4OKJA

Crystal structure of rnase as from m tuberculosis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
b'VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3'-5' exoribonuclease Rv2179c/MT2234.1
publication title Structure and Function of RNase AS, a Polyadenylate-Specific Exoribonuclease Affecting Mycobacterial Virulence In Vivo
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 50
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4okjA00
3HYFA 3CFPA 2VG6A 1BIZA 4Z4FA 1RTIA 1EP4A 1WSJA 3SQ2A 5KRSA 1NK7A 3T19A 3RR7A 1CXQA 1LWCA 1IO2A 1JKHA 2YNIA 3QEWA 4ELVA 1FXXA 1U48A 3KLGA 4FJNA 1HMVA 4FJJA 3HK2A 3VQ6A 1XI1A 2P5GA 3S3NA 3QEVA 3U3GA 1BISA 2HNZA 3DLGA 1KCFA 1UOCA 3OYHA 4CEDA 4DSFA 4CF1A 3C6TA 4CJ4A 3MEGA 4DTPA 5KGXA 1IG9A 4CJTA 3RMCA 4CJVA 1QTMA 4DTOA 4M3RA 4ZTJA 4TSXA 4IDKA 5CZ2A 5I3UA 3TAEA 1NJYA 3IAYA 2KFZA 4J2DA 3NH0A 4OGCA 3ZT4A 3ULDA 1UAXA 4IKFA 1NKBA 1LW0A 3DYAA 3U6FA 3ZT0A 1JXBA 2X74A 3OYDA 3OYJA 3AVNA 3TI0A 1Z26A 3BDPA 1U04A 3LPTA 4C8OA 3MXIA 1ZYQA 4FK0A 4DTMA 5D3GA 4FJXA 5HRNA 1NK0A 1ZBIA 4BE1A 1RCHA 1Q9XA 1UWBA 1RT1A 4Q5VA 2BDPA 4B9UA 4CGJA 4FJ5A 1L3SA 3AA3A 4E7KA 3H08A 3D0PA 2PZSA 1QS4A 1Z25A 3OYMA 4EZ6A 2A1RA 2HMIA 1NJWA 1VSFA 4CJWA 4IG0A 4OPKA 3AA5X 1EKEA 3AVBA 3HM9A 1T03A 4M42A 4M41A 2G8IA 4CHQA 3AO4A 4B08A 3DRSA 3K59A 4OKKA 2ETJA 2X6SA 5J1EA 2ATQA 2HW3A 4FCYA 1HNVA 4RW7A 3THVA 1CZ9A 4FM2A 2ITGA 1TVRA 2FBVA 4CJLA 5KGWA 3AVMA 4CJFA 2FBXA 2Y1IA 1NK8A 1N5YA 1QSYA 1L3UA 1WAJA 4CJUA 2KZMA 1KVBA 3QEIA 4BDPA 1RT7A 4OLBA 4CIFA 2VWJA 3TARA 1ZBFA 4CJKA 1BI4A 2XY8A 4FLWA 3KK1A 2F8SA 1VSHA 1EXQA 2E4LA 3ISNC 3T3FA 2HHQA 4CJQA 3V9WA 1X9MA 2EX3A 3EY1A 3QEPA 4KB0A 3SQ4A 1TAUA 3OS0A 4IFYA 2FBYA 3S3OA 2OYQA 3CFOA 2HHSA 3LWLA 2KZZA 1TAQA 1RTDA 3AA2A 3MEEA 3LAMA 3NF9A 2YNGA 1RBSA 2G8UA 2WOMA 3HXMA 3AVIA 3K5LA 3BGRA 4I9LA 3VN5A 4AHRA 3PX0A 1ASUA 3A2FA 4AHVA 4EP4A 5JS2A 3KD1E 3AO5A 1RDCA 3ZSYA 4CFBA 3LP3A 5HRRA 1VSJA 3KK3A 3F73A 1CZBA 3UIQA 4KHWA 2F8TA 2VG5A 5CYQA 3QNOA 1RBVA 1KLNA 1S1XA 3CQ8A 1IH7A 2OPRA 4FZYA 3MEDA 4CJEA 3O3HA 1BI4B 1NJXA 1HQUA 3QETA 1TK0A 4ELUA 4K8ZA 2IGIA 2RPIA 3G0ZA 2RF2A 4CHYA 4W5QA 3OS1A 3AVCA 4Z4IA 3OYCA 4F3TA 3KLIA 3OYAA 5J2PA 1NOZA 1BHLA 4LSLA 1RTJA 3MECA 4KTWA 4JS4A 1XHZA 1LV5A 3LP2A 3M8PA 4NCAA 3S9HA 1NOYA 2E6LA 3RR8A 2BGGA 4RW8A 4DLGA 3VQQA 2GUIA 4M45A 5J2NA 1JLBA 1HYZA 3AVAA 3QINA 4Y1DA 4FM0A 2HHUA 3ZCMA 4HTUA 4CJPA 4E19A 1LWFA 4CJ3A 1IKYA 1SKWA 1S5JA 2JGUA 3IG1A 1DTQA 3VQEA 4CK2A 1NKEA 1RDBA 4F2SA 4UQGA 2YKMA 3RMDA 2R7YA 4FK4A 4BDZA 3TAFA 1CXUA 4PA1A 5C42A 4DF8A 1SV5A 2PYLA 3ZSXA 4CGHA 2GBZA 3LAKA 1S1UA 3L2RA 2AJQA 4BDYA 4ICLA 3VQ4A 4CEQA 5J2QA 2IAJA 4E7IA 1BCMA 4BE0A 1GOBA 5KRTA 3NF8A 1FKPA 4RG8A 1RDAA 4G1QA 5CYMA 3T1AA 5FDLA 5JS1A 4DFPA 4KI4A 1S9GA 1BQMA 4OPJA 1T05A 3RRHA 3OYGA 2YNHA 3MAQA 2DTUA 3AV9A 2LSNA 3ITHA 1BIUA 3PV8A 1ASWA 3P1GA 4E89A 1B92A 1ITGA 4FK2A 3NGIA 3PO5A 4OJRA 1IKXA 1B9DA 3L2WA 4FJIA 1WSEA 1RILA 3M8SA 4HHTA 1ZBHA 3DLRA 3DRRA 3MXJA 2IDOA 3QNNA 4QCLA 1K6YA 3L3UA 5J2MA 5CZ1A 1R0AA 3PUFA 5HRSA 3O4QA 4CK3A 3O3GA 1VSIA 3HPGA 5HLFA 1S6PA 4B9TA 4KHSA 5FRMA 4E3SA 1C1CA 4N76A 3OYFA 2XRIA 2YV0X 1KFSA 4AILC 1SL2A 5KTQA 4ID1A 4B8AB 3VQDA 4GMJB 4KTZA 1KVCA 4RW4A 2Q3SA 5T7BA 4DSEA 1HJRA 3PX4A 4C8KA 1X1PA 4KTQA 1RT6A 3VQ9A 3SZ2A 1HYSA 4DWIA 1CLQA 1I3AA 3TWHA 4AHUA 4DFJA 4GW6A 4CGFA 2G8WA 4OGEA 2A1SA 4NYFA 4O4GA 1ASVA 1VSDA 3OY9A 1WNSA 4O0IA 3NF6A 3VQPA 4CGIA 4J2EA 1S1VA 4DTRA 4FLVA 2Z1GA 1TKTA 3NHGA 1QE1A 3ZSWA 4ELTA 2ZQBA 3OYLA 4BWJA 3ZSOA 4RW6A 3SUPA 1S1TA 4E0DA 4L8RB 1JXEA 1RT5A 3VQAA 1NK4A 2G8VA 4N41A 2E6MA 4DFMA 4O5BA 4CGDA 3PX6A 4DQPA 3QIPA 4AHSA 1WSHA 1C0TA 4ID5A 2IOCA 4Z4HA 3AO3A 4FLYA 3SUOA 2W42A 4FM1A 4DU3A 2HNDA 1WSFA 3HO1A 1T8EA 1D9FA 3VA3A 4DS5A 2DFEA 1HQEA 1DLOA 3ASMA 1X9WA 4KPYA 3AO1A 3L2VA 4LSNA 1TKZA 5E41A 2X78A 3SV4A 3DI6A 4EP5A 1TV6A 3KKSA 2JLEA 1UA0A 3LZJA 5EU7A 4B9MA 3RMAA 1C6VA 4I9QA 4NCBA 3V81A 4E1NA 1KRPA 3TABA 3NGZA 3AVJA 4CF0A 1D5AA 4W5TA 3DLKA 2KTQA 4C8NA 4CIEA 1S6QA 1QSSA 4KO0A 3OJSA 5DK5A 1JLCA 4CJSA 4PY5A 4HUGA 1GOCA 4DTXA 1I39A 4DTJA 4N56A 4OKEA 4AH9A 4CEAA 4FLTA 3U3YA 4O44A 2ZD1A 3K57A 4QAGA 3VQ8A 4LH5A 4KKOA 4CFCA 3DMJA 1U47A 1S1WA 2F96A 4CFAA 4CF2A 4B9NA 3VA0A 4KHQA 3VQBA 5K14A 3OYEA 4KHUA 4KB1A 4Z4GA 4PWDA 4AHCA 2Z1IA 3VQ7A 4KFBA 4CCHA 4C8MA 3NDKA 3V1RA 1L3VA 4O55A 1RDDA 1ZBUA 3HPHA 5SWMA 3WNEA 3K58A 2G8HA 4CIGA 1ZBLA 4E7LA 4CF8A 3ZSRA 3DLEA 3KK2A 4LH4A 2B6AA 3LP0A 4HVJA 4H4OA 4FZZA 2B5JA 4CESA 1VRUA 4N47A 1JLGA 2OPPA 4FJGA 4QOZB 4CGGA 5DMRA 3DLBA 1HYVA 3RTVA 2P51A 2ZE2A 3CFRA 3QLHA 3HVTA 2BANA 1BCOA 3HSTB 4IBNA 4Y1CA 1Q9YA 3SYZA 3TAGA 4DFKA 1LAWA 2D5RA 4DTSA 3NCIA 1KFDA 1O1WA 5CY4A 2BE2A 5C24A 1TK5A 1KLMA 1L5UA 4CHPA 3P83D 3IS9A 4Z0UA 1EX4A 2QKBA 3KLEA 1NK9A 3L2UA 1TK8A 4PQUA 1LWEA 4ZHRA 3ZSVA 1LAVA 3LALA 4CEZA 3V4IA 4PUOA 4FVMA 2O4GA 3HP9A 3L8BA 3KKRA 3TANA 1B9FA 4N5SA 4W5NA 1JL2A 3RMBA 1VSLA 4FLZA 4R5PA 4I2QA 2KFNA 2P1JA 2HHWA 2YNFA 5HRPA 4CHNA 2YHBA 2IC3A 2XY6A 3O3FA 1C1AA 1VK0A 3ZT2A 1TKDA 3I8DA 4KI6A 3HPOA 4BWMA 3VQCA 1DTTA 3WNGA 2QKKA 1Q8IA 4KAZA 1KTQA 1HNIA 5HROA 3C95A 1FKOA 4FZXC 3HP6A 3SV3A 3B6PA 2Z1JA 1TKXA 4I2PA 2RN2A 3SCXA 3KD5E 5I42A 3HL8A 4W5RA 2P5OA 2FBTA 4H4MA 4DSLA 3JSMA 3M8QA 1WN7A 3NE6A 2OZSA 4DSIA 4K8XA 4J2BA 2KW4A 4CEBA 3CM5A 2EHGA 2YKNA 3DOKA 3NH1A 3HT3A 5FRNA 1JLFA 1YVUA 4YFUA 1SL0A 1SUQA 2HB5A 3SNNA 1RNHA 3PY8A 1YTUA 1A5VA 3OVNA 2DFHA 4CF9A 1LW2A 3NH2A 4F2RA 4BACA 4Z4EA 1QHTA 2G8KA 4E1MA 4IFVA 1HPZA 3ZT1A 4C8LA 4FJMA 2QK9A 4CHZA 1C0UA 3QESA 2YHAA 3RRGA 1FK9A 4CECA 4GVMA 3O4NA 2NUBA 3KLFA 3LDSA 1KVAA 4B9SA 1TL1A 1YT3A 1D9DA 4I7FA 2XY5A 1KSPA 3KJVA 2HVIA 4M3UA 4M3XA 4FLXA 1QQCA 2DFFA 3QO9A 3OJUA 4LY7A 4OKJA 1UA1A 1SKRA 4J2AA 3QERA 1WAFA 3QEXA 2HHXA 1BQNA 3SUNA 3CM6A 1WSIA 2HHVA 3DRPA 3TAMA 2OZMA 3F9KA 1RT4A 3SUQA 4DSKA 3KIOA 1MU2A 4M3WA 4FYDA 4FJ8A 1RTHA 3V1QA 3V9UA 4FXDA 3SPYA 4B9VA 3PO4A 1XHXA 3AVFA 1A5WA 3C94A 3JYTA 2DY4A 1U49A 3I0RA 1JLQA 3QIOA 4F3OA 3OYBA 3RWUA 3ZSQA 4HUEA 2XHBA 4CFDA 2G8FA 4ZTFA 3ZSZA 4MQ3A 4CK1A 2QXFA 4KHYA 1NK6A 1VSEA 3DOLA 1XWLA 3NFAA 1REVA 1Y97A 2IS3A 1F21A 3V6DA 4OLAA 3D45A 4CJ5A 4FJHA 1A5XA 5C25A 4FJ7A 4B3OA 3DM2A 1W0HA 1J9AA 3SI6A 5SZTA 1WSGA 4JRQA 4M3YA 1S9EA 4HCCA 3CYMA 4FJ9A 3SQ1A 4NCGA 3SJJA 4DMNA 4JS5A 4DTUA 2D0AA 4HCBA 2OPQA 2I5JA 3NAEA 4W5OA 2D0CA 4DU1A 3SPZA 4OVLA 1N6QA 3K5MA 4DQIA 1VRTA 4KHNA 1GOAA 4MFBA 3OYKA 3G10A 4B8CA 4FW1A 1NK5A 3L2QA 4EZ9A 3MXMA 1W9HA 3CG7A 3OYIA 4RW9A 1VSKA 1X9SA 1QSLA 4HUFA 4YNQA 5FROA 4NYNA 1HRHA 4JLHA 3V9XA 3I0SA 2VWKA 1YTAA 2O4IA 2GV9A 3K2PA 3DLHA 1D8YA 3E01A 3HJFA 1J5OA 3VQ5A 3AO2A 3OS2A 4DQRA 4DQQA 3WNFA 1RT2A 3AA4A 1J54A 1JLAA 3FFIA 4IG3A 3SQ0A 4LD0A 3EZ5A 3C6UA 1C0MA 3IRXA 2XY7A 1VSMA 4DU4A 2PY5A 3L3VA 4O0JA 5KI6A 2XO7A 3KLHA 3EYZA 4FLUA 4DS4A 1L3TA 3S3MA 4F8RA 4DQSA 2VG7A 2WONA 4Z4CA 4CEFA 1J53A 4KREA 1BGXT 3V9SA 4BE2A 1U45A 3LP1A 4DSJA 3ALYA 4JRPA 4E7HA 3ZT3A 4DF4A 3OYNA 3AVLA 3TAQA 2B4JA 4CEOA 2HNYA 1RBUA 3K5OA 2HVHA 3K5NA 4FW2A 4CE9A 2Y1JA 1IKWA 3LZIA 3TAPA 3M8RA 4DTNA 4F4KA 3AVGA 3AVHA 4FJLA 2D0BA 1JLEA 1TGOA 3B6OA 3NF7A 3LPUA 4CJRA 1U4BA 2Z1HA 1T7PA 1IKVA 4KV8A 2OA8A 1BL3A 1SKSA 4M3ZA 4B9LA 4WE1A 4CERA 2OPSA 1SL1A 4DLEA 2RKIA 1EETA 5HP1A 1RT3A 3AVKA 3P5JA 3V9ZA 1JL1A 5HBMA 4DG1A 3WNHA 1WLJA 1G15A 4CHOA 4XIUA 1NKCA 3HVRA 4CEEA 2KQ2A 1RBTA 1TL3A 4FJKA 2PYJA 4AHTA 3TR8A 2X6NA 1XC9A 2FC0A 4H8KA 4M3TA 1NJZA 3V1OA 4E7JA 3LANA 3LWMA 4KRFA 3KTQA 4Q0BA 3NBPA 1RBRA 2HHTA 1C1BA 3NGYA
chains in the Genus database with same CATH superfamily
2VG6A 4BC4A 4Z4FA 3SQ2A 5KRSA 4RCHA 1CXQA 3ATVA 4X62K 3OBWA 4GY2B 3EE9A 4CBXA 4JK8A 2P5GA 4HTLA 3QEVA 5H1SQ 2HNZA 1UOCA 3MX5A 4M7XA 4CEDA 1YJNN 4KH6A 4M3RA 1NJYA 2KFZA 3LM2A 4BROA 3I56N 3ZT0A 4L3QA 1U04A 5FPDA 1NGGA 3LL3A 4C8OA 5LMUK 2O8FA 4DB3A 5D3GA 2P9KB 5HRNA 1ZBIA 4BE1A 1UWBA 3C7NA 1X3NA 4JV5K 3D0PA 4LF4K 2A1RA 2HMIA 1OKJA 1VSFA 4OPKA 3AA5X 3CQYA 1XUPO 4M42A 4M41A 4CHQA 3SJHA 2ETJA 5J1EA 2PAVA 2EWSA 1HNVA 4RW7A 5MLCQ 1KD1O 1YXQA 2FBVA 2Y1IA 1NK8A 2OCEA 1VQMN 1WAJA 4CJUA 4DR7K 3CJAA 4CIFA 4A2AA 1VSHA 2HHQA 3V9WA 4M7YA 3G71N 4IFYA 3S3OA 1QVFM 2HHSA 3EO3A 5JLHA 3D7EO 1SQKA 3CIPA 3LAMA 1HR0K 3ZEUA 2WOMA 3P31A 3K5LA 3VN5A 4AHRA 2HOEA 1KAXA 3F73A 1CZBA 1U2VB 2A3ZA 3J7YP 2OPRA 4FZYA 3MEDA 1TYQB 2J4RA 1NJXA 3HK2A 2RPIA 4JI7K 3KLIA 1RTJA 4IWVA 4JS4A 1XHZA 1LV5A 4NCAA 3RR8A 1C0GA 2BGGA 5BR9A 4M45A 1HYZA 3ZCMA 4HTUA 1IKYA 4UQGA 4FK4A 4BDZA 1ZXOA 5C42A 1SV5A 4CGHA 5M1KA 2WTUA 4GV9A 2D1KA 3KZBA 3MWPA 5KPTA 3M3ZA 5F2RA 3NF8A 1VAZA 1RDAA 2YJEA 2Q97A 5GAGP 2FF6A 1BQMA 2NNWA 2YNHA 3AV9A 2LSNA 4R79A 3ITHA 4E89A 3P38A 1ITGA 1B9DA 4FJIA 1WSEA 4HHTA 1ZBHA 3DLRA 1K73O 1K6YA 5AR0A 4GV6A 4JKGA 5CZ1A 1R0AA 3PUFA 3O80A 4BR7A 4B9TA 1S6PA 3D2FA 4LFAK 1C1CA 4CD3A 5KTQA 3VQDA 4GMJB 3CCEN 4DSEA 4DR3K 2V52B 3TTDA 1NMDA 5E84A 1T44A 4DFJA 1HNZK 2P9UB 4O4GA 3OY9A 4J2EA 1WNSA 