4OK3A

Crystal structure of hepatitis c virus ns3 helicase inhibitor co-complex with compound 7 [[1-(3-chlorobenzyl)-1h-indol-3-yl]acetic acid]
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
443
structure length
426
Chain Sequence
NSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLNAVASVIPDVVVVSTDALMTGGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated strategies for identifying leads that target the NS3 helicase of the hepatitis C virus.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease NS3
total genus 135
structure length 426
sequence length 443
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4ok3A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok3A01
3EPHA 1QG4A 1XXHA 1WA5A 4NCKA 3QQ5A 5IT5A 1O3YA 1Z29A 4LHYA 2E9SA 4DLWA 1DG1G 2ZUBA 4F7WA 3X1WA 4YMVA 1HQYE 3AF3A 3K0SA 1XCMA 4PC1A 4N3NA 4XVUA 1UKZA 1ZBDA 2DYKA 3GLIE 4HLDA 3PR1A 4B3BA 1TQ4A 1E2JA 4G0NA 1SVLA 4Q48A 2QPOA 4UNRA 2YC4C 1ZC3A 4CW7A 2AX4A 4ZKDA 4ACBA 4Q4AA 1LVGA 1W47A 3I5YA 2V8OA 3TH5A 1BYUA 3E5HA 1HQCA 3SJCA 3FB4A 1P9WA 2VHTA 3OZXA 3KKQA 1RRCA 2BBSA 1NF3A 5AJYA 2W6IA 1SXJA 2NG1A 1ZM9A 3B60A 3AP1A 4KU4A 2GCPA 2OBNA 2XX3A 3B1WA 5K8LA 4GZLA 3RRNA 2VP9A 1XTSA 4JVMA 3D6TB 2XSZD 4AYXA 3EC1A 4TLBA 4BZXA 4LHVA 2GJKA 4II7A 4I99A 1Q22A 3UATA 4TQUS 4HUQA 4EDHA 4C2UA 3RC8A 1A4RA 4A2PA 4K8OA 2HT1A 2F1HA 2OLJA 4YMSA 1DAGA 4Q9LA 4DB4A 4BASA 4CT4B 2QMHA 2WBLC 3CPEA 4JKYA 5FOTA 1CJTC 4HATA 1COWA 3RDPA 3IQXA 1P75A 3VHXA 1EWRA 4LC0A 3DM5A 1Y63A 2GXSA 3NG1A 4PSVA 2XXAA 1DAFA 1E98A 1G5PA 2G1JA 5E95A 3GLIA 4CEHA 1Z08A 2CBZA 4IKEA 4W5WA 2QY9A 121PA 2H16A 2QMUA 1E9DA 3AV0B 2IS6A 4G5QA 3OAAD 1UKEA 1G19A 5FBVB 4V0ME 5EUMA 3GD7A 5JWHA 1CKEA 2A5JA 2BC9A 4D82A 2PX3A 2J3EA 2FPMA 4GRAA 3RS3A 4BLSA 1E4VA 5CK4A 4DCSA 1NNEA 4NYJR 1U0JA 3D3QA 3O47A 4Z1MD 1GVNB 2IL1A 4KFRA 4LJ7A 2HLDD 3CR7A 4FMDF 4DIEA 4E5UA 5CITA 2PBRA 4LK2A 1DG3A 1G20E 2ZRJA 2QPAA 2ANCA 2ZSBA 1NMXA 4Z54A 4KVAA 3GEHA 2YJTD 2ODWA 1E9BA 1CU1A 3X1DA 1HE1C 1A82A 3IHWA 4BLRA 1MKYA 3UIEA 1CJKC 2FU5C 2VP2A 4B33A 2FMXA 2CVFA 2ZYVX 3EWAA 4HAUA 5CIQA 1JXOA 3CWZA 4PAQA 3C4JA 1ZU4A 2YNMA 3WY9A 3LBHA 4MYCA 4F92B 1AGRA 2WOJA 1WF3A 1E0JA 1NVWQ 1OE0A 2FJUA 4FWIB 5EE1A 5HTKA 3L0SA 4FCWA 5JSZA 4RSGA 4OI4A 2JLUA 3UMRA 4KSBA 4DLSA 2J0SA 1NVUQ 3GJ3A 5ELXA 5E7IA 1G8YA 4ZPXA 1P2VA 2WWWA 3KDSE 4GI7A 1EFTA 2QGZA 5AJXA 2FA9A 4JIMA 1F48A 2RGNC 4JJZA 3LVQE 1G64A 4CZ2A 5L3RA 4PSAA 1CBUA 1G17A 1QHXA 3WHLA 3NXSA 2ZM5A 3SFVA 1ZIOA 1E3MA 1UKYA 4JLDA 1QG2A 2XEXA 3NBXX 5EXTA 4LBYA 1GIAA 3BB4A 4TLDA 1OKKA 2XTNA 4TQ9A 3GLGE 4C3ZA 4V0OA 4WBSA 4X8LA 3EG5A 1KJYA 2RGGA 3NEYA 2ZXUA 2O8FA 1WRBA 2RKOA 1WBDA 2RGBA 2W0SA 3VFDA 2ZU0C 3K9GA 1XD2A 5K8UA 4OHZA 3NBZC 1PV4A 2QA5A 4B2LA 2QUZA 1HUQA 2V7QA 1M8PA 3KTAA 3NH6A 4LY6A 4XTCS 1YRBA 2O8CA 3P27A 2DR3A 3FMFA 2X2FA 2P65A 2QAGB 3CM0A 1NJFA 5FOSA 1SZPA 5TY0A 5FH9A 3WMEA 1YHNA 2BM0A 2YINC 4FXPA 1ZAKA 1KTVA 2REOA 2WKRA 2XSZA 4YMUA 2Z4SA 5HKKA 3L43A 2IT1A 2A5GA 1P72A 5J4VA 1ZP6A 1KK2A 1HY3A 4DEXA 2A78A 4S2EA 4DZZA 4G3XA 2X1VA 3CX6A 4DCVA 1T0HB 4Q4AB 1KAOA 1E2EA 1W5TA 1FQKA 2IF2A 2ZJ2A 1E6CA 3IEVA 4RFSB 4EQ6B 3RRYA 1Z0KA 1ETUA 4NYIR 3RABA 1YZLA 4DSNA 3K70B 2A5YB 2X8AA 2RGCA 4KCGA 1XD8A 5EXPA 2Q9AA 1KI4A 1VCIA 4HYYA 4D0GA 1BMFD 4IVRA 2NO6A 2YHSA 1SKYE 1QRAA 1LFDB 1GL7A 2RHDA 4BZQA 3KJEA 2YZ2A 4LPKA 1Z83A 2FWRA 3UG7A 2BOVA 3H4MA 2P6RA 2W00A 2AL7A 3ND8A 4UJ3A 3SYLA 2HYIC 3VHLB 4CYMA 3MRSA 3OIVA 1Q21A 2OEPA 1JEDA 4XD7D 2TMKA 4FD2A 2VP4A 3T5GA 2PJZA 2F1RA 5FBRB 2FN4A 4KHZA 1TF2A 2B21A 1KO1A 3TW8B 1GZSA 2AKAB 4CDGA 1NI3A 3BB1A 2ZSAA 1S1CA 4QBGB 3KB2A 3AVTA 1L8QA 3BK7A 5EE9A 5C1BA 5H1YA 3PJRA 1NY6A 4RZUA 3K9NA 2LCFA 5DGXA 3RC3A 1NKSA 1JR3E 5DSZA 4EAQA 1XD9A 2WMNB 3EA0A 1Q44A 1TU3A 4CGZA 2ZS8A 3AKYA 3HPRA 5B58C 2NGRA 4PC2A 1V43A 3HYTA 2D4HA 2EFGA 4AYTA 4JBYA 4NCNA 4BRUA 1WP9A 4M53A 3U5ZB 4MGYR 3EZFA 4HDOB 1XTIA 3KQUA 4Z1MA 5KSPA 5HZKA 2V54A 4URYR 3MGCA 5UKDA 1NP6A 4YXWA 2QNRA 1DE0A 4QFMA 2C99A 2DFLA 4GP7A 2IYTA 1NN5A 1Q3HA 4B3FX 1L7VC 1VHTA 1CTQA 4Q1FA 2O52A 4UNSA 2ZI7A 3TAHA 2R65A 3B2EA 3B13B 3PUWA 1IOZA 4IEIA 3KKMA 4GOJA 3BFKA 1ZD1A 2OLKA 2UZIR 2ZJ8A 2YOHA 4FMCF 3QPVA 2YVUA 5HPYB 3FKQA 3PQCA 2XZPA 4P0TA 5J40A 3QI2A 4M9ZA 4D2IA 3OE7D 1W4RA 3RWMB 2ZU6A 2GEVA 5D3QA 1CXZA 1KNQA 1SVMA 5JLJA 2O8CB 1OIVA 1G8PA 5B30A 1KYIA 2XZOA 3WMFA 2R6GA 5KNDA 2YOFA 4ZKEA 3VX4A 1CRPA 2IF0A 2FNAA 4QNRA 4YDSA 4ZIRA 2G77B 1YZQA 2IUUA 5C2JB 4NKRA 5IK2D 1Q1EA 2AHOA 5CDFA 1JQLB 5C18A 5JRJA 4M1OA 3THYA 1P6XA 2ZYTX 2RHMA 2YC2C 2ZJ5A 1R5BA 2IWRA 2O8EA 3V9PA 2W83A 1YE8A 1W46A 1QHYA 1ELOA 1FP6A 4R71A 1FFHA 4GZMA 3TUIC 1R8SA 1M34E 2ZVPX 2QGNA 3GP8A 3GLGB 3U6BA 2J5XA 3SNHA 1Z0IA 4YQFA 3ADBA 3PEVA 4AC9A 3UMFA 1ZM7A 2ZI9A 3GQBA 1M7BA 4QXAA 4XVQA 4PC7A 4MGKR 2QTVB 4TQAA 2CMKA 4URXR 2N1BA 4P4SA 4JMPA 2WMOB 3I32A 3VNVA 4Q19A 1PZNA 2C9YA 5KSZA 3K70C 2D06A 4MRSA 3SEAA 5JWRA 1IY1A 4IDPA 4G5OA 2CEAA 5LDDC 2C98A 2WPDD 4WOPA 4DT1A 4JT2A 3QG1A 5AWFC 1KI3A 2GCOA 2NO7A 4JLKA 5A5GA 2OCAA 3ZS9A 4A82A 1WXQA 1ZC4A 2C96A 1VKJA 3CPHA 2A2ZA 4IVQA 1S2MA 3U4QB 3BH0A 4JLJA 1KZ7B 