A;  4WWU C;  2D5U A;  3ZEF B;  2ODU A;  1DE3 A;  2H3R A;  3OPC A;  2XAF B;  1QAF A;  1JZO A;  2LSI A;  4IHJ E;  1I0X A;  3N9M A;  4HKA A; 
#chains in the Genus database with same CATH homology
 5JBS A;  1YKE B;  3OYZ A;  4UVC B;  1J2B A;  5KMG P;  1DVC A;  3FCS B;  5AFU L;  1UX5 A;  3N2K E;  3K0Z A;  3VU7 H;  4MBQ A;  5IG4 A;  1Q42 A;  2DWK A;  3STD A;  2E9X C;  1D1C A;  3CQX C;  4O3V A;  2A72 A;  3M8C A;  3ALA A;  1SHZ C;  5CLK A;  3PU3 A;  4HBR A;  2CLY C;  2ZMA A;  2LT3 A;  2XAJ B;  5J2T E;  1KSI A;  3CC7 3;  4HM6 B;  3H51 A;  1US7 B;  3LYG A;  3O4X E;  2P05 A;  4JEH B;  2CW9 A;  1FMW A;  4KFD A;  2LM9 A;  3O1H A;  1DMM A;  2YIN A;  3DUK A;  3CCV 3;  2VB6 A;  3ETU A;  4HM3 B;  3EC9 A;  5LBM A;  3CQG B;  2CEA A;  5LXT E;  5FY1 A;  2RA1 A;  2W56 B;  2UXN B;  1OAC A;  1ZHC A;  3CVR A;  2ML6 A;  4E7Z A;  2W9Q A;  4QHO A;  3NZP A;  2ACX A;  2E2T A;  3KV5 A;  2V7M A;  4I55 E;  3WOE B;  3I9W A;  3JUM A;  2ML5 A;  1ROA A;  3SLU A;  8CHO A;  3K63 A;  2CG0 A;  4XDW A;  4LMI A;  4N6L A;  5KDM C;  2IAK A;  1UI8 A;  3ZYK A;  4BJM A;  3H3H A;  1K41 A;  2LQV A;  3NZQ A;  1DVD A;  4NUU A;  3MAC A;  2QIY A;  5JRC B;  4IST A;  3MKD A;  5DQV A;  3LML A;  3SXX A;  3PUQ A;  4G1M B;  3AVR A;  1UW1 A;  1QAK A;  1VQ7 3;  2XF3 A;  5EK3 A;  3DY5 A;  3O1J A;  2CC3 A;  3UB1 A;  1WMO A;  2Q9Q D;  1SPU A;  2W2C A;  1E3R A;  5LJN A;  5ELJ A;  1YVB I;  2CFG A;  3B57 A;  3N8B A;  4I50 E;  3FLJ A;  4MJD A;  4Z8X A;  5D82 A;  3FKA A;  1OXZ A;  3RH3 A;  4AKZ A;  2KMF A;  5LNK A;  3F7S A;  5IEN A;  2SBL A;  1VRB A;  5LC6 A;  5FGO A;  5TGN A;  1JN5 A;  3JUP A;  4PEJ A;  3RGA A;  2KXG A;  5J2U E;  3ZMT B;  4N6T A;  1A2V A;  1HU9 A;  4CXY A;  2VL8 A;  1SIH A;  2DWG A;  1FIO A;  3QRD A;  3N5L A;  1OPY A;  2N1G A;  3E22 E;  2RGQ A;  1HS7 A;  2OTJ 3;  2X66 A;  4M1P A;  4I4K A;  2WOF A;  3E0Z A;  3KIN B;  1IQY A;  3CMA 3;  2KT9 A;  5FY0 A;  4R9K A;  2JMH A;  2SPC A;  1JV2 B;  2W00 A;  3U1W A;  1CQS A;  3TKL B;  3NQY A;  2BNG A;  1WR6 A;  2XFS A;  4WBN E;  3I0Q A;  4IE0 A;  3HA4 A;  3SOA A;  2X67 A;  3G6E 3;  3OYX A;  1D0Z A;  1S5A A;  4E7S A;  5L3D