4OKJA

Crystal structure of rnase as from m tuberculosis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of RNase AS, a Polyadenylate-Specific Exoribonuclease Affecting Mycobacterial Virulence In Vivo
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords 3'-5' exoribonuclease Rv2179c/MT2234.1
total genus 50
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4okjA00
2Z1HA 3K58A 4Z4IA 2YNGA 4E1NA 3QERA 3SQ2A 1BIUA 3QEWA 1NJXA 3S9HA 4FLTA 4KHUA 1VSKA 3NCIA 1C1CA 1RBTA 4GW6A 2QKKA 4O5BA 1HNVA 1U4BA 3L2WA 4C8LA 1BI4B 1KVCA 2A1RA 2OZMA 4CEQA 1VSIA 2F96A 4I7FA 4KV8A 3VQ8A 5KRSA 3QEIA 3SI6A 4DLEA 1X9WA 3NGZA 4CEDA 3SNNA 4AHCA 3HK2A 3V9XA 1JLEA 3LDSA 2QXFA 3K5MA 4IDKA 4CJTA 3RMAA 3B6OA 1ZBUA 3HVRA 2Y1IA 3WNFA 1RT3A 4F3TA 4CJVA 4W5OA 3NH2A 3VN5A 4OPKA 1QHTA 3ZSOA 3OYEA 4PWDA 1KSPA 4WE1A 1WSFA 4E0DA 2BGGA 3AO1A 4HUFA 4GVMA 4C8OA 3G0ZA 2KFNA 4B08A 1B92A 3LZIA 5FDLA 3ZSQA 4Z0UA 1KCFA 3DM2A 4HCCA 5CYQA 1Q8IA 4MQ3A 4CJ3A 3I0SA 2OYQA 2ZE2A 3KLIA 1N6QA 4KTWA 2YKMA 1KVAA 4KB1A 3JYTA 1VSEA 1S6QA 1SUQA 4KPYA 4FXDA 1QQCA 3U6FA 4B9VA 4OKJA 1QSYA 4IBNA 3AVJA 3DMJA 3OJUA 4DQQA 3AVNA 5FRNA 3NF6A 2HNYA 2VG7A 3HSTB 3AA4A 3O3GA 3SUOA 3MEDA 2JLEA 1RT6A 3LP1A 3ZT0A 2IS3A 1O1WA 2R7YA 1NK4A 3TARA 3AVLA 3OS2A 1SKRA 4LH5A 4CHZA 1JXEA 1L3VA 4CF8A 1C6VA 4CK3A 3KD5E 1X1PA 3KTQA 2D0AA 3MXIA 3BGRA 4PA1A 1IKVA 1RT5A 1SL2A 2ZD1A 5J2QA 4FJKA 5HROA 4DMNA 3KLFA 3DOKA 3KJVA 1LV5A 4EP4A 1CZ9A 5J2PA 4QCLA 3O4QA 4DS5A 3DLRA 3KLHA 5C24A 2OPQA 3TWHA 2GV9A 2HHSA 2NUBA 4CFBA 4FJ5A 3VQPA 4E7IA 3M8RA 2EX3A 4NCAA 3MEEA 3D45A 5KTQA 1RDDA 5HP1A 2JGUA 3P83D 4KRFA 1IKWA 4FJ8A 5CYMA 1VSHA 2D5RA 1XI1A 3OYDA 2IOCA 4CJQA 1S1WA 3KIOA 4NCGA 1QS4A 4B9SA 4FLZA 3AVFA 2HNZA 1XHZA 2IGIA 4ZHRA 3O3FA 1TL3A 3AVCA 1SL0A 4F3OA 2OPSA 2XY8A 4E7HA 3TAEA 4FJGA 4UQGA 1QSLA 3AA3A 3C95A 3WNHA 3NBPA 2DTUA 1ITGA 3V1RA 4DSFA 3ZSVA 4I9QA 4CHNA 3PUFA 3AO3A 4G1QA 4CF0A 4DFPA 4AILC 3AVMA 1KLMA 4OLAA 2B6AA 3AVAA 5KGWA 2YHBA 4HCBA 4JS4A 2X6NA 4BE1A 1CXQA 2G8FA 1KRPA 4FZXC 2ZQBA 3CM6A 3PX6A 4N56A 4DU4A 4KAZA 1GOBA 4DTUA 3ITHA 4PY5A 4OVLA 1BHLA 1JLAA 1HMVA 2FBTA 4TSXA 4O44A 5E41A 3AO2A 3VQEA 1TK0A 3LWLA 1EETA 2ITGA 3V81A 1REVA 1Z26A 1HQEA 1BCMA 2P5OA 3T19A 3ZSZA 3S3MA 1RT1A 3TABA 4DQSA 1W0HA 4IKFA 4DTNA 1C0UA 2OA8A 4Z4CA 4CEFA 1Z25A 2QK9A 4IFYA 3HP6A 2G8VA 1WNSA 4FJLA 2OPPA 4FJHA 2RN2A 3DYAA 4BE2A 1W9HA 4RW6A 5HRRA 4AHVA 4B9UA 1GOCA 4AH9A 4CHOA 4CFCA 1JKHA 4DSIA 3OYNA 4AHSA 4CGGA 2GBZA 1WAFA 2EHGA 5SWMA 2OPRA 4CFAA 3MECA 3CFRA 2E6MA 5J1EA 2Z1JA 3WNEA 3I0RA 4CEEA 4PUOA 3LWMA 1NK5A 4LSLA 1L3TA 3E01A 1XWLA 4KB0A 3AO5A 1BIZA 4M3ZA 3NGYA 5C42A 5FROA 1JL1A 3QINA 3PX0A 1HNIA 3L3VA 2FBYA 4FK0A 4CJSA 4FVMA 4M3XA 3OYMA 1YTUA 2HVHA 4Z4EA 3SUQA 4YFUA 3M8SA 3OYIA 2HHTA 3MXJA 4HUGA 2HVIA 2ETJA 1C0TA 4LD0A 3ISNC 1DTQA 1YVUA 5I42A 3QLHA 3VQDA 1LW0A 3NAEA 1X9MA 1MU2A 1EKEA 3F73A 1NOZA 4K8ZA 5J2NA 2P1JA 3QIPA 5JS2A 4CGHA 4DU3A 4JLHA 2IAJA 3L2UA 4B9TA 1WSEA 3OS1A 3CG7A 2HHQA 5D3GA 3VA0A 2G8HA 3QNNA 2RF2A 1NJWA 1K6YA 4ID1A 1S1TA 3HJFA 3RMCA 1KLNA 4HUEA 2KTQA 4ICLA 2VWKA 4KHWA 3EZ5A 1JLQA 2X74A 1CLQA 3KK1A 1IG9A 4FLXA 1BGXT 1RDAA 2BANA 2YKNA 1CXUA 1JL2A 3QO9A 2F8TA 3KLGA 4B3OA 2RKIA 4FW2A 1A5XA 1S6PA 4Z4GA 3RWUA 4H4OA 3HPOA 1RT7A 3MEGA 1J5OA 4CECA 4FLYA 1NK6A 2XO7A 3AA2A 2HHWA 3EYZA 3B6PA 1VK0A 3L3UA 3A2FA 1T05A 4IG0A 4E7KA 3DLHA 1VSFA 3OVNA 5DK5A 1LWEA 2VG5A 4CEZA 3AO4A 1HYZA 3VQ7A 3ZSRA 4I2PA 3SV3A 1JLGA 5SZTA 1XC9A 1NK7A 4CCHA 4KI6A 4KHQA 3NH0A 3OYHA 2PYJA 4CJRA 1DTTA 4FZZA 3HPHA 1ZYQA 2PZSA 2WOMA 2HHVA 4W5QA 1U45A 1TKDA 1HPZA 4FLVA 2IDOA 4DQRA 3RR7A 1ASWA 1Y97A 1ZBIA 2G8IA 4KTZA 4BDPA 4CGJA 1HJRA 3NF7A 3TANA 1NK9A 3ZSXA 1D9FA 4DG1A 1J53A 3KKSA 1YTAA 3LALA 4J2EA 4FK2A 1NJYA 1B9FA 2LSNA 1SV5A 2KFZA 4FJMA 1TKTA 2FBVA 3DRRA 3RTVA 5HRNA 1G15A 4BWJA 3V1QA 3OYKA 1FKOA 3TAQA 2Y1JA 3SCXA 3K59A 2XY6A 4DFKA 3RR8A 4N47A 4FCYA 3PO4A 1VRTA 4M3RA 1LW2A 3SQ4A 1SKSA 3ZSYA 3VQ6A 3KD1E 1TGOA 1X9SA 2E4LA 4M45A 1S9GA 3K57A 4RW4A 3VQAA 4F4KA 1RBVA 3PV8A 3I8DA 3MAQA 3AVHA 3DRPA 1HYSA 2HHXA 3OYAA 3OYGA 1ASUA 3K5NA 4KHSA 5EU7A 3L2RA 1BQNA 1WSIA 1S9EA 3VQCA 4HVJA 3NH1A 3LZJA 3ZT2A 4E3SA 1C1AA 3RMDA 4LH4A 3NGIA 2HW3A 3P5JA 3LANA 3IG1A 2KW4A 3K2PA 4CEBA 3OYCA 4FLUA 1UA0A 1YT3A 1VSJA 3M8QA 4NYNA 1C1BA 2YHAA 3HT3A 3D0PA 4FJJA 3OY9A 3V1OA 4C8NA 4O0JA 5HRPA 5T7BA 3V4IA 1RDBA 1RT4A 1L3SA 3UIQA 3ASMA 1NJZA 1TKXA 4R5PA 3K5LA 4M42A 4ID5A 4IFVA 1NKEA 1A5VA 5JS1A 2PYLA 1XHXA 2G8UA 1TV6A 4E1MA 3THVA 1JXBA 3SUPA 1KFDA 1WSGA 1SL1A 4ELTA 3QEVA 4DTRA 5DMRA 4BDYA 5CZ2A 1TAQA 3V9SA 4DTPA 4OGCA 4AHTA 4CIEA 4FJ9A 1TKZA 1RTJA 3AVKA 3SJJA 1IH7A 5HBMA 3VQQA 5K14A 3K5OA 4CFDA 4IG3A 3VA3A 1BISA 4CJPA 4BE0A 4BWMA 1U47A 4CJFA 1LAVA 1UOCA 2HB5A 2Z1IA 3IRXA 4O55A 4RW7A 3MXMA 1ZBLA 2G8KA 3QEXA 3S3NA 4FJIA 4N41A 1RBRA 4MFBA 1HYVA 3C6TA 1BCOA 1D5AA 4DTOA 1LWFA 3SPYA 3T1AA 2YNFA 4CERA 2VWJA 4DF8A 2X78A 3ZT4A 1NK0A 1BQMA 1VSLA 3IAYA 3HYFA 4FJXA 1TVRA 1WAJA 4Z4HA 4C8KA 4ELVA 4DSKA 2HHUA 3QETA 4DF4A 4M3WA 4KI4A 4E7JA 3OJSA 4AHUA 3TI0A 3FFIA 1JLBA 1LAWA 4FLWA 4DSLA 4LSNA 1LWCA 3VQ9A 4JS5A 1C0MA 4B9NA 4B9MA 4I2QA 3HXMA 4CJUA 2F8SA 1BI4A 3SV4A 4BDZA 2VG6A 1FKPA 1HRHA 3V6DA 3KK2A 3QEPA 1TK5A 3PY8A 4DTSA 1VSMA 4ELUA 4DLGA 1RNHA 3C6UA 1U49A 3OYBA 1WSHA 3O4NA 2IC3A 4RW9A 3TAMA 4Q5VA 1ASVA 4DU1A 3AVBA 3QESA 5KI6A 2P51A 3AA5X 4CJWA 4YNQA 3BDPA 1I39A 3NHGA 3L2QA 3DOLA 3CQ8A 2KQ2A 4NCBA 4QOZB 1T8EA 3TAGA 1UAXA 1QE1A 1TL1A 4CJEA 1BL3A 1RBSA 3V9ZA 1U48A 4I9LA 4CIFA 4FZYA 2B4JA 3QNOA 4F2RA 4CK1A 2DY4A 4M3TA 4KREA 4K8XA 1N5YA 2ATQA 3U3GA 4CHPA 4B8AB 3CFPA 3L8BA 1WSJA 3F9KA 3QIOA 2DFHA 1DLOA 3LPTA 4JRPA 2XY7A 2O4GA 3O3HA 4DSEA 4M3UA 3LP3A 3SZ2A 3SQ1A 1L5UA 1R0AA 1Q9YA 5FRMA 2DFFA 4CEOA 2O4IA 4RG8A 2A1SA 4CK2A 1RDCA 2WONA 3IS9A 4CF2A 3CFOA 1UWBA 4LY7A 2XHBA 1U04A 4W5RA 3NE6A 3V9WA 1T03A 1J54A 4JRQA 4FJNA 2KZMA 5CY4A 4DFJA 5J2MA 1S5JA 4CJKA 3ULDA 4F8RA 5C25A 4PQUA 4E19A 1SKWA 4L8RB 1NOYA 4B9LA 1I3AA 1EP4A 4CGFA 3SUNA 1D8YA 4ZTFA 2YV0X 5HRSA 4FJ7A 1TK8A 3C94A 3NF8A 2PY5A 1JLFA 4CE9A 3DLKA 4KHNA 1B9DA 4CIGA 3RMBA 5KGXA 3AVIA 2HMIA 1RCHA 3DI6A 4DTXA 2YNIA 3DRSA 3OYLA 2X6SA 3NDKA 3G10A 1CZBA 4OPJA 1L3UA 3ZCMA 3OYFA 1EXQA 1NKCA 1Q9XA 3SPZA 3LP2A 3NF9A 4O0IA 5HLFA 3VQBA 4M41A 1ZBFA 1NK8A 4FK4A 4CF1A 4CGDA 1S1UA 3VQ5A 3ZT3A 3HL8A 