3U44B 4KVGA 3QKRA 5DI3A 5CDFE 1U0LA 5BW8A 5KU1A 1MR3F 1TAGA 3PVSA 4YC7A 1G3RA 1KI9A 1Z22A 4WXPA 1H8HD 3QY0A 1D9XA 3B1XA 1EFHA 1SULA 2QP9X 5EXSA 3DVLA 1NMYA 4BRWA 3TUZC 2GRJA 1G3QA 1JXMA 4QJ4A 3TUJC 2GJAA 1KK3A 1Z5ZA 3B6EA 4JVNA 4NONA 3TRFA 1UJ2A 2OV2A 1WBBA 3OFNA 3DZDA 4NYJQ 3PFIA 2W0MA 1M74A 3ZIAA 3FHOA 4C0JA 1E79D 3B9PA 2G9NA 1ZM4A 3P32A 4AKHA 5B2ZA 3N2IA 3CIOA 4D4KA 1VG0B 3DMDA 1RW4A 4ZDWA 3T15A 2GA8A 2P6UA 1SXJD 1P5ZB 2W6ID 3NBFA 2OM2A 2H8KA 2IS2A 2RGDA 3QXSA 4G5GA 4EUNA 1E2GA 5DYGA 2BCJQ 2IYVA 1DAIA 2QQEA 2WJIA 1SGWA 1Z0JA 3ZVRA 2BMDA 1S96A 3LXRA 3LBIA 3LFUA 2GAAA 2GAOA 2F9LA 2OG2A 1NLZA 1P9RA 3OEEA 4WW0A 4BFTA 1G6HA 4CIDA 4IOLA 1Z47A 3ZDQA 4ZDKA 3ZD6A 3Q5DA 4AG6A 3BS4A 5GJWC 4D25A 2FOLA 4HUQB 4TLAA 4A2QA 3FHTA 2B7CA 4WAUA 3LQQA 4QNMA 4DLUA 1N6PA 2OESA 3LY5A 4DDVA 2WICA 3SN6A 2OHFA 2YKGA 2QPTA 2PLRA 3MWKA 1FP7A 2AKYA 4FIDA 4LBWA 1OB5A 2R6CA 3O8DA 3NVAA 3OF5A 5JCZA 1YZKA 2CHVA 3R8FA 2FDCA 1II0A 2LWIA 3TJZA 3ZD7A 5LB2A 1XRJA 2DFTA 4TZ0A 5G3ZA 1NLFA 1N6NA 2GHIA 2Q9CA 2QP3A 1GOTA 1K5GA 3FKSA 3W5IA 2O8DA 1II8A 2AD1A 4UNQA 4LHWA 3L82B 2QSYA 4NE2A 4RD6A 1RIFA 5DN6D 2QAJA 1IAQA 3SR0A 3QSYA 4S35A 2CNWA 3RS0A 2ZE8A 3PUZA 2ZYUX 3CLVA 1ZW6A 3NDBB 5F9HA 1JAHA 3H0KA 1NG9A 4TN1A 1IY2A 4PXAA 4JLPA 4KFUA 3DKVA 5DI3B 3HYRA 2QL6A 4X8HA 2AK2A 3SYNA 1L4UA 4LYAA 4QBHA 3K9LA 1B23P 2CCGA 3E1SA 5KNCA 2G83A 5F98A 1E2IA 3DKPA 4NH0A 4Q7KA 3Q7QA 4LYFA 1P61B 2YOGA 3KB1A 3U7GA 2B8WA 1UPTA 4C0HA 4CVNA 2GILA 5C4GB 5H8WA 3OEHA 1JQJC 3BFVA 1VTKA 4G5SA 2O8BA 4Q01A 2FFQA 5EP2A 2VHUA 3IKJA 3ZLJA 4MA4A 3SI7A 4LOAA 4BZPA 1OXSC 4M8NE 3U3MA 3HJNA 1R0WA 3PENA 1OB2A 2C5LA 1U98A 2IUTA 2IXGA 1S3SA 2P2LA 3MWYW 2D74A 2GVZC 2JLXA 2IHBA 3FVQA 1J70A 4Q21A 3C5CA 5BQ5A 4D81A 4RCYA 1QHHB 1GNQA 3AQ4A 4H1VA 3R20A 3SU8A 3VQTA 2ZSFA 1A2BA 1KMHA 1QF9A 1TF7A 5J47A 5EQTA 4QL3A 3I92A 4AK9A 1CEEA 1BOFA 4Z51A 2VPPA 3HU2A 3MWLA 3DZ8A 2GXQA 4URVR 1AK2A 1JEEA 4XJXA 2ORVA 3KXLA 4PHGA 4US0R 4F91B 4M9QA 3GCGA 2KB0A 5DNYB 4NMMA 5HZHA 3NWJA 5GVRA 3G0HA 3KJHA 3ETLA 4QM7A 4MITA 2EYQA 521PA 4MRVA 1TMKA 2V6JA 2GJSA 3GFPA 1R0YA 4LJ5A 2VSFA 2X19A 1UBCA 2QT0A 3DOFA 5CJPA 4KBFA 5JI3E 5FFMA 3Q72A 1S9DA 1NSFA 2JDIA 4UJ5A 3NKVA 3KTAB 1XTQA 1EFUA 1KO4A 4QBIA 3VAAA 1NIPA 2GZDA 3X2SA 6Q21A 4GMXA 2WJYA 4HDCA 4KLZA 2QBYA 1C9KA 2FGKA 4GSYA 2QI9C 4ARZA 3T35A 2QG6A 2JATA 2WAXA 5DE3A 3GLHA 1TUIA 3SQXA 4TTRA 1ZNZA 3EC2A 4WA7A 2WWHA 1G7CA 2D2EA 1P73A 1E9AA 1YZTA 4HAVA 2PJRA 3NC1C 4NCJA 5FTMA 3KQKA 1CIPA 1PLKA 3F5FA 1Z2AA 3TSWA 2G0TA 2B92A 2DPXA 1NIJA 3A1TA 2IC5A 3UANA 3PUVA 1P7CA 5L3SA 1ZU5A 5BN3A 1OHHD 2ZRAA 3BH6A 1ZRHA 2CXXA 1OH8A 2XJ4A 2BBOA 4ZV4A 5JMTA 3L8ZA 5IRCD 1G7SA 1E2NA 5JJKA 3N70A 2GTPA 3ZH9B 1OH6A 2GESA 3QKSA 3RS2A 2ZYWX 1XFAA 3L2OB 2ZRCA 2ONJA 4EFMA 1FL9A 3TVDA 4BQSA 1U9IA 2IA5A 4DDTA 1S9HA 2JIZA 1XP8A 1KSJA 2GZHA 4TMXA 4RD4A 3MJHA 2XNDA 2WSSD 3PEYA 1G4AE 4MUBA 5AUOB 3GJ6A 2EWVA 1G1MA 4LZZA 1N5JA 4Q4LA 3R9IA 2WWFA 3SOPA 4D0LB 4D4MA 2J0QA 2ZI5A 4GFDA 4EIWA 2O8EB 3CF2A 1JBKA 4PHTA 2KWIA 2QMOA 3EARA 3OEHD 4M1KA 1E96A 3IBGA 2ZI4A 5DHFA 4LCBA 2IYSA 1CR1A 1GNRA 1LB1B 4UKDA 1U9IC 5CK5A 2O8BB 5TVKA 1FQJA 5C46F 1J8MF 1GFIA 4MGIR 2RAPA 4PC6A 2ODEA 2VHQA 2P3SA 5D3MB 2J41A 3C16C 2VQSA 5FTJA 4G01B 1G7TA 1NVXQ 4PQYA 8OHMA 1G7RA 1KI6B 2IBMA 2PT7A 3ZQ6A 5B64A 1YR7A 1TX4B 3E2IA 2FFHA 2VP0A 2JJ1A 4NPHA 3GLFA 2H7VA 5KO2A 4MUAA 4A6PA 4JSYA 4Q1CA 3WP0A 3D8BA 2F43A 3VR3A 2PLFA 4KO8A 4IOKA 2PT5A 4TT3D 1T3HA 1H8EA 3S1AA 3L0PA 2Q21A 5J4HA 3CBQA 1F60A 5LB4A 2YWEA 1R10A 5FBWB 4M9XA 4XD7A 3A6PC 1N6LA 1XB2A 1G291 3CNNA 3BOSA 1XEWX 1ZCAA 3RRMA 3MWJA 5P21A 1X8KA 3VU9A 1ZM3A 4TSFA 3M0EA 1DPFA 1XXHB 4NU0A 4D4JA 3K70D 2QTFA 5DI9A 1TQ6A 1N6KA 4B35A 3KQLA 5BWMA 4ZO4A 3QKTA 3THOA 1EK0A 3LA6A 1IJFA 2QE7D 3Q8XB 1EG7A 2C78A 2YWHA 4PZZA 4UNNA 4C0BA 2MSEB 4JJKA 5EP4A 3K9HA 2I4IA 2OT3B 2W58A 2AXPA 1MO6A 1F2UB 2IYUA 4TMVA 4OJQA 3U60B 3K8YA 4G5RA 2FF7A 3WHKA 4IDOA 4MKFA 1NN3A 2WJJA 3TLXA 4B3GA 5FTLA 1U8YA 4JVSB 1VIYA 3UK6A 1DO0A 2CDNA 2FSGA 2ORWA 2IK8A 3AUYA 4B6EA 721PA 3A4NA 3ADCA 3SHFA 3PEUA 3OIWA 2ZRFA 2XJ9A 1J8YF 1BYIA 3MLEA 1OF1A 4ZIRB 2GJ9A 2JLZA 1UEJA 3C7KA 3AKCA 5KSOA 3ADKA 1TF5A 3R7WB 1KKMA 2NO9A 3I8SA 2JLYA 3AF1A 1T5IA 1XEWY 4U5XA 4YDHB 1J7KA 3SBDA 3HR7A 4FMBB 3U3OA 3EZ6A 2GETA 2V55B 4C0KA 1TL7C 1PJRA 4AY2A 3BAFA 221PA 3NTUA 4M1TA 1DADA 4UXIA 2X2EA 4UNPA 4BUJA 1SXJB 1GSIA 1DAMA 4L4UA 2VHCA 2DY1A 2ZITA 4GL2A 5H70A 2D2FA 2QAGA 5IDVA 5JJLA 3MMPA 4GMDA 1P2TA 2VHJA 3A1UA 2K5UA 3JZMA 2R6DA 2J7PD 1TQDA 3LLMA 3DHWC 3P26A 1E94E 2XXAB 1XCGB 4GOXA 1CR4A 1G41A 3THYB 4OQXA 5G41A 2HXSA 2ZIAA 4A0RA 2EFEB 4E07A 1M7GA 5HCIA 5EUQB 2F55A 1CR2A 3I72A 1DS6A 2ZJAA 2J87A 1X8JA 5FL7D 1YVDA 3VNUA 1W0JD 1CP2A 4M4SA 4OHYA 4QHSA 5F2EA 4D26A 1KKLA 3VMFA 5J5CA 3LW8A 2DHRA 4TYPA 4EPVA 4LX0A 3LQRA 3AUXA 3K09C 3G82C 1GUAA 5AK0A 3RRZA 3I61A 2DCUA 5G40A 1XNJA 4KI0A 1Z6XA 1AKEA 4JLBA 5HR5A 5JEDA 1QHNA 1RC8A 2ZSDA 4BEBA 4RKEA 4EPXA 1AQYA 5FOXA 2PEYA 2GBLA 3REFA 3FPAA 1K5DA 1GKYA 1KHTA 1KI1A 4NZYA 1ZUHA 5FUXA 2IYYA 3FMOB 5SZIA 3IO3A 4R98A 1FZQA 2V4ZA 2ZE5A 3KFXA 4LBZA 4FCTA 1WMSA 2ONKA 