B;  3CML A;  2Z7A A;  3C4Z A;  7STD A;  4ZI3 C;  1Q7Y 4;  4FCZ A;  1STF I;  5TAO A;  4N6N B;  2MC8 A;  3BND A;  1N8Q A;  5FXV A;  2QA7 A;  1QVG 2;  4PAG A;  4O4L E;  4XBF B;  2V1L A;  3ZJ1 A;  4GYR A;  2M67 A;  3OWS A;  1UUV B;  2YU1 A;  2OQE C;  1CYV A;  1WQL B;  5IEP A;  4XBT A;  1JN5 B;  4AI6 A;  5LOV E;  2X0L B;  2CWO A;  4ZI7 E;  3W15 B;  3IMA B;  1H7C A;  1R4C A;  2WSS V;  4MMY B;  2XGL A;  4DBR A;  4DO0 A;  3MG1 A;  1FGM A;  3SOL A;  3ZYL A;  4PJJ A;  2CFL A;  3SRZ A;  4HM4 B;  4P0A A;  2UXX B;  1TIJ A;  1EQK A;  3SED A;  5JR9 A;  4GOU A;  3RPU A;  3KKG A;  4EC6 A;  1HG5 A;  4X2O A;  3NV0 A;  3EN1 B;  3AAI A;  3ZN0 B;  4UIG A;  4BA9 A;  5CXO A;  2C5K T;  4MFR A;  4KVH A;  4X1Y E;  5GON E;  1W02 A;  2LEH A;  2VK9 A;  4TV9 E;  3PXM A;  4ZM8 A;  4JUY A;  2WMO A;  2OOV C;  2W03 A;  2W9P A;  3PUS A;  3WA3 A;  3ZC0 A;  3CD6 3;  2DCF A;  4G63 A;  2JJ9 A;  2D0U A;  5DAB A;  1GY7 A;  2X51 A;  4HM8 B;  4GYS A;  4UXN B;  4R80 A;  3LT8 A;  3O9X A;  3X40 A;  1VQ8 3;  4NRE A;  3AA0 B;  1Q82 4;  1VQL 3;  3I0Y A;  4L7K A;  4JRF A;  1Y64 B;  2G0U A;  2O3O A;  1NAF A;  2D0T A;  2EHO C;  2XR8 B;  3I9Y A;  3WMD A;  3EUH A;  2HMN B;  4TV8 E;  3DXO A;  2XUE A;  1JKG A;  2PG8 A;  5LA6 E;  1NB3 I;  2RP4 A;  4HFV A;  2HMK B;  3FHN A;  3Q2M A;  1WLX A;  1IK3 A;  2BMQ B;  4HKV B;  5JDF A;  1IV9 A;  3N9N A;  5EK2 A;  1IT8 A;  1FGT A;  3J7Y q;  2K0M A;  3MHE A;  2P0X A;  2XGN A;  1OUN A;  3WI3 A;  5IEO A;  1YHQ 3;  2BO9 B;  4R4K A;  1S94 A;  1Q86 4;  4XBY A;  3PCS A;  3KFQ C;  4O02 B;  4CZZ B;  3A5X A;  2DI4 A;  3UUM A;  5D81 A;  4UF0 B;  5HGR A;  4UEM A;  2Q9Q A;  4IDZ A;  1KC8 4;  5JPU A;  2A15 A;  3C4X A;  3E99 A;  5KP1 A;  2CWV A;  3RKO A;  3RGR A;  1LKX A;  4YLH A;  3ONX A;  2K48 A;  1HFA A;  3GZR A;  2CXL A;  3EX9 A;  5F8P A;  3NRX A;  3KN4 A;  2GEX A;  4P0B A;  1MIW A;  2XTL A;  3CX8 B;  5IG5 A;  4EV2 A;  4C91 A;  4U72 A;  2MTQ A;  4A56 A;  2CWY A;  1OGX A;  3N9H A;  3V98 A;  1S35 A;  4ASK A;  3N9P A;  2JMK A;  3ETV A;  4RBN A;  4EXT A;  4KFE A;  5AIG A;  3Q9D A;  5DRV A;  3PUA A;  2KLQ A;  2NW8 A;  2Y74 A;  4YFS A;  2YEV C;  