3OS0A 3HP9A 1KFSA 3KKRA 4CJ4A 4FYDA 3LAMA 1IKXA 2G8WA 2OZSA 3TR8A 1NKBA 1S1VA 4FM0A 3TAPA 1RTDA 4O4GA 2HNDA 4DSJA 4DWIA 3ZT1A 4OKEA 3LAKA 4HTUA 1HQUA 4XIUA 4FW1A 2KZZA 1RT2A 4CHYA 1VSDA 4OLBA 3JSMA 4CF9A 1FXXA 3SYZA 3HPGA 1WLJA 4W5NA 4NYFA 1QSSA 4DTJA 1KVBA 3EY1A 3WNGA 3PO5A 1F21A 3KK3A 4HHTA 4DQPA 2BDPA 4CGIA 1VRUA 3RRHA 3L2VA 1GOAA 1A5WA 4AHRA 4E89A 4FM1A 3H08A 4KO0A 4H4MA 2W42A 3S3OA 1WN7A 4CJLA 4ZTJA 3DLGA 3HVTA 2Z1GA 3RRGA 3CYMA 3V9UA 1JLCA 2FBXA 3ALYA 3P1GA 2YNHA 4KTQA 1KTQA 1J9AA 3LPUA 3KLEA 5KRTA 2E6LA 2XRIA 4C8MA 3CM5A 3HO1A 2B5JA 3T3FA 4FM2A 4DTMA 4QAGA 4OGEA 2QKBA 1T7PA 4F2SA 3DLEA 4EZ9A 3ZSWA 4W5TA 2XY5A 3SQ0A 1QTMA 2Q3SA 4OKKA 3LP0A 4J2BA 4KHYA 3TAFA 2P5GA 2GUIA 3PX4A 1RILA 1IKYA 4B8CA 2DFEA 1EX4A 1RTIA 4KKOA 4CHQA 3OYJA 4CESA 3U3YA 3M8PA 3VQ4A 1UA1A 2D0CA 4Z4FA 2AJQA 4CJ5A 1RTHA 4J2DA 2RPIA 4EZ6A 1IO2A 4KFBA 1S1XA 4BACA 4OJRA 3AVGA 4DS4A 2I5JA 4M3YA 1RBUA 4N76A 1D9DA 1ZBHA 1FK9A 4J2AA 4E7LA 3NFAA 1TAUA 4GMJB 3DLBA 4H8KA 2BE2A 2D0BA 4N5SA 4Q0BA 4DQIA 5I3UA 4RW8A 2FC0A 4DFMA 4CEAA 3HM9A 4Y1DA 5CZ1A 4EP5A 3AV9A 4Y1CA
chains in the Genus database with same CATH superfamily
3K58A 1NJXA 3SQ2A 2HBLA 4YOXA 2QKKA 1U4BA 1BI4B 3MX2A 2OZMA 4XH1A 2P9UB 4I7FA 4KV8A 3SI6A 2E2PA 2CGJA 4CEDA 3DXMA 3SNNA 2P9NA 4LFCK 2W6KA 3KWGA 3SAGA 3LDSA 2QXFA 4CJTA 3D2FA 3WNFA 1NGEA 4OPKA 3OYEA 4B1VA 4IO9L 3AO1A 2KLAA 4HUFA 4C8OA 1FJGK 4JKGB 3LZIA 3UKUA 1KCFA 5CR4A 1M90O 3I0SA 4JN4A 2ZE2A 2OYQA 2CH6A 3AGKA 3MCPA 2P9PA 3ZX0A 1S6QA 1SUQA 4FXDA 1HKCA 4A5BA 1N34K 2NRWA 3AVJA 3TU5A 4DQQA 1BO5O 3AA4A 3GE1A 4JK7A 3HZ6A 3LP1A 2R7YA 5AQYA 3TARA 4JKDA 3D2EB 3WQTA 4IO8A 4CVNE 4CK3A 2ASMA 3KD5E 1X1PA 4BRMA 3KTQA 3BGRA 4LF4K 1P90A 4PKGA 3KLFA 4JI1K 4EP4A 4AM7A 2OPQA 2NUBA 4FJ5A 2ZJPL 4U67L 1RDDA 2JGUA 1IKWA 4YOUA 5C2FA 2IOCA 5AZIA 1S1WA 4NCGA 5BN8A 3LDPA 3WUHA 1V4TA 2HOEA 3AVFA 4FLZA 2IGIA 1VQNN 4JKEA 3FR0A 4F3OA 2XY8A 3TAEA 4DR2K 2NRRA 4FJGA 3NBPA 4YY3K 4X62K 3AO3A 4NXMK 4DFPA 4CZFA 5I9EB 3AVAA 3QBWA 2BTFA 3MCAB 3LM2A 1CXQA 4BE1A 4JNEA 5FPMA 2V7ZA 3CC2N 3JAMO 2IVOA 4BRQA 5AQUA 3LWLA 3G25A 1Z26A 4EFHA 3CCLN 4IKFA 4DTNA 5BREA 1X9JA 4Z4CA 3H6EA 4IFYA 1NJIO 2OPPA 3SBGA 3DXKB 5HRRA 4DSIA 1GOCA 4CGGA 1WAFA 2EHGA 1W97L 4KB0A 1XWLA 5EXWA 2JWKA 1VHXA 3HRGA 4CD1A 3L3VA 1Y64A 2FBYA 2IIRA 5AZJB 1HUXA 3MWTA 4FVMA 4CJSA 1YTUA 2HVHA 4Z4EA 3SUQA 3CI5A 2V51B 3J7AP 1Q81O 3GL1A 1C0TA 3ISNC 3QLHA 2BUPA 1QZ5A 3F5TA 4LFAK 3NAEA 3F73A 3N4PA 4I6MA 3LDNA 4JLHA 4DU3A 1WSEA 3OS1A 3CG7A 2HHQA 3VA0A 1K6YA 4ID1A 2DPNA 2HBJA 3RMCA 5F1XA 1LCUA 4HUEA 2KTQA 2X74A 3EKUA 4FLXA 2W41A 3EE8A 2E8AA 1RDAA 5AQNA 4O8UA 3QO9A 3THWB 2F8TA 1GLCG 1A5XA 4CJ7A 1DKGD 1RT7A 3O6WA 3MEGA 3R3LA 3AA2A 2WFBA 1LOTB 1VK0A 4IG0A 3DLHA 3K0SA 2VG5A 2QEXN 1XNQK 4I2PA 4CCHA 1S72N 3PLAA 1WBBA 2PYJA 4CJRA 1ZYQA 4LC9B 2PZSA 1NGAA 3T7ZA 4BDPA 4BRLA 4CGJA 3NF7A 1U2VA 1WBDA 3VERA 4CD3A 4LFBK 3CQXA 3O1BA 4IZ9A 2Q0RA 5E84A 2LSNA 1SV5A 3VGMA 3RTVA 3DRRA 4BC3A 3AY9A 1HKGA 4FCYA 4FWQA 4M3RA 4H5VA 3VQ6A 4DKWA 3C65A 3K57A 1YHQN 1NU0A 3VQAA 1EO1A 3MDQA 3MAQA 4DR1K 3OYAA 5EVZA 3OYGA 4CZJA 5EU7A 4HVJA 1C1AA 4LH4A 1GLAG 3K2PA 2KW4A 3DAWA 3W0LA 2UUAK 2P9KB 4X64K 3HT3A 3D0PA 4FJJA 5C0YA 3OY9A 3V1OA 4C8NA 5AQJA 1RDBA 1L3SA 3ASMA 3D7EO 3O9TA 2AA4A 3E9LA 1NJZA 5DM7L 2Q0UA 2E20A 1NKEA 1XHXA 1TV6A 4JI5K 1JXBA 2FLOA 1KFDA 4MLHA 2QI2A 5DMRA 3V9SA 2QW9A 3K9JA 1TKZA 3AVKA 3SJJA 4CFDA 3B8AX 3K5OA 2NNWA 3FGUA 3TSUA 1UOCA 2G8KA 4RW7A 3S3NA 4N41A 3VF6A 1RBRA 1HYVA 4DTOA 3SMPA 2QWRA 5LY3A 1WAJA 3VF4A 4DSKA 3CJBA 4DF4A 4KI4A 3O9QA 4FLWA 5HOOA 4B9NA 2F8SA 2A42A 3WEEB 1FKPA 3QEPA 5M1KA 4DTSA 3EL2A 3H46O 4IWVA 4BRIA 4DLGA 1WSHA 3O4NA 3TAMA 2O8FB 2ZJRL 3AVBA 4CJWA 4YNQA 1RDWX 5ADXA 2HMPA 4BR5A 2KQ2A 3GBTA 5AQZA 1T8EA 3T1YK 4LF5K 1TL1A 1IG8A 3V9ZA 1U48A 1RBSA 4CIFA 4FZYA 3OHRA 4CK1A 4DUZK 4M3TA 5LMUK 3TSQA 4CHPA 3CFPA 1T44A 1QVFM 3VMFB 1BUPA 3VEWA 2XY7A 3O3HA 3LP3A 3SZ2A 3SQ1A 5FRMA 2DFFA 3U8XA 3LL3A 3H45C 4JHDB 2NLXA 4FWRA 5CY4A 4DFJA 4CJKA 4F8RA 5AR0A 4BRDA 4B9LA 1I3AA 3IDHA 3RSEA 4FJ7A 2PY5A 1JLFA 1B9DA 4CIGA 3RMBA 5KGXA 1RCHA 4JI7K 4OPJA 1NKCA 1KXPA 1Q9XA 2WUSA 3LP2A 3NF9A 3EZWA 3QMLA 1S1UA 3ZT3A 4FO0A 1NGHA 2G8WA 2OZSA 3TR8A 4FM0A 3TAPA 3J7YP 3ZT1A 4HTUA 1HQUA 2KZZA 4BY9C 4OLBA 3SAFA 3SYZA 1JCEA 4IEEA 3KK3A 4BRHA 3UB5A 1VQKN 1NGDA 2HF4A 2OCEA 4DR5K 4H4MA 3TTFA 5BRFA 3S3OA 4ISFA 2UYTA 3CYMA 5KPTA 4JYAK 3P1GA 1KTQA 3E1YA 2KKZA 5KRTA 3J81O 3CCRN 2XRIA 4C8MA 5M1PA 3T3FA 4QAGA 1T7PA 4F2SA 4EZ9A 2DTUA 3ZSWA 2QWMA 3BP8A 3TAFA 2HBKA 1YJNN 5BPNA 1XMQK 3VEXA 4K43A 4CESA 3M8PA 5BRDA 2D0CA 4CJ5A 1QZ6A 2RPIA 1S1XA 4XEIA 4OJRA 3SBTA 3WXIA 1FK9A 4MDBA 1ATSA 2P9NB 4N5SA 5I3UA 2FC0A 3D2FB 4CEAA 3AV9A 3ENBA 2Z1HA 1VQMN 4Z4IA 1E3MA 2E1ZA 4IDHA 4FLTA 2Q2RA 4JKGA 4JAXA 1HNVA 3L2WA 4C8LA 1KVCA 4WFBL 4CEQA 3IUCA 2F96A 3QEIA 3VQ8A 5KQDA 1ILYA 3NGZA 4AHCA 3HK2A 2NRXA 3KWIA 2P9PB 1NGCA 3K5MA 3RMAA 1RT3A 4F3TA 3QDKA 4IFEA 3NH2A 4IOCL 5C12A 4WQ4C 5KQ8A 5AQKA 3ID6A 1Q86O 4FWMA 4HCCA 2WTUA 1Q8IA 4MQ3A 1N6QA 2YKMA 2O8DB 4KB1A 4DR3K 1VSEA 2ITMA 3CIPA 3U6FA 4OKJA 3A5NC 2NRHA 3DMJA 4BC5A 3OJUA 3NF6A 2HNYA 2VG7A 4GKKK 3MEDA 5AJ3K 1RT6A 3ATVA 2A40A 1O1WA 4H0OA 1E4GT 3AVLA 1HKBA 3OS2A 1SKRA 4DR4K 3HM8A 1C6VA 5AZIB 3MXIA 3F2KA 1IKVA 1RT5A 1SL2A 4FJKA 4BG8A 4BREA 3MN6A 3DOKA 3KJVA 5J2PA 4H5TA 3DLRA 5C24A 4EAHD 4JK8A 4PL8A 4YDUA 4CFBA 1NGIA 1KAYA 3MEEA 4JEPA 3SJHA 4KRFA 2O8CB 2D5RA 1OH8A 1QHAA 3CCUN 4A57A 5JICA 1QS4A 4DV6K 2HNZA 3O3FA 1TL3A 3AVCA 1SL0A 4JI0K 2OPSA 3BZCA 3CD6N 3WNHA 1ITGA 4DSFA 4I9QA 4JK9A 3PUFA 4G1QA 4OLAA 3AVMA 1HPMA 2B6AA 2YHBA 4HCBA 1T3VA 2G8FA 1HLUA 4FZXC 2ZQBA 1NBWA 3CERA 4N56A 4DU4A 4KAZA 3DXKA 3ITHA 4OVLA 1BHLA 2FBTA 4DR7K 3AO2A 1EETA 2ITGA 3FZMA 2P5OA 3T19A 2VGMA 3S3MA 1RT1A 3N4QA 4DQSA 1W0HA 3CCMN 3OW2M 1K9MO 2QK9A 1K8KB 1XC3A 5C15A 4BE2A 3CC4N 2V52B 3M1FA 4MO4A 2HHTA 4CZIA 2P9LA 1JKHA 3UKUB 2CGKA 4AHSA 4CFCA 2GBZA 5SWMA 4CFAA 3MECA 3OBYA 5J1EA 3LWMA 3WXKA 3QINA 4BR0A 4IJAA 4M3XA 1GLDG 2CH5A 4K41A 3OYIA 3MXJA 3VETA 1ZBSA 4JKAA 3CCEN 3CJ1A 1DTQA 1NLVA 5LJVA 3D2EA 3G6EN 3A5MC 1EKEA 3VPZA 1NOZA 5JMVA 5J2NA 5JS2A 2IAJA 2HHHK 1S1TA 1VQON 1WB9A 2E2NA 3O1WA 2YKNA 1EWQA 2O8DA 2QA4N 3QFPA 4FW2A 1S6PA 4H4OA 1DT9A 1J5OA 3BY5A 3EYZA 3P31A 1T05A 5EX5A 4E7KA 3DWLA 3QB0A 4CEZA 5DK5A 3G71N 2OANA 1NGGA 