3O8CA 3D7MA 4LV6A 3R9XA 3A37A 5E7MA 2W2XA 1W0JA 1HA3A 2VBCA 4IDHA 4AYWA 4BE7B 4DT1B 3LRPA 5CLQA 1VECA 1UAAA 2C95A 2GJ8A 2F9MA 2WKPA 2R44A 2B7BA 4IHQA 4ASUD 3TMKA 1W0KD 1ESMA 2R8RA 1XDBA 4YONB 4NHOA 4LHZA 1P60A 1YR6A 3SE0A 2OBMA 4PAMA 5GJVC 1I4LD 5KPDA 4M21A 1GITA 3H84A 2JLSA 1W49A 4FI3C 2HJGA 4US2R 2Z83A 2I1QA 4OK6A 2EW1A 3HPQA 5DH9A 3O8RA 5SZHB 1PVOA 4MRPA 2JLQA 3OE7A 3IDQA 3RS4A 2IEZA 2CCJA 5J4YA 5DYIA 3H86A 3T61A 3EPKA 1Z07A 1M6NA 3A1VA 3ZVLA 1E1RD 4Z8YA 1GM5A 1E9EA 3QJYA 2QSZA 4N0DA 4BWYA 2JJ1D 2OCPA 3GJXC 1COWD 1GL6A 3R7WA 2ZRDA 2NIPA 2I1VB 1RRGA 1FTSA 1VCNA 1XU4A 4NTZA 4Q7MB 4IFEA 3P1JA 5JSZB 2ZUCA 3Q9LA 2HCJB 1IM2A 2AK3A 1W36C 5AJZA 1IJEA 4IJMA 1U8ZA 5JWOA 1SHKA 1FW6A 2PZEA 4PO9A 4AIIA 1IN5A 5KTYA 4HDQB 4L9WA 4GBMA 3G5UA 5GVSA 2ZUDA 3JVUA 1B0UA 1ODFA 1E0SA 1U81A 2Z5FA 4V02A 3VR4A 4F93B 4Q7LA 3KKNA 4IRUB 2BEKA 1SVOA 1J90A 2XAUA 3IIKA 1FUUA 2W6JD 4L8GA 3QNUA 4M22A 4OQLA 3I4LA 4KSCA 3W6OA 3CPJB 4BGDA 4OI0A 3ICEA 1XTRA 1LS6A 3HR8A 5EZ6B 4FWTA 2IEYA 5BXQC 1ESNA 1OXVA 4B6FA 1CF4A 1GNPA 4PO8A 1I2DA 2KSQA 1OFTA 1XTJA 1LF5A 3K53A 3PITA 5HE9A 2H92A 1CRQA 2Q0HA 3RAPR 3AGQA 1QHGA 3EPJA 5L3SB 3HWSA 4OL0A 1BKDR 4W7SA 4LYHA 2CLDX 3L8YA 4PHFA 3TQCA 4PANA 3EX7C 1EGAA 1N3BA 2EFHB 2H5EA 5FPHA 1SQ5A 2VO1A 2AXNA 2Q9BA 1KSFX 1KDPA 1VG8A 3QIAA 4AURA 1Z28A 2OAQ1 1FPMA 1HH4A 1KJWA 1NVVQ 2EQBA 4W5JA 1F2TB 2YWFA 3RYTC 4BFZA 4KITB 4JBXA 1NL3A 2FPKA 5KOYA 2REBA 1E9RA 1IN6A 1SVKA 3DPUA 1VYVA 4TMZA 5EP3A 3A4LA 1FUKA 2GBLC 2HCBA 3U6KA 1JJVA 2R6FA 5J4KA 4XH9B 1OHHA 2GF9A 4X8MA 4PHHA 1W0KA 3FFBA 3P4XA 2DWQA 5GADl 3B85A 4A8JC 1G9XA 1CJUC 3IUYA 2QTHA 5EP1A 4JLOA 3U3JA 4DLTA 1TEVA 4NCIA 4TTQA 1N6HA 2F3RA 1GRQA 5G3YA 1KOFA 2FG5A 1S3GA 2V1XA 2ZJBA 4Q1DA 2JLVA 1OV4A 1AIPA 3GLIB 4UQOA 4CEHB 4BFSA 3T1QA 4RD1A 4C0QC 2OCYC 2XOKA 4O3MA 1CS4C 2VLIA 1QBKC 3K0AB 1AQUA 1E9SA 3DO6A 4Q1BA 1RZ3A 2BDTA 1G5TA 2WIBA 1XEXA 4A2WA 5C4MA 2V3CC 4GDFA 1GDDA 2GCOB 2OAP1 4JT4A 2HLDA 5FUWA 3W5JA 4FN5A 4B71A 4NDZA 5CLLA 5HCNA 1L4YA 1Z2CA 3O8BA 1AS2A 1IN4A 1T3SA 2G1KA 4CEJA 1NBME 3B5JA 5CM9C 2CHQA 2B6HA 3OFND 1E2QA 2QROA 1P4SA 2BMEA 1ZCBA 4A8JA 1XZPA 2ATXA 3IGFA 2EVWX 2CK3D 1GWNA 4EPRA 3FE2A 4IW3B 3MFYA 2IYXA 1WDTA 2XNDD 2J7PA 4PPNA 2BMJA 2FH5B 1KY3A 1T4GA 5L3VA 4TLCA 5CYOA 3CRVA 2VF7A 3GJ4A 3M4YA 1A1VA 3U3KA 4HZUA 5JEEA 1NMZA 4C7OA 3K0CC 4Q4HA 2JJ2A 3TK1A 1OT3A 4BLPA 2HT6A 3MAAC 3QEOA 4EJSB 4IDQA 2EYUA 3RLFA 2MSCB 5JI2E 1IXRC 2A5DA 2DBYA 2QEQA 1FNMA 1XD2B 1DELA 1E9FA 3KXIA 4Q7JB 3AEZA 2PX0A 2FEMA 4D80A 2PMKA 3BGWA 3QKSB 1W5SA 2BBWA 1G3MA 2GDJA 1Z0DA 4JLMA 1XXHE 3UMSA 5JBQA 1YZUA 4IDNA 2QRNA 1G3UA 3FYHA 1Z06A 4MKGA 3V00A 3VTKA 3LH5A 2ZRGA 821PA 2C77A 2J46A 2YV5A 5KUTA 4LJYA 1U8AA 2QBYB 1BH2A 4I1SA 4O2RA 3QOFA 3F0TA 3VR2A 4ARZB 1XMIA 2JAQA 3KL4A 1G16A 2DFKB 1K6MA 2ZREA 3IPXA 4JLVA 4M1YA 5KDLA 2ZRMA 2CL0X 3WYAA 2X77A 3LD9A 1E0KA 2O8FB 4JZKA 4KFTA 4PQFA 4D6PA 1W36D 2IYZA 1II8B 4QBFA 5FTKA 1E2MA 1E2HA 3QBVA 2BM1A 2VTKA 3WRXC 1DEKA 5LPNA 2P5TB 1X86B 4RCZA 5DN6A 1OLOA 1HURA 2MMGA 3FDIA 4HLCA 4R9UC 4PQRA 1W4CA 4QKQA 1R0ZA 2WTUA 4FMDB 2JDID 1OXTA 1UF9A 4Q18A 4RKFA 2P5SA 1JI0A 4MGZR 4PC3A 1ZNXA 2OCBA 5HE8A 1Q20A 3WNDA 3GEIA 2BKEA 3I73A 2UVQA 2WM9B 4E09A 2ZI3A 3UWKA 3ICQB 3SJZA 2ODBA 2CJWB 2EU8A 1HV8A 2VIIA 4IEEA 4KXFB 4PSKA 3CKLA 2JEOA 3MG9A 4FINA 3E70C 1KO8A 2ZS7A 4PZLA 4MRNA 3AVXA 3AP2A 4HB0A 5BYJA 1JR3A 2BHRA 2ZR7A 2CL7X 3ZQJA 4I81A 4EPWA 5FL3A 3ND9A 4EPYA 4TMWA 5FOUA 4B73A 2JASA 2GK6A 2VA8A 4C9BA 3AGPA 1SVSA 3GFOA 5DLQC 3IIJA 4H9GA 2O0HA 2CK3A 3EIQA 3ECCA 2OXRA 1G4UR 1C4OA 4A15A 1GP2A 1ZUIA 3BBPA 3WBJA 1D6JA 2GK7A 4HZUB 4C7OB 4YXWD 4RD2A 2KJQA 3DMNA 1UFQA 3K09A 2IUSA 2FX3A 3PIRA 3X1YA 4DCNA 3R8CA 3B1VA 1JNYA 1ZNWA 3CO5A 1Z6YA 1E2LA 2O5VA 3QE0A 4B74A 1CULC 3KZ1E 5D3MA 4EKDA 1HEIA 3FWYA 4Q03A 2J0VA 3GEEA 4R2HA 4A0FA 1I4DD 1D8TA 2YWGA 2NMVA 1AA9A 4NYMQ 5FPTA 2QN6A 2D3WA 1KMHB 2VF8A 2RGNA 3FTQA 4DSUA 4TL8A 3KQNA 3CF6R 3CZPA 4PO1A 3RS7A 1SVIA 2CE7A 2ZETA 3PEWA 2ZRNA 1OFIA 5FI0B 2WSSA 1GILA 2KBFA 2QE7A 1AS0A 4NP6A 1MH1A 3FKSD 2C03A 4CEIB 5KPJA 2RB4A 3SHWA 5FUVA 3A36A 5CM8B 4Q00A 5KHOC 1MABB 3I8XA 1RFLA 1QHIA 2JGNA 2XTMA 2QAGC 5FPKA 2BJWA 4TYWA 1UBEA 2FEOA 3CH4B 2G6BA 4TWZA 3KKOA 1XPUA 2UZ3A 4ACAA 1R7RA 3FMPB 2FFBA 2FE4A 4RZ2A 2R62A 2ANBA 3CUEF 3SC3A 1F5NA 1G3IA 3U7HB 3THWB 2KBEA 4L16A 4M0LA 1OW3B 3REGA 3NC0C 4BEJA 5A0FA 4L5BA 4BFXA 3UKDA 1QVAA 1OFUX 2VH5R 1TADA 4HB2A 4EFLA 1P2SA 3UXMA 1H65A 1FX0B 1US8A 1RRFA 4HLQB 3SDZA 1U99A 4URWR 5FPYA 1BMFA 4EQ6A 3CRMA 4TYQA 1T0JB 4Q4JB 4GNKA 4HI0E 3GJ8A 1ONBA 3AF4A 2BJVA 2ERYA 2WV9A 4KBGA 4BFWA 4I1OA 4BFYA 3BIFA 1W4BA 1YU9A 5CJ2A 3BFXA 3EZ2A 1O87A 2OBLA 4Y0AA 4MYTA 1G5RA 2ZR0A 3NHAA 3DEFA 4C30A 3WYGA 1DTSA 2WAYA 3X1ZA 3I5XA 5B57C 4HLUC 5AJWA 1IN7A 3V4FA 1OPXA 3HDTA 4W9MC 2PEZA 3L0OA 3SZRA 5ANRB 3AB3A 5BN5A 3IILA 1E79A 3SYKA 3TSZA 1EXMA 3EASA 1VCMA 3RVBA 1Z0AA 5FUYA 2GXUA 3EIEA 4AG5A 3EPLA 1LF0A 3C15C 1MT0A 1X8LA 2EWWA 2KI5A 4KJZA 2ZS9A 4B3XA 4C2TA 1N2CE 1X6VA 3BXZA 3LW7A 1G8HA 4YMWA 4DCTA 4AWXA 4BFVA 1W4AA 1E2DA 1R0XA 1R4AA 3QXXA 2HXYA 3KFVA 1KY2A 2H18A 3U4QA 3GJ5A 3ZZ0A 