3S67 A;  2GU1 A;  3MPH A;  3G0K A;  4OYK A;  1SII A;  3NQZ A;  2OA5 A;  1ZKE A;  3OBV E;  3IJE B;  3N2O A;  3CCQ 3;  4H3U A;  4O2A E;  1ZV4 X;  5FYM A;  3N9L A;  5BXQ A;  2CXF A;  1Q40 A;  2Y48 B;  3OWU A;  3J7Y d;  1EKM A;  4ZS2 A;  4BTW A;  5LCY A;  1F8N A;  3LOY A;  3HKC E;  3RYI E;  4IE7 A;  4OFZ A;  1TUH A;  3LK4 2;  3CPW 2;  1DYU A;  5BMV E;  4QXB B;  1RJO A;  1HX8 A;  1W00 A;  1S72 3;  2XEP A;  1BR4 A;  3OX9 A;  2LSY A;  3NRY A;  1RKY A;  1PFP A;  2Y73 A;  2WWU A;  1A2K A;  4ZI2 D;  3SOY A;  3FBZ A;  4XZC A;  3SWH A;  5G2G A;  1KNZ A;  4AKR B;  2KRT A;  4K61 A;  1EZ3 A;  1OF5 A;  4AQF A;  1Y4K A;  1OWA A;  4HZB B;  2LSK A;  3KDS E;  1A90 A;  3PUG A;  5JDQ A;  1BR1 A;  2HMM B;  3PZW A;  3LG7 A;  1JB5 A;  4DBQ A;  3F7X A;  4IE4 A;  3D3L A;  1CUN A;  1N8R 4;  3CCE 3;  3KFW X;  4O8S A;  4XB5 A;  2LJL A;  4H63 H;  5AEU B;  2CWT A;  3ZMZ B;  1WNH A;  3N9Q A;  2ZM0 A;  4CDL A;  1IV7 A;  1V74 A;  3GMI A;  1FA3 A;  1KD1 4;  3HI7 A;  4QWT A;  1K9M 4;  4WYK A;  3B4P A;  3F8X A;  2H7V C;  4R1K A;  5LHG B;  3A76 A;  2IUK A;  3K5T A;  3SX1 A;  3B7C A;  3T8U A;  3DGN A;  3R6N A;  2ES0 A;  3ANW A;  2XH9 A;  3SS1 A;  5F3J A;  4XDV A;  4PNI A;  2W04 A;  4U74 A;  3FGY A;  2IUJ A;  3BQI A;  3HK4 A;  4CQI A;  1MMD A;  3NM7 A;  5ADX L;  4I43 B;  3F14 A;  3AA1 B;  4OVM A;  1NB5 I;  2KWI B;  1VQ6 3;  4EOZ B;  3FZW A;  5L3B B;  1RN7 A;  1MNL A;  4PW8 A;  2X9Y A;  5LGT B;  4AKL A;  5L3F B;  2RCD A;  4PK6 A;  3PYJ A;  4AKI A;  2X9H A;  2Z76 A;  3PUR A;  2Y6X A;  2LE8 A;  2OCT A;  4WNK A;  1JNQ A;  2CM0 A;  2W0Q A;  3AAE B;  3DM8 A;  3LJC A;  4CI1 B;  5AII A;  2E9X D;  4J8T A;  3R84 B;  4ZHQ E;  1NJI 4;  1ZO2 A;  2IC6 A;  2D1W A;  1MMG A;  1GD4 A;  4J9A A;  3CPO A;  1W5Z A;  2CCQ A;  2X68 A;  3ZCJ A;  3S28 A;  4K1V A;  3MK7 C;  3OKQ A;  5HXC A;  2VKH A;  3UNL A;  5CK6 A;  2VKJ A;  4PJL A;  1IDP A;  4DND A;  4WYK B;  3S27 A;  2GK9 A;  3I56 3;  2OWP A;  3WDG B;  2D2S A;  3PS8 A;  1FGO A;  1SJW A;  1HKX A;  4PJM A;  5C8Y E;  1AV4 A;  4HM2 B;  3MWZ A;  2B1E A;  3IBP A;  4HVN A;  1BUQ A;  3T0U A;  3CCJ 3;  4BJN A;  3CCR 3;  5EK4 A;  1LNH