1HYZA 4FPAA 5BN9A 1YJ9N 1JLGA 4KI6A 4FPBA 1BU6O 4FWNA 4CZMA 2WOMA 4W5QA 1TKDA 1HPZA 4IJNA 4DQRA 4FOEA 1KQSM 2O8EA 1KAXA 4CZLA 1NK9A 3ZSXA 1D9FA 1YTAA 4B3TK 4FK2A 3SMSA 1NJYA 5KPZA 1TKTA 4IXCA 3OYKA 3TAQA 4B9QA 1MDUB 2Y1JA 3K59A 2XY6A 1IJJA 2P9KA 1LW2A 1N32K 3SQ4A 1YVNA 3ZSYA 1IBMK 4M45A 1S9GA 4F4KA 3CCVN 3PV8A 3DRPA 1GLJO 1HYSA 2OTJN 1ASUA 4JD2B 1TYQA 1S9EA 3HBTA 4CZHA 4FLUA 4CEBA 1UA0A 1YT3A 3M8QA 4NYNA 2WBNA 2I7NA 1C1BA 1JCFA 5AQXA 3CHWA 2FSKA 1JJ2M 4OX9K 3R1XA 1A5VA 5JS1A 1G99A 3THVA 3SUPA 4ELTA 5H1SQ 4DTPA 1TAQA 3KZBA 4CIEA 4AHTA 2YHYA 3CJ7A 2Q97A 3PSIA 1BISA 4CJPA 4CJFA 2HB5A 2Z1IA 1ZBLA 4M3ZA 1J6ZA 4FJIA 3QEXA 1IBLK 3A5LC 1BCOA 1D5AA 2P9LB 3OBWA 2UXCK 3E9PA 4CERA 4DF8A 2X78A 3BF1A 1NMNA 2JWLA 4WFAL 1D4XA 3LM9A 4C8KA 4ELVA 2HHUA 4FWKA 1VAZA 3CPWM 3QETA 1CZAN 2E2QA 3NVKA 1DGKN 3TI0A 1JLBA 1LAWA 3CCJN 3VQ9A 1LWCA 5ADXH 4G9ZA 3THXB 4CJUA 1J5EK 4A59A 4BDZA 1HRHA 3UKRA 3FLCO 1P8ZA 1QVGM 3CCSN 3I55N 4RW9A 4DU1A 3QESA 3T1HK 5AQVA 3IKMA 4CJEA 4OPHA 2B4JA 2DY4A 1NNEA 2ATQA 3L8BA 4JRPA 1DLOA 4M3UA 4DSEA 1L5UA 1R0AA 1Q9YA 2O4IA 2A1SA 4E7JA 1UWBA 1U04A 4W5RA 3NE6A 3V9WA 4JRQA 5C25A 4PQUA 4ISEA 1NOYA 3AARA 1D8YA 3NF8A 3DLKA 4YOWA 2HMIA 4DTXA 2YNIA 3DRSA 4EHUA 3UE5A 4DV1K 3D6RA 1ZBFA 4CGDA 1KAZA 3VQ5A 4FL9A 3HP9A 4JI4K 3LAMA 4C23A 1HNWK 5AFUA 1IKXA 1NKBA 5CHIA 1HR0K 2ZGYA 3EE9A 3LAKA 2QWNA 4FW1A 1RT2A 1S3XA 4CF9A 3EKSA 1BDGA 4NYFA 3ZYYX 3EY1A 3PO5A 1F21A 5C10A 4JD2A 1TYQB 4FM1A 4CJLA 3DLGA 3RRGA 4C1NI 4IEIA 3V9UA 5FPEA 3EO3A 3M6GA 1J9AA 4NLBA 2E6LA 4FWLA 3U4LA 1W2BM 2UXBK 4FM2A 2FF3B 4OGEA 2QKBA 2XY5A 4OKKA 3LP0A 4BRKA 1IKYA 2O8FA 3TTCA 4CHQA 5TKWA 3U3YA 3VQ4A 1UA1A 1Q82O 4Z4FA 1C0GA 3CETA 4UY8O 2ZM6K 4FVUA 3AVGA 3ENHA 2I5JA 3G4SN 4N76A 3F9MA 4GNIA 3NFAA 1TAUA 4DV3K 3DLBA 3W3DA 2D0BA 2PAVA 4Q0BA 5AQFA 4DFMA 4Y1DA 4Y1CA 1X3NA 1BIUA 3VOVA 3C6AA 4KHUA 3LDQA 1VSKA 3EN9A 3NCIA 1RBTA 3IFRA 4O5BA 3P4IA 4PL7A 3L4QA 1VSIA 4WCEL 4DLEA 4DR6K 1MA9B 3V9XA 1JLEA 4BC4A 3FZHA 3MN5A 3JS6A 1OH7A 1IBKK 4BVOA 4GV9A 4W5OA 1OVYA 4PWDA 1QHTA 1KSPA 4E0DA 2BGGA 1T6CA 3VEOA 2KFNA 3ULEA 1B92A 4FWPA 5FDLA 3ZSQA 4Z0UA 3DM2A 4B1YB 5CYQA 3CCQN 4CJ3A 2ASPA 4KTWA 1KVAA 3ZETB 3JYTA 5E26A 4KPYA 1YJWN 1NGJA 4B9VA 1GLEG 2YX6A 1QSYA 4IBNA 4CZEA 3AVNA 5FRNA 3L4IA 4MLEA 3HSTB 3SUOA 4B3RK 2JLEA 2ZWHA 1NK4A 1L3VA 4MDAA 4KH6A 2RHKA 2FF6A 1M1KO 1ATRA 2D0AA 2YI1A 2ZD1A 5J2QA 3ZLJA 4DMNA 4JI6K 1CZ9A 4QCLA 3O4QA 4DS5A 3KLHA 3TWHA 2GV9A 3O9UA 4Z94A 1X3MA 4E7IA 3M8RA 4NCAA 5AFUH 5KTQA 5FPNA 2VQFK 4FJ8A 5CYMA 1XI1A 4IOAL 2I7PA 2ZF5O 3C0BA 5A2QO 4CJQA 5JVHL 1BWFO 2O8BB 1K73O 5F2RA 4ZHRA 3BUZB 4UQGA 3AA3A 3P39A 3V1RA 2NRZA 2VWBA 4H0TB 4CF0A 5MLCQ 2A41A 3J7ZO 4GV3A 2F9TA 1KRPA 3PX6A 2P9SB 1GOBA 1QQOA 2GELA 4HTLA 4PKHA 5AQGA 4PY5A 4V19S 1JLAA 1HMVA 5E41A 3VQEA 3V81A 4X65K 1REVA 1HQEA 1BCMA 3H3OB 3ZSZA 3FZLA 1C0UA 1VQ6N 4RTFD 4CEFA 1Z25A 2G8VA 3HP6A 1WNSA 4FJLA 3DYAA 1K8AO 1W9HA 2P9IB 4RW6A 4ILHA 4B9UA 4AH9A 4CHOA 3DLLL 4CBWA 3CFRA 2E6MA 2Z1JA 3WNEA 4CEEA 4PUOA 2NZTA 1L3TA 4LSLA 3E01A 3AO5A 1BIZA 2QWQA 1V4SA 5LMNK 3NGYA 3CQYA 5AQTA 3O9SA 3PX0A 1U2VB 3PSFA 1HNIA 4A62A 2WC9A 3HOTA 4YFUA 3VESA 3M8SA 1XMOK 5I42A 5AQWA 2FXUA 3VQDA 1LW0A 3VEVA 4BR2A 4DQ8A 3RVCA 4DV4K 2P1JA 3QIPA 4CGHA 4BQZA 3L2UA 3L6QA 1XUPO 4QS8A 5D3GA 4JI2K 2QM1A 3HJFA 3AAPA 2VWKA 2HBMA 1JLQA 3EZ5A 3KK1A 1IG9A 4H0YB 3GG4A 3E9OA 2BANA 4YHHK 1U6ZA 3M3ZA 1CXUA 4CBUA 3C7NA 4B3OA 4H5WA 4Z4GA 2BH1A 3RWUA 3KVGA 2HHWA 3B6PA 2FSJA 1VSFA 5M1OA 1LWEA 4O8KA 4OO1J 3AO4A 3LDLA 3ZSRA 4KH4A 4PHTX 5SZTA 1HX1A 1XC9A 3L0QA 4DUYK 1O13A 3NH0A 3ZX2A 3HPHA 1U45A 4FLVA 1ZBIA 3RR7A 1ASWA 4KTZA 3BF3A 1XNRK 2QXLA 3THYB 3LDOA 3KHYA 5IWAK 4DG1A 1J53A 2YHXA 3KKSA 4R79A 4J2EA 5LJWA 1B9FA 4FJMA 1MWMA 1S22A 3SCXA 4ILGB 2GUPA 5M1NA 4DFKA 4BQLA 5JLFA 3PO4A 1SKSA 2E1YA 2E4LA 3I8DA 1K8KA 3AVHA 3Q7BA 4BGBA 1WSIA 3NMUA 3MN9A 4E3SA 2GWJA 3RMDA 3NGIA 4XH5A 3LANA 4B1ZA 3IG1A 3OYCA 3VENA 5LL6Z 3THWA 1HNXK 5AQPA 1YAGA 4RWTA 4O0JA 4JV5K 5T7BA 3K5LA 2P9SA 2V7YA 4ID5A 4IFVA 4M7YA 3DJCA 1SL1A 5TKYA 4AM6A 4DTRA 4BDYA 3CJAA 1BA1A 4OGCA 3TPQA 1RTJA 1IH7A 4AQYK 3VA3A 1QQMA 4BE0A 4BWMA 5FLXO 1U47A 4MO5A 3MXMA 3IRXA 1EQYA 3THXA 3VF2A 5FPDA 1RDUA 1H1VA 3MK6A 3T1AA 2YNFA 1NK0A 3ZT4A 4WFNL 1VSLA 3R8EA 4FJXA 1TVRA 4Z4HA 4BROA 1E4FT 2W40A 4AHUA 4PKIA 4EIAA 4LSNA 3O4WA 1C0MA 4B9MA 4I2QA 3SV4A 4LF6K 3E66A 5ELZA 3V6DA 3KK2A 4CZGA 4O5FA 1TK5A 3PY8A 2F7TA 3U9DA 1RNHA 3C6UA 1U49A 3OYBA 4KHPK 2IC3A 2Q31A 5BR8K 1ASVA 3BDPA 5KI6A 3AA5X 4A61A 3A8YA 3WXJA 3DOLA 1NGFA 4NCBA 4QOZB 1SAZA 1UAXA 4I9LA 4F2RA 4YORA 3CXCM 3ZEUB 4K8XA 1WSJA 3QIOA 2DFHA 3LPTA 2O4GA 4CEOA 4CF2A 2WONA 4Y0WA 3IS9A 2XHBA 4LY7A 2ZGZA 4LF8K 1J54A 4FJNA 3K9KA 2KZMA 5J2MA 1SQKA 3ULDA 3ENOA 2IVPA 4E19A 4L8RB 5HL7L 4CGFA 2YV0X 1HJOA 5BR9A 3VTHA 5HRSA 1TK8A 5BRHA 4KHNA 1N33K 2UXDK 3WQUA 3SUNA 4LF7K 4KH5A 2X6SA 3NDKA 3G10A 1EXQA 2F4VK 5F0XA 3WT0A 3SPZA 4O0IA 5HLFA 3VQBA 1NK8A 4FK4A 2HF3A 4BRCA 3OS0A 1KFSA 4FYDA 3FZKA 1S1VA 5GADP 1BOTO 5AQOA 2HNDA 3BEXA 3M5RA 1VSDA 3HPGA 1WLJA 1QSSA 4DTJA 1KVBA 2YCHA 3WNGA 4CW7B 5C2DA 4HHTA 1TUUA 2BDPA 4CGIA 2VCPA 1GOAA 4DV7K 4DHYA 2Z1GA 4BRNA 5EOYA 2FBXA 3ALYA 3QFUA 2YNHA 3MN7A 4KTQA 4B3MK 3HTVA 3LPUA 3KLEA 3CMEN 3J80O 3HO1A 4XH4A 1EWRA 4DTMA 3DLEA 4KHYA 2Q3SA 2P5GA 2GUIA 4KKOA 1RTIA 1QQNA 2AJQA 4J2DA 1IO2A 4GVEA 4BACA 1RBUA 2D0OA 1D9DA 4H5RA 4H8KA 2BE2A 1JCGA 4FWOA 4RW8A 3HM9A 3OYFA 4B3SK 1W7AA 2YNGA 4E1NA 3QERA 3QEWA 3GDQA 3S9HA 2Q1NA 5BPLA 1C1CA 4GW6A 3ULEB 5JLHA 4YOYA 4FSVA 2A1RA 1VQ9N 5KRSA 3O08A 1X9WA 3Q7CA 3A0IX 1Q7YO 2O8CA 4H0XB 4RCHA 1IV0A 4IDKA 4JKCA 3B6OA 1ZBUA 3HVRA 2Y1IA 4CJVA 5BPMA 3H3NO 3VN5A 3ZSOA 4JKFA 3R6MA 4WE1A 1WSFA 4GVMA 1VQ4N 3G0ZA 2E2OA 4B08A 1SS6A 3OTOK 4A2AA 2NRVA 2P9UA 3S41A 1R59O 4B1UB 3KLIA 2D4WA 3SAHA 3MX5A 1QQCA 4JI8K 4LF9K 3R9PA 1NMDA 1BA0A 3O3GA 3ZT0A 2IS3A 5M1FA 1SZ2A 4LH5A 4CHZA 1JXEA 4CF8A 3I56N 4I6MB 2VGNA 4PA1A 5HROA 3AGRA 1LV5A 4BR9A 3TSPA 2YJEA 2EWSA 3VQPA 3SLCA 2EX3A 3D45A 5HP1A 4DB3A 5EY4A 3P83D 1YF5L 3PIOL 4K42A 1VSHA 3WXLA 3OYDA 4X66K 4B1WB 3KIOA 4YOTA 1KD1O 4B9SA 1GLLO 4A2BA 1XHZA 4F9OA 3T69A 4E7HA 1QSLA 3C95A 3ZSVA 4CHNA 5JVGL 2QWLA 4AILC 1KLMA 1VQ5N 4ILJA 3CF5L 5KGWA 4JS4A 2ASOA 2X6NA 3CM6A 4DTUA 1Z6RA 4TSXA 4O44A 1TK0A 5GINA 4KBOA 3GOIA 3TABA 3FZFA 2OA8A 2W6LA 4GKJK 4GY2B 