2JIZD 3U61B 2MMCA 2F3TA 4A92A 4LYJA 2D62A 1E32A 2QM8A 2CL6X 2PL3A 1KK1A 2Z4RA 3ZVMA 3CNLA 1WCV1 2WJHA 1X3SA 3EXAA 4WZBE 1E2FA 4DUGA 4B32A 1GKIA 4V0LA 1SXJC 2FZLA 3CF0A 1ZIPA 4TL6A 3MD0A 4FCVA 3LX5A 4RD0A 3A8TA 1T91A 1JPJA 1PUJA 3C41J 1VCOA 4AKEA 4TYYA 2J45A 1N6RA 2F6RA 3CR8A 2WPDA 3FHCB 1UKVY 3GFTA 1R5OA 4PPFA 5CIWA 4B47A 3B9QA 2VP5A 3FOZA 4QM6A 3ZVNA 1MO4A 4A9AA 4DHEA 2LKDA 3KXKA 4B75A 3IIMA 1C1YA 2J1LA 3M6AA 2IXFA 1KI6A 4NCHA 1ZNYA 4XTRA 2N46A 1DAEA 1PLLA 3NDPA 4A36A 1GL9B 2CVHA 2KE5A 4ILEA 5CB8A 1EWQA 4DJTA 4OK3A 4OHXA 4ESHA 1T3LA 2GWHA 4B76A 3Q85A 1N0UA 2RMKA 4XOIA 1KDTA 3K0FA 4DVGA 5JHHB 1Z6AA 4XSGA 4P3YA 2ECKA 4CEIA 3CRRA 4R2IA 4KLNA 1MOZA 1RYHA 4TL7A 2Q3HA 1TPZA 2HUPA 1KIMA 2ZRPA 3AVWA 4DLYA 3CRW1 5LD2B 1D2NA 5DISB 4U7DA 1RPZA 3AF2A 3DDCA 3IQWA 3W90A 2A7QA 2WZQA 2H57A 3KKPA 4L9SA 2WSMA 4MRRA 2Z0MA 3K0FB 2Q6TA 4POAA 3THWA 2H17A 3ZJYA 4V0KA 1X1RA 2WOOA 3THXB 2JLRA 1SKQA 2GVDC 3NH9A 3LWNA 2QP4A 2I3BA 2R6AA 4JBWA 5TB5A 3T5DA 2ZAOA 4AD8A 3TGPA 1N5LA 3CX8A 3C8UA 3LXXA 4EJSC 2ZTSA 3W6NA 4DUGD 1FMJA 2SHKA 3X1XA 3KJIA 3AVYA 1MRNA 4MH0R 1Z8FA 3N2EA 1OXXK 1RKBA 3QF7A 1F2UA 4Y0VA 5FTNA 3NHBA 1ZMXA 3T1OA 4FMCB 1KK0A 3MJRA 4RFVA 3B8HA 4MDFA 4NBSA 4OBEA 3WYFA 2OE2A 3MUFA 4A1FA 3QXHA 1ZUNB 4XWOA 4QHTA 5J4LA 1N25A 1Q0UA 4OQMA 1LY1A 3IEUA 1NN0A 4ON9A 1AZSC 1LV7A 3QXCA 3GJ0A 1GAJA 3I62A 1P9NA 2H1LA 1KGDA 4DLVA 4QJ3A 1W48A 2ATVA 1DOAA 1Q12A 2ZE7A 3A1SA 4C0LA 2PMDA 3QENA 4H1UA 3AVQA 4JS0A 1JECA 4QHYA 3W34A 1E1QD 2QZ4A 2Q3MA 2E1RA 2RGEA 1E1QA 3NBYC 4IVPA 1G8FA 4RFSA 5HKKD 3QVVA 4DDUA 3PG5A 1N5KA 4Q4JA 1I2MA 4LDJA 1Q3TA 4V0MA 3GLGA 1TNDA 3B1YA 1XBTA 2V6IA 1JR6A 2ZJYA 3BD9A 4C0AC 2OXCA 4LWZA 3U44A 2NPIA 5CYPA 3DM9B 3RWOA 3UWOA 4DRZA 1XMSA 2ZROA 2J9RA 3QPWA 4DWJA 1HTWA 3CB4A 5EE0A 1UM8A 1F6BA 2G0NA 2BWJA 2HEIA 2RGAA 1XZQA 1Q1QA 1ZYUA 4HEJA 4A8JB 5E7JA 4M1SA 1XJ0A 2ZSEA 2IHYA 2VRWA 1NJGA 1V5WA 1YQTA 2F7SA 2IS1A 4OI1A 5AR1A 1OSNA 2VSOA 3FGNA 4TMKA 3AH8A 1GTVA 1T8UA 1YZNA 2GF0A 2WIAA 3I1FA 2VL7A 5DO9A 2IWHA 1H8ED 3EA5A 1KNXA 4JL8A 2BEJA 4WZ6A 4ERNA 3QUSA 3EAQA 3K0AA 3UPUA 4N0EA 3T06B 4F4CA 1NKTA 4HAXA 4KYIB 1UEIA 2HYDA 2IYRA 4JYBA 4LJAA 1SXJE 1OIWA 4B48A 1WE2A 2HDNB 4DEYA 2QORA 3LVRE 2BV3A 1S0UA 1YRAA 2F43B 2AWNA 2C8VA 2F1IA 2WKQA 3AF0A 4OYHA 3T34A 4D0NA 2ZR9A 4Q9JA 1Z6GA 2RH5A 1UADA 3ZZUA 4P32A 4Q4HB 3W8RA 1XCPA 2BMFA 4QGAA 2B8TA 3C14C 1EFRA 3LV8A 3M1IA 2BIFA 1KAGA 4XIGS 4QOSA 4RZ3A 1MO5A 1AN0A 2VYFA 1IXSB 4NL4H 1P2UA 4IOMA 4XSHA 3GPLA 4JYCA 5AJVB 1RVDA 4LPSA 4A0HA 2FGJA 4N1AA 2FSIA 4TLEA 1BS1A 5FL7A 5BN4A 4B43A 4LBVA 4ZI3A 5BYKA 4HAWA 1JALA 3BRWD 1LS1A 4FW9A 2ZRLA 4HAZA 1XJCA 5DHAA 4PFSA 5EJEA 1JJ7A 4KAXA 3KJGA 4ABYA 1UDXA 4DCUA 2IX3A 1CJVC 1N0VC 1W44A 4NYMR 4RVCA 4EJSA 1SHZA 1MABA 4MQBA 3R9WA 4QGFA 4JVLA 5DIFA 4E22A 3EWSA 3BH7A 1A5TA 3GJ7A 1QHSA 4TMTA 3SS8A 3TIFA 1XX6A 1JB1A 4MYUA 4OHVA 5FBQB 3PXGA 4EPTA 5AUPB 2IYQA 4LI0A 1NG1A 3H2YA 2ERXA 2P0EA 1KSGA 3TBKA 3BERA 2ZE6A 2OILA 4LC1A 4Q1EA 2XB2A 4E03A 1QZXA 1J2JA 2BBTA 3BORA 4PAOA 2FSFA 4QGGA 4YMTA 2O8DB 2QMEA 1LTQA 2DFNA 3CWQA 4URZR 4CF7A 1EFCA 1UBGA 2XNSA 1FX0A 1US8B 1M1YE 4TTPA 5KYKA 2P6NA 3QPUA 4JL6A 4ASUA 5G53C 1II9A 1E4YA 5KDDA 2OFXA 1A7JA 4I1UA 1D9ZA 1Z63A 3ASYA 2FV8A 4US1R 4A4DA 2OFWA 3U3RA 4IOJA 3RHFA 2D7DA 3WP1B 3W3ZB 2O0KA 4YLGA 5JJIA 1T9HA 1YJ5A 3LX8A 2HF8A 1IN8A 2LKCA 3FFAA 3NIBA 3SJAA 1OFHA 3AP3A 4AKGA 2JA1A 1Q1ZA 4A6XA 3HP1A 3PV0A 4OQFA 3Q7PA 5FR2A 1T6NA 1AS3A 3TKLA 4DSOA 2JLWA 4OHWA 2WWIA 2V9PA 1WQ1R 2A5FA 1EX6A 1G8GA 4KYUA 2ZRHA 3I3SR 3RS5A 4DLRA 2GXAA 4U00A 4BECA 4KV9A 3GLFE 4LJ6A 5TARA 4I1VA 4RZXA 2ZAMA 3TW4A 2IYWA 4K81B 4M2LA 2C9CA 3W3AA 4LRWA 4BLQA 1E2PA 1XMJA 4Q1AA 1S1MA 3CONA 4RD3A 2ZJOA 3KUCA 4LSGA 1U90A 4JLAA 4GP6A 4P31A 3IPYA 2XGJA 3VKHA 4B34A 4TSFD 5CB6A 1XF9A 1R2QA 3EIHA 1NRJB 4Q9KA 5JS7A 4P4TA 2WWYA 3BB3A 1RJ9B 1VDZA 3HU3A 2QU8A 1EX7A 3WNCA 3H1TA 1N6IA 2WHXA 3LLUA 3IBYA 4G1UC 2AN9A 5EZ5A 4LJ8A 2CHGA 4IFBA 3GLFB 4IXNA 4TT3A 1OYWA 1S4QA 4LJ4A 5TDHA 2ZVQX 5JS8A 2ZJZA 1VPLA 5IF9A 2W2TA 3ZZTA 1VHLA 1J99A 1P3JA 4ZCIA 3S1AB 5JFGA 3JZAA 5A4JA 1P62B 2BCGY 2ZRIA 1T8TA 5K8TA 1AZTA 3PCRB 4U02A 1RJ9A 3EZ7A 5L3QA 1T5LA 5FPSA 1TUEA 2HJVA 2ZRBA 4DLXA 5LBIA 4K46A 2J0UA 2AFHE 1K8RA 2YYZA 3K1JA 2NPFA 1AGPA 2ODNA 1YZGA 1L2TA 1NBMD 3DL0A 4PX9A 4C0SA 4GOKA 3KQHA 2PH1A 2QENA 1FTNA 1KMQA 2QRZA 3CRQA 2OFOA 3GLHB 5SZJA 1XWIA 2IW3A 4ZCMA 2FZ4A 4P4UA 4UXHA 1FMLA 4MYHA 1D2MA 2E87A 3IO5A 4Q9IA 3ZIAD 1HE8B 4WIAA 3SQWA 3K0CA 1R5NA 2AWOA 3VR6A 1DO2A 2XZLA 3CH5A 4HB4A 5JCPA 2QM7A 4HZIA 1F3OA 4O25A 1AKYA 1KO5A 3J81k 1N0WA 2HF9A 2XOKD 2V7QD 2CNWD 2JCSA 4Q02A 1DAHA 3D31A 2C2HA 2J7KA 2NQ2C 1KJZA 1H8HA 3PUYA 3BC1A 1X1SA 1PUIA 1G6OA 1E1RA 1OKKD 3T1VA 1IY0A 3QVUA 1KSHA 2CLCX 2Y8EA 3WBKA 1KDOA 2IXEA 4DBLC 3KX2A 1D5CA 2G88A 3RSOA 1E9CA 4BFUA 1R8QA 2WJGA 2W2VA 4OJKA 5GJCA 1IBRA 1E99A 3QXJA 4M1WA 2ZPTX 5FI1B 3UG6A 4DKXA 1OYYA 5FOWA 1GRRA 1LNZA 2VSXA 4ZCLA 4BLOA 1XPRA 2FPLA 3AVUA 3N5CA 3OIUA 4V0NA 3TE6A 1NLYA 4D4LA 4OQNA 2HV8A 3WMGA 1U94A 2IS4A 3TR0A 1OXUA 1KZGB 1S8FA 4HSEA 2C9OA 5IHPA 1N6OA 4AKIA 2GEDA 4B3CA 4WXRA 1IONA 4LJ9A 