A;  2BT3 A;  2NWB A;  2HH7 A;  2XHE B;  4IPB A;  4N3V A;  4H9Q C;  3JUQ A;  1D1A A;  2EHO A;  5AI1 A;  4EB6 E;  3X42 A;  3X3Z A;  4TN7 B;  3FSD A;  3LTB A;  5LG4 A;  3N9O A;  3HX8 A;  3SVA A;  1LRZ A;  4L8O A;  4L8P A;  2N2N A;  4ZS3 A;  3HIG A;  5LJM A;  2C0S A;  1PU4 A;  2ODV A;  1O7P B;  4B6X A;  3X41 A;  1G96 A;  1W6G A;  4AXP A;  2QA4 3;  4JLE A;  3RYC E;  1YD8 G;  4JEU B;  1HF8 A;  3MYT A;  1YJW 3;  1O7N B;  3NBJ A;  3H37 A;  2BZB A;  3LXU X;  1MIY A;  1U5O A;  3LBX A;  5AIF A;  4L9I A;  4CCV A;  5CA1 E;  2CXD A;  4IIJ E;  1IVV A;  3I55 3;  4EYY R;  2JPF A;  2CFK A;  4FCM A;  4ZOL E;  3IF8 B;  1ZEE A;  3GRD A;  3RYH E;  3BB9 A;  1SQW A;  4H9O C;  4LSO A;  2BHM A;  2RSX A;  4MEI A;  1A67 A;  2F99 A;  3OJA A;  1C7H A;  4PJN A;  1AJ3 A;  2GEY A;  3JVC A;  3JC6 C;  5FP3 A;  2LOP A;  3DGL A;  4H61 A;  2L8K A;  1MIV A;  3CU3 A;  4L0R A;  3HKE E;  1IJ6 A;  4EIW A;  4PFP A;  1DMN A;  3MG2 A;  1ULI B;  3B4O A;  5HXH A;  2W6J H;  3N2G E;  3E08 A;  3WOD G;  2WM9 A;  2NTX A;  2XSH B;  1D0Y A;  3HII A;  3LK3 B;  2IA7 A;  5HXS A;  2L3L A;  4FI5 A;  1IQ8 A;  5FXW A;  1OCV A;  4BTY A;  3GN5 A;  1O7H B;  2GBX B;  3AMO A;  3RC3 A;  3ZN1 B;  5HAX A;  2M7O A;  2YX9 A;  1NWM X;  4RNY A;  2BMR B;  1QVF 2;  1FGQ A;  3RYF E;  2WGO A;  1TFK A;  1QSD A;  1N9J A;  3UUX B;  4O4I E;  3O1I A;  3VKG A;  4TZ4 C;  4QXC B;  5FXZ A;  4V1A v;  3AVS A;  4WP5 A;  4ZI3 D;  3WAJ A;  1Z1S A;  2JRK A;  3X3X A;  1AVK A;  3S5C A;  3KBT A;  5ETW A;  3RRC A;  4G2A A;  1O3X A;  3V92 A;  1N5H A;  1KK7 A;  2FGT A;  3TDG A;  4HM7 B;  5HXE A;  3FXD B;  5KP3 A;  6STD A;  5IHY A;  2I59 A;  5L2L A;  3S4U A;  4LEH A;  1W6C A;  1YIT 3;  2CA5 A;  3FG1 A;  5KP4 A;  4N6M A;  1E97 A;  1VQN 3;  1D6Z A;  5JQG E;  4O4H E;  1FEW A;  4KZ1 A;  2Z77 A;  3FB2 A;  4HJL B;  1OH0 A;  3EDV A;  3CCM 3;  5IYZ E;  1NU3 A;  3LZA A;  3FG3 A;  3MG3 A;  3UL6 A;  5D83 A;  3ZLI A;  3NM2 A;  3GWH A;  3HI2 A;  5FY7 A;  5KX5 E;  5AYR B;  3KZT A;  1UCU A;  2ZLY A;  2V7L A;  2E9X A;  1YI2 3;  3KBU A;  3BNC A;  4UEL A;  3KV6 A;  2CHC A;  1STD A;  1IAP A;  4HN9 A;  3L09 A;  3PCR A;  1MMN