1NG9A 4FJHA 2RN2A 2QWOA 4AHVA 3OYNA 4BGAA 2OPRA 5AQSA 3I0RA 1NK5A 4NO7A 3ZETA 4WQ5C 3J8AA 5C42A 4K25A 5FROA 1JL1A 1MWKA 2O8EB 5M1QA 4JI3K 1Q18A 4C1NK 4FK0A 2D1KA 4A5AA 3OYMA 3SK3A 4HUGA 2ETJA 2HVIA 4LD0A 1YVUA 1T6DA 3C7NB 4J8FA 5B8HA 5KPRA 1X9MA 1MU2A 2UU9K 4K8ZA 2YJFA 4B9TA 1RFQA 1BG3A 5AZJA 2NRTA 2RF2A 3QNNA 3MMVA 1NJWA 2G8HA 2D0PA 1KLNA 2J4RA 4ICLA 4KHWA 1OKJA 1CLQA 1BGXT 1JL2A 3KLGA 2RKIA 3OA9A 4HWIA 3THYA 1HNZK 2E5LK 4H0VB 3HPOA 4CECA 4FLYA 1NK6A 2XO7A 2Q36A 1KC8O 2O8BA 3L3UA 3QBXA 3A2FA 3I8BA 3OVNA 3WEEA 5AQQA 1NGBA 3VQ7A 3SV3A 1NK7A 3CPEA 4KHQA 4GV6A 3OYHA 3QICA 1DTTA 4FZZA 2HHVA 3C6HA 2G8IA 2IDOA 1Y97A 4L3QA 1VQ7N 3U9ZA 3ZX3A 1HJRA 2YHWA 2QWPA 5CE3A 3TANA 3LALA 2VQEK 1YIJN 4BRFA 2KFZA 5GAGP 4IOXA 4BRPA 2FBVA 5HRNA 1G15A 4BWJA 3CJCA 3V1QA 1FKOA 4BRGA 3RR8A 4N47A 3KK7A 1VRTA 3O9RA 4NLCA 3KD1E 4BR7A 1TGOA 1YUWA 1X9SA 4RW4A 2AP1A 3PIPL 1RBVA 4JHDA 2HHXA 3UKRB 3K5NA 4KHSA 3L2RA 2P9IA 1BQNA 2GTDA 3VQCA 3NH1A 3LZJA 3ZT2A 2UUCK 2HW3A 3O8MA 3P5JA 2A3ZA 1VSJA 4M63C 4CBXA 2YHAA 4CI6A 2OTLN 2HSTA 2CGLA 5HRPA 3V4IA 1RT4A 3UIQA 1TKXA 4R5PA 4M42A 3HOSA 4FOIA 2G8UA 2PYLA 1YITN 1NM1A 4E1MA 4H5NA 4YOVA 1WSGA 3QEVA 4QS7A 5CZ2A 4FJ9A 5HBMA 3VQQA 5K14A 5AQHA 4IG3A 1ESVA 2A5XA 1LAVA 4O55A 5IT9O 4B1XB 4QS9A 4MFBA 2ZJQL 3SPYA 3C6TA 3BZKA 3JXUA 1LWFA 4EHTA 2QTDA 3IMXA 2VWJA 1BQMA 3IAYA 3CMAN 3HYFA 1TUYA 1YI2N 5DM6L 2E88A 1I94K 4M3WA 3OJSA 4W5NA 3FFIA 2PFUA 4DSLA 3VEZA 4JS5A 1ZXOA 3VTIA 3HXMA 4U7BA 3MWPA 1BI4A 3I33A 2VG6A 4AF1A 4FWSA 4NXNK 3DXMB 2FSNA 4BRAA 1VSMA 4ELUA 1WUAA 1VQPN 4Q5VA 1GLFO 2P51A 4JKBA 4NB4A 1I39A 1ZC6A 4WQ4A 3NHGA 3L2QA 3CQ8A 4JKHA 3ATUA 3TAGA 1QE1A 3CJ9A 1VQLN 1BL3A 1WOQA 5AQLA 4BG9A 3QNOA 2GEMA 4WYBA 3CC7N 3H1QA 4KREA 3ID8A 1N5YA 3U3GA 4B8AB 3F9KA 4WQ5A 4ISGA 2VYPA 3NVMA 1XQSC 1GLBG 2PBDA 5AQMA 3VGLA 4RG8A 4CK2A 1RDCA 3CFOA 1T03A 1N8RO 2A6AA 3O5BA 1S5JA 1Z05A 1SKWA 3P38A 1EP4A 4ZTFA 3WXMB 2HHSA 3C94A 1VQ8N 4CE9A 4E1JA 3AVIA 3DI6A 3OYLA 1L3UA 1CZBA 3ZCMA 3O80A 4K0KK 4M41A 4CF1A 2KHOA 3HL8A 3KKRA 4CJ4A 4BC2A 5GAEP 1RTDA 3H1VX 4O4GA 4H0PA 4H03B 4DSJA 4DWIA 4OKEA 1FW6A 4XIUA 3RSEB 1OVQA 4CHYA 3VGKA 2UUBK 3JSMA 1DEJA 1FXXA 1N36K 1NWKA 3HI0A 5GIPA 4DQPA 1ATNA 4DCHA 1VRUA 4M7XA 3RRHA 3TTDA 3L2VA 4AHRA 1A5WA 3AAQA 4E89A 2GWKA 4BR4A 1OH5A 3H08A 4KO0A 2W42A 5GIOA 1WN7A 4DV2K 4ZTJA 5AQRA 3HVTA 5AQIA 4CZKA 1JLCA 1C0FA 3FFKB 4OPAA 4YDUC 1OH6A 2RE2A 2GX9A 4DV5K 3HSCA 3CM5A 2B5JA 4J2BA 4W5TA 1QTMA 3SQ0A 4DV0K 3FE1A 3PX4A 1RILA 1YXQA 4B8CA 2DFEA 1EX4A 3EEQA 2H3GX 3OYJA 1RGIA 1RTHA 4BVPA 3A5OC 3VEYA 4EZ6A 2IVNA 4KFBA 4DS4A 4M3YA 2F9WA 1ZBHA 4J2AA 4E7LA 4GMJB 4DQIA 3ZEUA 5GAHP 4WF9L 5CZ1A 4EP5A
chains in the Genus database with same CATH topology
2Z1HA 3K58A 4Z4IA 2YNGA 4E1NA 3QERA 3SQ2A 1BIUA 3QEWA 1NJXA 3S9HA 4FLTA 4KHUA 1VSKA 3NCIA 1C1CA 1RBTA 4GW6A 2QKKA 4O5BA 1HNVA 1U4BA 3L2WA 4C8LA 1BI4B 1KVCA 2A1RA 2OZMA 4CEQA 1VSIA 2F96A 4I7FA 4KV8A 3VQ8A 5KRSA 3QEIA 3SI6A 4DLEA 1X9WA 3NGZA 4CEDA 3SNNA 4AHCA 3HK2A 3V9XA 1JLEA 3LDSA 2QXFA 3K5MA 4IDKA 4CJTA 3RMAA 3B6OA 1ZBUA 3HVRA 2Y1IA 3WNFA 1RT3A 4F3TA 4CJVA 4W5OA 3NH2A 3VN5A 4OPKA 1QHTA 3ZSOA 3OYEA 4PWDA 1KSPA 4WE1A 1WSFA 4E0DA 2BGGA 3AO1A 4HUFA 4GVMA 4C8OA 3G0ZA 2KFNA 4B08A 1B92A 3LZIA 5FDLA 3ZSQA 4Z0UA 1KCFA 3DM2A 4HCCA 5CYQA 1Q8IA 4MQ3A 4CJ3A 3I0SA 2OYQA 2ZE2A 3KLIA 1N6QA 4KTWA 2YKMA 1KVAA 4KB1A 3JYTA 1VSEA 1S6QA 1SUQA 4KPYA 4FXDA 1QQCA 3U6FA 4B9VA 4OKJA 1QSYA 4IBNA 3AVJA 3DMJA 3OJUA 4DQQA 3AVNA 5FRNA 3NF6A 2HNYA 2VG7A 3HSTB 3AA4A 3O3GA 3SUOA 3MEDA 2JLEA 1RT6A 3LP1A 3ZT0A 2IS3A 1O1WA 2R7YA 1NK4A 3TARA 3AVLA 3OS2A 1SKRA 4LH5A 4CHZA 1JXEA 1L3VA 4CF8A 1C6VA 4CK3A 3KD5E 1X1PA 3KTQA 2D0AA 3MXIA 3BGRA 4PA1A 1IKVA 1RT5A 1SL2A 2ZD1A 5J2QA 4FJKA 5HROA 4DMNA 3KLFA 3DOKA 3KJVA 1LV5A 4EP4A 1CZ9A 5J2PA 4QCLA 3O4QA 4DS5A 3DLRA 3KLHA 5C24A 2OPQA 3TWHA 2GV9A 2HHSA 2NUBA 4CFBA 4FJ5A 3VQPA 4E7IA 3M8RA 2EX3A 4NCAA 3MEEA 3D45A 5KTQA 1RDDA 5HP1A 2JGUA 3P83D 4KRFA 1IKWA 4FJ8A 5CYMA 1VSHA 2D5RA 1XI1A 3OYDA 2IOCA 4CJQA 1S1WA 3KIOA 4NCGA 1QS4A 4B9SA 4FLZA 3AVFA 2HNZA 1XHZA 2IGIA 4ZHRA 3O3FA 1TL3A 3AVCA 1SL0A 4F3OA 2OPSA 2XY8A 4E7HA 3TAEA 4FJGA 4UQGA 1QSLA 3AA3A 3C95A 3WNHA 3NBPA 2DTUA 1ITGA 3V1RA 4DSFA 3ZSVA 4I9QA 4CHNA 3PUFA 3AO3A 4G1QA 4CF0A 4DFPA 4AILC 3AVMA 1KLMA 4OLAA 2B6AA 3AVAA 5KGWA 2YHBA 4HCBA 4JS4A 2X6NA 4BE1A 1CXQA 2G8FA 1KRPA 4FZXC 2ZQBA 3CM6A 3PX6A 4N56A 4DU4A 4KAZA 1GOBA 4DTUA 3ITHA 4PY5A 4OVLA 1BHLA 1JLAA 1HMVA 2FBTA 4TSXA 4O44A 5E41A 3AO2A 3VQEA 1TK0A 3LWLA 1EETA 2ITGA 3V81A 1REVA 1Z26A 1HQEA 1BCMA 2P5OA 3T19A 3ZSZA 3S3MA 1RT1A 3TABA 4DQSA 1W0HA 4IKFA 4DTNA 1C0UA 2OA8A 4Z4CA 4CEFA 1Z25A 2QK9A 4IFYA 3HP6A 2G8VA 1WNSA 4FJLA 2OPPA 4FJHA 2RN2A 3DYAA 4BE2A 1W9HA 4RW6A 5HRRA 4AHVA 4B9UA 1GOCA 4AH9A 4CHOA 4CFCA 1JKHA 4DSIA 3OYNA 4AHSA 4CGGA 2GBZA 1WAFA 2EHGA 5SWMA 2OPRA 4CFAA 3MECA 3CFRA 2E6MA 5J1EA 2Z1JA 3WNEA 3I0RA 4CEEA 4PUOA 3LWMA 1NK5A 4LSLA 1L3TA 3E01A 1XWLA 4KB0A 3AO5A 1BIZA 4M3ZA 3NGYA 5C42A 5FROA 1JL1A 3QINA 3PX0A 1HNIA 3L3VA 2FBYA 4FK0A 4CJSA 4FVMA 4M3XA 3OYMA 1YTUA 2HVHA 4Z4EA 3SUQA 4YFUA 3M8SA 3OYIA 2HHTA 3MXJA 4HUGA 2HVIA 2ETJA 1C0TA 4LD0A 3ISNC 1DTQA 1YVUA 5I42A 3QLHA 3VQDA 1LW0A 3NAEA 1X9MA 1MU2A 1EKEA 3F73A 1NOZA 4K8ZA 5J2NA 2P1JA 3QIPA 5JS2A 4CGHA 4DU3A 4JLHA 2IAJA 3L2UA 4B9TA 1WSEA 3OS1A 3CG7A 2HHQA 5D3GA 3VA0A 2G8HA 3QNNA 2RF2A 1NJWA 1K6YA 4ID1A 1S1TA 3HJFA 3RMCA 1KLNA 4HUEA 2KTQA 4ICLA 2VWKA 4KHWA 3EZ5A 1JLQA 2X74A 1CLQA 3KK1A 1IG9A 4FLXA 1BGXT 1RDAA 2BANA 2YKNA 1CXUA 1JL2A 3QO9A 2F8TA 3KLGA 4B3OA 2RKIA 4FW2A 1A5XA 1S6PA 4Z4GA 3RWUA 4H4OA 3HPOA 1RT7A 3MEGA 1J5OA 4CECA 4FLYA 1NK6A 2XO7A 3AA2A 2HHWA 3EYZA 3B6PA 1VK0A 3L3UA 3A2FA 1T05A 4IG0A 4E7KA 3DLHA 1VSFA 3OVNA 5DK5A 1LWEA 2VG5A 4CEZA 3AO4A 1HYZA 3VQ7A 3ZSRA 4I2PA 3SV3A 1JLGA 5SZTA 1XC9A 1NK7A 4CCHA 4KI6A 4KHQA 3NH0A 3OYHA 2PYJA 4CJRA 1DTTA 4FZZA 3HPHA 1ZYQA 2PZSA 2WOMA 2HHVA 4W5QA 1U45A 1TKDA 1HPZA 4FLVA 2IDOA 4DQRA 3RR7A 1ASWA 1Y97A 1ZBIA 2G8IA 4KTZA 4BDPA 4CGJA 1HJRA 3NF7A 3TANA 1NK9A 3ZSXA 1D9FA 4DG1A 1J53A 3KKSA 1YTAA 3LALA 4J2EA 4FK2A 1NJYA 1B9FA 2LSNA 1SV5A 2KFZA 4FJMA 1TKTA 2FBVA 3DRRA 3RTVA 5HRNA 1G15A 4BWJA 3V1QA 3OYKA 1FKOA 3TAQA 2Y1JA 3SCXA 3K59A 2XY6A 4DFKA 3RR8A 4N47A 4FCYA 3PO4A 1VRTA 4M3RA 1LW2A 3SQ4A 1SKSA 3ZSYA 3VQ6A 3KD1E 1TGOA 1X9SA 2E4LA 