2WJVA 2ZQ5A 3AKEA 1OJLA 4HB3A 4JL5A 4WZAE 1Y3AA 3MCAA 3W9YA 3ASZA 1I4TD 1ANKA 3MSXA 5JZVA 3U7FB 1RYFA 2NO0A 3OEED 4Q47A 1QVRA 1TTTA 1R6BX 1YR8A 1GG2A 2CE2X 3QEJA 1VMAA 3Q5EA 5TMPA 2PZFA 3ZGXA 5AUQA 1W7AA 4MKHA 1GRNA 3NEJA 3Q3JB 3QKRB 4KODA 2NO1A 1NY5A 3LNCA 2EFCB 3T12A 4OKSA 2Z43A 3OESA 3OHMA 4Z8XA 1TQ2A 1W1WA 4PZYA 3BWDD 2IYLD 3LO5A 3VR5A 1QHHA 1WB9A 5M04A 5GJBA 2R9VA 5FOVA 3SBEA 1VIAA 2Z6VA 1E0AA 1BO6A 3A1WA 1M7HA 2MSDB 2CJWA 2XTZA 3F3YA 3VX3A 2NZJA 1TU4A 1AJEA 2V1UA 2DB3A 5IK2A 4QC2A 1SKYB 1AM4D 3WNBA 2DWPA 1NN1A 4O2LA 3PUXA 4PPQA 3CZQA 3OAAA 4M9SA 1QDEA 2A9KA 4Q5IA 5FBLB 3TR5A 1OH5A 4B2PA 3VKGA 1DARA 2VEDA 1ZD8A 1DVRA 1XEXB 3LBNA 4DXAA 4HAYA 4M1MA 4QGHA 3VU9B 2Q3FA 4IXMA 1CLUA 1D2EA 2REXB 4JSTA 3FMIA 5L3QB 1GKUB 1JR3D 421PA 4DC9A 4TYNA 4P33A 3SFZA 4B2IA 3IHLA 2J0UB 3P4YA 3GMTA 3B82A 1CR0A 3QF4A 1A2KC 2AR7A 2O0JA 2WVJA 3T1TA 2RCNA 4QG7A 4XVRA 2JJ8A 1Z0FA 4MDEA 2CLSA 5KDOA 4GT1A 5H68A 1LW7A 4AI6A 4PPGA 1G18A 4O0MA 1DBSA 4URUR 4ESVA 1E2KA 5JHGB 4TZ6A 2F1JA 2NZ8A 4MKIA 3BJIC 1PLJA 1XJQA 1Z3IX 4RY2A 2GEUA 4CRWB 1EESA 1ZVQA 4BPBA 1IXZA 4KFSA 2N42A 2AFIE 3CX7A 3WRYC 1VG9B 2ZRKA 1FOEB 4J0QA 5TXGA 1NSTA 4LGMA 5JRZA 1XMVA 2RGXA 2WWXA 4DSTA 4UXJA 4LV8B 4PTLA 2QT1A 1Z6TA 1YR9A 1IHUA 5TV2A 3TNFA 3CNOA 1UDWA 1TEXA 2NOAA 2PCLA 2ORIA 3F8TA 4LUCA 4NYIQ 3RANA 2P67A 4L15A 1CJMA 3LAWA 3AVVA 5E3HA 2NTYC 5SZKB 3TQFA 1MRSA 2PZGA 1Q1BA 3A58B 3B7GA 4C4PA 2PCJA 2OZEA 1MO3A 3ADDA 1NVVR 3P20A 1HT2E 1N5IA 3THXA 3VR1A 2ZEJA 1G21E 2XITA 2QQ0A 3AVOA 2ASEA 4F38A 3HU1A 2EFDB 3TSOA 1HYQA 3V4RA 1KI7A 3L0IB 3C5HA 5AUNB 1ZM2A 2VP6A 1IQPA 1VG1A 1M2OB 2GKSA 1KO7A 5F9FA 1VYUA 4QRHA 1U0HC 1KDRA 3OIYA 2WWGA 1BIFA 4WVFA 1W36B 2J59A 4HUTA 3CW2A 4OI2A 2A3RA 4ZDIA 2R2AA 4DDWA 4BLTA 1ZINA 3GLHE 4ZI2A 1E69A 2C04A 2OUKA 5E4FA 1XTKA 2ZANA 3QG5A 4QJ5A 1SVWA 2JJ2D 2L0XA 5KNBA 3TAUA 1W2HA 3QBTA 4RJLA 2ZI6A 4DLZA 3W8NA 4DIDA 3W6PA 3DOEA 3EZ9A 5JECA 1UBFA 1YKSA 4EFNA 1DAKA 1HT1E 3JVVA 4LV5B 1OH7A 3AVPA 4P4SB 4A0GA 4X8OA 1F2TA 2OO7A 4B3DA 2OSBA 3B78A 4B44A 4GPTA 1FNNA 1XPOA 2FSHA 5EXXA 4JKIA 1JAIA 5EE3A 5K8IA 3KUDA 4R7ZA 5FR1A 2GNOA 3SJBA 1U2RA 2FFAA 4ZDJA 621PA 4CT5A 1VYTA 3U2QA 4PR0A 4V03A 2W6JA 1Q57A 2DWOA 4XWKA 4Q9HA 2A30A 4W5HA 3WXMA 3U7EB 4CEJB 3K0EA 4OK5A 3ZS8A 3EW9A 5LD2C 1KI8A 3A4MA 5F3WB 1EFRD 3VKWA 1OIXA 3ZYCA 1NBMA 2GCNA 1JPNA 1W2GA 5L8VA 2AD5A 1RE0A 2XB4A 1KI2A 4I4LA 1RRPA 3AKDA 2BVNA 2UKDA 4XWAA 3B1ZA 3ONWA 4ITRC 2GZAA 4F4JA 5EE5B 3BE4A 1ZJ6A 4DB2A 4JLNA 4TL9A 2D7CA 1XEFA 3QF4B 1MV5A 4HLUA 3RSLA 4LHXA 5KSYA 3LDAA 1ZD9A 4Q66C 3TVTA 2BKUA 3QKUA 3RNLA 4F4IA 2CCKA 2G3YA 3AM1A
chains in the Genus database with same CATH superfamily
4KKXB 3CU5A 2CBXA 3AUAA 2XZLA 5IT5A 3ORRA 3T5MA 3P71T 3WBKA 4C14A 2BFFA 4LHYA 1DG1G 2X5XA 4YH1A 1LTHR 4Z9AA 4I8XA 1HQYE 1JLLA 1NURA 5HS4A 2GZRA 1WDLA 3UOAB 3URKA 5BMVB 2VAPA 2WRZA 4XVUA 3LUKA 2JHPA 4KQFA 3I9V6 4WNAB 2B0JA 4NS1A 2H4XA 1LUAA 4R1PA 3W4IA 3RAJA 5IJWA 3DWFA 1C30A 2F67A 3I9OA 5KS2A 1M1YB 3K20A 4G0NA 4P3OA 4UARA 3P96A 4NNJA 3IAM1 4KNYA 1RQLA 4CW7A 3R7LA 1O5TA 2G72A 1QOPB 1SUPA 2RGWA 3WO1A 3USES 3K9FC 4TXHA 5EQJB 4Y2YA 4DM3A 3E5HA 1HQCA 5EHGA 4R6WA 2YYAA 3AY7A 4D97A 2B5WA 4Y1RA 2B1RA 3KKQA 1ZEMA 5G0VA 2I3GA 2JVIA 5DTRA 4KOEC 1PBNA 3AP1A 2IV2X 3RV4A 4MWSA 4ALLA 5JNWA 1EWKA 4EMTA 2GCPA 5IDXA 2XX3A 3B1WA 1EU1A 5DOVA 4WASA 4O6VA 2GAJA 1O1YA 3MYRA 4CQJA 2VP9A 5HKBA 4BY9E 3DUWA 3N2NA 1OD6A 3FOCA 3D6TB 4BATA 2XCRB 2VWHA 4TLBA 1FRNA 1EA5A 3GO4A 1R6TA 2PJDA 3VTFA 2ZK7A 5EPEA 1YQQA 1VSTA 1YH3A 1J22A 1YL6A 1Q22A 2XCLA 4I99A 4EL0A 3EXHB 4AZWA 4TQUS 1RMQA 2CD7A 4C2UA 2XVYA 1RADA 1TEHA 3RC8A 2Q3LA 2X0IA 1G5HA 3PHCA 1FRVA 2F1HA 1OLXB 1QH0A 1CQXA 2NUPB 1YE5A 4LZWA 4IJKA 2F17A 4JKYA 4AJ1A 2GSDA 1CJTC 2JBHA 3CE6A 4IGIA 5EJ6A 4OSPA 1EUYA 3RDPA 3F7NA 4RK7A 2CLMB 4BEVA 3NG1A 1EXNA 2W4MA 1DAFA 3Q0TA 1T5SA 1LPPA 1C3EA 3EAFA 1J56A 3GLIA 1VJCA 4XGRA 8GPBA 1TI7A 1Z08A 1EVLA 2CBZA 4IKEA 4F72A 9ATCA 2PFSA 4MHOA 4Q3AA 3KT6A 2GERA 2OBFA 4IIVA 4G5QA 2COEA 3ONVA 4NESA 4B45A 1UKEA 5FBVB 2BRUA 3PUHA 4V0ME 5EUMA 3DZBA 3GD7A 1R3UA 1XZKA 5JWHA 1S3IA 4LJRA 3DULA 4D82A 4UVGA 4J29A 1MP0A 2EBHX 2GBGA 1XLWA 2ZJ4A 1E4VA 1V26A 5DNAA 4G0QA 2A0UA 2BKAA 1NNEA 3B6JA 2QZJA 4NYJR 4Y2VA 2FN9A 1AURA 3HCOA 2PE5A 4Z1MD 1AUQA 1M34A 1GVNB 2IL1A 1Z39A 4KFRA 2HLDD 4IO1A 4N3AA 4BB6A 1WDKA 5H7XA 5EMKA 1O4VA 1T2CA 1G20E 1LU9A 5DXFA 4MLZA 3ONFA 5TC4A 2IZ6A 2WA2A 3NHUA 3GEHA 3I0ZA 4HDSA 4NBKA 2YIVX 1H0RA 2NT4A 2E6UX 3G0OA 4ZOLA 3CVUA 1E9BA 1EFPA 3E22B 5CVCA 4EW1A 1SUIA 3GK3A 1HE1C 1HL3A 1POXA 4O4IF 4QQRA 4ZU1X 4BLRA 3CLUC 4BNDB 2VP2A 3B52X 3HU5A 4B33A 1J8DA 2FR8A 3GFFA 3PQEA 4JX8A 5KYVA 2VDMB 1NC3A 1WUHS 1C0EA 2QYTA 5BV7A 4G2NA 4ZO6A 4BNXA 2GN0A 2ZJ0A 4PPYA 3LBHA 5JXGA 1GG5A 3DOOA 4F92B 2W2KA 1B15A 4V39A 2NU9A 1WF3A 2QZ9A 2IYNA 3T4PA 3OZSA 1XMPA 3U4MA 4MP3A 1KAHA 4FZRA 4R1OA 3PI6A 5E9QA 4U7GA 1EFVA 2C9DA 2W2LA 2XUHA 3GJ3A 5ELXA 1H4QA 1G8YA 1UPFA 1GCGA 1BG6A 1EFTA 4QT4A 3KAKA 4PLFA 2FA9A 3S5UA 2RGNC 1HMPA 1L5YA 3GGCA 1KYZA 4EG8A 1P81A 4Y6SA 4ETNA 4FDUA 3PC6A 1DEHA 1CHNA 3NXSA 4Y7DA 1ZIOA 2DPHA 4IILA 3HS3A 1TT5B 