2PBDA 3NF6A 3VQPA 5EVZA 4DTRA 3ENOA 4JKFA 4FPAA 2YHXA 3SUPA 4E0DA 1S1TA 2O8CB 1HLUA 1NK4A 1EWQA 2E6MA 4DFMA 3H45C 3VETA 4CBUA 4CZGA 2IOCA 4CW7B 1WSFA 1GLCG 4UY8O 1X9WA 1HQEA 5FPNA 3H6EA 2QWQA 2HF3A 2X78A 2O8DB 5AZJA 1NG9A 3KKSA 4B9MA 1XQSC 4H0PA 1BUPA 4RWTA 1EO1A 1YI2N 3AVJA 4CF0A 1D5AA 3BY5A 4FWMA 4W5TA 5EOYA 1OH7A 1JJ2M 4FWLA 2V7YA 4CIEA 5FPEA 4CZIA 3OJSA 4CZKA 4CJSA 4A5BA 4XEIA 4PY5A 3HBTA 4HUGA 4BRIA 2WC9A 3THWB 2ZD1A 2RE2A 3VQ8A 4CFCA 4KHQA 1S1WA 2F96A 2W6KA 4CF2A 3D2EB 5K14A 4KHUA 3CCSN 3VQ7A 4DUZK 2AA4A 1RDDA 3K58A 3WNEA 3SMPA 1ZBLA 3WEEA 3ZSRA 3HI0A 4H4OA 2RHKA 2B5JA 4N47A 3A5MC 5CE3A 1BCOA 4LC9B 2IVPA 3TAGA 4LFBK 1O1WA 5CY4A 4I6MA 4JN4A 2BE2A 3VESA 3O5BA 1IV0A 3AY9A 1NK9A 3L2UA 1LWEA 4CEZA 2O4GA 2QXLA 4GV3A 2E8AA 1VSLA 4LF5K 3T1YK 4FLZA 4I2QA 2HHWA 2YNFA 5FLXO 1RFQA 1C1AA 3ZT2A 3HPOA 4BWMA 1DEJA 4DV7K 2P9NB 1VQNN 3B6PA 5KQ8A 5I42A 2P5OA 2FBTA 4H4MA 4K0KK 5EX5A 3NE6A 4DSIA 4K8XA 4J2BA 4CEBA 5C2FA 3CM5A 4XH1A 3HT3A 1JLFA 1YVUA 2VCPA 1E3MA 2HB5A 3J7AP 4K42A 4FOIA 1YTUA 3NH2A 4CF9A 1LW2A 3VF2A 1QHTA 2G8KA 3FFKB 3ZT1A 1C0UA 3RRGA 1VQ6N 4CECA 3KLFA 5BREA 3U4LA 1KVAA 1TL1A 1D9DA 2VGMA 3B8AX 1KSPA 2ASOA 3DXMA 2DFFA 4FWPA 1V4TA 1SKRA 3I55N 3QERA 4WQ5C 1HX1A 3DRPA 3TAMA 4B1XB 1RT4A 4M3WA 1VQLN 4B1UB 3V9UA 4EHUA 3SPYA 4B9VA 3JYTA 4DR6K 3VERA 3I0RA 4H0VB 2P9LA 4F3OA 3RWUA 4H0TB 3PSFA 3ZSQA 4KH5A 3MCAB 4MQ3A 4CK1A 4KHYA 1NK6A 1VSEA 3O9UA 3NFAA 1W97L 1REVA 3N4PA 2D0PA 3BF3A 4FJHA 1D4XA 1W0HA 1J9AA 4M3YA 2D4WA 3EE8A 2BUPA 4H0XB 2P9SB 4NCGA 4DMNA 2D0CA 4OVLA 4KHNA 4GNIA 1VRTA 3G10A 4FW1A 3L2QA 4BY9C 2GWJA 3ZLJA 2KLAA 3VEYA 1X9SA 1QSLA 5HL7L 3I0SA 2HHHK 1Q82O 4IZ9A 5AQMA 3HJFA 4BRMA 3K0SA 1T6DA 4DQRA 2ZJQL 3C6AA 3WNFA 1RT2A 3OA9A 1J54A 2UYTA 4IG3A 3SQ0A 1C0MA 3SAFA 4DU4A 4O0JA 2XO7A 4DS4A 1L3TA 4CEFA 4BQZA 2D0OA 2ITMA 3AVLA 3TAQA 4CEOA 1RBUA 4CE9A 2Y1JA 3LZIA 2O8BB 3AVHA 1JLEA 3NF7A 4M3ZA 1IKVA 1SL1A 2JWLA 4JHDB 5HP1A 3V9ZA 1JL1A 4DG1A 1WLJA 3J7ZO 3A5NC 4HWIA 4JI8K 4FWKA 1TL3A 3LDNA 4CJ7A 4RTFD 3TR8A 1VQ7N 1HNXK 3G25A 4B9QA 4E7JA 3LANA 3GE1A 4A5AA 1NGFA 5LMNK 3HYFA 4DR4K 3L4IA 5ADXA 3VF6A 3QFUA 3SK3A 4CBWA 1JKHA 3VOVA 4IOAL 1FXXA 1U48A 3LDPA 4JYAK 1NM1A 4IJAA 1BISA 3OYHA 3J8AA 1KCFA 3PIPL 4BGBA 3CC4N 3C6TA 2BTFA 1IG9A 4CJTA 3RMCA 4ZTJA 4Z94A 4TSXA 3IAYA 4CVNE 3NH0A 4FOEA 3U6FA 1JXBA 2X74A 3PIOL 3OYDA 3AVNA 1NGJA 4Y0WA 4IEEA 5CR4A 4GKKK 3LPTA 1KAYA 1ZYQA 3L6QA 3LDLA 3E66A 1RCHA 2BDPA 5A2QO 5AQFA 3H08A 3OYMA 4CJWA 3RSEA 2ZJRL 1EKEA 3HM9A 2G8IA 4LFCK 3K59A 2X6SA 3H3NO 4FCYA 1TUYA 2BH1A 1CZ9A 4FM2A 2ITGA 1N5YA 3AVMA 5GAHP 1DGKN 4FSVA 2KZMA 1JCFA 3TPQA 3QEIA 3VTIA 1RT7A 4BDPA 4OLBA 2VWJA 3TARA 2HF4A 1BI4A 4FLWA 4ILHA 2F8SA 3ISNC 4CJQA 4BR2A 4MDAA 2EX3A 3EY1A 1M1KO 4FWQA 3DLLL 1TAUA 3LM9A 3OS0A 3K9KA 5F0XA 3LWLA 3QFPA 5JLFA 3MEEA 4YHHK 1RBSA 2VQEK 2YHYA 4BREA 4I9LA 4B3TK 3EEQA 1KAZA 3AO5A 1RDCA 4CFBA 4LF7K 4BRGA 3CCLN 4KHWA 2VG5A 5CYQA 1Q86O 4U67L 2QWNA 3O3HA 4A59A 2GELA 4MDBA 1TK0A 4K8ZA 3W3DA 3G0ZA 3M6GA 5AQGA 4Z4IA 3OS1A 4F3TA 5IWAK 3S9HA 2E6LA 1XMOK 5J2NA 1JLBA 3AVAA 2GX9A 3HOSA 2HHUA 4DV6K 4CJPA 3THXB 3ATUA 1LWFA 2JGUA 3L4QA 4CK2A 1DTQA 2P9PB 3ZX2A 1ATNA 5AQXA 3U9DA 2CGLA 4PA1A 4DF8A 2Q0RA 3JS6A 3ZSXA 2AJQA 4FWRA 4ICLA 4NLCA 3DWLA 3VQ4A 1R59O 5AFUH 5J2QA 3U9ZA 4FWSA 1S22A 5AQTA 1GOBA 4YOYA 3IMXA 5FDLA 5JS1A 3R1XA 3WEEB 3MAQA 1BIUA 3PV8A 5AZIA 1OH8A 4FK2A 2O8EB 3TSPA 4K25A 3ULEA 5C10A 2QTDA 1RILA 3M8SA 2A6AA 2IDOA 4DUYK 3QNNA 3MMVA 3CMEN 2UUAK 2QWLA 3ZX0A 5HRSA 3O4QA 3O3GA 3LDOA 3ZX3A 4N76A 3OYFA 2XRIA 2YV0X 1RDUA 4ID1A 2HMPA 4RW4A 4C8KA 1RT6A 4DWIA 1I3AA 3WQTA 1GLAG 1TUUA 4GW6A 4XH5A 4CGFA 3SMSA 4PHTX 1IBMK 2G8WA 4OGEA 4NYFA 1DKGD 4O0IA 5LJVA 3TSQA 2WFBA 1M90O 2NRWA 2Z1GA 1FJGK 4A62A 1ATRA 3MN7A 3O1WA 4ELTA 4RW6A 3QBXA 3Q7BA 3VQAA 4BC5A 4F9OA 3DXKB 5BN9A 2G8VA 4N41A 3FZKA 4O5BA 4CGDA 3OHRA 1W2BM 3A0IX 3QIPA 1WSHA 1C0TA 4C23A 4FM1A 2HNDA 3VA3A 2DFEA 4KPYA 3L2VA 3SV4A 2P9IA 3DI6A 2F9TA 3LZJA 3CC7N 4NCBA 3KWIA 1KRPA 1Q81O 3DLKA 2KTQA 4C8NA 4X64K 1S6QA 3EN9A 3JXUA 4KO0A 1W7AA 5AFUA 5GADP 4IEIA 4BC3A 3R6MA 2VYPA 1I39A 4DTJA 4N56A 1XNRK 4FWOA 4QAGA 5TKWA 3SAHA 4B9NA 4O8KA 2Z1IA 4KFBA 4CCHA 4O55A 3OTOK 1NGEA 4CIGA 5AQUA 3C65A 3U8XA 2VWBA 4E7LA 4H5VA 3O9RA 3VEXA 2HSTA 3M1FA 2NRHA 2A40A 1JLGA 4QS9A 4QOZB 1LCUA 4CZFA 3HVTA 3HSTB 4IBNA 5KPRA 2A41A 4NXMK 4DFKA 1OVYA 1LAWA 1KFDA 1KLMA 1YF5L 4CHPA 1L5UA 3K9JA 3P83D 5F1XA 5LY3A 1N8RO 4K43A 3LALA 3V4IA 4FVMA 2Q0UA 3L8BA 3KKRA 3TANA 4MLEA 4W5NA 1FW6A 3CCRN 4JD2B 4CI6A 2IC3A 1VK0A 3CHWA 4KI6A 3C0BA 3WNGA 4DKWA 4KAZA 5AQVA 1FKOA 4FZXC 3HP6A 4BRFA 2Z1JA 4IOCL 2E20A 4GKJK 1TKXA 2RN2A 3EZWA 3TTFA 5GIOA 1NGIA 2KW4A 5FRNA 3DAWA 1SL0A 4AM6A 5TKYA 1ZBSA 3SNNA 4FVUA 4B3SK 3OVNA 4PKHA 2DFHA 4F2RA 4E1MA 4FJMA 1X3MA 4CD1A 3QESA 4YDUC 2W6LA 3CCUN 3O4NA 2NUBA 3LDSA 3O4WA 4B9SA 2IVNA 1ILYA 1N34K 5AQLA 1ATSA 1QQCA 3QO9A 4FLXA 1UA1A 4OKJA 3CD6N 1WAFA 1BQNA 1VQ8N 3VEOA 5C12A 3T69A 1Z6RA 3KIOA 3AGRA 1RTHA 3V1QA 3AVFA 4WCEL 1U49A 1K8KA 3KK7A 3UKRB 5JICA 4J8FA 2XHBA 4CFDA 3FZFA 5BN8A 3FE1A 3GDQA 2AP1A 1F21A 3D45A 4BR5A 4DR2K 2E2NA 1QZ5A 4QS8A 5SZTA 1WSGA 4FJ9A 3SJJA 4WFNL 3WT0A 5I9EB 2I5JA 3MCPA 2CH6A 3DLHA 1J6ZA 4BRQA 3K5MA 2KKZA 1GOAA 4MFBA 3OYKA 3IKMA 3MXMA 1W9HA 1VSKA 4YNQA 4NYNA 4JLHA 3V9XA 2VWKA 3G6EN 5CHIA 2GV9A 1IBKK 4KHPK 3K2PA 1VQ9N 1D8YA 3E01A 4BR4A 4FPBA 3A5OC 3A8YA 1H1VA 4BVPA 4DQQA 1TKDA 3CJ7A 1JLAA 3EZ5A 3EYZA 5LL6Z 3S3MA 2HBMA 4DQSA 2VG7A 2QEXN 1J53A 1BGXT 1U45A 3LP1A 4JRPA 3FLCO 3ZT3A 4B3MK 3K5OA 5C15A 1IKWA 3M8RA 5BPLA 5GINA 3TTCA 3N4QA 3O1BA 3FZLA 2KHOA 4BRHA 3LPUA 1U4BA 2OA8A 3THYA 1BL3A 2NRXA 4WE1A 4CERA 1EETA 3WXJA 4DV3K 1IG8A 2GWKA 1NMNA 4FJKA 5M1PA 1XC9A 4H8KA 1NJZA 2IIRA 4Q0BA 3ENHA 2NLXA 3E1YA 1C1BA 4A61A 1RTIA 1HKBA 1NK7A 1QVGM 3T19A 3WUHA 2P9KA 4JKEA 2YNIA 1OH5A 4ELVA 4NB4A 5LJWA 3MN5A 3KLGA 1HMVA 4FJJA 3BF1A 1QZ6A 2V7ZA 4IO9L 3S3NA 3U3GA 3DLGA 2E1YA 4CZMA 4DSFA 4CF1A 3ZETB 3UKUA 5KGXA 4DV0K 2FSNA 5AQYA 4IDKA 5CZ2A 3O6WA 5I3UA 5BRHA 4J2DA 4OGCA 2E88A 4IKFA 3SBTA 1HNWK 3VEVA 1NKBA 1LW0A 3DYAA 4E1JA 3CPWM 2GUPA 2I7PA 5JMVA 2OTLN 4EFHA 3CMAN 4JK9A 2V51B 4ILGB 3MXIA 4FK0A 4FJXA 1NK0A 4DV1K 4FJ5A 3AA3A 4E7KA 5ADXH 4IG0A 3F5TA 4DV5K 4B08A 3DRSA 3P4IA 4OKKA 2FLOA 4MO4A 2HW3A 2CH5A 4C1NI 3QICA 3THVA 1HUXA 1QSYA 2FBXA 1U2VA 4YOTA 1K9MO 3BZCA 1TYQA 1ZBFA 4CJKA 5DM6L 3KK1A 2O8FB 4AQYK 3CXCM 1X9MA 3MWTA 4JKBA 3C7NB 2GEMA 2FBYA 3VEZA 1NGAA 3AARA 1T6CA 1RTDA 4WYBA 3AA2A 5AQSA 2QWPA 2Q1NA 2G8UA 3KWGA 4YOWA 3BGRA 3F2KA 1ASUA 4ISEA 3A2FA 4EP4A 2QW9A 3KD1E 3ZSYA 3KK3A 3QNOA 4YY3K 1RBVA 3H3OB 1S1XA 3NMUA 1IH7A 2E1ZA 4LF9K 5AQKA 1MWKA 4CJEA 3QETA 4ELUA 4CHYA 4JKCA 2RF2A 4W5QA 1EQYA 4YOUA 3MECA 4KTWA 3LP2A 3M8PA 4H03B 3IDHA 3FZMA 2ASPA 4RW8A 1YHQN 2GUIA 4PL8A 4FM0A 1XMQK 4DR1K 3ZEUB 2ZJPL 1SKWA 3VQEA 4BC2A 3WXIA 1VQON 1NKEA 4IDHA 4F2SA 2YKMA 3RMDA 2PYLA 2GBZA 3LAKA 1S1UA 3L2RA 4BDYA 3AAPA 3CETA 1SZ2A 4E7IA 1BCMA 4BE0A 5KRTA 2CGJA 1FKPA 2QWRA 4RG8A 4G1QA 5CYMA 4DFPA 4KI4A 2HBJA 3BEXA 2P9UA 3RRHA 3OYGA 1ASWA 1B92A 3GBTA 5AQHA 5BR8K 4YOVA 4OJRA 1IKXA 5BRFA 3DRRA 3QB0A 3L3UA 5J2MA 4BRPA 2O8CA 4CK3A 5HLFA 1VSIA 3BZKA 4KHSA 5FRMA 4E3SA 3CCVN 1SL2A 4B8AB 4KTZA 4JI1K 5T7BA 3PX4A 1QQMA 4KTQA 1HYSA 3VQ9A 3SZ2A 3TWHA 3SAGA 3TU5A 1WB9A 1ASVA 4OO1J 2O8DA 4CGIA 1S1VA 5M1FA 4FLVA 4JNEA 4JEPA 4A57A 3NHGA 1QE1A 1RDWX 1KXPA 3ZSWA 2ZQBA 4JKGB 3VEWA 3D2FB 4DQPA 3JAMO 3CJ9A 4AHSA 1MWMA 4ID5A 3THWA 3SUOA 4FLYA 3HTVA 2W42A 3HO1A 3D2EA 1D9FA 4DS5A 1DLOA 1S3XA 2FSKA 1TKZA 5E41A 4MO5A 1TV6A 5EU7A 4I9QA 4BG8A 4KBOA 3V81A 5C2DA 1QSSA 4WQ4A 3CERA 5DK5A 3VTHA 3NVMA 1GOCA 4DTXA 3ZYYX 4OKEA 4CEAA 3U3YA 3K57A 1VQKN 4CFAA 1BOTO 1CZAN 2ZGZA 3WQUA 3VA0A 4Z4GA 4C8MA 1L3VA 3HPHA 5SWMA 2G8HA 1NGDA 5AZJB 3BUZB 2B6AA 4DCHA 1GLLO 2W41A 2DPNA 2OPPA 3C6HA 2ZWHA 5DMRA 4CGGA 1HYVA 2P51A 2P9NA 5GIPA 2UXBK 4Y1CA 2D5RA 4DV2K 4WFAL 5C24A 1TK5A 4H5RA 4Z0UA 3IS9A 3VMFB 1EX4A 2QKBA 3KVGA 1TK8A 4ZHRA 3ZSVA 1ESVA 4PUOA 4MLHA 4JI3K 1YJ9N 1JL2A 4R5PA 2KFNA 1NGBA 2WUSA 5HRPA 4WQ5A 2XY6A 3VQCA 3FGUA 5HROA 3C95A 4WFBL 3SV3A 1NU0A 4JKDA 3HSCA 3FR0A 4I2PA 3WXLA 3SCXA 2E2QA 3HOTA 4I6MB 3HL8A 4DSLA 1GLEG 3M8QA 1WN7A 1NJIO 4IJNA 4V19S 2YKNA 3CCQN 4YFUA 1SUQA 4BACA 3EL2A 3THYB 4IFVA 1HPZA 4C8LA 2QK9A 2YHAA 1YT3A 4I7FA 3R8EA 2XY5A 3KJVA 2HVIA 3UE5A 1YAGA 3OJUA 3H1VX 4J2AA 2FF3B 3EKUA 4K41A 1WSIA 2P9SA 4XH4A 3SUQA 4FYDA 1MU2A 4FJ8A 4FXDA 3PO4A 1XHXA 3C94A 2DY4A 4BGAA 2NRVA 5AQIA 1QQNA 3OYBA 2G8FA 4PL7A 3UKUB 2IS3A 3DXMB 3V6DA 3T7ZA 4CJ5A 3R9PA 4FJ7A 4B3OA 3DM2A 4QS7A 1BG3A 3SI6A 4JRQA 1S9EA 4HCCA 3GOIA 3CYMA 3P39A 5AQZA 4JS5A 2D0AA 4DTUA 4HCBA 2OPQA 4DU1A 3NAEA 4W5OA 1N6QA 3SPZA 4DQIA 1LOTB 3CG7A 4RW9A 2P9LB 5B8HA 4LF8K 5FROA 1X9JA 1GLBG 1HRHA 2O8BA 5IT9O 2O4IA 5BPMA 4IO8A 4JHDA 1J5OA 3AAQA 3AO2A 3OS2A 2FSJA 3AA4A 4EHTA 3FZHA 1VSMA 3L3VA 4FLUA 5KI6A 4F8RA 4BRAA 3KLHA 4BE2A 4JAXA 1OH6A 3QDKA 4BRDA 3W0LA 