4M45A 1S9GA 3K57A 4RW4A 3VQAA 4F4KA 1RBVA 3PV8A 3I8DA 3MAQA 3AVHA 3DRPA 1HYSA 2HHXA 3OYAA 3OYGA 1ASUA 3K5NA 4KHSA 5EU7A 3L2RA 1BQNA 1WSIA 1S9EA 3VQCA 4HVJA 3NH1A 3LZJA 3ZT2A 4E3SA 1C1AA 3RMDA 4LH4A 3NGIA 2HW3A 3P5JA 3LANA 3IG1A 2KW4A 3K2PA 4CEBA 3OYCA 4FLUA 1UA0A 1YT3A 1VSJA 3M8QA 4NYNA 1C1BA 2YHAA 3HT3A 3D0PA 4FJJA 3OY9A 3V1OA 4C8NA 4O0JA 5HRPA 5T7BA 3V4IA 1RDBA 1RT4A 1L3SA 3UIQA 3ASMA 1NJZA 1TKXA 4R5PA 3K5LA 4M42A 4ID5A 4IFVA 1NKEA 1A5VA 5JS1A 2PYLA 1XHXA 2G8UA 1TV6A 4E1MA 3THVA 1JXBA 3SUPA 1KFDA 1WSGA 1SL1A 4ELTA 3QEVA 4DTRA 5DMRA 4BDYA 5CZ2A 1TAQA 3V9SA 4DTPA 4OGCA 4AHTA 4CIEA 4FJ9A 1TKZA 1RTJA 3AVKA 3SJJA 1IH7A 5HBMA 3VQQA 5K14A 3K5OA 4CFDA 4IG3A 3VA3A 1BISA 4CJPA 4BE0A 4BWMA 1U47A 4CJFA 1LAVA 1UOCA 2HB5A 2Z1IA 3IRXA 4O55A 4RW7A 3MXMA 1ZBLA 2G8KA 3QEXA 3S3NA 4FJIA 4N41A 1RBRA 4MFBA 1HYVA 3C6TA 1BCOA 1D5AA 4DTOA 1LWFA 3SPYA 3T1AA 2YNFA 4CERA 2VWJA 4DF8A 2X78A 3ZT4A 1NK0A 1BQMA 1VSLA 3IAYA 3HYFA 4FJXA 1TVRA 1WAJA 4Z4HA 4C8KA 4ELVA 4DSKA 2HHUA 3QETA 4DF4A 4M3WA 4KI4A 4E7JA 3OJSA 4AHUA 3TI0A 3FFIA 1JLBA 1LAWA 4FLWA 4DSLA 4LSNA 1LWCA 3VQ9A 4JS5A 1C0MA 4B9NA 4B9MA 4I2QA 3HXMA 4CJUA 2F8SA 1BI4A 3SV4A 4BDZA 2VG6A 1FKPA 1HRHA 3V6DA 3KK2A 3QEPA 1TK5A 3PY8A 4DTSA 1VSMA 4ELUA 4DLGA 1RNHA 3C6UA 1U49A 3OYBA 1WSHA 3O4NA 2IC3A 4RW9A 3TAMA 4Q5VA 1ASVA 4DU1A 3AVBA 3QESA 5KI6A 2P51A 3AA5X 4CJWA 4YNQA 3BDPA 1I39A 3NHGA 3L2QA 3DOLA 3CQ8A 2KQ2A 4NCBA 4QOZB 1T8EA 3TAGA 1UAXA 1QE1A 1TL1A 4CJEA 1BL3A 1RBSA 3V9ZA 1U48A 4I9LA 4CIFA 4FZYA 2B4JA 3QNOA 4F2RA 4CK1A 2DY4A 4M3TA 4KREA 4K8XA 1N5YA 2ATQA 3U3GA 4CHPA 4B8AB 3CFPA 3L8BA 1WSJA 3F9KA 3QIOA 2DFHA 1DLOA 3LPTA 4JRPA 2XY7A 2O4GA 3O3HA 4DSEA 4M3UA 3LP3A 3SZ2A 3SQ1A 1L5UA 1R0AA 1Q9YA 5FRMA 2DFFA 4CEOA 2O4IA 4RG8A 2A1SA 4CK2A 1RDCA 2WONA 3IS9A 4CF2A 3CFOA 1UWBA 4LY7A 2XHBA 1U04A 4W5RA 3NE6A 3V9WA 1T03A 1J54A 4JRQA 4FJNA 2KZMA 5CY4A 4DFJA 5J2MA 1S5JA 4CJKA 3ULDA 4F8RA 5C25A 4PQUA 4E19A 1SKWA 4L8RB 1NOYA 4B9LA 1I3AA 1EP4A 4CGFA 3SUNA 1D8YA 4ZTFA 2YV0X 5HRSA 4FJ7A 1TK8A 3C94A 3NF8A 2PY5A 1JLFA 4CE9A 3DLKA 4KHNA 1B9DA 4CIGA 3RMBA 5KGXA 3AVIA 2HMIA 1RCHA 3DI6A 4DTXA 2YNIA 3DRSA 3OYLA 2X6SA 3NDKA 3G10A 1CZBA 4OPJA 1L3UA 3ZCMA 3OYFA 1EXQA 1NKCA 1Q9XA 3SPZA 3LP2A 3NF9A 4O0IA 5HLFA 3VQBA 4M41A 1ZBFA 1NK8A 4FK4A 4CF1A 4CGDA 1S1UA 3VQ5A 3ZT3A 3HL8A 3OS0A 3HP9A 1KFSA 3KKRA 4CJ4A 4FYDA 3LAMA 1IKXA 2G8WA 2OZSA 3TR8A 1NKBA 1S1VA 4FM0A 3TAPA 1RTDA 4O4GA 2HNDA 4DSJA 4DWIA 3ZT1A 4OKEA 3LAKA 4HTUA 1HQUA 4XIUA 4FW1A 2KZZA 1RT2A 4CHYA 1VSDA 4OLBA 3JSMA 4CF9A 1FXXA 3SYZA 3HPGA 1WLJA 4W5NA 4NYFA 1QSSA 4DTJA 1KVBA 3EY1A 3WNGA 3PO5A 1F21A 3KK3A 4HHTA 4DQPA 2BDPA 4CGIA 1VRUA 3RRHA 3L2VA 1GOAA 1A5WA 4AHRA 4E89A 4FM1A 3H08A 4KO0A 4H4MA 2W42A 3S3OA 1WN7A 4CJLA 4ZTJA 3DLGA 3HVTA 2Z1GA 3RRGA 3CYMA 3V9UA 1JLCA 2FBXA 3ALYA 3P1GA 2YNHA 4KTQA 1KTQA 1J9AA 3LPUA 3KLEA 5KRTA 2E6LA 2XRIA 4C8MA 3CM5A 3HO1A 2B5JA 3T3FA 4FM2A 4DTMA 4QAGA 4OGEA 2QKBA 1T7PA 4F2SA 3DLEA 4EZ9A 3ZSWA 4W5TA 2XY5A 3SQ0A 1QTMA 2Q3SA 4OKKA 3LP0A 4J2BA 4KHYA 3TAFA 2P5GA 2GUIA 3PX4A 1RILA 1IKYA 4B8CA 2DFEA 1EX4A 1RTIA 4KKOA 4CHQA 3OYJA 4CESA 3U3YA 3M8PA 3VQ4A 1UA1A 2D0CA 4Z4FA 2AJQA 4CJ5A 1RTHA 4J2DA 2RPIA 4EZ6A 1IO2A 4KFBA 1S1XA 4BACA 4OJRA 3AVGA 4DS4A 2I5JA 4M3YA 1RBUA 4N76A 1D9DA 1ZBHA 1FK9A 4J2AA 4E7LA 3NFAA 1TAUA 4GMJB 3DLBA 4H8KA 2BE2A 2D0BA 4N5SA 4Q0BA 4DQIA 5I3UA 4RW8A 2FC0A 4DFMA 4CEAA 3HM9A 4Y1DA 5CZ1A 4EP5A 3AV9A 4Y1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1H A;  3K58 A;  4Z4I A;  2YNG A;  4E1N A;  3QER A;  3SQ2 A;  1BIU A;  3QEW A;  1NJX A;  3S9H A;  4FLT A;  4KHU A;  1VSK A;  3NCI A;  1C1C A;  1RBT A;  4GW6 A;  2QKK A;  4O5B A;  1HNV A;  1U4B A;  3L2W A;  4C8L A;  1BI4 B;  1KVC A;  2A1R A;  2OZM A;  4CEQ A;  1VSI A;  2F96 A;  4I7F A;  4KV8 A;  3VQ8 A;  5KRS A;  3QEI A;  3SI6 A;  4DLE A;  1X9W A;  3NGZ A;  4CED A;  3SNN A;  4AHC A;  3HK2 A;  3V9X A;  1JLE A;  3LDS A;  2QXF A;  3K5M A;  4IDK A;  4CJT A;  3RMA A;  3B6O A;  1ZBU A;  3HVR A;  2Y1I A;  3WNF A;  1RT3 A;  4F3T A;  4CJV A;  4W5O A;  3NH2 A;  3VN5 A;  4OPK A;  1QHT A;  3ZSO A;  3OYE A;  4PWD A;  1KSP A;  4WE1 A;  1WSF A;  4E0D A;  2BGG A;  3AO1 A;  4HUF A;  4GVM A;  4C8O A;  3G0Z A;  2KFN A;  4B08 A;  1B92 A;  3LZI A;  5FDL A;  3ZSQ A;  4Z0U A;  1KCF A;  3DM2 A;  4HCC A;  5CYQ A;  1Q8I A;  4MQ3 A;  4CJ3 A;  3I0S A;  2OYQ A;  2ZE2 A;  3KLI A;  1N6Q A;  4KTW A;  2YKM A;  1KVA A;  4KB1 A;  3JYT A;  1VSE A;  1S6Q A;  1SUQ A;  4KPY A;  4FXD A;  1QQC A;  3U6F A;  4B9V A;  4OKJ A;  1QSY A;  4IBN A;  3AVJ A;  3DMJ A;  3OJU A;  4DQQ A;  3AVN A;  5FRN A;  3NF6 A;  2HNY A;  2VG7 A;  3HST B;  3AA4 A;  3O3G A;  3SUO A;  3MED A;  2JLE A;  1RT6 A;  3LP1 A;  3ZT0 A;  2IS3 A;  1O1W A;  2R7Y A;  1NK4 A;  3TAR A;  3AVL A;  3OS2 A;  1SKR A;  4LH5 A;  4CHZ A;  1JXE A;  1L3V A;  4CF8 A;  1C6V A;  4CK3 A;  3KD5 E;  1X1P A;  3KTQ A;  2D0A A;  3MXI A;  3BGR A;  4PA1 A;  1IKV A;  1RT5 A;  1SL2 A;  2ZD1 A;  5J2Q A;  4FJK A;  5HRO A;  4DMN A;  3KLF A;  3DOK A;  3KJV A;  1LV5 A;  4EP4 A;  1CZ9 A;  5J2P A;  4QCL A;  3O4Q A;  4DS5 A;  3DLR A;  3KLH A;  5C24 A;  2OPQ A;  3TWH A;  2GV9 A;  2HHS A;  2NUB A;  4CFB A;  4FJ5 A;  3VQP A;  4E7I A;  3M8R A;  2EX3 A;  4NCA A;  3MEE A;  3D45 A;  5KTQ A;  1RDD A;  5HP1 A;  2JGU A;  3P83 D;  4KRF A;  1IKW A;  4FJ8 A;  5CYM A;  1VSH A;  2D5R A;  1XI1 A;  3OYD A;  2IOC A;  4CJQ A;  1S1W A;  3KIO A;  4NCG A;  1QS4 A;  4B9S A;  4FLZ A;  3AVF A;  2HNZ A;  1XHZ A;  2IGI A;  4ZHR A;  3O3F A;  1TL3 A;  3AVC A;  1SL0 A;  4F3O A;  2OPS A;  2XY8 A;  4E7H A;  3TAE A;  4FJG A;  4UQG A;  1QSL A;  3AA3 A;  3C95 A;  3WNH A;  3NBP A;  2DTU A;  1ITG A;  3V1R A;  4DSF A;  3ZSV A;  4I9Q A;  4CHN A;  3PUF A;  3AO3 A;  4G1Q A;  4CF0 A;  4DFP A;  4AIL C;  3AVM A;  1KLM A;  4OLA A;  2B6A A;  3AVA A;  5KGW A;  2YHB A;  4HCB A;  4JS4 A;  2X6N A;  4BE1 A;  1CXQ A;  2G8F A;  1KRP A;  4FZX C;  2ZQB A;  3CM6 A;  3PX6 A;  4N56 A;  4DU4 A;  4KAZ A;  1GOB A;  4DTU A;  3ITH A;  4PY5 A;  4OVL A;  1BHL A;  1JLA A;  1HMV A;  2FBT A;  4TSX A;  4O44 A;  5E41 A;  3AO2 A;  3VQE A;  1TK0 A;  3LWL A;  1EET A;  2ITG A;  3V81 A;  1REV A;  1Z26 A;  1HQE A;  1BCM A;  2P5O A;  3T19 A;  3ZSZ A;  3S3M A;  1RT1 A;  3TAB A;  4DQS A;  1W0H A;  4IKF A;  