A;  3ZMU B;  2QGS A;  1RRL A;  5CF1 A;  1SA0 E;  4FCJ A;  3DZL A;  5JR9 B;  3OWY A;  2WGQ A;  1LVN A;  2MBG A;  3GZY B;  3NV0 B;  3WA2 X;  3OXA A;  1YJN 3;  2NP9 A;  3UT5 E;  2MF7 A;  4AKG A;  3AAA B;  2K9A A;  4OUQ A;  1YIJ 3;  4AKH A;  4K1U A;  5L3C B;  2JQ5 A;  4HE8 A;  4IE6 A;  1UUW B;  2CH9 A;  4HM1 B;  3U97 A;  2E2V A;  2PZV A;  4DMW A;  5JRE A;  2EHO D;  2XQY A;  4XAX B;  5FXX A;  2A2F X;  2UX0 A;  4U13 A;  2A3D A;  3EDU A;  4MHC A;  1K8A 4;  2MOZ A;  1YJ9 3;  2X9W A;  2NW9 A;  1DMQ A;  1W01 A;  1U4Q A;  3K9M C;  5LHH B;  1OHS A;  4QWN B;  5AIH A;  1O7G B;  1UX4 A;  3KVA A;  1BR0 A;  4UVA B;  3KV9 A;  5EEO A;  1JB4 A;  1M9G A;  1JKG B;  3WAK A;  4KUM B;  2NOX A;  4O4J E;  3HKD E;  3RC8 A;  2P09 A;  3QK9 A;  3B13 A;  3HR0 A;  2ZM2 A;  2L9Q A;  1M1K 4;  1FMV A;  2W0G A;  3ZC1 A;  2P9B A;  2HPL A;  4YHJ A;  3JUO A;  3U78 A;  4X20 E;  2D42 A;  3Q1C A;  1JRQ A;  2P38 A;  3CQC B;  3EQQ B;  5L3G B;  1K28 A;  2RFR A;  4X2H A;  1VQ9 3;  3G4S 3;  3F40 A;  1HTJ F;  2K24 A;  3EBY A;  2F86 B;  4GIW A;  1V9D A;  4H9S E;  1IVX A;  4NUV A;  1W6Y A;  3CWZ B;  3I1A A;  5A1L A;  1WTH A;  2Q9Q B;  4MMX B;  2KND A;  2YU2 A;  2Q07 A;  5JR9 C;  3DP7 A;  3ESL A;  4X1I E;  1RRH A;  1FGR A;  2W56 A;  1D6U A;  2WBL A;  1YW0 A;  3DTO A;  3V5U A;  3EVY A;  3CPZ A;  3G16 A;  4PFO A;  5L3E B;  3ZMS B;  3F31 A;  1YKH B;  5FMN A;  1K73 4;  4TX5 A;  5A0O B;  3F9S A;  3UJM A;  2STD A;  3Q5X A;  4FR9 A;  1VQ4 3;  3X3Y A;  3ZPO A;  2C5I T;  3RRW A;  2JQQ A;  3D0T A;  3PU8 A;  2IMJ A;  3F8H A;  4KMC A;  5CF2 A;  2LYX A;  3OW2 2;  3DJB A;  2W62 A;  4BAY B;  1QJG A;  4PK5 A;  5LBQ B;  2FXT A;  1IU7 A;  4LGQ A;  4IIA A;  4EAH A;  1GY5 A;  5FNV E;  2HML B;  2R4I A;  3ECF A;  4WFO A;  5JRC A;  5STD A;  3VHL A;  1Q40 B;  3EF8 A;  1FUW A;  3CCS 3;  4KP3 C;  4EYC A;  4EYU A;  4OHF A;  3P7I A;  3UL5 A;  2V7I A;  4TUY E;  3PGB A;  3F2E A;  1D0X A;  1WYC A;  1JB2 A;  1Z0P A;  4GK0 E;  4AEQ A;  3NBB A;  2VKD A;  4N6V 0;  3CCL 3;  2OQE A;  4BTX A;  5IG0 A;  4ADZ A;  1VQ5 3;  4GL6 A;  1GD3 A;  1LVF A;  2DLR A;  5BVB A;  1N5P A;  4GK5 E;  2CE7 A;  3HKB E;  