4DSJA 2YHWA 3ALYA 4WF9L 4E7HA 3OYNA 1QHAA 2HNYA 4H5TA 4FW2A 3TAPA 5FPMA 3ENBA 4DTNA 4F4KA 1YIJN 2D0BA 1T7PA 4CJRA 4ILJA 4KV8A 4B1WB 4B9LA 3SLCA 2OPSA 5KQDA 1HKGA 1RT3A 3P5JA 5M1QA 5HBMA 3VGMA 1G15A 4CHOA 4CEEA 1VQ4N 1RBTA 5JVHL 2ZF5O 3HRGA 4H5NA 4M3TA 3LWMA 3NBPA 1RBRA 3I8BA 1MDUB 3CFPA 1U6ZA 1BIZA 4QCLA 1EP4A 1WSJA 2QI2A 3RR7A 1BA1A 1LWCA 1K8AO 1IO2A 3QEWA 4CZEA 4EAHD 4FJNA 3O8MA 3VQ6A 3H1QA 3E9LA 1XI1A 3J81O 4JI2K 2ZGYA 5AQPA 5AQJA 4CJ4A 3MEGA 4DTPA 3ID6A 1XNQK 3F9MA 4CJVA 1QTMA 4BRLA 4DTOA 3TAEA 2IVOA 1KQSM 3ZT4A 5C0YA 3ULDA 1UAXA 3CPEA 5HOOA 1N32K 3OYJA 3TI0A 1Z26A 3BDPA 3WXMB 4DTMA 1Q9XA 4B9UA 1RT1A 4Q5VA 4CGJA 1L3SA 3A5LC 2PZSA 1QS4A 1Z25A 4EZ6A 2QM1A 5KPZA 1NJWA 2QWOA 3TSUA 4B1YB 3AVBA 1T03A 1JCEA 3AO4A 1XC3A 2ATQA 2F9WA 3VF4A 1O13A 3CF5L 5AQNA 1HPMA 1TVRA 4CJLA 5KGWA 4CJFA 1L3UA 1Q18A 1HJOA 1KVBA 2XY8A 1EXQA 2E4LA 3CCJN 3T3FA 3QEPA 4KB0A 3SQ4A 2OYQA 3CFOA 2KZZA 3CJBA 1P8ZA 1TAQA 1DT9A 3RSEB 4JI5K 3VPZA 3T1HK 3THXA 3NF9A 2YX6A 2YNGA 3HXMA 3AVIA 3CI5A 2P9PA 2VQFK 3D6RA 3PX0A 4NXNK 4AHVA 5JS2A 3MN6A 3LP3A 5HRRA 1VSJA 2YCHA 3UIQA 2F8TA 2I7NA 3IFRA 2Q31A 3O9SA 1KLNA 2E5LK 3CQ8A 1IJJA 4OX9K 1BI4B 3J80O 1HQUA 2IGIA 3MDQA 3IUCA 3AVCA 1NNEA 3OYCA 3OYAA 5J2PA 1Z05A 1NOZA 1BHLA 4LSLA 1P90A 4JKHA 1NOYA 4DLGA 3VQQA 3QINA 4Y1DA 1WOQA 4E19A 2O8EA 4CJ3A 1S5JA 3IG1A 2Q2RA 3AGKA 1RDBA 2JWKA 4BR0A 4DHYA 4EIAA 2R7YA 3TAFA 1CXUA 2H3GX 3O9QA 1BDGA 4CEQA 2OTJN 2IAJA 2UXCK 4WQ4C 4A2BA 1N33K 4IFEA 3T1AA 3OW2M 3I33A 1S9GA 3VGKA 2YJFA 4OPJA 1T05A 2F4VK 2DTUA 2W40A 3P1GA 1EWRA 1GLFO 1N36K 2YI1A 3NGIA 2OANA 3PO5A 4FO0A 3L2WA 1RGIA 4CZJA 3QMLA 3MXJA 5DM7L 5BPNA 1VQPN 3DXKA 3E9OA 1NWKA 3HPGA 5AQOA 1KFSA 4AILC 2E2PA 1KVCA 4DR5K 3VENA 2Q3SA 1HJRA 1X1PA 2F7TA 5AQRA 1CLQA 5BRDA 4AHUA 1NGCA 2UU9K 2A1SA 2HBLA 1VSDA 5AZIB 4BR9A 2ASMA 3HM8A 3EKSA 3ULEB 2UUBK 1TKTA 4DV4K 3ID8A 3OYLA 4BWJA 3ZSOA 4L8RB 1JXEA 1RT5A 4GVEA 2Q36A 3O08A 3PX6A 1GLDG 4Z4HA 3AO3A 3GL1A 4NLBA 4DU3A 3CQXA 1T8EA 3ASMA 3AO1A 5AQQA 4LSNA 3CC2N 4EP5A 1BWFO 2JLEA 1UA0A 3RMAA 1C6VA 4E1NA 3E9PA 3TABA 3NGZA 4CZHA 2NZTA 2ZM6K 3R3LA 3HZ6A 1JLCA 4AH9A 4FLTA 2PFUA 1ZC6A 4O44A 4ISFA 4LH5A 4KKOA 3DMJA 1U47A 3VQBA 3OYEA 4KB1A 4PWDA 4BRNA 4AHCA 1OVQA 3NDKA 3V1RA 1ZBUA 2P9IB 4JD2A 4CF8A 1Q7YO 3DLEA 3KK2A 4LH4A 2NRZA 3LP0A 4HVJA 4FZZA 4CESA 1VRUA 1VHXA 4FJGA 3DLBA 4OPHA 3RTVA 2ZE2A 3CFRA 3QLHA 3S41A 2BANA 4IOXA 1Q9YA 3SYZA 4LF6K 4DTSA 3NCIA 4C1NK 1KC8O 4BQLA 3BP8A 1YUWA 4BVOA 3O9TA 3KLEA 4O5FA 4YDUA 4PQUA 3Q7CA 1LAVA 5M1NA 4YOXA 2VGNA 3HP9A 5E26A 1B9FA 4N5SA 3RMBA 3L0QA 2P1JA 4JI4K 4X65K 1S72N 2NRRA 4CHNA 1C0FA 2YHBA 3O3FA 2FXUA 2UXDK 3I8DA 5AJ3K 4AF1A 1DTTA 1Y64A 2QKKA 1Q8IA 1KTQA 1HNIA 3DJCA 3KD5E 1BU6O 5GAEP 4U7BA 4W5RA 2HBKA 3JSMA 2OZSA 1JCGA 1I94K 4OPAA 2EHGA 3NH1A 3DOKA 1WBDA 4G9ZA 5ELZA 1RNHA 4B1ZA 4JI6K 3PY8A 1A5VA 4Z4EA 3UKRA 1YJWN 4CHZA 4AM7A 4CZLA 1FK9A 1YITN 4GVMA 2CGKA 2NRTA 4ISGA 3PSIA 4M3UA 4M3XA 4DQ8A 4LY7A 4FWNA 3QEXA 2HHXA 1T3VA 3SUNA 5JVGL 3G4SN 4B1VA 3CM6A 3UB5A 2HHVA 4FL9A 4YORA 2OZMA 3F9KA 4DSKA 1MA9B 3CCMN 4NO7A 1BO5O 5EXWA 1SS6A 3PLAA 1A5WA 1JLQA 3QIOA 3MX2A 2QA4N 4HUEA 4X66K 4ZTFA 1GLJO 3ZSZA 2QXFA 3KHYA 4IXCA 1BA0A 2WBNA 3DOLA 1XWLA 1VQ5N 4BG9A 1Y97A 1IBLK 2GTDA 3VGLA 4H0OA 4OLAA 1A5XA 5C25A 3CJ1A 4BRKA 1NLVA 3OBYA 2UUCK 3SQ1A 1G99A 4PKGA 4B8CA 1NGHA 3MN9A 1V4SA 1NK5A 4JKAA 5M1OA 4EZ9A 1K8KB 3OYIA 1QQOA 3H46O 4HUFA 5EY4A 3GG4A 1YTAA 4KH4A 2QWMA 3RVCA 3VQ5A 3FFIA 4LD0A 3C6UA 3IRXA 2XY7A 2PY5A 3QBWA 1E4FT 2E2OA 2WONA 4Z4CA 1SAZA 4KREA 3V9SA 2A42A 4H5WA 4O8UA 4DF4A 3WXKA 2B4JA 2A5XA 2HVHA 3K5NA 4B3RK 1J5EK 4H0YB 4M63C 3AVGA 4FJLA 3B6OA 1TGOA 3CJCA 2Z1HA 3NVKA 4PKIA 1SKSA 4DLEA 1WBBA 2RKIA 3AVKA 3ZETA 3WNHA 3MK6A 4XIUA 1NKCA 3M5RA 3LDQA 4JI0K 3HVRA 1WUAA 2KQ2A 2PYJA 4AHTA 5AQWA 1HKCA 2X6NA 4BRCA 4JK7A 2FC0A 3SBGA 3V1OA 4KRFA 1E4GT 1YVNA 3KTQA 1NBWA 2HHTA 3NGYA
chains in the Genus database with same CATH topology
3HYFA 3CFPA 2VG6A 1BIZA 4Z4FA 1RTIA 1EP4A 1WSJA 3SQ2A 5KRSA 1NK7A 3T19A 3RR7A 1CXQA 1LWCA 1IO2A 1JKHA 2YNIA 3QEWA 4ELVA 1FXXA 1U48A 3KLGA 4FJNA 1HMVA 4FJJA 3HK2A 3VQ6A 1XI1A 2P5GA 3S3NA 3QEVA 3U3GA 1BISA 2HNZA 3DLGA 1KCFA 1UOCA 3OYHA 4CEDA 4DSFA 4CF1A 3C6TA 4CJ4A 3MEGA 4DTPA 5KGXA 1IG9A 4CJTA 3RMCA 4CJVA 1QTMA 4DTOA 4M3RA 4ZTJA 4TSXA 4IDKA 5CZ2A 5I3UA 3TAEA 1NJYA 3IAYA 2KFZA 4J2DA 3NH0A 4OGCA 3ZT4A 3ULDA 1UAXA 4IKFA 1NKBA 1LW0A 3DYAA 3U6FA 3ZT0A 1JXBA 2X74A 3OYDA 3OYJA 3AVNA 3TI0A 1Z26A 3BDPA 1U04A 3LPTA 4C8OA 3MXIA 1ZYQA 4FK0A 4DTMA 5D3GA 4FJXA 5HRNA 1NK0A 1ZBIA 4BE1A 1RCHA 1Q9XA 1UWBA 1RT1A 4Q5VA 2BDPA 4B9UA 4CGJA 4FJ5A 1L3SA 3AA3A 4E7KA 3H08A 3D0PA 2PZSA 1QS4A 1Z25A 3OYMA 4EZ6A 2A1RA 2HMIA 1NJWA 1VSFA 4CJWA 4IG0A 4OPKA 3AA5X 1EKEA 3AVBA 3HM9A 1T03A 4M42A 4M41A 2G8IA 4CHQA 3AO4A 4B08A 3DRSA 3K59A 4OKKA 2ETJA 2X6SA 5J1EA 2ATQA 2HW3A 4FCYA 1HNVA 4RW7A 3THVA 1CZ9A 4FM2A 2ITGA 1TVRA 2FBVA 4CJLA 5KGWA 3AVMA 4CJFA 2FBXA 2Y1IA 1NK8A 1N5YA 1QSYA 1L3UA 1WAJA 4CJUA 2KZMA 1KVBA 3QEIA 4BDPA 1RT7A 4OLBA 4CIFA 2VWJA 3TARA 1ZBFA 4CJKA 1BI4A 2XY8A 4FLWA 3KK1A 2F8SA 1VSHA 1EXQA 2E4LA 3ISNC 3T3FA 2HHQA 4CJQA 3V9WA 1X9MA 2EX3A 3EY1A 3QEPA 4KB0A 3SQ4A 1TAUA 3OS0A 4IFYA 2FBYA 3S3OA 2OYQA 3CFOA 2HHSA 3LWLA 2KZZA 1TAQA 1RTDA 3AA2A 3MEEA 3LAMA 3NF9A 2YNGA 1RBSA 2G8UA 2WOMA 3HXMA 3AVIA 3K5LA 3BGRA 4I9LA 3VN5A 4AHRA 3PX0A 1ASUA 3A2FA 4AHVA 4EP4A 5JS2A 3KD1E 3AO5A 1RDCA 3ZSYA 4CFBA 3LP3A 5HRRA 1VSJA 3KK3A 3F73A 1CZBA 3UIQA 4KHWA 2F8TA 2VG5A 5CYQA 3QNOA 1RBVA 1KLNA 1S1XA 3CQ8A 1IH7A 2OPRA 4FZYA 3MEDA 4CJEA 3O3HA 1BI4B 1NJXA 1HQUA 3QETA 1TK0A 4ELUA 4K8ZA 2IGIA 2RPIA 3G0ZA 2RF2A 4CHYA 4W5QA 3OS1A 3AVCA 4Z4IA 3OYCA 4F3TA 3KLIA 3OYAA 5J2PA 1NOZA 1BHLA 4LSLA 1RTJA 3MECA 4KTWA 4JS4A 1XHZA 1LV5A 3LP2A 3M8PA 4NCAA 3S9HA 1NOYA 2E6LA 3RR8A 2BGGA 4RW8A 4DLGA 3VQQA 2GUIA 4M45A 5J2NA 1JLBA 1HYZA 3AVAA 3QINA 4Y1DA 4FM0A 2HHUA 3ZCMA 4HTUA 4CJPA 4E19A 1LWFA 4CJ3A 1IKYA 1SKWA 1S5JA 2JGUA 3IG1A 1DTQA 3VQEA 4CK2A 1NKEA 1RDBA 4F2SA 4UQGA 2YKMA 3RMDA 2R7YA 4FK4A 4BDZA 3TAFA 1CXUA 4PA1A 5C42A 4DF8A 1SV5A 2PYLA 3ZSXA 4CGHA 2GBZA 3LAKA 1S1UA 3L2RA 2AJQA 4BDYA 4ICLA 3VQ4A 4CEQA 5J2QA 2IAJA 4E7IA 1BCMA 4BE0A 1GOBA 5KRTA 3NF8A 1FKPA 4RG8A 1RDAA 4G1QA 5CYMA 3T1AA 5FDLA 5JS1A 4DFPA 4KI4A 1S9GA 1BQMA 4OPJA 1T05A 3RRHA 3OYGA 2YNHA 3MAQA 2DTUA 3AV9A 2LSNA 3ITHA 1BIUA 3PV8A 1ASWA 3P1GA 4E89A 1B92A 1ITGA 4FK2A 3NGIA 3PO5A 4OJRA 1IKXA 1B9DA 3L2WA 4FJIA 1WSEA 1RILA 3M8SA 4HHTA 1ZBHA 3DLRA 3DRRA 3MXJA 2IDOA 3QNNA 4QCLA 1K6YA 3L3UA 5J2MA 5CZ1A 1R0AA 3PUFA 5HRSA 3O4QA 4CK3A 3O3GA 1VSIA 3HPGA 5HLFA 1S6PA 4B9TA 4KHSA 5FRMA 4E3SA 1C1CA 4N76A 3OYFA 2XRIA 2YV0X 1KFSA 4AILC 1SL2A 5KTQA 4ID1A 4B8AB 3VQDA 4GMJB 4KTZA 1KVCA 4RW4A 2Q3SA 5T7BA 4DSEA 1HJRA 3PX4A 4C8KA 1X1PA 4KTQA 1RT6A 3VQ9A 3SZ2A 1HYSA 4DWIA 1CLQA 1I3AA 3TWHA 4AHUA 4DFJA 4GW6A 4CGFA 2G8WA 4OGEA 2A1SA 4NYFA 4O4GA 1ASVA 1VSDA 3OY9A 1WNSA 4O0IA 3NF6A 3VQPA 4CGIA 4J2EA 1S1VA 4DTRA 4FLVA 2Z1GA 1TKTA 3NHGA 1QE1A 3ZSWA 4ELTA 2ZQBA 3OYLA 4BWJA 3ZSOA 4RW6A 3SUPA 1S1TA 4E0DA 4L8RB 1JXEA 1RT5A 3VQAA 1NK4A 2G8VA 4N41A 2E6MA 4DFMA 4O5BA 4CGDA 3PX6A 4DQPA 3QIPA 4AHSA 1WSHA 1C0TA 4ID5A 2IOCA 4Z4HA 3AO3A 4FLYA 3SUOA 2W42A 4FM1A 4DU3A 2HNDA 1WSFA 3HO1A 1T8EA 1D9FA 3VA3A 4DS5A 2DFEA 1HQEA 1DLOA 3ASMA 1X9WA 4KPYA 3AO1A 3L2VA 4LSNA 1TKZA 5E41A 2X78A 3SV4A 3DI6A 4EP5A 1TV6A 3KKSA 2JLEA 1UA0A 3LZJA 5EU7A 4B9MA 3RMAA 1C6VA 4I9QA 4NCBA 3V81A 4E1NA 1KRPA 3TABA 3NGZA 3AVJA 4CF0A 1D5AA 4W5TA 3DLKA 2KTQA 4C8NA 4CIEA 1S6QA 1QSSA 4KO0A 3OJSA 5DK5A 1JLCA 4CJSA 4PY5A 4HUGA 1GOCA 4DTXA 1I39A 4DTJA 4N56A 4OKEA 4AH9A 4CEAA 4FLTA 3U3YA 4O44A 2ZD1A 3K57A 4QAGA 3VQ8A 4LH5A 4KKOA 4CFCA 3DMJA 1U47A 1S1WA 2F96A 4CFAA 4CF2A 4B9NA 3VA0A 4KHQA 3VQBA 5K14A 3OYEA 4KHUA 4KB1A 4Z4GA 4PWDA 4AHCA 2Z1IA 3VQ7A 4KFBA 4CCHA 4C8MA 3NDKA 3V1RA 1L3VA 4O55A 1RDDA 1ZBUA 3HPHA 5SWMA 3WNEA 3K58A 2G8HA 4CIGA 1ZBLA 4E7LA 4CF8A 3ZSRA 3DLEA 3KK2A 4LH4A 2B6AA 3LP0A 4HVJA 4H4OA 4FZZA 2B5JA 4CESA 1VRUA 4N47A 1JLGA 2OPPA 4FJGA 4QOZB 4CGGA 5DMRA 3DLBA 1HYVA 3RTVA 2P51A 2ZE2A 3CFRA 3QLHA 3HVTA 2BANA 1BCOA 3HSTB 4IBNA 4Y1CA 1Q9YA 3SYZA 3TAGA 4DFKA 1LAWA 2D5RA 4DTSA 3NCIA 1KFDA 1O1WA 5CY4A 2BE2A 5C24A 1TK5A 1KLMA 1L5UA 4CHPA 3P83D 3IS9A 4Z0UA 1EX4A 2QKBA 3KLEA 1NK9A 3L2UA 1TK8A 4PQUA 1LWEA 4ZHRA 3ZSVA 1LAVA 3LALA 4CEZA 3V4IA 4PUOA 4FVMA 2O4GA 3HP9A 3L8BA 3KKRA 3TANA 1B9FA 4N5SA 4W5NA 1JL2A 3RMBA 1VSLA 4FLZA 4R5PA 4I2QA 2KFNA 2P1JA 2HHWA 2YNFA 5HRPA 4CHNA 2YHBA 2IC3A 2XY6A 3O3FA 1C1AA 1VK0A 3ZT2A 1TKDA 3I8DA 4KI6A 3HPOA 4BWMA 3VQCA 1DTTA 3WNGA 2QKKA 1Q8IA 4KAZA 1KTQA 1HNIA 5HROA 3C95A 1FKOA 4FZXC 3HP6A 3SV3A 3B6PA 2Z1JA 1TKXA 4I2PA 2RN2A 3SCXA 3KD5E 5I42A 3HL8A 4W5RA 2P5OA 2FBTA 4H4MA 4DSLA 3JSMA 3M8QA 1WN7A 3NE6A 2OZSA 4DSIA 4K8XA 4J2BA 2KW4A 4CEBA 3CM5A 2EHGA 2YKNA 3DOKA 3NH1A 3HT3A 5FRNA 1JLFA 1YVUA 4YFUA 1SL0A 1SUQA 2HB5A 3SNNA 1RNHA 3PY8A 1YTUA 1A5VA 3OVNA 2DFHA 4CF9A 1LW2A 