4IRXA 4JLDA 2XEXA 1ZESA 3NBXX 2NSLA 1OKKA 1QANA 4TQ9A 3GLGE 3RFVA 4V0OA 4X8LA 4EW2A 1KJYA 4UASA 3NEYA 2ZXUA 2Y2UA 3HABA 4UJ3A 2RKOA 4BKMA 4YJFB 3WGGA 2BI8A 1WBDA 3ZDDA 1ECJA 1QCYA 1YI8A 3HZHA 1KJIA 3IALA 5A3VA 4K87A 4OHZA 4EGAA 5K0ZA 1V9SA 2GBCA 2X5OA 5K8UA 1PV4A 2QA5A 1CUJA 4WCVA 3KTAA 3PUIA 1NXQA 3KQPA 4XTCS 4FSHA 5SYNA 2DR3A 4AVYA 4KK4A 3IAHA 2YBDA 2BY4A 4B80A 4D9KA 2HAEA 3OM0A 1UT6A 3ZCXA 2V5VA 5TY0A 4HEQA 4II3A 3RLIA 1TC1A 1P7VA 1YHNA 2FXIA 2FCAA 1ATIA 3DD1A 2R8ZA 1KTVA 2D5CA 2REOA 2C94A 3LIIA 5TRTA 1J0CA 3MB5A 2YXLA 2OFPA 1W25A 2IT1A 2A5GA 4HADA 4IICA 1FB5A 2X58A 2CJPA 1KK2A 3NGMA 1R4MB 4DZZA 4ZZ3A 5KVAA 3BICA 2TMYA 4F6RB 3CX6A 1T0HB 2ZVJA 4Q4AB 1X19A 4FYHA 2WQ7A 4HWKA 1OGIA 2CUZA 3MJ4A 2YXEA 2ZJ2A 2HFJA 1E6CA 3DE0X 4RDHA 1I3MA 2IU3A 1G1AA 2C3MA 2Q6KA 3RRYA 4BRSA 1E6EA 2GARA 5LXTF 3EVBA 5E1BA 1ONSA 4NYIR 1M83A 4BYMA 3TAXA 5JH7A 5DF1A 4DSNA 2YH2A 4YRCA 3OX2A 2WJWA 4BUCA 1B41A 2ALJA 2WAAA 2ZBEA 5B4TA 1VCIA 3I04A 5I9LA 4IVRA 1XZHA 3HJGA 2AFVA 4BWFB 3O92A 3M83A 2H4HA 2ZW9A 3AEKA 3WLPA 5KX5F 3FRJA 2QVCA 3KRTA 1JKIA 2RHDA 1PT8A 4G0OA 1MA0A 3KJEA 4LPKA 4AZ0A 3EOAI 1SBZA 3UG7A 1IVSA 2P6RA 3ND8A 5KVQA 3TNJA 3EBLA 2ZYRA 2Z3VA 3QLUC 2VYNA 3KOZA 2ZT8A 4Q37A 5JMPA 3VHLB 3LUPA 3VPFA 1Q21A 2ZIXB 3HCBA 5IH3A 1JEDA 1RJFA 2C20A 2D2XA 3OI7A 5K3SA 1LPNA 2VP4A 4FD2A 3ZD8A 4AFNA 2WD7B 4BJHB 4GYYA 2FN4A 4J1QA 5FBRB 3UMYA 4O08A 2B21A 1KO1A 1XZGA 1N57A 2POQX 5H4GA 5BR8B 4R9VA 4OQQA 1GZSA 1U7UA 4CDGA 3QWHA 3TL6A 2HPAA 3BK7A 2FZKA 3LS2A 4F4HA 1XK7A 4NFHA 1NY6A 2OA0A 2NXJA 4FM9A 2QN1A 1W87A 3U81A 3RVMA 4ZC1A 3IL2A 1JR3E 4EAQA 1XD9A 1Q44A 3L6RA 3H16A 4G5YA 4KPGA 3V1KA 3OOSA 1UZLA 3ZV7A 2WTMA 4YP9A 1J24A 3OZDA 2XKBA 2VBIA 5A7HA 3KT8A 1MJ5A 2YQ4A 1MU0A 2MDTA 5CB0A 1LLFA 2HSZA 2P2NA 1A8SA 4G1BA 1L4FA 3FZNA 4QBKA 4N40A 2X4IA 2Y6VA 3HYTA 1NNUA 5BR4A 1G4HA 5ITZB 1U5BB 1IXKA 2EFGA 1BXGB 2NO4A 4JBYA 5AKJA 5CAEA 3K6KA 3A26A 4A8PA 3R6WA 3ZW7A 3PXCX 2AEMA 1WP9A 2HDHA 3CN9A 4M53A 3U5ZB 1XN1A 3FI9A 2WUWE 1BFKA 4HDOB 1VHDA 3HBMA 4YRMA 2HA4A 3UTDA 4CNQA 1B93A 5UKDA 5LYJA 3UAWA 1NP6A 3WO0A 3HG7A 1SD2A 2BFCB 2QNRA 1DE0A 2A59A 3I2YX 1NASA 4P0PB 5LMZA 1EH5A 2DFLA 1HNXB 2OZVA 2IYTA 2J9XB 4R1UA 1Q3HA 3U19A 2FR1A 5K01A 1VHTA 3L7BA 1CTQA 4I66A 3H9JA 1LTKA 2SKCA 4NIMA 3WL4A 3KPYA 3B2EA 4F1KA 3IUEA 3ZHTA 1B8OA 2JZNA 1PDWA 3PUWA 1GPH1 3FTPA 4XSVA 1Q50A 1SVNA 1L8LA 4TX1A 3WRYA 3KKMA 2ONYA 2IP2A 1VBFA 4GOJA 4HEHA 4LE2A 1EP2B 1ZD1A 1XVVA 2OLKA 4LI3X 1V7ZA 4XR4A 4XX0A 2AC4A 4FMCF 5L9AA 3OO1A 3QPVA 3C39A 5J40A 1TZKA 2EKZA 3RWMB 3R3YA 3ZJ4A 2GEVA 1CXZA 1D0SA 1DQYA 1KNQA 3PE4A 3DDUA 5EIOA 2O8CB 1PR5A 4FLEA 3SKVA 2RHBA 1C1DB 3H1GA 1YCGA 4MUGA 5ADHA 2FY8A 3BMCB 3HM2A 2DTDA 3VX4A 4ZKEA 1SURA 2IF0A 3ULKA 1T8YA 4P4GA 2K7ZA 5J2TF 5CCBA 3CVVA 2J3QA 2HWXA 2WAOA 3DE2X 2IUUA 2XTAA 3VYTB 1I6LA 4NKRA 1Q77A 1I0IA 1NM5A 1Q1EA 2NSHA 2Z2IA 1K2VN 4NLLA 4OLFA 3IAUA 5CDFA 1G55A 4BVHA 1T35A 4M1OA 4GKVA 2AUNA 2XZTA 3LLSA 4L3OA 4Z7OB 1QGOA 1MQAA 2ZBDA 4J0EA 2XYQA 4HNGA 2OMEA 3V9PA 3PX7A 1YE8A 2YNMD 1C0PA 1ELOA 2EX1A 1DHRA 1T4MA 1IFXA 1OJ7A 4BE4A 4H1WA 1K4YA 1JILA 1GU7A 1RWPA 1NDHA 1R8SA 1T10A 1Z38A 4PY2A 4FIZA 1RAAA 4IIDA 2ZUFA 4UQLA 3FGOA 2I7TA 4M99A 3ODGA 5KYUA 1CX9B 3UJNA 3HDQA 3BIJA 4DQLA 4Q3EA 4E94A 3FCOA 1M2GA 2ZI9A 4ZOEA 1O77A 4XVQA 2IVFA 4MGKR 1BS2A 1IE3A 1GGJA 1ZD3A 3OTIA 4TQAA 3UJPA 3G3EA 1UC5B 2P79A 4XB2A 4ZYVA 2QLFA 5AVOA 4URXR 3BWYA 4ZGWA 4BCDA 1F8UA 1QC5A 1GSOA 4PWZA 3UGTA 3CG0A 4Q19A 3PWKA 2VBGA 4Q3KA 5LVAA 3LQYA 3ZUPA 3PXAA 2PDAA 3WSWA 3DW1X 3LWBA 2J31A 5AW2A 1BCRB 2C98A 1DUIA 2GN8A 4L4SA 4PZUA 3U9TA 3U7JA 3AL0C 1ZJYA 1XTUA 1M8FA 2WG1A 2VDWA 3ZU2A 2NO7A 3GNSA 4MQLA 4TV9A 4M88A 4CR7A 1WXQA 3DBRA 2XKAA 4J94A 2A6PA 2C96A 2C88A 4F5DA 4OMCA 2A2ZA 4IVQA 1K3FA 2OO3A 1GPDG 2WTBA 4I9UA 2CFCA 1BEEA 1FNSA 4JEUA 2EG9A 1AV7A 4PU0A 4O1IA 5F7ZA 4C6SA 4MDHA 4JC5A 1Y37A 1MFPA 1CNFA 5KU1A 2DECA 3PVSA 4D8UA 5A5VA 1FUEA 3SBXA 1G3RA 2FPUA 4F85A 3O3NB 1Z22A 3BWMA 1H8HD 4ZAWA 1D9XA 2BYTA 1VL8A 1UUFA 3R44A 4EI9A 1JKJB 2QP9X 4M1EA 2QX7A 4DLBA 2PAFA 2QTZA 3X44A 3SWWA 3TUZC 1L1FA 1FFDA 1SC6A 1CEQA 2VYVD 3EDQA 4QJ4A 1T2AA 1VIDA 3IB3A 3WE7A 1MHPA 3B6EA 4FKZA 4JVNA 3RROA 4LQ4A 1KIAA 3L40A 3OJEA 2I54A 1XIVA 4NNOA 1UXGA 3PFIA 4YRKA 4BMCA 2H3HA 3ZIAA 5IEBA 1S8AA 4AJIA 4Q7QA 2IXDA 4L9AA 3P32A 4AJNA 3C7CB 5JCOC 4J1TC 4JENA 3CMMA 1TYCA 3N2IA 2XDYA 4EFDA 1EK6A 2C4TA 1CE8B 1I94B 1SXJD 2W6ID 1VZ3A 3FYUC 4OJMX 3HE3A 4YQZA 2H8KA 3KWJA 1ISMA 2RGDA 3IQEA 3QXSA 4H27A 4X94A 2QJFA 4EY3A 1DBIA 1E2GA 3IPCA 1L7EA 4OUKX 4WNAA 1DAPA 4HWOA 2BCJQ 3NJRA 3GP3A 1J5XA 2WJIA 3THRA 4H7EA 2ISSD 5K4HA 2R8YA 4UHBA 2GAAA 4BMPB 4MXDA 1AKUA 3N07A 4LG1A 1H9BA 4WW0A 1P9RA 3AERB 1G6HA 5B1HA 3KPJA 1RRMA 3QX9A 2QE6A 1GFSA 4GNRA 5FI3A 4AG6A 5EI5A 2VVTA 2FOLA 2FX2A 3M4JA 4TLAA 4QXMA 3FHTA 1Z37A 1DV1A 2B7CA 3ESAA 5A4KA 3I53A 4QNMA 3EEBA 4AXXA 3U9SA 2VPIA 1PP4A 2BTOA 2WICA 3IUQA 4U9UA 3AR4A 3SDSA 1QDLB 1XZCA 2WM3A 2ZWIA 1MUUA 3WGKA 4ZYUA 1K6JA 2HQBA 5CA0F 1JHUA 2OFFA 2PLRA 5ED0A 4R8RA 2GD0A 3F7TA 4UVEA 3YASA 2PVPA 2ZBGA 2X1LA 1OCEA 2FWAA 4ETIA 3R8FA 2Q1WA 1II0A 2V0CA 1CZLA 