2ZL8 A;  5JDH A;  3B8L A;  1E3V A;  3O8Y A;  5H6R B;  2KZ7 B;  2LHN A;  2HMJ B;  3MXZ A;  3DGO A;  2Q9Q C;  2BVM A;  4L5G A;  1OF5 B;  3UFE A;  4HEA A;  3FBL A;  4XBX A;  1D6Y A;  5JDM A;  5LHI B;  1HCI A;  2VKO A;  3MA9 A;  3Q90 A;  1G73 A;  2YFL B;  3VF1 A;  4OK0 A;  3MZK B;  2HMO B;  3V5S A;  3DGM A;  2IW5 B;  4AKY A;  4UVB B;  1OHP A;  3K3N A;  5DRE A;  2OOV A;  4QKN A;  2F98 A;  3CX6 B;  4HYZ A;  3BNE A;  2XSO B;  4EZH A;  2X9X A;  3J9X 1;  4F6R C;  4ANJ A;  1NDO B;  3G8Z A;  1WRD A;  1KWI A;  2DNX A;  2CKF B;  3BLZ A;  3NBX X;  3Q2P A;  3HZP A;  2KCD A;  3ANW B;  4K0U A;  5LGN B;  1G8X A;  2VAS A;  5JDG A;  1MOL A;  2YFJ B;  3KV4 A;  5EVH A;  4H9N C;  2V7J A;  2B24 B;  2YFI B;  2OTL 3;  3LH4 A;  1U8C B;  3FXE B;  3QK6 A;  2XAH B;  4MAL A;  1IJ5 A;  2KXP B;  4ILU A;  2XAQ B;  1QUU A;  3L3P A;  3M65 A;  4O2H A;  5LP6 E;  1VQP 3;  5ELU A;  4FMB A;  3C50 A;  1W4N A;  4EBG A;  2PJQ A;  3LK2 B;  5JPP A;  3KII A;  2GU3 A;  2WOH A;  2WO0 A;  3NX0 A;  1WYB A;  3LTC A;  3I0O A;  2GXF A;  1IZN B;  2I9W A;  3CNX A;  3D9R A;  3AA6 B;  1LOX A;  3S29 A;  5J1G A;  1O7W B;  3C51 A;  1L5G B;  1T5Y A;  2YK0 A;  1VQO 3;  4FMD A;  4O2B E;  4AQF C;  3IHR A;  2CIU A;  3CCU 3;  4N6O B;  2JDI H;  2ZM8 A;  1MNE A;  2CG1 A;  2J1D G;  2P0M A;  1ASK A;  3BK9 A;  1ULJ B;  5JH7 E;  2PFV A;  4UV9 B;  5HXR A;  3LTD A;  4K90 B;  4UV8 B;  2LSG A;  4MLK A;  3U3I A;  3Q5W A;  1EA2 A;  5AYS C;  3GA8 A;  3FF0 A;  1QAL A;  5FW5 A;  3LFM A;  1MND A;  3GAX A;  3AA7 B;  4HM0 B;  1TP6 A;  1E1H B;  1WMN A;  4YJ2 E;  5IER A;  2IC9 A;  3RX6 A;  4H9P C;  5EZY E;  2EHO B;  1HG2 A;  3K8P C;  1AVL A;  1GS3 A;  3DMC A;  4GB5 A;  2XAS B;  3P8C D;  4YJ3 E;  2BVL A;  3GZX B;  4C90 A;  1GYB A;  4DVD A;  4KFF A;  2QEX 3;  1VQM 3;  1TU5 A;  1M90 4;  3KVB A;  4EV5 A;  3ER7 A;  4R9L A;  5DJQ C;  2E2U A;  4Q53 A;  3CME 3;  2FNQ A;  3ZMV B;  1X79 A;  3GWR A;  3LT9 A;  3MJX A;  4J2C A;  3BQL A;  3CX7 B;  2ZDJ A;  3FF2 A;  2XRX B;  4ORL A;  3LBX B;  4CI3 B;  3FH1 A;  4JF8 A;  1LVK A;  3JC6 D;  2LOS A;  4CI2 B;  2VWA A;  1W7C A;  4LZI A;  2E8I A;  2C11 A;  3K7C A;  