3NH2A 4F2RA 4BACA 4Z4EA 1QHTA 2G8KA 4E1MA 4IFVA 1HPZA 3ZT1A 4C8LA 4FJMA 2QK9A 4CHZA 1C0UA 3QESA 2YHAA 3RRGA 1FK9A 4CECA 4GVMA 3O4NA 2NUBA 3KLFA 3LDSA 1KVAA 4B9SA 1TL1A 1YT3A 1D9DA 4I7FA 2XY5A 1KSPA 3KJVA 2HVIA 4M3UA 4M3XA 4FLXA 1QQCA 2DFFA 3QO9A 3OJUA 4LY7A 4OKJA 1UA1A 1SKRA 4J2AA 3QERA 1WAFA 3QEXA 2HHXA 1BQNA 3SUNA 3CM6A 1WSIA 2HHVA 3DRPA 3TAMA 2OZMA 3F9KA 1RT4A 3SUQA 4DSKA 3KIOA 1MU2A 4M3WA 4FYDA 4FJ8A 1RTHA 3V1QA 3V9UA 4FXDA 3SPYA 4B9VA 3PO4A 1XHXA 3AVFA 1A5WA 3C94A 3JYTA 2DY4A 1U49A 3I0RA 1JLQA 3QIOA 4F3OA 3OYBA 3RWUA 3ZSQA 4HUEA 2XHBA 4CFDA 2G8FA 4ZTFA 3ZSZA 4MQ3A 4CK1A 2QXFA 4KHYA 1NK6A 1VSEA 3DOLA 1XWLA 3NFAA 1REVA 1Y97A 2IS3A 1F21A 3V6DA 4OLAA 3D45A 4CJ5A 4FJHA 1A5XA 5C25A 4FJ7A 4B3OA 3DM2A 1W0HA 1J9AA 3SI6A 5SZTA 1WSGA 4JRQA 4M3YA 1S9EA 4HCCA 3CYMA 4FJ9A 3SQ1A 4NCGA 3SJJA 4DMNA 4JS5A 4DTUA 2D0AA 4HCBA 2OPQA 2I5JA 3NAEA 4W5OA 2D0CA 4DU1A 3SPZA 4OVLA 1N6QA 3K5MA 4DQIA 1VRTA 4KHNA 1GOAA 4MFBA 3OYKA 3G10A 4B8CA 4FW1A 1NK5A 3L2QA 4EZ9A 3MXMA 1W9HA 3CG7A 3OYIA 4RW9A 1VSKA 1X9SA 1QSLA 4HUFA 4YNQA 5FROA 4NYNA 1HRHA 4JLHA 3V9XA 3I0SA 2VWKA 1YTAA 2O4IA 2GV9A 3K2PA 3DLHA 1D8YA 3E01A 3HJFA 1J5OA 3VQ5A 3AO2A 3OS2A 4DQRA 4DQQA 3WNFA 1RT2A 3AA4A 1J54A 1JLAA 3FFIA 4IG3A 3SQ0A 4LD0A 3EZ5A 3C6UA 1C0MA 3IRXA 2XY7A 1VSMA 4DU4A 2PY5A 3L3VA 4O0JA 5KI6A 2XO7A 3KLHA 3EYZA 4FLUA 4DS4A 1L3TA 3S3MA 4F8RA 4DQSA 2VG7A 2WONA 4Z4CA 4CEFA 1J53A 4KREA 1BGXT 3V9SA 4BE2A 1U45A 3LP1A 4DSJA 3ALYA 4JRPA 4E7HA 3ZT3A 4DF4A 3OYNA 3AVLA 3TAQA 2B4JA 4CEOA 2HNYA 1RBUA 3K5OA 2HVHA 3K5NA 4FW2A 4CE9A 2Y1JA 1IKWA 3LZIA 3TAPA 3M8RA 4DTNA 4F4KA 3AVGA 3AVHA 4FJLA 2D0BA 1JLEA 1TGOA 3B6OA 3NF7A 3LPUA 4CJRA 1U4BA 2Z1HA 1T7PA 1IKVA 4KV8A 2OA8A 1BL3A 1SKSA 4M3ZA 4B9LA 4WE1A 4CERA 2OPSA 1SL1A 4DLEA 2RKIA 1EETA 5HP1A 1RT3A 3AVKA 3P5JA 3V9ZA 1JL1A 5HBMA 4DG1A 3WNHA 1WLJA 1G15A 4CHOA 4XIUA 1NKCA 3HVRA 4CEEA 2KQ2A 1RBTA 1TL3A 4FJKA 2PYJA 4AHTA 3TR8A 2X6NA 1XC9A 2FC0A 4H8KA 4M3TA 1NJZA 3V1OA 4E7JA 3LANA 3LWMA 4KRFA 3KTQA 4Q0BA 3NBPA 1RBRA 2HHTA 1C1BA 3NGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYF A;  3CFP A;  2VG6 A;  1BIZ A;  4Z4F A;  1RTI A;  1EP4 A;  1WSJ A;  3SQ2 A;  5KRS A;  1NK7 A;  3T19 A;  3RR7 A;  1CXQ A;  1LWC A;  1IO2 A;  1JKH A;  2YNI A;  3QEW A;  4ELV A;  1FXX A;  1U48 A;  3KLG A;  4FJN A;  1HMV A;  4FJJ A;  3HK2 A;  3VQ6 A;  1XI1 A;  2P5G A;  3S3N A;  3QEV A;  3U3G A;  1BIS A;  2HNZ A;  3DLG A;  1KCF A;  1UOC A;  3OYH A;  4CED A;  4DSF A;  4CF1 A;  3C6T A;  4CJ4 A;  3MEG A;  4DTP A;  5KGX A;  1IG9 A;  4CJT A;  3RMC A;  4CJV A;  1QTM A;  4DTO A;  4M3R A;  4ZTJ A;  4TSX A;  4IDK A;  5CZ2 A;  5I3U A;  3TAE A;  1NJY A;  3IAY A;  2KFZ A;  4J2D A;  3NH0 A;  4OGC A;  3ZT4 A;  3ULD A;  1UAX A;  4IKF A;  1NKB A;  1LW0 A;  3DYA A;  3U6F A;  3ZT0 A;  1JXB A;  2X74 A;  3OYD A;  3OYJ A;  3AVN A;  3TI0 A;  1Z26 A;  3BDP A;  1U04 A;  3LPT A;  4C8O A;  3MXI A;  1ZYQ A;  4FK0 A;  4DTM A;  5D3G A;  4FJX A;  5HRN A;  1NK0 A;  1ZBI A;  4BE1 A;  1RCH A;  1Q9X A;  1UWB A;  1RT1 A;  4Q5V A;  2BDP A;  4B9U A;  4CGJ A;  4FJ5 A;  1L3S A;  3AA3 A;  4E7K A;  3H08 A;  3D0P A;  2PZS A;  1QS4 A;  1Z25 A;  3OYM A;  4EZ6 A;  2A1R A;  2HMI A;  1NJW A;  1VSF A;  4CJW A;  4IG0 A;  4OPK A;  3AA5 X;  1EKE A;  3AVB A;  3HM9 A;  1T03 A;  4M42 A;  4M41 A;  2G8I A;  4CHQ A;  3AO4 A;  4B08 A;  3DRS A;  3K59 A;  4OKK A;  2ETJ A;  2X6S A;  5J1E A;  2ATQ A;  2HW3 A;  4FCY A;  1HNV A;  4RW7 A;  3THV A;  1CZ9 A;  4FM2 A;  2ITG A;  1TVR A;  2FBV A;  4CJL A;  5KGW A;  3AVM A;  4CJF A;  2FBX A;  2Y1I A;  1NK8 A;  1N5Y A;  1QSY A;  1L3U A;  1WAJ A;  4CJU A;  2KZM A;  1KVB A;  3QEI A;  4BDP A;  1RT7 A;  4OLB A;  4CIF A;  2VWJ A;  3TAR A;  1ZBF A;  4CJK A;  1BI4 A;  2XY8 A;  4FLW A;  3KK1 A;  2F8S A;  1VSH A;  1EXQ A;  2E4L A;  3ISN C;  3T3F A;  2HHQ A;  4CJQ A;  3V9W A;  1X9M A;  2EX3 A;  3EY1 A;  3QEP A;  4KB0 A;  3SQ4 A;  1TAU A;  3OS0 A;  4IFY A;  2FBY A;  3S3O A;  2OYQ A;  3CFO A;  2HHS A;  3LWL A;  2KZZ A;  1TAQ A;  1RTD A;  3AA2 A;  3MEE A;  3LAM A;  3NF9 A;  2YNG A;  1RBS A;  2G8U A;  2WOM A;  3HXM A;  3AVI A;  3K5L A;  3BGR A;  4I9L A;  3VN5 A;  4AHR A;  3PX0 A;  1ASU A;  3A2F A;  4AHV A;  4EP4 A;  5JS2 A;  3KD1 E;  3AO5 A;  1RDC A;  3ZSY A;  4CFB A;  3LP3 A;  5HRR A;  1VSJ A;  3KK3 A;  3F73 A;  1CZB A;  3UIQ A;  4KHW A;  2F8T A;  2VG5 A;  5CYQ A;  3QNO A;  1RBV A;  1KLN A;  1S1X A;  3CQ8 A;  1IH7 A;  2OPR A;  4FZY A;  3MED A;  4CJE A;  3O3H A;  1BI4 B;  1NJX A;  1HQU A;  3QET A;  1TK0 A;  4ELU A;  4K8Z A;  2IGI A;  2RPI A;  3G0Z A;  2RF2 A;  4CHY A;  4W5Q A;  3OS1 A;  3AVC A;  4Z4I A;  3OYC A;  4F3T A;  3KLI A;  3OYA A;  5J2P A;  1NOZ A;  1BHL A;  4LSL A;  1RTJ A;  3MEC A;  4KTW A;  4JS4 A;  1XHZ A;  1LV5 A;  3LP2 A;  3M8P A;  4NCA A;  3S9H A;  1NOY A;  2E6L A;  3RR8 A;  2BGG A;  4RW8 A;  4DLG A;  3VQQ A;  2GUI A;  4M45 A;  5J2N A;  1JLB A;  1HYZ A;  3AVA A;  3QIN A;  4Y1D A;  4FM0 A;  2HHU A;  3ZCM A;  4HTU A;  4CJP A;  4E19 A;  1LWF A;  4CJ3 A;  1IKY A;  1SKW A;  1S5J A;  2JGU A;  3IG1 A;  1DTQ A;  3VQE A;  4CK2 A;  1NKE A;  1RDB A;  4F2S A;  4UQG A;  2YKM A;  3RMD A;  2R7Y A;  4FK4 A;  4BDZ A;  3TAF A;  1CXU A;  4PA1 A;  5C42 A;  4DF8 A;  1SV5 A;  2PYL A;  3ZSX A;  4CGH A;  2GBZ A;  3LAK A;  1S1U A;  3L2R A;  2AJQ A;  4BDY A;  4ICL A;  3VQ4 A;  4CEQ A;  5J2Q A;  2IAJ A;  4E7I A;  1BCM A;  4BE0 A;  1GOB A;  5KRT A;  3NF8 A;  1FKP A;  4RG8 A;  1RDA A;  4G1Q A;  5CYM A;  3T1A A;  5FDL A;  5JS1 A;  4DFP A;  4KI4 A;  1S9G A;  1BQM A;  4OPJ A;  1T05 A;  3RRH A;  3OYG A;  2YNH A;  3MAQ A;  2DTU A;  3AV9 A;  2LSN A;  3ITH A;  1BIU A;  3PV8 A;  1ASW A;  3P1G A;  4E89 A;  1B92 A;  1ITG A;  4FK2 A;  3NGI A;  3PO5 A;  4OJR A;  1IKX A;  1B9D A;  3L2W A;  4FJI A;  1WSE A;  1RIL A;  3M8S A;  4HHT A;  1ZBH A;  3DLR A;  3DRR A;  3MXJ A;  2IDO A;  3QNN A;  4QCL A;  1K6Y A;  3L3U A;  5J2M A;  5CZ1 A;  1R0A A;  3PUF A;  5HRS A;  3O4Q A;  4CK3 A;  3O3G A;  1VSI A;  3HPG A;  5HLF A;  1S6P A;  4B9T A;  4KHS A;  5FRM A;  4E3S A;  1C1C A;  4N76 A;  3OYF A;  2XRI A;  2YV0 X;  1KFS A;  4AIL C;  1SL2 A;  5KTQ A;  4ID1 A;  4B8A B;  3VQD A;  4GMJ B;  4KTZ A;  1KVC A;  4RW4 A;  2Q3S A;  5T7B A;  4DSE A;  1HJR A;  3PX4 A;  4C8K A;  1X1P A;  4KTQ A;  1RT6 A;  3VQ9 A;  3SZ2 A;  1HYS A;  4DWI A;  1CLQ A;  1I3A A;  3TWH A;  4AHU A;  4DFJ A;  4GW6 A;  4CGF A;  2G8W A;  4OGE A;  2A1S A;  4NYF A;  4O4G A;  1ASV A;  1VSD A;  3OY9 A;  1WNS A;  4O0I A;  3NF6 A;  3VQP A;  4CGI A;  4J2E A;  1S1V A;  4DTR A;  4FLV A;  2Z1G A;  1TKT A;  3NHG A;  1QE1 A;  3ZSW A;  4ELT A;  2ZQB A;  3OYL A;  4BWJ A;  3ZSO A;  4RW6 A;  3SUP A;  1S1T A;  4E0D A;  4L8R B;  1JXE A;  1RT5 A;  3VQA A;  1NK4 A;  2G8V A;  4N41 A;  2E6M A;  4DFM A;  4O5B A;  4CGD A;  3PX6 A;  4DQP A;  3QIP A;  4AHS A;  1WSH A;  1C0T A;  4ID5 A;  2IOC A;  4Z4H A;  3AO3 A;  4FLY A;  3SUO A;  2W42 A;  4FM1 A;  4DU3 A;  2HND A;  1WSF A;  3HO1 A;  1T8E A;  1D9F A;  3VA3 A;  4DS5 A;  2DFE A;  1HQE A;  1DLO A;  3ASM A;  1X9W A;  4KPY A;  3AO1 A;  3L2V A;  4LSN A;  1TKZ A;  5E41 A;  2X78 A;  3SV4 A;  3DI6 A;  4EP5 A;  1TV6 A;  3KKS A;  2JLE A;  1UA0 A;  3LZJ A;  5EU7 A;  4B9M A;  3RMA A;  1C6V A;  4I9Q A;  4NCB A;  3V81 A;  4E1N A;  1KRP A;  3TAB A;  3NGZ A;  3AVJ A;  4CF0 A;  1D5A A;  4W5T A;  3DLK A;  2KTQ A;  4C8N A;  4CIE A;  1S6Q A;  1QSS A;  4KO0 A;  3OJS A;  5DK5 A;  1JLC A;  4CJS A;  4PY5 A;  4HUG A;  1GOC A;  4DTX A;  1I39 A;  4DTJ A;  4N56 A;  4OKE A;  4AH9 A;  4CEA A;  4FLT A;  3U3Y A;  4O44 A;  2ZD1 A;  3K57 A;  4QAG A;  3VQ8 A;  4LH5 A;  4KKO A;  4CFC A;  3DMJ A;  1U47 A;  1S1W A;  2F96 A;  4CFA A;  4CF2 A;  4B9N A;  3VA0 A;  4KHQ A;  3VQB A;  5K14 A;  3OYE A;  4KHU A;  4KB1 A;  4Z4G A;  4PWD A;  4AHC A;  2Z1I A;  3VQ7 A;  4KFB A;  4CCH A;  4C8M A;  3NDK A;  3V1R A;  1L3V A;  4O55 A;  1RDD A;  1ZBU A;  3HPH A;  5SWM A;  3WNE A;  3K58 A;  2G8H A;  4CIG A;  1ZBL A;  4E7L A;  4CF8 A;  3ZSR A;  3DLE A;  3KK2 A;  4LH4 A;  2B6A A;  3LP0 A;  4HVJ A;  4H4O A;  4FZZ A;  2B5J A;  4CES A;  1VRU A;  4N47 A;  1JLG A;  2OPP A;  4FJG A;  4QOZ B;  4CGG A;  5DMR A;  3DLB A;  1HYV A;  3RTV A;  2P51 A;  2ZE2 A;  3CFR A;  3QLH A;  3HVT A;  2BAN A;  1BCO A;  3HST B;  4IBN A;  4Y1C A;  1Q9Y A;  3SYZ A;  3TAG A;  4DFK A;  1LAW A;  2D5R A;  4DTS A;  3NCI A;  1KFD A;  1O1W A;  5CY4 A;  2BE2 A;  5C24 A;  1TK5 A;  1KLM A;  1L5U A;  4CHP A;  3P83 D;  3IS9 A;  4Z0U A;  1EX4 A;  2QKB A;  3KLE A;  1NK9 A;  3L2U A;  1TK8 A;  4PQU A;  1LWE A;  4ZHR A;  3ZSV A;  1LAV A;  3LAL A;  4CEZ A;  3V4I A;  4PUO A;  4FVM A;  2O4G A;  3HP9 A;  3L8B A;  3KKR A;  3TAN A;  1B9F A;  4N5S A;  4W5N A;  1JL2 A;  3RMB A;  1VSL A;  4FLZ A;  4R5P A;  4I2Q A;  2KFN A;  2P1J A;  2HHW A;  2YNF A;  5HRP A;  4CHN A;  2YHB A;  2IC3 A;  2XY6 A;  3O3F A;  