4DTN A;  1C0U A;  2OA8 A;  4Z4C A;  4CEF A;  1Z25 A;  2QK9 A;  4IFY A;  3HP6 A;  2G8V A;  1WNS A;  4FJL A;  2OPP A;  4FJH A;  2RN2 A;  3DYA A;  4BE2 A;  1W9H A;  4RW6 A;  5HRR A;  4AHV A;  4B9U A;  1GOC A;  4AH9 A;  4CHO A;  4CFC A;  1JKH A;  4DSI A;  3OYN A;  4AHS A;  4CGG A;  2GBZ A;  1WAF A;  2EHG A;  5SWM A;  2OPR A;  4CFA A;  3MEC A;  3CFR A;  2E6M A;  5J1E A;  2Z1J A;  3WNE A;  3I0R A;  4CEE A;  4PUO A;  3LWM A;  1NK5 A;  4LSL A;  1L3T A;  3E01 A;  1XWL A;  4KB0 A;  3AO5 A;  1BIZ A;  4M3Z A;  3NGY A;  5C42 A;  5FRO A;  1JL1 A;  3QIN A;  3PX0 A;  1HNI A;  3L3V A;  2FBY A;  4FK0 A;  4CJS A;  4FVM A;  4M3X A;  3OYM A;  1YTU A;  2HVH A;  4Z4E A;  3SUQ A;  4YFU A;  3M8S A;  3OYI A;  2HHT A;  3MXJ A;  4HUG A;  2HVI A;  2ETJ A;  1C0T A;  4LD0 A;  3ISN C;  1DTQ A;  1YVU A;  5I42 A;  3QLH A;  3VQD A;  1LW0 A;  3NAE A;  1X9M A;  1MU2 A;  1EKE A;  3F73 A;  1NOZ A;  4K8Z A;  5J2N A;  2P1J A;  3QIP A;  5JS2 A;  4CGH A;  4DU3 A;  4JLH A;  2IAJ A;  3L2U A;  4B9T A;  1WSE A;  3OS1 A;  3CG7 A;  2HHQ A;  5D3G A;  3VA0 A;  2G8H A;  3QNN A;  2RF2 A;  1NJW A;  1K6Y A;  4ID1 A;  1S1T A;  3HJF A;  3RMC A;  1KLN A;  4HUE A;  2KTQ A;  4ICL A;  2VWK A;  4KHW A;  3EZ5 A;  1JLQ A;  2X74 A;  1CLQ A;  3KK1 A;  1IG9 A;  4FLX A;  1BGX T;  1RDA A;  2BAN A;  2YKN A;  1CXU A;  1JL2 A;  3QO9 A;  2F8T A;  3KLG A;  4B3O A;  2RKI A;  4FW2 A;  1A5X A;  1S6P A;  4Z4G A;  3RWU A;  4H4O A;  3HPO A;  1RT7 A;  3MEG A;  1J5O A;  4CEC A;  4FLY A;  1NK6 A;  2XO7 A;  3AA2 A;  2HHW A;  3EYZ A;  3B6P A;  1VK0 A;  3L3U A;  3A2F A;  1T05 A;  4IG0 A;  4E7K A;  3DLH A;  1VSF A;  3OVN A;  5DK5 A;  1LWE A;  2VG5 A;  4CEZ A;  3AO4 A;  1HYZ A;  3VQ7 A;  3ZSR A;  4I2P A;  3SV3 A;  1JLG A;  5SZT A;  1XC9 A;  1NK7 A;  4CCH A;  4KI6 A;  4KHQ A;  3NH0 A;  3OYH A;  2PYJ A;  4CJR A;  1DTT A;  4FZZ A;  3HPH A;  1ZYQ A;  2PZS A;  2WOM A;  2HHV A;  4W5Q A;  1U45 A;  1TKD A;  1HPZ A;  4FLV A;  2IDO A;  4DQR A;  3RR7 A;  1ASW A;  1Y97 A;  1ZBI A;  2G8I A;  4KTZ A;  4BDP A;  4CGJ A;  1HJR A;  3NF7 A;  3TAN A;  1NK9 A;  3ZSX A;  1D9F A;  4DG1 A;  1J53 A;  3KKS A;  1YTA A;  3LAL A;  4J2E A;  4FK2 A;  1NJY A;  1B9F A;  2LSN A;  1SV5 A;  2KFZ A;  4FJM A;  1TKT A;  2FBV A;  3DRR A;  3RTV A;  5HRN A;  1G15 A;  4BWJ A;  3V1Q A;  3OYK A;  1FKO A;  3TAQ A;  2Y1J A;  3SCX A;  3K59 A;  2XY6 A;  4DFK A;  3RR8 A;  4N47 A;  4FCY A;  3PO4 A;  1VRT A;  4M3R A;  1LW2 A;  3SQ4 A;  1SKS A;  3ZSY A;  3VQ6 A;  3KD1 E;  1TGO A;  1X9S A;  2E4L A;  4M45 A;  1S9G A;  3K57 A;  4RW4 A;  3VQA A;  4F4K A;  1RBV A;  3PV8 A;  3I8D A;  3MAQ A;  3AVH A;  3DRP A;  1HYS A;  2HHX A;  3OYA A;  3OYG A;  1ASU A;  3K5N A;  4KHS A;  5EU7 A;  3L2R A;  1BQN A;  1WSI A;  1S9E A;  3VQC A;  4HVJ A;  3NH1 A;  3LZJ A;  3ZT2 A;  4E3S A;  1C1A A;  3RMD A;  4LH4 A;  3NGI A;  2HW3 A;  3P5J A;  3LAN A;  3IG1 A;  2KW4 A;  3K2P A;  4CEB A;  3OYC A;  4FLU A;  1UA0 A;  1YT3 A;  1VSJ A;  3M8Q A;  4NYN A;  1C1B A;  2YHA A;  3HT3 A;  3D0P A;  4FJJ A;  3OY9 A;  3V1O A;  4C8N A;  4O0J A;  5HRP A;  5T7B A;  3V4I A;  1RDB A;  1RT4 A;  1L3S A;  3UIQ A;  3ASM A;  1NJZ A;  1TKX A;  4R5P A;  3K5L A;  4M42 A;  4ID5 A;  4IFV A;  1NKE A;  1A5V A;  5JS1 A;  2PYL A;  1XHX A;  2G8U A;  1TV6 A;  4E1M A;  3THV A;  1JXB A;  3SUP A;  1KFD A;  1WSG A;  1SL1 A;  4ELT A;  3QEV A;  4DTR A;  5DMR A;  4BDY A;  5CZ2 A;  1TAQ A;  3V9S A;  4DTP A;  4OGC A;  4AHT A;  4CIE A;  4FJ9 A;  1TKZ A;  1RTJ A;  3AVK A;  3SJJ A;  1IH7 A;  5HBM A;  3VQQ A;  5K14 A;  3K5O A;  4CFD A;  4IG3 A;  3VA3 A;  1BIS A;  4CJP A;  4BE0 A;  4BWM A;  1U47 A;  4CJF A;  1LAV A;  1UOC A;  2HB5 A;  2Z1I A;  3IRX A;  4O55 A;  4RW7 A;  3MXM A;  1ZBL A;  2G8K A;  3QEX A;  3S3N A;  4FJI A;  4N41 A;  1RBR A;  4MFB A;  1HYV A;  3C6T A;  1BCO A;  1D5A A;  4DTO A;  1LWF A;  3SPY A;  3T1A A;  2YNF A;  4CER A;  2VWJ A;  4DF8 A;  2X78 A;  3ZT4 A;  1NK0 A;  1BQM A;  1VSL A;  3IAY A;  3HYF A;  4FJX A;  1TVR A;  1WAJ A;  4Z4H A;  4C8K A;  4ELV A;  4DSK A;  2HHU A;  3QET A;  4DF4 A;  4M3W A;  4KI4 A;  4E7J A;  3OJS A;  4AHU A;  3TI0 A;  3FFI A;  1JLB A;  1LAW A;  4FLW A;  4DSL A;  4LSN A;  1LWC A;  3VQ9 A;  4JS5 A;  1C0M A;  4B9N A;  4B9M A;  4I2Q A;  3HXM A;  4CJU A;  2F8S A;  1BI4 A;  3SV4 A;  4BDZ A;  2VG6 A;  1FKP A;  1HRH A;  3V6D A;  3KK2 A;  3QEP A;  1TK5 A;  3PY8 A;  4DTS A;  1VSM A;  4ELU A;  4DLG A;  1RNH A;  3C6U A;  1U49 A;  3OYB A;  1WSH A;  3O4N A;  2IC3 A;  4RW9 A;  3TAM A;  4Q5V A;  1ASV A;  4DU1 A;  3AVB A;  3QES A;  5KI6 A;  2P51 A;  3AA5 X;  4CJW A;  4YNQ A;  3BDP A;  1I39 A;  3NHG A;  3L2Q A;  3DOL A;  3CQ8 A;  2KQ2 A;  4NCB A;  4QOZ B;  1T8E A;  3TAG A;  1UAX A;  1QE1 A;  1TL1 A;  4CJE A;  1BL3 A;  1RBS A;  3V9Z A;  1U48 A;  4I9L A;  4CIF A;  4FZY A;  2B4J A;  3QNO A;  4F2R A;  4CK1 A;  2DY4 A;  4M3T A;  4KRE A;  4K8X A;  1N5Y A;  2ATQ A;  3U3G A;  4CHP A;  4B8A B;  3CFP A;  3L8B A;  1WSJ A;  3F9K A;  3QIO A;  2DFH A;  1DLO A;  3LPT A;  4JRP A;  2XY7 A;  2O4G A;  3O3H A;  4DSE A;  4M3U A;  3LP3 A;  3SZ2 A;  3SQ1 A;  1L5U A;  1R0A A;  1Q9Y A;  5FRM A;  2DFF A;  4CEO A;  2O4I A;  4RG8 A;  2A1S A;  4CK2 A;  1RDC A;  2WON A;  3IS9 A;  4CF2 A;  3CFO A;  1UWB A;  4LY7 A;  2XHB A;  1U04 A;  4W5R A;  3NE6 A;  3V9W A;  1T03 A;  1J54 A;  4JRQ A;  4FJN A;  2KZM A;  5CY4 A;  4DFJ A;  5J2M A;  1S5J A;  4CJK A;  3ULD A;  4F8R A;  5C25 A;  4PQU A;  4E19 A;  1SKW A;  4L8R B;  1NOY A;  4B9L A;  1I3A A;  1EP4 A;  4CGF A;  3SUN A;  1D8Y A;  4ZTF A;  2YV0 X;  5HRS A;  4FJ7 A;  1TK8 A;  3C94 A;  3NF8 A;  2PY5 A;  1JLF A;  4CE9 A;  3DLK A;  4KHN A;  1B9D A;  4CIG A;  3RMB A;  5KGX A;  3AVI A;  2HMI A;  1RCH A;  3DI6 A;  4DTX A;  2YNI A;  3DRS A;  3OYL A;  2X6S A;  3NDK A;  3G10 A;  1CZB A;  4OPJ A;  1L3U A;  3ZCM A;  3OYF A;  1EXQ A;  1NKC A;  1Q9X A;  3SPZ A;  3LP2 A;  3NF9 A;  4O0I A;  5HLF A;  3VQB A;  4M41 A;  1ZBF A;  1NK8 A;  4FK4 A;  4CF1 A;  4CGD A;  1S1U A;  3VQ5 A;  3ZT3 A;  3HL8 A;  3OS0 A;  3HP9 A;  1KFS A;  3KKR A;  4CJ4 A;  4FYD A;  3LAM A;  1IKX A;  2G8W A;  2OZS A;  3TR8 A;  1NKB A;  1S1V A;  4FM0 A;  3TAP A;  1RTD A;  4O4G A;  2HND A;  4DSJ A;  4DWI A;  3ZT1 A;  4OKE A;  3LAK A;  4HTU A;  1HQU A;  4XIU A;  4FW1 A;  2KZZ A;  