3KSE D;  1LXE A;  5JDN A;  4KBM B;  2KWH A;  2HPJ A;  2LSJ A;  4UF0 A;  4STD A;  3C98 B;  1M1X B;  2CFD A;  3EE1 A;  3BNB A;  3JUN A;  3ZYM A;  1Q81 4;  2INX A;  2BDE A;  4ERR A;  2KIN B;  5LC7 A;  3MKI A;  2B1X B;  1NWW A;  1IT7 A;  5LGU B;  4P09 A;  3HL6 A;  1BR2 A;  2PBI A;  1IQX A;  3IPT A;  1YGE A;  5AEW B;  4MMZ B;  5CA0 E;  1ISK A;  2L4V A;  3C4W A;  3UUN A;  4N78 D;  2W61 A;  4WHA A;  4IE5 A;  3GN5 B;  4H63 V;  4I4T E;  3AMO B;  2NW7 A;  5H6Q B;  1B7T A;  2W63 A;  1UI7 A;  4QXH B;  2DHR A;  4EXR A;  3WOF B;  1N9E A;  1VZZ A;  3NHX A;  2V26 A;  3NXJ A;  3QUJ A;  2V7K A;  4DMV A;  2O9U X;  5IF6 A;  5JDL A;  3IEE A;  5DQW A;  3L0R A;  2V1D B;  2CK3 H;  3K3Q C;  5HWX A;  3PTR B;  4AQG A;  2QGU A;  3EJV A;  1EG9 B;  3RDE A;  1W2B 2;  3EHC A;  3OV4 A;  4XM4 A;  1U5P A;  3KE7 A;  4CXX A;  2XAG B;  1IVW A;  4ISS A;  5HYA A;  3CC4 3;  2WAU A;  2XFT A;  3G71 3;  3MSO A;  2NTY A;  4WW0 A;  2MYS A;  3CNM A;  4RNZ A;  4TX4 A;  1OHO A;  2N9D A;  1CEW I;  1ZX2 A;  2H7O A;  3UUL A;  5IW9 A;  3H3A A;  1CYU A;  1OGZ A;  3AB3 B;  1AR0 A;  3EN8 A;  3PDY A;  5EQL A;  2E9X B;  4HZ9 B;  3F57 A;  3VSY A;  3UTK A;  4OYJ A;  3NUV A;  3ROB A;  2CLY B;  4FMC A;  5IG3 A;  4HM5 B;  3VGN A;  3KSP A;  4ZI2 C;  1TFO A;  4FJO A;  4HGA A;  4H9R C;  3EB8 A;  2Y8D A;  1VQK 3;  4EZ4 A;  3CXC 2;  4RZM A;  1US1 A;  2K5B B;  1D1B A;  3ZCI A;  1T98 A;  4PK4 A;  3ZJ2 A;  3FG4 A;  5CB4 E;  2Z6E A;  1VOM A;  3NBR A;  3CC2 3;  1NO3 A;  3VKH A;  2CMR A;  2CWU A;  5LYJ E;  3GZB A;  1KQS 2;  1QMA A;  4N6U A;  3C64 A;  3T8O A;  2C5J A;  4WBO A;  1ROV A;  2Z6B A;  2BMO B;  4X1K E;  1IVU A;  1W2Z A;  3LTA A;  2PNC A;  1MMA A;  5JVD E;  2K54 A;  5HWY A;  1WMP A;  5E0O A;  2C10 A;  4NHF A;  3K3O A;  3V99 A;  4HTE A;  1JJ2 2;  4QX8 B;  1GY6 A;  5I97 A;  3BQK A;  4FMA A;  4QX7 B;  4IT7 A;  2WMN A;  5M4Y A;  3QC9 A;  4CXW A;  2CFW A;  3N54 B;  1O7M B;  2LHR A;  3CKD A;  4IGU A;  3PE0 A;  3T8N A;  2GBW B;  3EBT A;  4WWU C;  2D5U A;  3ZEF B;  2ODU A;  2H3R A;  2XAF B;  1QAF A;  2LSI A;  4IHJ E;  3N9M A;  4HKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...