1C1A A;  1VK0 A;  3ZT2 A;  1TKD A;  3I8D A;  4KI6 A;  3HPO A;  4BWM A;  3VQC A;  1DTT A;  3WNG A;  2QKK A;  1Q8I A;  4KAZ A;  1KTQ A;  1HNI A;  5HRO A;  3C95 A;  1FKO A;  4FZX C;  3HP6 A;  3SV3 A;  3B6P A;  2Z1J A;  1TKX A;  4I2P A;  2RN2 A;  3SCX A;  3KD5 E;  5I42 A;  3HL8 A;  4W5R A;  2P5O A;  2FBT A;  4H4M A;  4DSL A;  3JSM A;  3M8Q A;  1WN7 A;  3NE6 A;  2OZS A;  4DSI A;  4K8X A;  4J2B A;  2KW4 A;  4CEB A;  3CM5 A;  2EHG A;  2YKN A;  3DOK A;  3NH1 A;  3HT3 A;  5FRN A;  1JLF A;  1YVU A;  4YFU A;  1SL0 A;  1SUQ A;  2HB5 A;  3SNN A;  1RNH A;  3PY8 A;  1YTU A;  1A5V A;  3OVN A;  2DFH A;  4CF9 A;  1LW2 A;  3NH2 A;  4F2R A;  4BAC A;  4Z4E A;  1QHT A;  2G8K A;  4E1M A;  4IFV A;  1HPZ A;  3ZT1 A;  4C8L A;  4FJM A;  2QK9 A;  4CHZ A;  1C0U A;  3QES A;  2YHA A;  3RRG A;  1FK9 A;  4CEC A;  4GVM A;  3O4N A;  2NUB A;  3KLF A;  3LDS A;  1KVA A;  4B9S A;  1TL1 A;  1YT3 A;  1D9D A;  4I7F A;  2XY5 A;  1KSP A;  3KJV A;  2HVI A;  4M3U A;  4M3X A;  4FLX A;  1QQC A;  2DFF A;  3QO9 A;  3OJU A;  4LY7 A;  4OKJ A;  1UA1 A;  1SKR A;  4J2A A;  3QER A;  1WAF A;  3QEX A;  2HHX A;  1BQN A;  3SUN A;  3CM6 A;  1WSI A;  2HHV A;  3DRP A;  3TAM A;  2OZM A;  3F9K A;  1RT4 A;  3SUQ A;  4DSK A;  3KIO A;  1MU2 A;  4M3W A;  4FYD A;  4FJ8 A;  1RTH A;  3V1Q A;  3V9U A;  4FXD A;  3SPY A;  4B9V A;  3PO4 A;  1XHX A;  3AVF A;  1A5W A;  3C94 A;  3JYT A;  2DY4 A;  1U49 A;  3I0R A;  1JLQ A;  3QIO A;  4F3O A;  3OYB A;  3RWU A;  3ZSQ A;  4HUE A;  2XHB A;  4CFD A;  2G8F A;  4ZTF A;  3ZSZ A;  4MQ3 A;  4CK1 A;  2QXF A;  4KHY A;  1NK6 A;  1VSE A;  3DOL A;  1XWL A;  3NFA A;  1REV A;  1Y97 A;  2IS3 A;  1F21 A;  3V6D A;  4OLA A;  3D45 A;  4CJ5 A;  4FJH A;  1A5X A;  5C25 A;  4FJ7 A;  4B3O A;  3DM2 A;  1W0H A;  1J9A A;  3SI6 A;  5SZT A;  1WSG A;  4JRQ A;  4M3Y A;  1S9E A;  4HCC A;  3CYM A;  4FJ9 A;  3SQ1 A;  4NCG A;  3SJJ A;  4DMN A;  4JS5 A;  4DTU A;  2D0A A;  4HCB A;  2OPQ A;  2I5J A;  3NAE A;  4W5O A;  2D0C A;  4DU1 A;  3SPZ A;  4OVL A;  1N6Q A;  3K5M A;  4DQI A;  1VRT A;  4KHN A;  1GOA A;  4MFB A;  3OYK A;  3G10 A;  4B8C A;  4FW1 A;  1NK5 A;  3L2Q A;  4EZ9 A;  3MXM A;  1W9H A;  3CG7 A;  3OYI A;  4RW9 A;  1VSK A;  1X9S A;  1QSL A;  4HUF A;  4YNQ A;  5FRO A;  4NYN A;  1HRH A;  4JLH A;  3V9X A;  3I0S A;  2VWK A;  1YTA A;  2O4I A;  2GV9 A;  3K2P A;  3DLH A;  1D8Y A;  3E01 A;  3HJF A;  1J5O A;  3VQ5 A;  3AO2 A;  3OS2 A;  4DQR A;  4DQQ A;  3WNF A;  1RT2 A;  3AA4 A;  1J54 A;  1JLA A;  3FFI A;  4IG3 A;  3SQ0 A;  4LD0 A;  3EZ5 A;  3C6U A;  1C0M A;  3IRX A;  2XY7 A;  1VSM A;  4DU4 A;  2PY5 A;  3L3V A;  4O0J A;  5KI6 A;  2XO7 A;  3KLH A;  3EYZ A;  4FLU A;  4DS4 A;  1L3T A;  3S3M A;  4F8R A;  4DQS A;  2VG7 A;  2WON A;  4Z4C A;  4CEF A;  1J53 A;  4KRE A;  1BGX T;  3V9S A;  4BE2 A;  1U45 A;  3LP1 A;  4DSJ A;  3ALY A;  4JRP A;  4E7H A;  3ZT3 A;  4DF4 A;  3OYN A;  3AVL A;  3TAQ A;  2B4J A;  4CEO A;  2HNY A;  1RBU A;  3K5O A;  2HVH A;  3K5N A;  4FW2 A;  4CE9 A;  2Y1J A;  1IKW A;  3LZI A;  3TAP A;  3M8R A;  4DTN A;  4F4K A;  3AVG A;  3AVH A;  4FJL A;  2D0B A;  1JLE A;  1TGO A;  3B6O A;  3NF7 A;  3LPU A;  4CJR A;  1U4B A;  2Z1H A;  1T7P A;  1IKV A;  4KV8 A;  2OA8 A;  1BL3 A;  1SKS A;  4M3Z A;  4B9L A;  4WE1 A;  4CER A;  2OPS A;  1SL1 A;  4DLE A;  2RKI A;  1EET A;  5HP1 A;  1RT3 A;  3AVK A;  3P5J A;  3V9Z A;  1JL1 A;  5HBM A;  4DG1 A;  3WNH A;  1WLJ A;  1G15 A;  4CHO A;  4XIU A;  1NKC A;  3HVR A;  4CEE A;  2KQ2 A;  1RBT A;  1TL3 A;  4FJK A;  2PYJ A;  4AHT A;  3TR8 A;  2X6N A;  1XC9 A;  2FC0 A;  4H8K A;  4M3T A;  1NJZ A;  3V1O A;  4E7J A;  3LAN A;  3LWM A;  4KRF A;  3KTQ A;  4Q0B A;  3NBP A;  1RBR A;  2HHT A;  1C1B A;  3NGY A; 
#chains in the Genus database with same CATH topology
 2VG6 A;  4BC4 A;  4Z4F A;  3SQ2 A;  5KRS A;  4RCH A;  1CXQ A;  3ATV A;  4X62 K;  3OBW A;  4GY2 B;  3EE9 A;  4CBX A;  4JK8 A;  2P5G A;  4HTL A;  3QEV A;  5H1S Q;  2HNZ A;  1UOC A;  3MX5 A;  4M7X A;  4CED A;  1YJN N;  4KH6 A;  4M3R A;  1NJY A;  2KFZ A;  3LM2 A;  4BRO A;  3I56 N;  3ZT0 A;  4L3Q A;  1U04 A;  5FPD A;  1NGG A;  3LL3 A;  4C8O A;  5LMU K;  2O8F A;  4DB3 A;  5D3G A;  2P9K B;  5HRN A;  1ZBI A;  4BE1 A;  1UWB A;  3C7N A;  1X3N A;  4JV5 K;  3D0P A;  4LF4 K;  2A1R A;  2HMI A;  1OKJ A;  1VSF A;  4OPK A;  3AA5 X;  3CQY A;  1XUP O;  4M42 A;  4M41 A;  4CHQ A;  3SJH A;  2ETJ A;  5J1E A;  2PAV A;  2EWS A;  1HNV A;  4RW7 A;  5MLC Q;  1KD1 O;  1YXQ A;  2FBV A;  2Y1I A;  1NK8 A;  2OCE A;  1VQM N;  1WAJ A;  4CJU A;  4DR7 K;  3CJA A;  4CIF A;  4A2A A;  1VSH A;  2HHQ A;  3V9W A;  4M7Y A;  3G71 N;  4IFY A;  3S3O A;  1QVF M;  2HHS A;  3EO3 A;  5JLH A;  3D7E O;  1SQK A;  3CIP A;  3LAM A;  1HR0 K;  3ZEU A;  2WOM A;  3P31 A;  3K5L A;  3VN5 A;  4AHR A;  2HOE A;  1KAX A;  3F73 A;  1CZB A;  1U2V B;  2A3Z A;  3J7Y P;  2OPR A;  4FZY A;  3MED A;  1TYQ B;  2J4R A;  1NJX A;  3HK2 A;  2RPI A;  4JI7 K;  3KLI A;  1RTJ A;  4IWV A;  4JS4 A;  1XHZ A;  1LV5 A;  4NCA A;  3RR8 A;  1C0G A;  2BGG A;  5BR9 A;  4M45 A;  1HYZ A;  3ZCM A;  4HTU A;  1IKY A;  4UQG A;  4FK4 A;  4BDZ A;  1ZXO A;  5C42 A;  1SV5 A;  4CGH A;  5M1K A;  2WTU A;  4GV9 A;  2D1K A;  3KZB A;  3MWP A;  5KPT A;  3M3Z A;  5F2R A;  3NF8 A;  1VAZ A;  1RDA A;  2YJE A;  2Q97 A;  5GAG P;  2FF6 A;  1BQM A;  2NNW A;  2YNH A;  3AV9 A;  2LSN A;  4R79 A;  3ITH A;  4E89 A;  3P38 A;  1ITG A;  1B9D A;  4FJI A;  1WSE A;  4HHT A;  1ZBH A;  3DLR A;  1K73 O;  1K6Y A;  5AR0 A;  4GV6 A;  4JKG A;  5CZ1 A;  1R0A A;  3PUF A;  3O80 A;  4BR7 A;  4B9T A;  1S6P A;  3D2F A;  4LFA K;  1C1C A;  4CD3 A;  5KTQ A;  3VQD A;  4GMJ B;  3CCE N;  4DSE A;  4DR3 K;  2V52 B;  3TTD A;  1NMD A;  5E84 A;  1T44 A;  4DFJ A;  1HNZ K;  2P9U B;  4O4G A;  3OY9 A;  4J2E A;  1WNS A;  2PBD A;  3NF6 A;  3VQP A;  5EVZ A;  4DTR A;  3ENO A;  4JKF A;  4FPA A;  2YHX A;  3SUP A;  4E0D A;  1S1T A;  2O8C B;  1HLU A;  1NK4 A;  1EWQ A;  2E6M A;  4DFM A;  3H45 C;  3VET A;  4CBU A;  4CZG A;  2IOC A;  4CW7 B;  1WSF A;  1GLC G;  4UY8 O;  1X9W A;  1HQE A;  5FPN A;  3H6E A;  2QWQ A;  2HF3 A;  2X78 A;  2O8D B;  5AZJ A;  1NG9 A;  3KKS A;  4B9M A;  1XQS C;  4H0P A;  1BUP A;  4RWT A;  1EO1 A;  1YI2 N;  3AVJ A;  4CF0 A;  1D5A A;  3BY5 A;  4FWM A;  4W5T A;  5EOY A;  1OH7 A;  1JJ2 M;  4FWL A;  2V7Y A;  4CIE A;  5FPE A;  4CZI A;  3OJS A;  4CZK A;  4CJS A;  4A5B A;  4XEI A;  4PY5 A;  3HBT A;  4HUG A;  4BRI A;  2WC9 A;  3THW B;  2ZD1 A;  2RE2 A;  3VQ8 A;  4CFC A;  4KHQ A;  1S1W A;  2F96 A;  2W6K A;  4CF2 A;  3D2E B;  5K14 A;  4KHU A;  3CCS N;  3VQ7 A;  4DUZ K;  2AA4 A;  1RDD A;  3K58 A;  3WNE A;  3SMP A;  1ZBL A;  3WEE A;  3ZSR A;  3HI0 A;  4H4O A;  2RHK A;  2B5J A;  4N47 A;  3A5M C;  5CE3 A;  1BCO A;  4LC9 B;  2IVP A;  3TAG A;  4LFB K;  1O1W A;  5CY4 A;  4I6M A;  4JN4 A;  2BE2 A;  3VES A;  3O5B A;  1IV0 A;  3AY9 A;  1NK9 A;  3L2U A;  1LWE A;  4CEZ A;  2O4G A;  2QXL A;  4GV3 A;  2E8A A;  1VSL A;  4LF5 K;  3T1Y K;  4FLZ A;  4I2Q A;  2HHW A;  2YNF A;  5FLX O;  1RFQ A;  1C1A A;  3ZT2 A;  3HPO A;  4BWM A;  1DEJ A;  4DV7 K;  2P9N B;  1VQN N;  3B6P A;  5KQ8 A;  5I42 A;  2P5O A;  2FBT A;  4H4M A;  4K0K K;  5EX5 A;  3NE6 A;  4DSI A;  4K8X A;  4J2B A;  4CEB A;  5C2F A;  3CM5 A;  4XH1 A;  3HT3 A;  1JLF A;  1YVU A;  2VCP A;  1E3M A;  2HB5 A;  3J7A P;  4K42 A;  4FOI A;  1YTU A;  3NH2 A;  4CF9 A;  1LW2 A;  3VF2 A;  1QHT A;  2G8K A;  3FFK B;  3ZT1 A;  1C0U A;  3RRG A;  1VQ6 N;  4CEC A;  3KLF A;  5BRE A;  3U4L A;  1KVA A;  1TL1 A;  1D9D A;  2VGM A;  3B8A X;  1KSP A;  2ASO A;  3DXM A;  2DFF A;  4FWP A;  1V4T A;  1SKR A;  3I55 N;  3QER A;  4WQ5 C;  1HX1 A;  3DRP A;  3TAM A;  4B1X B;  1RT4 A;  4M3W A;  1VQL N;  4B1U B;  3V9U A;  4EHU A;  3SPY A;  4B9V A;  3JYT A;  4DR6 K;  3VER A;  3I0R A;  4H0V B;  2P9L A;  4F3O A;  3RWU A;  4H0T B;  3PSF A;  3ZSQ A;  4KH5 A;  3MCA B;  4MQ3 A;  4CK1 A;  4KHY A;  1NK6 A;  1VSE A;  3O9U A;  3NFA A;  1W97 L;  1REV A;  3N4P A;  2D0P A;  3BF3 A;  4FJH A;  1D4X A;  1W0H A;  1J9A A;  4M3Y A;  2D4W A;  3EE8 A;  2BUP A;  4H0X B;  2P9S B;  4NCG A;  4DMN A;  2D0C A;  4OVL A;  4KHN A;  4GNI A;  1VRT A;  3G10 A;  4FW1 A;  3L2Q A;  4BY9 C;  2GWJ A;  3ZLJ A;  2KLA A;  3VEY A;  1X9S A;  1QSL A;  5HL7 L;  3I0S A;  2HHH K;  1Q82 O;  4IZ9 A;  5AQM A;  3HJF A;  4BRM A;  3K0S A;  1T6D A;  4DQR A;  2ZJQ L;  3C6A A;  3WNF A;  1RT2 A;  3OA9 A;  1J54 A;  2UYT A;  4IG3 A;  3SQ0 A;  1C0M A;  3SAF A;  4DU4 A;  4O0J A;  2XO7 A;  4DS4 A;  1L3T A;  4CEF A;  4BQZ A;  2D0O A;  2ITM A;  3AVL A;  3TAQ A;  4CEO A;  1RBU A;  4CE9 A;  2Y1J A;  3LZI A;  2O8B B;  3AVH A;  1JLE A;  3NF7 A;  4M3Z A;  1IKV A;  1SL1 A;  2JWL A;  4JHD B;  5HP1 A;  3V9Z A;  1JL1 A;  4DG1 A;  1WLJ A;  3J7Z O;  3A5N C;  4HWI A;  4JI8 K;  4FWK A;  1TL3 A;  3LDN A;  4CJ7 A;  4RTF D;  3TR8 A;  1VQ7 N;  1HNX K;  3G25 A;  4B9Q A;  4E7J A;  3LAN