1RT2 A;  4CHY A;  1VSD A;  4OLB A;  3JSM A;  4CF9 A;  1FXX A;  3SYZ A;  3HPG A;  1WLJ A;  4W5N A;  4NYF A;  1QSS A;  4DTJ A;  1KVB A;  3EY1 A;  3WNG A;  3PO5 A;  1F21 A;  3KK3 A;  4HHT A;  4DQP A;  2BDP A;  4CGI A;  1VRU A;  3RRH A;  3L2V A;  1GOA A;  1A5W A;  4AHR A;  4E89 A;  4FM1 A;  3H08 A;  4KO0 A;  4H4M A;  2W42 A;  3S3O A;  1WN7 A;  4CJL A;  4ZTJ A;  3DLG A;  3HVT A;  2Z1G A;  3RRG A;  3CYM A;  3V9U A;  1JLC A;  2FBX A;  3ALY A;  3P1G A;  2YNH A;  4KTQ A;  1KTQ A;  1J9A A;  3LPU A;  3KLE A;  5KRT A;  2E6L A;  2XRI A;  4C8M A;  3CM5 A;  3HO1 A;  2B5J A;  3T3F A;  4FM2 A;  4DTM A;  4QAG A;  4OGE A;  2QKB A;  1T7P A;  4F2S A;  3DLE A;  4EZ9 A;  3ZSW A;  4W5T A;  2XY5 A;  3SQ0 A;  1QTM A;  2Q3S A;  4OKK A;  3LP0 A;  4J2B A;  4KHY A;  3TAF A;  2P5G A;  2GUI A;  3PX4 A;  1RIL A;  1IKY A;  4B8C A;  2DFE A;  1EX4 A;  1RTI A;  4KKO A;  4CHQ A;  3OYJ A;  4CES A;  3U3Y A;  3M8P A;  3VQ4 A;  1UA1 A;  2D0C A;  4Z4F A;  2AJQ A;  4CJ5 A;  1RTH A;  4J2D A;  2RPI A;  4EZ6 A;  1IO2 A;  4KFB A;  1S1X A;  4BAC A;  4OJR A;  3AVG A;  4DS4 A;  2I5J A;  4M3Y A;  1RBU A;  4N76 A;  1D9D A;  1ZBH A;  1FK9 A;  4J2A A;  4E7L A;  3NFA A;  1TAU A;  4GMJ B;  3DLB A;  4H8K A;  2BE2 A;  2D0B A;  4N5S A;  4Q0B A;  4DQI A;  5I3U A;  4RW8 A;  2FC0 A;  4DFM A;  4CEA A;  3HM9 A;  4Y1D A;  5CZ1 A;  4EP5 A;  3AV9 A;  4Y1C A; 
#chains in the Genus database with same CATH topology
 3K58 A;  1NJX A;  3SQ2 A;  2HBL A;  4YOX A;  2QKK A;  1U4B A;  1BI4 B;  3MX2 A;  2OZM A;  4XH1 A;  2P9U B;  4I7F A;  4KV8 A;  3SI6 A;  2E2P A;  2CGJ A;  4CED A;  3DXM A;  3SNN A;  2P9N A;  4LFC K;  2W6K A;  3KWG A;  3SAG A;  3LDS A;  2QXF A;  4CJT A;  3D2F A;  3WNF A;  1NGE A;  4OPK A;  3OYE A;  4B1V A;  4IO9 L;  3AO1 A;  2KLA A;  4HUF A;  4C8O A;  1FJG K;  4JKG B;  3LZI A;  3UKU A;  1KCF A;  5CR4 A;  1M90 O;  3I0S A;  4JN4 A;  2ZE2 A;  2OYQ A;  2CH6 A;  3AGK A;  3MCP A;  2P9P A;  3ZX0 A;  1S6Q A;  1SUQ A;  4FXD A;  1HKC A;  4A5B A;  1N34 K;  2NRW A;  3AVJ A;  3TU5 A;  4DQQ A;  1BO5 O;  3AA4 A;  3GE1 A;  4JK7 A;  3HZ6 A;  3LP1 A;  2R7Y A;  5AQY A;  3TAR A;  4JKD A;  3D2E B;  3WQT A;  4IO8 A;  4CVN E;  4CK3 A;  2ASM A;  3KD5 E;  1X1P A;  4BRM A;  3KTQ A;  3BGR A;  4LF4 K;  1P90 A;  4PKG A;  3KLF A;  4JI1 K;  4EP4 A;  4AM7 A;  2OPQ A;  2NUB A;  4FJ5 A;  2ZJP L;  4U67 L;  1RDD A;  2JGU A;  1IKW A;  4YOU A;  5C2F A;  2IOC A;  5AZI A;  1S1W A;  4NCG A;  5BN8 A;  3LDP A;  3WUH A;  1V4T A;  2HOE A;  3AVF A;  4FLZ A;  2IGI A;  1VQN N;  4JKE A;  3FR0 A;  4F3O A;  2XY8 A;  3TAE A;  4DR2 K;  2NRR A;  4FJG A;  3NBP A;  4YY3 K;  4X62 K;  3AO3 A;  4NXM K;  4DFP A;  4CZF A;  5I9E B;  3AVA A;  3QBW A;  2BTF A;  3MCA B;  3LM2 A;  1CXQ A;  4BE1 A;  4JNE A;  5FPM A;  2V7Z A;  3CC2 N;  3JAM O;  2IVO A;  4BRQ A;  5AQU A;  3LWL A;  3G25 A;  1Z26 A;  4EFH A;  3CCL N;  4IKF A;  4DTN A;  5BRE A;  1X9J A;  4Z4C A;  3H6E A;  4IFY A;  1NJI O;  2OPP A;  3SBG A;  3DXK B;  5HRR A;  4DSI A;  1GOC A;  4CGG A;  1WAF A;  2EHG A;  1W97 L;  4KB0 A;  1XWL A;  5EXW A;  2JWK A;  1VHX A;  3HRG A;  4CD1 A;  3L3V A;  1Y64 A;  2FBY A;  2IIR A;  5AZJ B;  1HUX A;  3MWT A;  4FVM A;  4CJS A;  1YTU A;  2HVH A;  4Z4E A;  3SUQ A;  3CI5 A;  2V51 B;  3J7A P;  1Q81 O;  3GL1 A;  1C0T A;  3ISN C;  3QLH A;  2BUP A;  1QZ5 A;  3F5T A;  4LFA K;  3NAE A;  3F73 A;  3N4P A;  4I6M A;  3LDN A;  4JLH A;  4DU3 A;  1WSE A;  3OS1 A;  3CG7 A;  2HHQ A;  3VA0 A;  1K6Y A;  4ID1 A;  2DPN A;  2HBJ A;  3RMC A;  5F1X A;  1LCU A;  4HUE A;  2KTQ A;  2X74 A;  3EKU A;  4FLX A;  2W41 A;  3EE8 A;  2E8A A;  1RDA A;  5AQN A;  4O8U A;  3QO9 A;  3THW B;  2F8T A;  1GLC G;  1A5X A;  4CJ7 A;  1DKG D;  1RT7 A;  3O6W A;  3MEG A;  3R3L A;  3AA2 A;  2WFB A;  1LOT B;  1VK0 A;  4IG0 A;  3DLH A;  3K0S A;  2VG5 A;  2QEX N;  1XNQ K;  4I2P A;  4CCH A;  1S72 N;  3PLA A;  1WBB A;  2PYJ A;  4CJR A;  1ZYQ A;  4LC9 B;  2PZS A;  1NGA A;  3T7Z A;  4BDP A;  4BRL A;  4CGJ A;  3NF7 A;  1U2V A;  1WBD A;  3VER A;  4CD3 A;  4LFB K;  3CQX A;  3O1B A;  4IZ9 A;  2Q0R A;  5E84 A;  2LSN A;  1SV5 A;  3VGM A;  3RTV A;  3DRR A;  4BC3 A;  3AY9 A;  1HKG A;  4FCY A;  4FWQ A;  4M3R A;  4H5V A;  3VQ6 A;  4DKW A;  3C65 A;  3K57 A;  1YHQ N;  1NU0 A;  3VQA A;  1EO1 A;  3MDQ A;  3MAQ A;  4DR1 K;  3OYA A;  5EVZ A;  3OYG A;  4CZJ A;  5EU7 A;  4HVJ A;  1C1A A;  4LH4 A;  1GLA G;  3K2P A;  2KW4 A;  3DAW A;  3W0L A;  2UUA K;  2P9K B;  4X64 K;  3HT3 A;  3D0P A;  4FJJ A;  5C0Y A;  3OY9 A;  3V1O A;  4C8N A;  5AQJ A;  1RDB A;  1L3S A;  3ASM A;  3D7E O;  3O9T A;  2AA4 A;  3E9L A;  1NJZ A;  5DM7 L;  2Q0U A;  2E20 A;  1NKE A;  1XHX A;  1TV6 A;  4JI5 K;  1JXB A;  2FLO A;  1KFD A;  4MLH A;  2QI2 A;  5DMR A;  3V9S A;  2QW9 A;  3K9J A;  1TKZ A;  3AVK A;  3SJJ A;  4CFD A;  3B8A X;  3K5O A;  2NNW A;  3FGU A;  3TSU A;  1UOC A;  2G8K A;  4RW7 A;  3S3N A;  4N41 A;  3VF6 A;  1RBR A;  1HYV A;  4DTO A;  3SMP A;  2QWR A;  5LY3 A;  1WAJ A;  3VF4 A;  4DSK A;  3CJB A;  4DF4 A;  4KI4 A;  3O9Q A;  4FLW A;  5HOO A;  4B9N A;  2F8S A;  2A42 A;  3WEE B;  1FKP A;  3QEP A;  5M1K A;  4DTS A;  3EL2 A;  3H46 O;  4IWV A;  4BRI A;  4DLG A;  1WSH A;  3O4N A;  3TAM A;  2O8F B;  2ZJR L;  3AVB A;  4CJW A;  4YNQ A;  1RDW X;  5ADX A;  2HMP A;  4BR5 A;  2KQ2 A;  3GBT A;  5AQZ A;  1T8E A;  3T1Y K;  4LF5 K;  1TL1 A;  1IG8 A;  3V9Z A;  1U48 A;  1RBS A;  4CIF A;  4FZY A;  3OHR A;  4CK1 A;  4DUZ K;  4M3T A;  5LMU K;  3TSQ A;  4CHP A;  3CFP A;  1T44 A;  1QVF M;  3VMF B;  1BUP A;  3VEW A;  2XY7 A;  3O3H A;  3LP3 A;  3SZ2 A;  3SQ1 A;  5FRM A;  2DFF A;  3U8X A;  3LL3 A;  3H45 C;  4JHD B;  2NLX A;  4FWR A;  5CY4 A;  4DFJ A;  4CJK A;  4F8R A;  5AR0 A;  4BRD A;  4B9L A;  1I3A A;  3IDH A;  3RSE A;  4FJ7 A;  2PY5 A;  1JLF A;  1B9D A;  4CIG A;  3RMB A;  5KGX A;  1RCH A;  4JI7 K;  4OPJ A;  1NKC A;  1KXP A;  1Q9X A;  2WUS A;  3LP2 A;  3NF9 A;  3EZW A;  3QML A;  1S1U A;  3ZT3 A;  4FO0 A;  1NGH A;  2G8W A;  2OZS A;  3TR8 A;  4FM0 A;  3TAP A;  3J7Y P;  3ZT1 A;  4HTU A;  1HQU A;  2KZZ A;  4BY9 C;  4OLB A;  3SAF A;  3SYZ A;  1JCE A;  4IEE A;  3KK3 A;  4BRH A;  3UB5 A;  1VQK N;  1NGD A;  2HF4 A;  2OCE A;  4DR5 K;  4H4M A;  3TTF A;  5BRF A;  3S3O A;  4ISF A;  2UYT A;  3CYM A;  5KPT A;  4JYA K;  3P1G A;  