4YS6A 4ZU6X 1WU8A 4WESB 2HK8A 3KVNA 1XUOA 2WSIA 1XRJA 4M54A 2DFTA 3WLHA 1PD0A 1WCYA 3W5HA 2VHYA 1K3TA 4P38A 4OREX 1GOTA 3EULA 2H06A 5JAQA 5A2QA 4UZEA 2H08A 1II8A 2CY0A 2HUNA 1TZBA 2QSYA 4RD6A 4HGYA 2WJ4A 3DOIA 1NZDA 3V3TA 1ULUA 3SR0A 3QSYA 3CE9A 5DEOA 3FMGA 1L7PA 2CNWA 4K9OA 4N3BA 5C7LO 2ZE8A 2VCHA 3MNFA 2ZYUX 4WK2B 3IJPA 4DV1B 3ZVKA 3K5IA 5HMLA 4UM9B 3FTDA 4DMGA 1DBQA 1U8TA 4QLOA 2P9BA 3U3ZA 2QS9A 1IY2A 3K31A 3P2EA 5TVGA 1OLUB 5L7WA 5JXJA 2MSNA 2O7QA 4QOGA 3SYNA 4QBHA 3T0GA 5F2OA 1Z9BA 1GYQA 3K9LA 2CCGA 3LLCA 4MIOA 5THKA 3LI2A 5KOJA 5L6LB 3KLOA 3LX6A 4Q7KA 4NH0A 2AN4A 1JXQA 2QD4A 1TYAE 1FNBA 2B8WA 5BP7A 5AVXA 3EEYA 4OHOA 4P5EA 2C8KA 2EKQA 1CF9A 3BFVA 1VTKA 4G5SA 4EKGA 2O8BA 1QYDA 4ENWA 4EHDA 2C2MA 2J4FA 4GVLA 3LUDA 4LOAA 4N5NA 4X7BA 4FS8A 3G2HA 4M8NE 3SX2A 3V8MA 5DEIA 5BVHB 2HQSA 1RXEA 2CKDA 1N4DA 2IUTA 2MHCA 2P2LA 4MKXA 2GVZC 1CDOA 4HXYA 2WPNA 1NTRA 2XNCA 3B51X 3C5CA 4TLMB 4RCYA 5EJ5A 3EGDB 1NQOA 3ROQA 1QHHB 3AQ4A 5BOSB 3IHTA 4H1VA 1ZPDA 4R2XA 3W4JA 1THTA 2AX3A 4CXMA 4F4DA 4RF2A 2DM6A 3ZBPA 5J47A 5EQTA 4MCHA 4QL3A 4AK9A 4ZHQF 1BOFA 5JYBA 3M6LA 3HMKA 4DUYB 4I6EA 4G07A 4G0XA 3WHPA 4PHGA 4KOAA 2JFWA 4II2A 3ETHA 1XA4A 1ZVKA 5DNYB 4ZYWA 2AT1A 1T0UA 3W2HA 3ELYA 1WQ4A 3TL3A 2OC9A 5DFAA 2AF4C 1CUZA 1OFUA 2GKGA 5JSHA 1N2CA 4QM7A 1RPNA 2FUEA 3T4XA 4MRVA 4FDLA 1DINA 4PBRA 1OZ0A 3LM8A 1QYWA 2YR0A 3UENA 1QIEA 1O94D 3BCHA 4NV3A 4ZK2A 1Y1QA 5FFMA 2E85A 3Q72A 3X43A 2VTEA 5EXXA 5C5IA 3NKVA 2ZJ7A 1M54A 1RXVA 3ZUGA 2XMGA 3RC1A 4ZZ1A 2GZDA 3KYCB 1GGHA 2NZ2A 2FB9A 1AHIA 4HDCA 4ZHQA 5D1HA 5HKAA 2GFQA 4AO7A 2QI9C 3RQSA 1WHTA 1ZX1A 3MTBA 4ARZA 1IK6A 1G2IA 1WOYA 2JATA 3Q7EA 4YDQA 2WAXA 1B6TA 2JVKA 3CNQS 5DE3A 5BUCA 1GZ7A 4F71A 2W8ZA 1W75A 4UM8B 3ZCVA 1SIUA 3EC2A 2NU8B 1P73A 4REOA 3FNRA 2E1PA 1B3BA 1VB5A 2GEJA 3SLRA 1RXYA 4G0YA 3NC1C 4D3DA 4NOMA 4YK7A 3KQKA 2IKSA 4MWDA 1VSQA 3BWXA 3F5FA 2VAWA 3TSWA 4RTJA 2B92A 5B1YA 5MGBA 1EIWA 3R2JA 1Y3FE 3OQJA 4RDIA 4KDRA 1H4VB 1TJYA 2IC5A 4WOKA 3PUVA 1BDJA 1K0UA 1P7CA 2RHCA 2L69A 1MA3A 3E58A 3W7AA 2YASA 4ENVA 4BU1A 1TLTA 5IHXA 1P1IA 3E9DA 2CXXA 4LXHA 4DV5B 1MW8X 1EXDA 3Q8WA 2IOHA 4JBGA 4WBNB 3OBIA 4FT4A 3O1JC 1QZZA 3PUKA 1G7SA 4YRIA 3ESRA 3PDHA 4OIMA 4EYKA 5JJKA 3DLTA 3ZH9B 2GESA 3RS2A 2ZYWX 3L2OB 1KL7A 3OC6A 1JZTA 1EI9A 1YOVB 2WSBA 4GI3A 2Q3BA 4S1OA 1F6WA 2ONJA 1FL9A 1RXIA 2QLTA 1SIOA 1WW3A 2A35A 3I9JA 4P22A 1A9TA 4ERXA 4F04A 2FW1A 3CIFA 2V7TA 1NT4A 4QQNA 4AP6A 1FNCA 1DL5A 4EJ6A 3NM4A 4EO4A 1KSJA 2DH5A 2P27A 5NLLA 3V6LA 3MJHA 3NU1A 4D9NA 2WSSD 3ZWVA 1HPLA 1M2VA 1G4AE 4J0CA 1T4CA 5DGIA 2EWVA 1G1MA 3HGQA 1N5JA 4L4RA 3SOPA 3ZDCA 4LNHA 4YP6A 3TLCA 2IUFA 3V4OA 1FA9A 4ETMA 3CF2A 1UMCA 3PE3A 3WLFA 4WKBA 1XRPA 1Y1KE 5FQOA 3EARA 3OEHD 1QSGA 3FNHA 4IY1A 4RK6A 2QLLA 3HUDA 3EH2A 2G25A 2QTTA 3ZZMA 5JH7B 4IYJA 1UBHS 4UDOA 4BJ1A 3KZKA 5ILGA 2P6OA 1B6SA 1WCIA 3U7RA 3AR2A 4Y67A 2XXJA 1USIA 2GCGA 2XYVA 1U9IC 3JARA 3BM5A 2B69A 3IP8A 1CWUA 3DVQX 4OFWA 4MRAA 3B6MA 2WIDA 2BFBA 1TO2E 5EVJA 4LSMA 4MGIR 4DANA 2RAPA 4PC6A 3SHVA 2DPMA 1O0SA 4MV0A 4R9NA 3D02A 3CGGA 3MAJA 5D3MB 5ADWA 1RBMA 2J41A 2ZVDA 5L6MB 3C16C 4ZARA 4BNLA 5KB3A 4M7WA 3U9LA 2PUAA 2CF6A 2VQSA 2HY7A 1G7TA 4PQYA 5HKLA 2V4MA 3DMTA 1G7RA 3DQZA 3O83A 4KO1S 5B64A 1GG9A 2XYGA 4UHCA 4C7KA 3AEKB 4G5HA 5JRDS 4RTSA 2BELA 5EWLB 3RIGA 4N5DA 1A88A 2FFHA 2VP0A 2XA1A 2I4NA 1TK3A 3BXHA 4RWZA 4D0RA 2OV4A 5A7GA 3TMAA 4EVQA 2WU4A 5T6MA 3HXQA 4KO8A 1TM5E 2W2PA 2Y67A 3A7EA 4ER5A 3H9EO 4DR4B 2IHTA 2I4MA 2WIGA 4EI7A 1HTBA 5J4HA 1F60A 4HFNA 3CEJA 2PV0A 3L7LA 4RPJA 2HA7A 3QEMA 3R7NA 2Q41A 1GD1O 4QYIB 1N6LA 3N0VA 5J59A 4IH1A 4AP5A 2FRXA 2VFAA 3I05A 2DFVA 3TRIA 2ACEA 3OQBA 2X1HA 3RRMA 1TZMA 2VT3A 3HMQA 4YO8A 2AFIA 4Z86A 4KRFA 6PFKA 3M0EA 4NU0A 4QX6A 4TVBA 2PJUA 3R23A 1BXGA 1XF1A 2BKLA 3AMVA 4MV8A 4D3FA 1QONA 1QXSA 5DI9A 1UDBA 1N6KA 4B35A 3THOA 1EK0A 1IJFA 4AIRA 1XA3A 2ZZKA 4N41A 5EP4A 3RF6A 3K9HA 1JEYA 4UEJA 1LSJA 1UPXA 3LVBA 4UHJA 3RSFA 5EIXA 1F2UB 1U9ZA 3DVAA 3IQZA 3F3KA 3WNQA 2OCKA 3U60B 4CQLB 4UPEA 1KBOA 1U3DA 1HT0A 2FF7A 1HG1A 3PHGA 4Q12A 4X97A 3NOXA 3V34A 3VYWA 3TLXA 4B6OA 5C1PA 4UVHA 1TDJA 4B3GA 3HVKA 4JVSB 1VIYA 3UAGA 4MDEA 1DO0A 2CDCA 2CDNA 2FSGA 2QUJA 2FZGA 2GPSA 1KYTA 4AJEA 1W34A 2G80A 721PA 5CT9A 3SHFA 3U49A 1N1MA 3OIWA 4WFQA 2ZRFA 2XJ9A 1LQ2A 4ND8B 1XNQB 1UPAA 1T3GA 4CGYA 1ECCA 1VKZA 3KSDO 4LQCA 1Y7TA 5ENDA 4TGLA 1SBHA 3BIXA 5EC8A 2R1UA 2NZXA 1YB4A 3QQPA 1T5DX 4XJTA 5G4KB 2CWWA 3WKDA 3PNYA 4IJWA 1QS0B 4YB8A 1KKMA 1XALA 2NO9A 2JLYA 4B7CA 1X38A 5C81A 2CSXA 3DTYA 3HUTA 3KEFA 3LBFA 1U6JA 4O4LB 4U5XA 4EG6A 2HCRA 1J7KA 3FYUB 3RGGA 4FMBB 1A7UA 1OXBB 1TMOA 4XXHA 3HJHA 2V55B 3VOSA 4YJ2A 4L7VA 3T5BA 4GX2A 3BAFA 4M1TA 3KK0A 4UXIA 3QVXA 1GSIA 2PGOA 4NH4A 3DZIA 1SMKA 4QYTA 2KX7A 4IJQA 5HEKA 2V0GA 3FDFA 2ZZMA 1PK8A 3PVZA 1ADFA 1TVKB 2J5BA 5IDVA 3TEMA 4GL2A 2PSEA 4BX3A 1Y89A 4F84A 2JIQA 3OZUA 4IIUA 4WY5A 4MUXA 4R4JA 5BWNA 2H6EA 2PWAA 3CUKA 1TQDA 3VI4B 3P26A 2Z9DA 1KEWA 4L9RA 3ZU4A 5GTDA 1E94E 5ENZA 1XCGB 2UZ1A 4X95A 4PG4A 4GKKB 4GF5A 1XHEA 1M6WA 3BDVA 3WSVA 4OQXA 4OA8A 1XRSB 2ZIAA 4A0RA 4E07A 3VSDA 2YQ5A 4U6NA 3PF8A 