A;  3GE1 A;  4A5A A;  1NGF A;  5LMN K;  3HYF A;  4DR4 K;  3L4I A;  5ADX A;  3VF6 A;  3QFU A;  3SK3 A;  4CBW A;  1JKH A;  3VOV A;  4IOA L;  1FXX A;  1U48 A;  3LDP A;  4JYA K;  1NM1 A;  4IJA A;  1BIS A;  3OYH A;  3J8A A;  1KCF A;  3PIP L;  4BGB A;  3CC4 N;  3C6T A;  2BTF A;  1IG9 A;  4CJT A;  3RMC A;  4ZTJ A;  4Z94 A;  4TSX A;  3IAY A;  4CVN E;  3NH0 A;  4FOE A;  3U6F A;  1JXB A;  2X74 A;  3PIO L;  3OYD A;  3AVN A;  1NGJ A;  4Y0W A;  4IEE A;  5CR4 A;  4GKK K;  3LPT A;  1KAY A;  1ZYQ A;  3L6Q A;  3LDL A;  3E66 A;  1RCH A;  2BDP A;  5A2Q O;  5AQF A;  3H08 A;  3OYM A;  4CJW A;  3RSE A;  2ZJR L;  1EKE A;  3HM9 A;  2G8I A;  4LFC K;  3K59 A;  2X6S A;  3H3N O;  4FCY A;  1TUY A;  2BH1 A;  1CZ9 A;  4FM2 A;  2ITG A;  1N5Y A;  3AVM A;  5GAH P;  1DGK N;  4FSV A;  2KZM A;  1JCF A;  3TPQ A;  3QEI A;  3VTI A;  1RT7 A;  4BDP A;  4OLB A;  2VWJ A;  3TAR A;  2HF4 A;  1BI4 A;  4FLW A;  4ILH A;  2F8S A;  3ISN C;  4CJQ A;  4BR2 A;  4MDA A;  2EX3 A;  3EY1 A;  1M1K O;  4FWQ A;  3DLL L;  1TAU A;  3LM9 A;  3OS0 A;  3K9K A;  5F0X A;  3LWL A;  3QFP A;  5JLF A;  3MEE A;  4YHH K;  1RBS A;  2VQE K;  2YHY A;  4BRE A;  4I9L A;  4B3T K;  3EEQ A;  1KAZ A;  3AO5 A;  1RDC A;  4CFB A;  4LF7 K;  4BRG A;  3CCL N;  4KHW A;  2VG5 A;  5CYQ A;  1Q86 O;  4U67 L;  2QWN A;  3O3H A;  4A59 A;  2GEL A;  4MDB A;  1TK0 A;  4K8Z A;  3W3D A;  3G0Z A;  3M6G A;  5AQG A;  4Z4I A;  3OS1 A;  4F3T A;  5IWA K;  3S9H A;  2E6L A;  1XMO K;  5J2N A;  1JLB A;  3AVA A;  2GX9 A;  3HOS A;  2HHU A;  4DV6 K;  4CJP A;  3THX B;  3ATU A;  1LWF A;  2JGU A;  3L4Q A;  4CK2 A;  1DTQ A;  2P9P B;  3ZX2 A;  1ATN A;  5AQX A;  3U9D A;  2CGL A;  4PA1 A;  4DF8 A;  2Q0R A;  3JS6 A;  3ZSX A;  2AJQ A;  4FWR A;  4ICL A;  4NLC A;  3DWL A;  3VQ4 A;  1R59 O;  5AFU H;  5J2Q A;  3U9Z A;  4FWS A;  1S22 A;  5AQT A;  1GOB A;  4YOY A;  3IMX A;  5FDL A;  5JS1 A;  3R1X A;  3WEE B;  3MAQ A;  1BIU A;  3PV8 A;  5AZI A;  1OH8 A;  4FK2 A;  2O8E B;  3TSP A;  4K25 A;  3ULE A;  5C10 A;  2QTD A;  1RIL A;  3M8S A;  2A6A A;  2IDO A;  4DUY K;  3QNN A;  3MMV A;  3CME N;  2UUA K;  2QWL A;  3ZX0 A;  5HRS A;  3O4Q A;  3O3G A;  3LDO A;  3ZX3 A;  4N76 A;  3OYF A;  2XRI A;  2YV0 X;  1RDU A;  4ID1 A;  2HMP A;  4RW4 A;  4C8K A;  1RT6 A;  4DWI A;  1I3A A;  3WQT A;  1GLA G;  1TUU A;  4GW6 A;  4XH5 A;  4CGF A;  3SMS A;  4PHT X;  1IBM K;  2G8W A;  4OGE A;  4NYF A;  1DKG D;  4O0I A;  5LJV A;  3TSQ A;  2WFB A;  1M90 O;  2NRW A;  2Z1G A;  1FJG K;  4A62 A;  1ATR A;  3MN7 A;  3O1W A;  4ELT A;  4RW6 A;  3QBX A;  3Q7B A;  3VQA A;  4BC5 A;  4F9O A;  3DXK B;  5BN9 A;  2G8V A;  4N41 A;  3FZK A;  4O5B A;  4CGD A;  3OHR A;  1W2B M;  3A0I X;  3QIP A;  1WSH A;  1C0T A;  4C23 A;  4FM1 A;  2HND A;  3VA3 A;  2DFE A;  4KPY A;  3L2V A;  3SV4 A;  2P9I A;  3DI6 A;  2F9T A;  3LZJ A;  3CC7 N;  4NCB A;  3KWI A;  1KRP A;  1Q81 O;  3DLK A;  2KTQ A;  4C8N A;  4X64 K;  1S6Q A;  3EN9 A;  3JXU A;  4KO0 A;  1W7A A;  5AFU A;  5GAD P;  4IEI A;  4BC3 A;  3R6M A;  2VYP A;  1I39 A;  4DTJ A;  4N56 A;  1XNR K;  4FWO A;  4QAG A;  5TKW A;  3SAH A;  4B9N A;  4O8K A;  2Z1I A;  4KFB A;  4CCH A;  4O55 A;  3OTO K;  1NGE A;  4CIG A;  5AQU A;  3C65 A;  3U8X A;  2VWB A;  4E7L A;  4H5V A;  3O9R A;  3VEX A;  2HST A;  3M1F A;  2NRH A;  2A40 A;  1JLG A;  4QS9 A;  4QOZ B;  1LCU A;  4CZF A;  3HVT A;  3HST B;  4IBN A;  5KPR A;  2A41 A;  4NXM K;  4DFK A;  1OVY A;  1LAW A;  1KFD A;  1KLM A;  1YF5 L;  4CHP A;  1L5U A;  3K9J A;  3P83 D;  5F1X A;  5LY3 A;  1N8R O;  4K43 A;  3LAL A;  3V4I A;  4FVM A;  2Q0U A;  3L8B A;  3KKR A;  3TAN A;  4MLE A;  4W5N A;  1FW6 A;  3CCR N;  4JD2 B;  4CI6 A;  2IC3 A;  1VK0 A;  3CHW A;  4KI6 A;  3C0B A;  3WNG A;  4DKW A;  4KAZ A;  5AQV A;  1FKO A;  4FZX C;  3HP6 A;  4BRF A;  2Z1J A;  4IOC L;  2E20 A;  4GKJ K;  1TKX A;  2RN2 A;  3EZW A;  3TTF A;  5GIO A;  1NGI A;  2KW4 A;  5FRN A;  3DAW A;  1SL0 A;  4AM6 A;  5TKY A;  1ZBS A;  3SNN A;  4FVU A;  4B3S K;  3OVN A;  4PKH A;  2DFH A;  4F2R A;  4E1M A;  4FJM A;  1X3M A;  4CD1 A;  3QES A;  4YDU C;  2W6L A;  3CCU N;  3O4N A;  2NUB A;  3LDS A;  3O4W A;  4B9S A;  2IVN A;  1ILY A;  1N34 K;  5AQL A;  1ATS A;  1QQC A;  3QO9 A;  4FLX A;  1UA1 A;  4OKJ A;  3CD6 N;  1WAF A;  1BQN A;  1VQ8 N;  3VEO A;  5C12 A;  3T69 A;  1Z6R A;  3KIO A;  3AGR A;  1RTH A;  3V1Q A;  3AVF A;  4WCE L;  1U49 A;  1K8K A;  3KK7 A;  3UKR B;  5JIC A;  4J8F A;  2XHB A;  4CFD A;  3FZF A;  5BN8 A;  3FE1 A;  3GDQ A;  2AP1 A;  1F21 A;  3D45 A;  4BR5 A;  4DR2 K;  2E2N A;  1QZ5 A;  4QS8 A;  5SZT A;  1WSG A;  4FJ9 A;  3SJJ A;  4WFN L;  3WT0 A;  5I9E B;  2I5J A;  3MCP A;  2CH6 A;  3DLH A;  1J6Z A;  4BRQ A;  3K5M A;  2KKZ A;  1GOA A;  4MFB A;  3OYK A;  3IKM A;  3MXM A;  1W9H A;  1VSK A;  4YNQ A;  4NYN A;  4JLH A;  3V9X A;  2VWK A;  3G6E N;  5CHI A;  2GV9 A;  1IBK K;  4KHP K;  3K2P A;  1VQ9 N;  1D8Y A;  3E01 A;  4BR4 A;  4FPB A;  3A5O C;  3A8Y A;  1H1V A;  4BVP A;  4DQQ A;  1TKD A;  3CJ7 A;  1JLA A;  3EZ5 A;  3EYZ A;  5LL6 Z;  3S3M A;  2HBM A;  4DQS A;  2VG7 A;  2QEX N;  1J53 A;  1BGX T;  1U45 A;  3LP1 A;  4JRP A;  3FLC O;  3ZT3 A;  4B3M K;  3K5O A;  5C15 A;  1IKW A;  3M8R A;  5BPL A;  5GIN A;  3TTC A;  3N4Q A;  3O1B A;  3FZL A;  2KHO A;  4BRH A;  3LPU A;  1U4B A;  2OA8 A;  3THY A;  1BL3 A;  2NRX A;  4WE1 A;  4CER A;  1EET A;  3WXJ A;  4DV3 K;  1IG8 A;  2GWK A;  1NMN A;  4FJK A;  5M1P A;  1XC9 A;  4H8K A;  1NJZ A;  2IIR A;  4Q0B A;  3ENH A;  2NLX A;  3E1Y A;  1C1B A;  4A61 A;  1RTI A;  1HKB A;  1NK7 A;  1QVG M;  3T19 A;  3WUH A;  2P9K A;  4JKE A;  2YNI A;  1OH5 A;  4ELV A;  4NB4 A;  5LJW A;  3MN5 A;  3KLG A;  1HMV A;  4FJJ A;  3BF1 A;  1QZ6 A;  2V7Z A;  4IO9 L;  3S3N A;  3U3G A;  3DLG A;  2E1Y A;  4CZM A;  4DSF A;  4CF1 A;  3ZET B;  3UKU A;  5KGX A;  4DV0 K;  2FSN A;  5AQY A;  4IDK A;  5CZ2 A;  3O6W A;  5I3U A;  5BRH A;  4J2D A;  4OGC A;  2E88 A;  4IKF A;  3SBT A;  1HNW K;  3VEV A;  1NKB A;  1LW0 A;  3DYA A;  4E1J A;  3CPW M;  2GUP A;  2I7P A;  5JMV A;  2OTL N;  4EFH A;  3CMA N;  4JK9 A;  2V51 B;  4ILG B;  3MXI A;  4FK0 A;  4FJX A;  1NK0 A;  4DV1 K;  4FJ5 A;  3AA3 A;  4E7K A;  5ADX H;  4IG0 A;  3F5T A;  4DV5 K;  4B08 A;  3DRS A;  3P4I A;  4OKK A;  2FLO A;  4MO4 A;  2HW3 A;  2CH5 A;  4C1N I;  3QIC A;  3THV A;  1HUX A;  1QSY A;  2FBX A;  1U2V A;  4YOT A;  1K9M O;  3BZC A;  1TYQ A;  1ZBF A;  4CJK A;  5DM6 L;  3KK1 A;  2O8F B;  4AQY K;  3CXC M;  1X9M A;  3MWT A;  4JKB A;  3C7N B;  2GEM A;  2FBY A;  3VEZ A;  1NGA A;  3AAR A;  1T6C A;  1RTD A;  4WYB A;  3AA2 A;  5AQS A;  2QWP A;  2Q1N A;  2G8U A;  3KWG A;  4YOW A;  3BGR A;  3F2K A;  1ASU A;  4ISE A;  3A2F A;  4EP4 A;  2QW9 A;  3KD1 E;  3ZSY A;  3KK3 A;  3QNO A;  4YY3 K;  1RBV A;  3H3O B;  1S1X A;  3NMU A;  1IH7 A;  2E1Z A;  4LF9 K;  5AQK A;  1MWK A;  4CJE A;  3QET A;  4ELU A;  4CHY A;  4JKC A;  2RF2 A;  4W5Q A;  1EQY A;  4YOU A;  3MEC A;  4KTW A;  3LP2 A;  3M8P A;  4H03 B;  3IDH A;  3FZM A;  2ASP A;  4RW8 A;  1YHQ N;  2GUI A;  4PL8 A;  4FM0 A;  1XMQ K;  4DR1 K;  3ZEU B;  2ZJP L;  1SKW A;  3VQE A;  4BC2 A;  3WXI A;  1VQO N;  1NKE A;  4IDH A;  4F2S A;  2YKM A;  3RMD A;  2PYL A;  2GBZ A;  3LAK A;  1S1U A;  3L2R A;  4BDY A;  3AAP A;  3CET A;  1SZ2 A;  4E7I A;  1BCM A;  4BE0 A;  5KRT A;  2CGJ A;  1FKP A;  2QWR A;  4RG8 A;  4G1Q A;  5CYM A;  4DFP A;  4KI4 A;  2HBJ A;  3BEX A;  2P9U A;  3RRH A;  3OYG A;  1ASW A;  1B92 A;  3GBT A;  5AQH A;  5BR8 K;  4YOV A;  4OJR A;  1IKX A;  5BRF A;  3DRR A;  3QB0 A;  3L3U A;  5J2M A;  4BRP A;  2O8C A;  4CK3 A;  5HLF A;  1VSI A;  3BZK A;  4KHS A;  5FRM A;  4E3S A;  3CCV N;  1SL2 A;  4B8A B;  4KTZ A;  4JI1 K;  5T7B A;  3PX4 A;  1QQM A;  4KTQ A;  1HYS A;  3VQ9 A;  3SZ2 A;  3TWH A;  3SAG A;  3TU5 A;  1WB9 A;  1ASV A;  4OO1 J;  2O8D A;  4CGI A;  1S1V A;  5M1F A;  4FLV A;  4JNE A;  4JEP A;  4A57 A;  3NHG A;  1QE1 A;  1RDW X;  1KXP A;  3ZSW A;  2ZQB A;  4JKG B;  3VEW A;  3D2F B;  4DQP A;  3JAM O;  3CJ9 A;  4AHS A;  1MWM A;  4ID5 A;  3THW A;  3SUO A;  4FLY A;  3HTV A;  2W42 A;  3HO1 A;  3D2E A;  1D9F A;  4DS5 A;  1DLO A;  1S3X A;  2FSK A;  1TKZ A;  5E41 A;  4MO5 A;  1TV6 A;  5EU7 A;  4I9Q A;  4BG8 A;  4KBO A;  3V81 A;  5C2D A;  1QSS A;  4WQ4 A;  3CER A;  5DK5 A;  3VTH A;  3NVM A;  1GOC A;  4DTX A;  3ZYY X;  4OKE A;  4CEA A;  3U3Y A;  3K57 A;  1VQK N;  4CFA A;  1BOT O;  1CZA N;  2ZGZ A;  3WQU A;  3VA0 A;  4Z4G A;  4C8M A;  1L3V A;  3HPH A;  5SWM A;  2G8H A;  1NGD A;  5AZJ B;  3BUZ B;  2B6A A;  4DCH A;  1GLL O;  2W41 A;  2DPN A;  2OPP A;  3C6H A;  2ZWH A;  5DMR A;  4CGG A;  1HYV A;  2P51 A;  2P9N A;  5GIP A;  2UXB K;  4Y1C A;  2D5R A;  4DV2 K;  4WFA L;  5C24 A;  1TK5 A;  4H5R A;  4Z0U A;  3IS9 A;  3VMF B;  1EX4 A;  2QKB A;  3KVG A;  1TK8 A;  4ZHR A;  3ZSV A;  1ESV A;  4PUO A;  4MLH A;  4JI3 K;  1YJ9 N;  1JL2 A;  4R5P A;  2KFN A;  1NGB A;  2WUS A;  5HRP A;  4WQ5 A;  2XY6 A;  3VQC A;  3FGU A;  5HRO A;  3C95 A;  4WFB L;  3SV3 A;  1NU0 A;  4JKD A;  3HSC A;  3FR0 A;  4I2P A;  3WXL A;  3SCX A;  2E2Q A;  3HOT A;  4I6M B;  3HL8 A;  4DSL A;  1GLE G;  3M8Q A;  1WN7 A;  1NJI O;  4IJN A;  4V19 S;  2YKN A;  3CCQ N;  4YFU A;  1SUQ A;  4BAC A;  3EL2 A;  3THY B;  4IFV A;  1HPZ A;  4C8L A;  2QK9 A;  2YHA A;  1YT3 A;  4I7F A;  3R8E A;  2XY5 A;  3KJV A;  2HVI A;  3UE5 A;  1YAG A;  3OJU A;  3H1V X;  4J2A A;  2FF3 B;  3EKU A;  4K41 A;  1WSI A;  2P9S A;  4XH4 A;  3SUQ A;  4FYD A;  1MU2 A;  4FJ8 A;  4FXD A;  3PO4 A;  1XHX A;  3C94 A;  2DY4 A;  4BGA A;  2NRV A;  5AQI A;  1QQN A;  3OYB A;  2G8F A;  4PL7 A;  3UKU B;  2IS3 A;  3DXM B;  3V6D A;  3T7Z A;  4CJ5 A;  3R9P A;  4FJ7 A;  4B3O A;  3DM2 A;  4QS7 A;  1BG3 A;  3SI6 A;  4JRQ A;  1S9E A;  4HCC A;  3GOI A;  3CYM A;  3P39 A;  5AQZ A;  4JS5 A;  2D0A A;  4DTU A;  4HCB A;  2OPQ A;  4DU1 A;  3NAE A;  4W5O A;  1N6Q A;  3SPZ A;  4DQI A;  1LOT B;  3CG7 A;  4RW9 A;  2P9L B;  5B8H A;  4LF8 K;  5FRO A;  1X9J A;  1GLB G;  1HRH A;  2O8B A;  5IT9 O;  2O4I A;  5BPM A;  4IO8 A;  4JHD A;  1J5O A;  3AAQ A;  3AO2 A;  3OS2 A;  2FSJ A;  3AA4 A;  4EHT A;  3FZH A;  1VSM A;  3L3V A;  4FLU A;  5KI6 A;  4F8R A;  4BRA A;  3KLH A;  4BE2 A;  4JAX A;  1OH6 A;  3QDK A;  4BRD A;  3W0L A;  4DSJ A;  2YHW A;  3ALY A;  4WF9 L;  4E7H A;  3OYN A;  1QHA A;  2HNY A;  4H5T A;  4FW2 A;  3TAP A;  5FPM A;  3ENB A;  4DTN A;  4F4K A;  1YIJ N;  2D0B A;  1T7P A;  4CJR A;  4ILJ A;  4KV8 A;  4B1W B;  4B9L A;  3SLC A;  2OPS A;  5KQD A;  1HKG A;  1RT3 A;  3P5J A;  5M1Q A;  5HBM A;  3VGM A;  1G15 A;  4CHO A;  4CEE A;  1VQ4 N;  1RBT A;  5JVH L;  2ZF5 O;  3HRG A;  4H5N A;  4M3T A;  3LWM A;  3NBP A;  1RBR A;  3I8B A;  1MDU B;  3CFP A;  1U6Z A;  1BIZ A;  4QCL A;  1EP4 A;  1WSJ A;  2QI2 A;  3RR7 A;  1BA1 A;  1LWC A;  1K8A O;  1IO2 A;  3QEW A;  4CZE A;  4EAH D;  4FJN A;  3O8M A;  3VQ6 A;  3H1Q A;  3E9L A;  1XI1 A;  3J81 O;  4JI2 K;  2ZGY A;  5AQP A;  5AQJ A;  4CJ4 A;  3MEG A;  4DTP A;  3ID6 A;  1XNQ K;  3F9M A;  4CJV A;  1QTM A;  4BRL A;  4DTO A;  3TAE A;  2IVO A;  1KQS M;  3ZT4 A;  5C0Y A;  3ULD A;  1UAX A;  3CPE A;  5HOO A;  1N32 K;  3OYJ A;  3TI0 A;  1Z26 A;  3BDP A;  3WXM B;  4DTM A;  1Q9X A;  4B9U A;  1RT1 A;  4Q5V A;  4CGJ A;  1L3S A;  3A5L C;  2PZS A;  1QS4 A;  1Z25 A;  4EZ6 A;  2QM1 A;  5KPZ A;  1NJW A;  2QWO A;  3TSU A;  4B1Y B;  3AVB A;  1T03 A;  1JCE A;  3AO4 A;  1XC3 A;  2ATQ A;  2F9W A;  3VF4 A;  1O13 A;  3CF5 L;  5AQN A;  1HPM A;  1TVR A;  4CJL A;  5KGW A;  4CJF A;  1L3U A;  1Q18 A;  1HJO A;  1KVB A;  2XY8 A;  1EXQ A;  2E4L A;  3CCJ N;  3T3F A;  3QEP A;  4KB0 A;  3SQ4 A;  2OYQ A;  3CFO A;  2KZZ A;  3CJB A;  1P8Z A;  1TAQ A;  1DT9 A;  3RSE B;  4JI5 K;  3VPZ A;  3T1H K;  3THX A;  3NF9 A;  2YX6 A;  2YNG A;  3HXM A;  3AVI A;  3CI5 A;  2P9P A;  2VQF K;  3D6R A;  3PX0 A;  4NXN K;  4AHV A;  5JS2 A;  3MN6 A;  3LP3 A;  5HRR A;  1VSJ A;  2YCH A;  3UIQ A;  2F8T A;  2I7N A;  3IFR A;  2Q31 A;  3O9S A;  1KLN A;  2E5L K;  3CQ8 A;  1IJJ A;  4OX9 K;  1BI4 B;  3J80 O;  1HQU A;  2IGI A;  3MDQ A;  3IUC A;  3AVC A;  1NNE A;  3OYC A;  3OYA A;  5J2P A;  1Z05 A;  1NOZ A;  1BHL A;  4LSL A;  1P90 A;  4JKH A;  1NOY A;  4DLG A;  3VQQ A;  3QIN A;  4Y1D A;  1WOQ A;  4E19 A;  2O8E A;  4CJ3 A;  1S5J A;  3IG1 A;  2Q2R A;  3AGK A;  1RDB A;  2JWK A;  4BR0 A;  4DHY A;  4EIA A;  2R7Y A;  3TAF A;  1CXU A;  2H3G X;  3O9Q A;  1BDG A;  4CEQ A;  2OTJ N;  2IAJ A;  2UXC K;  4WQ4 C;  4A2B A;  1N33 K;  4IFE A;  3T1A A;  3OW2 M;  3I33 A;  1S9G A;  3VGK A;  2YJF A;  4OPJ A;  1T05 A;  2F4V K;  2DTU A;  2W40 A;  3P1G A;  1EWR A;  1GLF O;  1N36 K;  2YI1 A;  3NGI A;  2OAN A;  3PO5 A;  4FO0 A;  3L2W A;  1RGI A;  4CZJ A;  3QML A;  3MXJ A;  5DM7 L;  5BPN A;  1VQP N;  3DXK A;  3E9O A;  1NWK A;  3HPG A;  5AQO A;  1KFS A;  4AIL C;  2E2P A;  1KVC A;  4DR5 K;  3VEN A;  2Q3S A;  1HJR A;  1X1P A;  2F7T A;  5AQR A;  1CLQ A;  5BRD A;  4AHU A;  1NGC A;  2UU9 K;  2A1S A;  2HBL A;  1VSD A;  5AZI B;  4BR9 A;  2ASM A;  3HM8 A;  3EKS A;  3ULE B;  2UUB K;  1TKT A;  4DV4 K;  3ID8 A;  3OYL A;  4BWJ A;  3ZSO A;  4L8R B;  1JXE A;  1RT5 A;  4GVE A;  2Q36 A;  3O08 A;  3PX6 A;  1GLD G;  4Z4H A;  3AO3 A;  3GL1 A;  4NLB A;  4DU3 A;  3CQX A;  1T8E A;  3ASM A;  3AO1 A;  5AQQ A;  4LSN A;  3CC2 N;  4EP5 A;  1BWF O;  2JLE A;  1UA0 A;  3RMA A;  1C6V A;  4E1N A;  3E9P A;  3TAB A;  3NGZ A;  4CZH A;  2NZT A;  2ZM6 K;  3R3L A;  3HZ6 A;  1JLC A;  4AH9 A;  4FLT A;  2PFU A;  1ZC6 A;  4O44 A;  4ISF A;  4LH5 A;  4KKO A;  3DMJ A;  1U47 A;  3VQB A;  3OYE A;  4KB1 A;  4PWD A;  4BRN A;  4AHC A;  1OVQ A;  3NDK A;  3V1R A;  1ZBU A;  2P9I B;  4JD2 A;  4CF8 A;  1Q7Y O;  3DLE A;  3KK2 A;  4LH4 A;  2NRZ A;  3LP0 A;  4HVJ A;  4FZZ A;  4CES A;  1VRU A;  1VHX A;  4FJG A;  3DLB A;  4OPH A;  3RTV A;  2ZE2 A;  3CFR A;  3QLH A;  3S41 A;  2BAN A;  4IOX A;  1Q9Y A;  3SYZ A;  4LF6 K;  4DTS A;  3NCI A;  4C1N K;  1KC8 O;  4BQL A;  3BP8 A;  1YUW A;  4BVO A;  3O9T A;  3KLE A;  4O5F A;  4YDU A;  4PQU A;  3Q7C A;  1LAV A;  5M1N A;  4YOX A;  2VGN A;  3HP9 A;  5E26 A;  1B9F A;  4N5S A;  3RMB A;  3L0Q A;  2P1J A;  4JI4 K;  4X65 K;  1S72 N;  2NRR A;  4CHN A;  1C0F A;  2YHB A;  3O3F A;  2FXU A;  2UXD K;  3I8D A;  5AJ3 K;  4AF1 A;  1DTT A;  1Y64 A;  2QKK A;  1Q8I A;  1KTQ A;  1HNI A;  3DJC A;  3KD5 E;  1BU6 O;  5GAE P;  4U7B A;  4W5R A;  2HBK A;  3JSM A;  2OZS A;  1JCG A;  1I94 K;  4OPA A;  2EHG A;  3NH1 A;  3DOK A;  1WBD A;  4G9Z A;  5ELZ A;  1RNH A;  4B1Z A;  4JI6 K;  3PY8 A;  1A5V A;  4Z4E A;  3UKR A;  1YJW N;  4CHZ A;  4AM7 A;  4CZL A;  1FK9 A;  1YIT N;  4GVM A;  2CGK A;  2NRT A;  4ISG A;  3PSI A;  4M3U A;  4M3X A;  4DQ8 A;  4LY7 A;  4FWN A;  3QEX A;  2HHX A;  1T3V A;  3SUN A;  5JVG L;  3G4S N;  4B1V A;  3CM6 A;  3UB5 A;  2HHV A;  4FL9 A;  4YOR A;  2OZM A;  3F9K A;  4DSK A;  1MA9 B;  3CCM N;  4NO7 A;  1BO5 O;  5EXW A;  1SS6 A;  3PLA A;  1A5W A;  1JLQ A;  3QIO A;  3MX2 A;  2QA4 N;  4HUE A;  4X66 K;  4ZTF A;  1GLJ O;  3ZSZ A;  2QXF A;  3KHY A;  4IXC A;  1BA0 A;  2WBN A;  3DOL A;  1XWL A;  1VQ5 N;  4BG9 A;  1Y97 A;  1IBL K;  2GTD A;  3VGL A;  4H0O A;  4OLA A;  1A5X A;  5C25 A;  3CJ1 A;  4BRK A;  1NLV A;  3OBY A;  2UUC K;  3SQ1 A;  1G99 A;  4PKG A;  4B8C A;  1NGH A;  3MN9 A;  1V4S A;  1NK5 A;  4JKA A;  5M1O A;  4EZ9 A;  1K8K B;  3OYI A;  1QQO A;  3H46 O;  4HUF A;  5EY4 A;  3GG4 A;  1YTA A;  4KH4 A;  2QWM A;  3RVC A;  3VQ5 A;  3FFI A;  4LD0 A;  3C6U A;  3IRX A;  2XY7 A;  2PY5 A;  3QBW A;  1E4F T;  2E2O A;  2WON A;  4Z4C A;  1SAZ A;  4KRE A;  3V9S A;  2A42 A;  4H5W A;  4O8U A;  4DF4 A;  3WXK A;  2B4J A;  2A5X A;  2HVH A;  3K5N A;  4B3R K;  1J5E K;  4H0Y B;  4M63 C;  3AVG A;  4FJL A;  3B6O A;  1TGO A;  3CJC A;  2Z1H A;  3NVK A;  4PKI A;  1SKS A;  4DLE A;  1WBB A;  2RKI A;  3AVK A;  3ZET A;  3WNH A;  3MK6 A;  4XIU A;  1NKC A;  3M5R A;  3LDQ A;  4JI0 K;  3HVR A;  1WUA A;  2KQ2 A;  2PYJ A;  4AHT A;  5AQW A;  1HKC A;  2X6N A;  4BRC A;  4JK7 A;  2FC0 A;  3SBG A;  3V1O A;  4KRF A;  1E4G T;  1YVN A;  3KTQ A;  1NBW A;  2HHT A;  3NGY A; 
#chains in the Genus database with same CATH homology
 3HYF A;  3CFP A;  2VG6 A;  1BIZ A;  4Z4F A;  1RTI A;  1EP4 A;  1WSJ A;  3SQ2 A;  5KRS A;  1NK7 A;  3T19 A;  3RR7 A;  1CXQ A;  1LWC A;  1IO2 A;  1JKH A;  2YNI A;  3QEW A;  4ELV A;  1FXX A;  1U48 A;  3KLG A;  4FJN A;  1HMV A;  4FJJ A;  3HK2 A;  3VQ6 A;  1XI1 A;  2P5G A;  3S3N A;  3QEV A;  3U3G A;  1BIS A;  2HNZ A;  3DLG A;  1KCF A;  1UOC A;  3OYH A;  4CED A;  4DSF A;  4CF1 A;  3C6T A;  4CJ4 A;  3MEG A;  4DTP A;  5KGX A;  1IG9 A;  4CJT A;  3RMC A;  4CJV A;  1QTM A;  4DTO A;  4M3R A;  4ZTJ A;  4TSX A;  4IDK A;  5CZ2 A;  5I3U A;  3TAE A;  1NJY A;  3IAY A;  2KFZ A;  4J2D A;  3NH0 A;  4OGC A;  3ZT4 A;  3ULD A;  1UAX A;  4IKF A;  1NKB A;  1LW0 A;  3DYA A;  3U6F A;  3ZT0 A;  1JXB A;  2X74 A;  3OYD A;  3OYJ A;  3AVN A;  3TI0 A;  1Z26 A;  3BDP A;  1U04 A;  3LPT A;  4C8O A;  3MXI A;  1ZYQ A;  4FK0 A;  4DTM A;  5D3G A;  4FJX A;  5HRN A;  1NK0 A;  1ZBI A;  4BE1 A;  1RCH A;  1Q9X A;  1UWB A;  1RT1 A;  4Q5V A;  2BDP A;  4B9U A;  4CGJ A;  4FJ5 A;  1L3S A;  3AA3 A;  4E7K A;  3H08 A;  3D0P A;  2PZS A;  1QS4 A;  1Z25 A;  3OYM A;  4EZ6 A;  2A1R A;  2HMI A;  1NJW A;  1VSF A;  4CJW A;  4IG0 A;  4OPK A;  3AA5 X;  1EKE A;  3AVB A;  3HM9 A;  1T03 A;  4M42 A;  4M41 A;  2G8I A;  4CHQ A;  3AO4 A;  4B08 A;  3DRS A;  3K59 A;  4OKK A;  2ETJ A;  2X6S A;  5J1E A;  2ATQ A;  2HW3 A;  4FCY A;  1HNV A;  4RW7 A;  3THV A;  1CZ9 A;  4FM2 A;  2ITG A;  1TVR A;  2FBV A;  4CJL A;  5KGW A;  3AVM A;  4CJF A;  2FBX A;  2Y1I A;  1NK8 A;  1N5Y A;  1QSY A;  1L3U A;  1WAJ A;  4CJU A;  2KZM A;  1KVB A;  3QEI A;  4BDP A;  1RT7 A;  4OLB A;  4CIF A;  2VWJ A;  3TAR A;  1ZBF A;  4CJK A;  1BI4 A;  2XY8 A;  4FLW