2F55A 2F00A 4TWBA 2QDKA 3RGWS 3UFBA 3GA0A 1Y5RA 3H6KA 3MPOA 4YCLA 4G0UA 2CLIB 1C0KA 4OHYA 3GPBA 1DC3A 1FYXA 2YCLA 3HACA 2VDOB 4XFDA 5FHQA 2C82A 3K09C 1AUOA 4WDQA 1Z2NX 3I61A 2DCUA 2UZ1B 4UFNA 4QATA 2Q4EA 3D8SA 4LC9A 5HR5A 1QHNA 4BEBA 3QFCA 4K86A 4HDKB 4EPXA 4GX1A 3REFA 1CC1S 1A95A 4CUJA 1GTZA 1QE3A 3SAJA 3FPAA 3CZ5A 1GKYA 2PSFA 4CBVA 4HK4A 3UJ8A 1QOQB 4XEUA 4BVGA 1H2HA 1TJNA 1Q15A 4BZWA 4Z5XA 3H4IA 5HG0A 2ETVA 1NXTA 2VF4X 5CDHA 2GO7A 1PJTA 1XNGA 3DC7A 4INPA 4NC9A 4PYIA 4XYBA 1NF2A 2XE8A 4Z6KA 2PU5A 4LV6A 3D7MA 3SHTA 3R9XA 1P7WA 3SXUB 3ITNA 3A37A 3ETGA 4Y9UA 5E7MA 1HA3A 2P4EA 2E4YA 1WCXA 3AFHA 2YMLA 3KPWA 5CLQA 4BE7B 2P9CA 1UAAA 4HQ6A 3H9UA 2F9MA 3EE6A 3ETCA 2Y6UA 1FLNA 2R7AA 4IIYA 5JW6A 3TMKA 4LZJA 1DQPA 1ESMA 1REQB 2VNAA 3INTA 3V4SA 3C3JA 4ZI7F 3HJCA 3DHEA 3GGGA 1VSVA 2CXRA 4BL5A 1N2OA 5GJVC 4PAMA 1J8VA 1I4LD 4HG2A 4M21A 1RQGA 3B53X 5KOHB 1BX0A 1IHYA 3CV3A 4BTLA 4QDUA 1ZZGA 2D3TA 3OPYI 4US2R 5JS6A 2HHCA 3HPQA 2TSYB 3O8RA 5DH9A 1I7PA 5SZHB 4MRPA 2JLQA 4Y3UA 1HQDA 1Q6ZA 3HO8A 1JKMA 3ZVLA 1M6NA 2ZJFA 4P54A 4AMVA 4I5EA 1H5QA 4Z2YA 1VMKA 1FDVA 2QTGA 4AW9A 2ENUA 1ZOPA 3WQHA 4H7IA 2ZTUA 1WHSB 5A62A 1FU7A 1JLMA 1QLHA 3DVAB 3OOEA 3R7WA 3WIUA 3IAFA 5CA1A 1L1RA 1PNTA 3JRNA 4A1OA 4LF7B 1MX1A 1YJXA 1GQ2A 1X1BA 3O03A 1IM2A 4INOA 3M34A 3VJLA 4K7JA 3ZDYB 4B6SA 4OHKA 2XUGA 4AIIA 1A9SA 4NZOA 1MIHA 5KTYA 3TRHA 4HDQB 4GBMA 2PWPA 1WSBA 2PM8A 1B0UA 4KAAA 1E0SA 5IJZA 2KPOA 4HWTA 1JYEA 4LHEA 1BE6A 1JT2A 2BEKA 3OSZA 3GIDA 3RVDA 3QEKA 1FUUA 4KSCA 1TAHA 4M6WA 3A1EA 3EH1A 3ICEA 1X80B 1U7TA 1RP7A 4WZBB 1TLFA 3UC9A 3UFXB 2DJ5A 4DDKA 1U7XA 2HWWA 3EN0A 4B6FA 2Q5LA 3WKBA 4P3XA 3UBTA 5LL6P 1DJMA 2YY7A 3M9WA 4PO8A 5EMHA 1I2DA 2KSQA 5LYJF 5HF9A 3KOUA 3WQQA 1V2HE 1RKUA 3PITA 3RUCA 3E35A 5FJIA 5HE9A 3R7DA 3VMMA 4BBPA 3EXIB 4RETA 5DW0A 3RAPR 1T9BA 2CXPA 4FVTA 5E4YA 1QRDA 1V37A 2IEIA 3KOXA 2GM9A 3FIJA 3TD9A 4LYHA 2O7RA 2A92A 5H82A 1SEPA 2AE1A 3R5XA 2C2ZA 5JH7F 5ALOA 1JDBC 1GTJ1 4EG4A 1NONA 2GTHA 1QIKA 2AXNA 1KXZA 2HO4A 4MINA 5EVCA 4L72A 1ZN8A 1NVVQ 1HH4A 1K6XA 1F2TB 1VSBA 2YWFA 3EXHA 4EG3A 2FPKA 5KOYA 5G2OA 5JCXA 2IGBA 4Q05A 5LMCA 2BE9A 3E1GA 3MTAA 3T5AA 1FUKA 3U6KA 1FYFA 4FQ7A 4HVTA 4MMXB 1FYEA 2FZVA 3ET5A 1FDSA 3JWPA 1VP9A 4PCVA 5CVVA 3U16A 2HBZA 5GONB 4PHHA 3FFBA 1YCDA 2IODA 1MOPA 3OT4A 2FP3A 4GQBA 4IDEA 3FLEA 1TIKA 3B85A 4ZTZB 4CMEC 1IQUA 5GWXA 3UF0A 1P1RA 4BVLA 4R0MA 5EP1A 1XLTC 3EVDA 4XOUA 3K8OE 4P83A 3DJFA 4N6OA 1M72A 4N65A 1XZFA 2SCUB 3G1TA 1C9YA 3KLPX 2DKOA 3ZWWA 4XRGA 3OP1A 4RUKA 1TE2A 3PT9A 1GRQA 1KOFA 2BZSA 2HU2A 3AESA 3SF8B 3RAEC 1KR5A 5C53B 4FKBA 8ATCA 1XMQB 1YTLA 4Q1DA 1NHWA 3BXOA 3I6YA 1AIPA 4CEHB 4R40A 4UQOA 3F74A 2FW8A 1SKMA 3H5TA 2YZMA 1J2UA 3K0AB 1AQUA 4JBLA 4OFXA 1A9YA 2P7HA 2DH6A 2NZWA 3TRKA 4Q1BA 2ODPA 3ISTA 2BDTA 1RHRA 2WIBA 1XEXA 5TPZD 5B6JA 5C4MA 3ZJ5A 1QFZA 1AQ6A 1VHJA 1SBTA 1YAJA 2G36A 2IKQA 4ID3A 3TLMA 2WUVA 1GAQA 1GDDA 1JS1X 2KLBA 2ZSHA 2OKCA 2HLDA 4JT4A 4UDXX 5FUWA 3ZE1B 4B48A 1C8BA 1HLDA 3RYIB 1L4YA 2XD9A 4F8YA 5LZ9A 1JQ3A 3A9VA 4MYSA 3RK1A 2XUKA 4R54A 2UU9B 1U0GA 2B99A 3EZNA 5A6VA 5CM9C 2C7GA 5C7OO 5JALA 5EUBA 5FT9A 5C4IA 3F3SA 4BC0A 3B5IA 4S0XA 1XDDA 2ATXA 1PR2A 2CJXA 2EVWX 4EPRA 1DOZA 4NBTA 4IW3B 4J7AA 3C3BA 1WDTA 3DOCA 4PPNA 5TMEA 3TOVA 3L8CA 3V33A 2FMKA 1EXWA 1GU0A 4KXXA 1K88A 5BY2A 5L3VA 2IE0A 2VF7A 2DTXA 1YJAA 4TWAA 5AOBA 3CX3A 1NMZA 3BMOB 1WF6A 3T7RA 4OM8A 2RE8A 2XQIA 3TK1A 3W5DA 1JEQB 1IRIA 1GN8A 4PSCA 1ZGZA 2HT6A 3MAAC 4PX3A 4EJSB 1JWLA 1ESZA 1W4ZA 4BEWA 4ZXPA 2ID9A 4I4CA 3BQMB 4L6IA 3RLFA 5JO0A 2B8JA 4LE1A 1IXRC 4NCAA 5DTJA 3S5JA 2V3VA 3KXIA 3OTWA 3PC4A 3AEZA 2X0FA 2PX0A 1Q92A 3J7TA 4KPFC 1GRCA 1U4SA 1W19A 3QV2A 1AK1A 5E4TA 3B3AA 4KZKA 4GOLD 5AI4A 2PLNA 1P2DA 1TAUA 1Z0DA 4DJJA 3UMSA 1LBSA 4PIPA 3CEMA 1YZUA 4IDNA 2QRNA 1QQAA 2YY5A 3FYHA 1C29B 3N2YA 3ODPA 3HJFA 3VTKA 2ZRGA 5K7SA 2YV5A 4IUBS 1E3WA 5KUTA 1R9NA 2CNDA 1Y7HA 2WG0A 4MULA 4DIFA 4KH0A 4IPTA 1M1NA 2XEDA 3QOFA 3VR2A 4YAFA 1R4MA 3KL4A 2JH3A 3IPXA 3MRVA 4G25A 4MWEA 4OXNA 3NWBA 4QOFA 3L4BA 2CL0X 5FORA 1W581 3T7KA 1E3TA 1Q19A 4HDNA 1Y4SA 2XVAA 4YAKA 5JMOA 3ILVA 2EJTA 2FN7A 2Z3ZA 1BN6A 5FTKA 1Y1TA 5JE8A 2CC2A 5D2CA 1QGUA 1E2HA 2PLWA 2RG1A 1PDVA 3QBVA 3W0LB 4C4AA 1FEZA 3EVGA 2WE8A 5GGYA 2HBQA 4KX3A 4RKYA 1TM4E 3VU1A 2P5TB 5LC1A 3UO8B 5EKTA 4KL8S 4HLCA 5EAIA 4HVCA 4PYQA 3FUUA 3G02A 2VQ3A 3FG9A 7MHTA 4DLKA 1K92A 1R0ZA 4JJGA 3OPNA 4FMDB 1HYBA 2JDID 4G97A 4H60A 4WBNA 4Q18A 4GWGA 4BNWA 1JI0A 5JOQA 3UCXA 4GM0A 1EJBA 4MGZR 4PC3A 3PI7A 4AZ3A 5AXCA 2MU1A 2UZAA 1IZ8A 4C6HA 3NRJA 1C4WA 3JYQA 2RHGB 4RWEA 4Y9SA 2CFTA 2JFPA 2QD1A 2UVQA 5AI5A 4E09A 3ZWMA 3S81A 2J4DA 2C8JA 3N2KA 5H3LA 3TQIA 4E3ZA 4YT2A 3GEBA 2CJWB 1HV8A 5HOEA 3R3HA 1HF3A 2C84A 3ZDRA 4PSKA 4ZCQA 3CKLA 3SYTA 1MDBA 3W2FA 4TV8B 1P4RA 2AOTB 1KYWA 3AP2A 3NAGA 4NARA 4BJ5A 4DJFC 2BHRA 4L78A 1W73A 4DV6B 4K9LA 1N0IA 3OTQA 3PHHA 4B73A 1NFQA 1XYGA 2XUIA 3Q88A 2ID4A 4U6QA 5FOUA 2C3PA 3PF9A 3E8SA 1PI3A 2Z8XA 2J3IA 4MUHA 3JALB 1VI6A 2HHAA 4UD6A 5DBEX 3WJ1A 1PTJC 3GFOA 4ZJYA 3ST7A 3BXFA 1N5RA 3DL7A 3IIJA 3LY7A 4D8WA 3IC5A 2I7DA 1EE1A 2Q07A 3ECCA 1ZN9A