A;  3KK1 A;  2F8S A;  1VSH A;  1EXQ A;  2E4L A;  3ISN C;  3T3F A;  2HHQ A;  4CJQ A;  3V9W A;  1X9M A;  2EX3 A;  3EY1 A;  3QEP A;  4KB0 A;  3SQ4 A;  1TAU A;  3OS0 A;  4IFY A;  2FBY A;  3S3O A;  2OYQ A;  3CFO A;  2HHS A;  3LWL A;  2KZZ A;  1TAQ A;  1RTD A;  3AA2 A;  3MEE A;  3LAM A;  3NF9 A;  2YNG A;  1RBS A;  2G8U A;  2WOM A;  3HXM A;  3AVI A;  3K5L A;  3BGR A;  4I9L A;  3VN5 A;  4AHR A;  3PX0 A;  1ASU A;  3A2F A;  4AHV A;  4EP4 A;  5JS2 A;  3KD1 E;  3AO5 A;  1RDC A;  3ZSY A;  4CFB A;  3LP3 A;  5HRR A;  1VSJ A;  3KK3 A;  3F73 A;  1CZB A;  3UIQ A;  4KHW A;  2F8T A;  2VG5 A;  5CYQ A;  3QNO A;  1RBV A;  1KLN A;  1S1X A;  3CQ8 A;  1IH7 A;  2OPR A;  4FZY A;  3MED A;  4CJE A;  3O3H A;  1BI4 B;  1NJX A;  1HQU A;  3QET A;  1TK0 A;  4ELU A;  4K8Z A;  2IGI A;  2RPI A;  3G0Z A;  2RF2 A;  4CHY A;  4W5Q A;  3OS1 A;  3AVC A;  4Z4I A;  3OYC A;  4F3T A;  3KLI A;  3OYA A;  5J2P A;  1NOZ A;  1BHL A;  4LSL A;  1RTJ A;  3MEC A;  4KTW A;  4JS4 A;  1XHZ A;  1LV5 A;  3LP2 A;  3M8P A;  4NCA A;  3S9H A;  1NOY A;  2E6L A;  3RR8 A;  2BGG A;  4RW8 A;  4DLG A;  3VQQ A;  2GUI A;  4M45 A;  5J2N A;  1JLB A;  1HYZ A;  3AVA A;  3QIN A;  4Y1D A;  4FM0 A;  2HHU A;  3ZCM A;  4HTU A;  4CJP A;  4E19 A;  1LWF A;  4CJ3 A;  1IKY A;  1SKW A;  1S5J A;  2JGU A;  3IG1 A;  1DTQ A;  3VQE A;  4CK2 A;  1NKE A;  1RDB A;  4F2S A;  4UQG A;  2YKM A;  3RMD A;  2R7Y A;  4FK4 A;  4BDZ A;  3TAF A;  1CXU A;  4PA1 A;  5C42 A;  4DF8 A;  1SV5 A;  2PYL A;  3ZSX A;  4CGH A;  2GBZ A;  3LAK A;  1S1U A;  3L2R A;  2AJQ A;  4BDY A;  4ICL A;  3VQ4 A;  4CEQ A;  5J2Q A;  2IAJ A;  4E7I A;  1BCM A;  4BE0 A;  1GOB A;  5KRT A;  3NF8 A;  1FKP A;  4RG8 A;  1RDA A;  4G1Q A;  5CYM A;  3T1A A;  5FDL A;  5JS1 A;  4DFP A;  4KI4 A;  1S9G A;  1BQM A;  4OPJ A;  1T05 A;  3RRH A;  3OYG A;  2YNH A;  3MAQ A;  2DTU A;  3AV9 A;  2LSN A;  3ITH A;  1BIU A;  3PV8 A;  1ASW A;  3P1G A;  4E89 A;  1B92 A;  1ITG A;  4FK2 A;  3NGI A;  3PO5 A;  4OJR A;  1IKX A;  1B9D A;  3L2W A;  4FJI A;  1WSE A;  1RIL A;  3M8S A;  4HHT A;  1ZBH A;  3DLR A;  3DRR A;  3MXJ A;  2IDO A;  3QNN A;  4QCL A;  1K6Y A;  3L3U A;  5J2M A;  5CZ1 A;  1R0A A;  3PUF A;  5HRS A;  3O4Q A;  4CK3 A;  3O3G A;  1VSI A;  3HPG A;  5HLF A;  1S6P A;  4B9T A;  4KHS A;  5FRM A;  4E3S A;  1C1C A;  4N76 A;  3OYF A;  2XRI A;  2YV0 X;  1KFS A;  4AIL C;  1SL2 A;  5KTQ A;  4ID1 A;  4B8A B;  3VQD A;  4GMJ B;  4KTZ A;  1KVC A;  4RW4 A;  2Q3S A;  5T7B A;  4DSE A;  1HJR A;  3PX4 A;  4C8K A;  1X1P A;  4KTQ A;  1RT6 A;  3VQ9 A;  3SZ2 A;  1HYS A;  4DWI A;  1CLQ A;  1I3A A;  3TWH A;  4AHU A;  4DFJ A;  4GW6 A;  4CGF A;  2G8W A;  4OGE A;  2A1S A;  4NYF A;  4O4G A;  1ASV A;  1VSD A;  3OY9 A;  1WNS A;  4O0I A;  3NF6 A;  3VQP A;  4CGI A;  4J2E A;  1S1V A;  4DTR A;  4FLV A;  2Z1G A;  1TKT A;  3NHG A;  1QE1 A;  3ZSW A;  4ELT A;  2ZQB A;  3OYL A;  4BWJ A;  3ZSO A;  4RW6 A;  3SUP A;  1S1T A;  4E0D A;  4L8R B;  1JXE A;  1RT5 A;  3VQA A;  1NK4 A;  2G8V A;  4N41 A;  2E6M A;  4DFM A;  4O5B A;  4CGD A;  3PX6 A;  4DQP A;  3QIP A;  4AHS A;  1WSH A;  1C0T A;  4ID5 A;  2IOC A;  4Z4H A;  3AO3 A;  4FLY A;  3SUO A;  2W42 A;  4FM1 A;  4DU3 A;  2HND A;  1WSF A;  3HO1 A;  1T8E A;  1D9F A;  3VA3 A;  4DS5 A;  2DFE A;  1HQE A;  1DLO A;  3ASM A;  1X9W A;  4KPY A;  3AO1 A;  3L2V A;  4LSN A;  1TKZ A;  5E41 A;  2X78 A;  3SV4 A;  3DI6 A;  4EP5 A;  1TV6 A;  3KKS A;  2JLE A;  1UA0 A;  3LZJ A;  5EU7 A;  4B9M A;  3RMA A;  1C6V A;  4I9Q A;  4NCB A;  3V81 A;  4E1N A;  1KRP A;  3TAB A;  3NGZ A;  3AVJ A;  4CF0 A;  1D5A A;  4W5T A;  3DLK A;  2KTQ A;  4C8N A;  4CIE A;  1S6Q A;  1QSS A;  4KO0 A;  3OJS A;  5DK5 A;  1JLC A;  4CJS A;  4PY5 A;  4HUG A;  1GOC A;  4DTX A;  1I39 A;  4DTJ A;  4N56 A;  4OKE A;  4AH9 A;  4CEA A;  4FLT A;  3U3Y A;  4O44 A;  2ZD1 A;  3K57 A;  4QAG A;  3VQ8 A;  4LH5 A;  4KKO A;  4CFC A;  3DMJ A;  1U47 A;  1S1W A;  2F96 A;  4CFA A;  4CF2 A;  4B9N A;  3VA0 A;  4KHQ A;  3VQB A;  5K14 A;  3OYE A;  4KHU A;  4KB1 A;  4Z4G A;  4PWD A;  4AHC A;  2Z1I A;  3VQ7 A;  4KFB A;  4CCH A;  4C8M A;  3NDK A;  3V1R A;  1L3V A;  4O55 A;  1RDD A;  1ZBU A;  3HPH A;  5SWM A;  3WNE A;  3K58 A;  2G8H A;  4CIG A;  1ZBL A;  4E7L A;  4CF8 A;  3ZSR A;  3DLE A;  3KK2 A;  4LH4 A;  2B6A A;  3LP0 A;  4HVJ A;  4H4O A;  4FZZ A;  2B5J A;  4CES A;  1VRU A;  4N47 A;  1JLG A;  2OPP A;  4FJG A;  4QOZ B;  4CGG A;  5DMR A;  3DLB A;  1HYV A;  3RTV A;  2P51 A;  2ZE2 A;  3CFR A;  3QLH A;  3HVT A;  2BAN A;  1BCO A;  3HST B;  4IBN A;  4Y1C A;  1Q9Y A;  3SYZ A;  3TAG A;  4DFK A;  1LAW A;  2D5R A;  4DTS A;  3NCI A;  1KFD A;  1O1W A;  5CY4 A;  2BE2 A;  5C24 A;  1TK5 A;  1KLM A;  1L5U A;  4CHP A;  3P83 D;  3IS9 A;  4Z0U A;  1EX4 A;  2QKB A;  3KLE A;  1NK9 A;  3L2U A;  1TK8 A;  4PQU A;  1LWE A;  4ZHR A;  3ZSV A;  1LAV A;  3LAL A;  4CEZ A;  3V4I A;  4PUO A;  4FVM A;  2O4G A;  3HP9 A;  3L8B A;  3KKR A;  3TAN A;  1B9F A;  4N5S A;  4W5N A;  1JL2 A;  3RMB A;  1VSL A;  4FLZ A;  4R5P A;  4I2Q A;  2KFN A;  2P1J A;  2HHW A;  2YNF A;  5HRP A;  4CHN A;  2YHB A;  2IC3 A;  2XY6 A;  3O3F A;  1C1A A;  1VK0 A;  3ZT2 A;  1TKD A;  3I8D A;  4KI6 A;  3HPO A;  4BWM A;  3VQC A;  1DTT A;  3WNG A;  2QKK A;  1Q8I A;  4KAZ A;  1KTQ A;  1HNI A;  5HRO A;  3C95 A;  1FKO A;  4FZX C;  3HP6 A;  3SV3 A;  3B6P A;  2Z1J A;  1TKX A;  4I2P A;  2RN2 A;  3SCX A;  3KD5 E;  5I42 A;  3HL8 A;  4W5R A;  2P5O A;  2FBT A;  4H4M A;  4DSL A;  3JSM A;  3M8Q A;  1WN7 A;  3NE6 A;  2OZS A;  4DSI A;  4K8X A;  4J2B A;  2KW4 A;  4CEB A;  3CM5 A;  2EHG A;  2YKN A;  3DOK A;  3NH1 A;  3HT3 A;  5FRN A;  1JLF A;  1YVU A;  4YFU A;  1SL0 A;  1SUQ A;  2HB5 A;  3SNN A;  1RNH A;  3PY8 A;  1YTU A;  1A5V A;  3OVN A;  2DFH A;  4CF9 A;  1LW2 A;  3NH2 A;  4F2R A;  4BAC A;  4Z4E A;  1QHT A;  2G8K A;  4E1M A;  4IFV A;  1HPZ A;  3ZT1 A;  4C8L A;  4FJM A;  2QK9 A;  4CHZ A;  1C0U A;  3QES A;  2YHA A;  3RRG A;  1FK9 A;  4CEC A;  4GVM A;  3O4N A;  2NUB A;  3KLF A;  3LDS A;  1KVA A;  4B9S A;  1TL1 A;  1YT3 A;  1D9D A;  4I7F A;  2XY5 A;  1KSP A;  3KJV A;  2HVI A;  4M3U A;  4M3X A;  4FLX A;  1QQC A;  2DFF A;  3QO9 A;  3OJU A;  4LY7 A;  4OKJ A;  1UA1 A;  1SKR A;  4J2A A;  3QER A;  1WAF A;  3QEX A;  2HHX A;  1BQN A;  3SUN A;  3CM6 A;  1WSI A;  2HHV A;  3DRP A;  3TAM A;  2OZM A;  3F9K A;  1RT4 A;  3SUQ A;  4DSK A;  3KIO A;  1MU2 A;  4M3W A;  4FYD A;  4FJ8 A;  1RTH A;  3V1Q A;  3V9U A;  4FXD A;  3SPY A;  4B9V A;  3PO4 A;  1XHX A;  3AVF A;  1A5W A;  3C94 A;  3JYT A;  2DY4 A;  1U49 A;  3I0R A;  1JLQ A;  3QIO A;  4F3O A;  3OYB A;  3RWU A;  3ZSQ A;  4HUE A;  2XHB A;  4CFD A;  2G8F A;  4ZTF A;  3ZSZ A;  4MQ3 A;  4CK1 A;  2QXF A;  4KHY A;  1NK6 A;  1VSE A;  3DOL A;  1XWL A;  3NFA A;  1REV A;  1Y97 A;  2IS3 A;  1F21 A;  3V6D A;  4OLA A;  3D45 A;  4CJ5 A;  4FJH A;  1A5X A;  5C25 A;  4FJ7 A;  4B3O A;  3DM2 A;  1W0H A;  1J9A A;  3SI6 A;  5SZT A;  1WSG A;  4JRQ A;  4M3Y A;  1S9E A;  4HCC A;  3CYM A;  4FJ9 A;  3SQ1 A;  4NCG A;  3SJJ A;  4DMN A;  4JS5 A;  4DTU A;  2D0A A;  4HCB A;  2OPQ A;  2I5J A;  3NAE A;  4W5O A;  2D0C A;  4DU1 A;  3SPZ A;  4OVL A;  1N6Q A;  3K5M A;  4DQI A;  1VRT A;  4KHN A;  1GOA A;  4MFB A;  3OYK A;  3G10 A;  4B8C A;  4FW1 A;  1NK5 A;  3L2Q A;  4EZ9 A;  3MXM A;  1W9H A;  3CG7 A;  3OYI A;  4RW9 A;  1VSK A;  1X9S A;  1QSL A;  4HUF A;  4YNQ A;  5FRO A;  4NYN A;  1HRH A;  4JLH A;  3V9X A;  3I0S A;  2VWK A;  1YTA A;  2O4I A;  2GV9 A;  3K2P A;  3DLH A;  1D8Y A;  3E01 A;  3HJF A;  1J5O A;  3VQ5 A;  3AO2 A;  3OS2 A;  4DQR A;  4DQQ A;  3WNF A;  1RT2 A;  3AA4 A;  1J54 A;  1JLA A;  3FFI A;  4IG3 A;  3SQ0 A;  4LD0 A;  3EZ5 A;  3C6U A;  1C0M A;  3IRX A;  2XY7 A;  1VSM A;  4DU4 A;  2PY5 A;  3L3V A;  4O0J A;  5KI6 A;  2XO7 A;  3KLH A;  3EYZ A;  4FLU A;  4DS4 A;  1L3T A;  3S3M A;  4F8R A;  4DQS A;  2VG7 A;  2WON A;  4Z4C A;  4CEF A;  1J53 A;  4KRE A;  1BGX T;  3V9S A;  4BE2 A;  1U45 A;  3LP1 A;  4DSJ A;  3ALY A;  4JRP A;  4E7H A;  3ZT3 A;  4DF4 A;  3OYN A;  3AVL A;  3TAQ A;  2B4J A;  4CEO A;  2HNY A;  1RBU A;  3K5O A;  2HVH A;  3K5N A;  4FW2 A;  4CE9 A;  2Y1J A;  1IKW A;  3LZI A;  3TAP A;  3M8R A;  4DTN A;  4F4K A;  3AVG A;  3AVH A;  4FJL A;  2D0B A;  1JLE A;  1TGO A;  3B6O A;  3NF7 A;  3LPU A;  4CJR A;  1U4B A;  2Z1H A;  1T7P A;  1IKV A;  4KV8 A;  2OA8 A;  1BL3 A;  1SKS A;  4M3Z A;  4B9L A;  4WE1 A;  4CER A;  2OPS A;  1SL1 A;  4DLE A;  2RKI A;  1EET A;  5HP1 A;  1RT3 A;  3AVK A;  3P5J A;  3V9Z A;  1JL1 A;  5HBM A;  4DG1 A;  3WNH A;  1WLJ A;  1G15 A;  4CHO A;  4XIU A;  1NKC A;  3HVR A;  4CEE A;  2KQ2 A;  1RBT A;  1TL3 A;  4FJK A;  2PYJ A;  4AHT A;  3TR8 A;  2X6N A;  1XC9 A;  2FC0 A;  4H8K A;  4M3T A;  1NJZ A;  3V1O A;  4E7J A;  3LAN A;  3LWM A;  4KRF A;  3KTQ A;  4Q0B A;  3NBP A;  1RBR A;  2HHT A;  1C1B A;  3NGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...