1KTQ A;  3E1Y A;  2KKZ A;  5KRT A;  3J81 O;  3CCR N;  2XRI A;  4C8M A;  5M1P A;  3T3F A;  4QAG A;  1T7P A;  4F2S A;  4EZ9 A;  2DTU A;  3ZSW A;  2QWM A;  3BP8 A;  3TAF A;  2HBK A;  1YJN N;  5BPN A;  1XMQ K;  3VEX A;  4K43 A;  4CES A;  3M8P A;  5BRD A;  2D0C A;  4CJ5 A;  1QZ6 A;  2RPI A;  1S1X A;  4XEI A;  4OJR A;  3SBT A;  3WXI A;  1FK9 A;  4MDB A;  1ATS A;  2P9N B;  4N5S A;  5I3U A;  2FC0 A;  3D2F B;  4CEA A;  3AV9 A;  3ENB A;  2Z1H A;  1VQM N;  4Z4I A;  1E3M A;  2E1Z A;  4IDH A;  4FLT A;  2Q2R A;  4JKG A;  4JAX A;  1HNV A;  3L2W A;  4C8L A;  1KVC A;  4WFB L;  4CEQ A;  3IUC A;  2F96 A;  3QEI A;  3VQ8 A;  5KQD A;  1ILY A;  3NGZ A;  4AHC A;  3HK2 A;  2NRX A;  3KWI A;  2P9P B;  1NGC A;  3K5M A;  3RMA A;  1RT3 A;  4F3T A;  3QDK A;  4IFE A;  3NH2 A;  4IOC L;  5C12 A;  4WQ4 C;  5KQ8 A;  5AQK A;  3ID6 A;  1Q86 O;  4FWM A;  4HCC A;  2WTU A;  1Q8I A;  4MQ3 A;  1N6Q A;  2YKM A;  2O8D B;  4KB1 A;  4DR3 K;  1VSE A;  2ITM A;  3CIP A;  3U6F A;  4OKJ A;  3A5N C;  2NRH A;  3DMJ A;  4BC5 A;  3OJU A;  3NF6 A;  2HNY A;  2VG7 A;  4GKK K;  3MED A;  5AJ3 K;  1RT6 A;  3ATV A;  2A40 A;  1O1W A;  4H0O A;  1E4G T;  3AVL A;  1HKB A;  3OS2 A;  1SKR A;  4DR4 K;  3HM8 A;  1C6V A;  5AZI B;  3MXI A;  3F2K A;  1IKV A;  1RT5 A;  1SL2 A;  4FJK A;  4BG8 A;  4BRE A;  3MN6 A;  3DOK A;  3KJV A;  5J2P A;  4H5T A;  3DLR A;  5C24 A;  4EAH D;  4JK8 A;  4PL8 A;  4YDU A;  4CFB A;  1NGI A;  1KAY A;  3MEE A;  4JEP A;  3SJH A;  4KRF A;  2O8C B;  2D5R A;  1OH8 A;  1QHA A;  3CCU N;  4A57 A;  5JIC A;  1QS4 A;  4DV6 K;  2HNZ A;  3O3F A;  1TL3 A;  3AVC A;  1SL0 A;  4JI0 K;  2OPS A;  3BZC A;  3CD6 N;  3WNH A;  1ITG A;  4DSF A;  4I9Q A;  4JK9 A;  3PUF A;  4G1Q A;  4OLA A;  3AVM A;  1HPM A;  2B6A A;  2YHB A;  4HCB A;  1T3V A;  2G8F A;  1HLU A;  4FZX C;  2ZQB A;  1NBW A;  3CER A;  4N56 A;  4DU4 A;  4KAZ A;  3DXK A;  3ITH A;  4OVL A;  1BHL A;  2FBT A;  4DR7 K;  3AO2 A;  1EET A;  2ITG A;  3FZM A;  2P5O A;  3T19 A;  2VGM A;  3S3M A;  1RT1 A;  3N4Q A;  4DQS A;  1W0H A;  3CCM N;  3OW2 M;  1K9M O;  2QK9 A;  1K8K B;  1XC3 A;  5C15 A;  4BE2 A;  3CC4 N;  2V52 B;  3M1F A;  4MO4 A;  2HHT A;  4CZI A;  2P9L A;  1JKH A;  3UKU B;  2CGK A;  4AHS A;  4CFC A;  2GBZ A;  5SWM A;  4CFA A;  3MEC A;  3OBY A;  5J1E A;  3LWM A;  3WXK A;  3QIN A;  4BR0 A;  4IJA A;  4M3X A;  1GLD G;  2CH5 A;  4K41 A;  3OYI A;  3MXJ A;  3VET A;  1ZBS A;  4JKA A;  3CCE N;  3CJ1 A;  1DTQ A;  1NLV A;  5LJV A;  3D2E A;  3G6E N;  3A5M C;  1EKE A;  3VPZ A;  1NOZ A;  5JMV A;  5J2N A;  5JS2 A;  2IAJ A;  2HHH K;  1S1T A;  1VQO N;  1WB9 A;  2E2N A;  3O1W A;  2YKN A;  1EWQ A;  2O8D A;  2QA4 N;  3QFP A;  4FW2 A;  1S6P A;  4H4O A;  1DT9 A;  1J5O A;  3BY5 A;  3EYZ A;  3P31 A;  1T05 A;  5EX5 A;  4E7K A;  3DWL A;  3QB0 A;  4CEZ A;  5DK5 A;  3G71 N;  2OAN A;  1NGG A;  1HYZ A;  4FPA A;  5BN9 A;  1YJ9 N;  1JLG A;  4KI6 A;  4FPB A;  1BU6 O;  4FWN A;  4CZM A;  2WOM A;  4W5Q A;  1TKD A;  1HPZ A;  4IJN A;  4DQR A;  4FOE A;  1KQS M;  2O8E A;  1KAX A;  4CZL A;  1NK9 A;  3ZSX A;  1D9F A;  1YTA A;  4B3T K;  4FK2 A;  3SMS A;  1NJY A;  5KPZ A;  1TKT A;  4IXC A;  3OYK A;  3TAQ A;  4B9Q A;  1MDU B;  2Y1J A;  3K59 A;  2XY6 A;  1IJJ A;  2P9K A;  1LW2 A;  1N32 K;  3SQ4 A;  1YVN A;  3ZSY A;  1IBM K;  4M45 A;  1S9G A;  4F4K A;  3CCV N;  3PV8 A;  3DRP A;  1GLJ O;  1HYS A;  2OTJ N;  1ASU A;  4JD2 B;  1TYQ A;  1S9E A;  3HBT A;  4CZH A;  4FLU A;  4CEB A;  1UA0 A;  1YT3 A;  3M8Q A;  4NYN A;  2WBN A;  2I7N A;  1C1B A;  1JCF A;  5AQX A;  3CHW A;  2FSK A;  1JJ2 M;  4OX9 K;  3R1X A;  1A5V A;  5JS1 A;  1G99 A;  3THV A;  3SUP A;  4ELT A;  5H1S Q;  4DTP A;  1TAQ A;  3KZB A;  4CIE A;  4AHT A;  2YHY A;  3CJ7 A;  2Q97 A;  3PSI A;  1BIS A;  4CJP A;  4CJF A;  2HB5 A;  2Z1I A;  1ZBL A;  4M3Z A;  1J6Z A;  4FJI A;  3QEX A;  1IBL K;  3A5L C;  1BCO A;  1D5A A;  2P9L B;  3OBW A;  2UXC K;  3E9P A;  4CER A;  4DF8 A;  2X78 A;  3BF1 A;  1NMN A;  2JWL A;  4WFA L;  1D4X A;  3LM9 A;  4C8K A;  4ELV A;  2HHU A;  4FWK A;  1VAZ A;  3CPW M;  3QET A;  1CZA N;  2E2Q A;  3NVK A;  1DGK N;  3TI0 A;  1JLB A;  1LAW A;  3CCJ N;  3VQ9 A;  1LWC A;  5ADX H;  4G9Z A;  3THX B;  4CJU A;  1J5E K;  4A59 A;  4BDZ A;  1HRH A;  3UKR A;  3FLC O;  1P8Z A;  1QVG M;  3CCS N;  3I55 N;  4RW9 A;  4DU1 A;  3QES A;  3T1H K;  5AQV A;  3IKM A;  4CJE A;  4OPH A;  2B4J A;  2DY4 A;  1NNE A;  2ATQ A;  3L8B A;  4JRP A;  1DLO A;  4M3U A;  4DSE A;  1L5U A;  1R0A A;  1Q9Y A;  2O4I A;  2A1S A;  4E7J A;  1UWB A;  1U04 A;  4W5R A;  3NE6 A;  3V9W A;  4JRQ A;  5C25 A;  4PQU A;  4ISE A;  1NOY A;  3AAR A;  1D8Y A;  3NF8 A;  3DLK A;  4YOW A;  2HMI A;  4DTX A;  2YNI A;  3DRS A;  4EHU A;  3UE5 A;  4DV1 K;  3D6R A;  1ZBF A;  4CGD A;  1KAZ A;  3VQ5 A;  4FL9 A;  3HP9 A;  4JI4 K;  3LAM A;  4C23 A;  1HNW K;  5AFU A;  1IKX A;  1NKB A;  5CHI A;  1HR0 K;  2ZGY A;  3EE9 A;  3LAK A;  2QWN A;  4FW1 A;  1RT2 A;  1S3X A;  4CF9 A;  3EKS A;  1BDG A;  4NYF A;  3ZYY X;  3EY1 A;  3PO5 A;  1F21 A;  5C10 A;  4JD2 A;  1TYQ B;  4FM1 A;  4CJL A;  3DLG A;  3RRG A;  4C1N I;  4IEI A;  3V9U A;  5FPE A;  3EO3 A;  3M6G A;  1J9A A;  4NLB A;  2E6L A;  4FWL A;  3U4L A;  1W2B M;  2UXB K;  4FM2 A;  2FF3 B;  4OGE A;  2QKB A;  2XY5 A;  4OKK A;  3LP0 A;  4BRK A;  1IKY A;  2O8F A;  3TTC A;  4CHQ A;  5TKW A;  3U3Y A;  3VQ4 A;  1UA1 A;  1Q82 O;  4Z4F A;  1C0G A;  3CET A;  4UY8 O;  2ZM6 K;  4FVU A;  3AVG A;  3ENH A;  2I5J A;  3G4S N;  4N76 A;  3F9M A;  4GNI A;  3NFA A;  1TAU A;  4DV3 K;  3DLB A;  3W3D A;  2D0B A;  2PAV A;  4Q0B A;  5AQF A;  4DFM A;  4Y1D A;  4Y1C A;  1X3N A;  1BIU A;  3VOV A;  3C6A A;  4KHU A;  3LDQ A;  1VSK A;  3EN9 A;  3NCI A;  1RBT A;  3IFR A;  4O5B A;  3P4I A;  4PL7 A;  3L4Q A;  1VSI A;  4WCE L;  4DLE A;  4DR6 K;  1MA9 B;  3V9X A;  1JLE A;  4BC4 A;  3FZH A;  3MN5 A;  3JS6 A;  1OH7 A;  1IBK K;  4BVO A;  4GV9 A;  4W5O A;  1OVY A;  4PWD A;  1QHT A;  1KSP A;  4E0D A;  2BGG A;  1T6C A;  3VEO A;  2KFN A;  3ULE A;  1B92 A;  4FWP A;  5FDL A;  3ZSQ A;  4Z0U A;  3DM2 A;  4B1Y B;  5CYQ A;  3CCQ N;  4CJ3 A;  2ASP A;  4KTW A;  1KVA A;  3ZET B;  3JYT A;  5E26 A;  4KPY A;  1YJW N;  1NGJ A;  4B9V A;  1GLE G;  2YX6 A;  1QSY A;  4IBN A;  4CZE A;  3AVN A;  5FRN A;  3L4I A;  4MLE A;  3HST B;  3SUO A;  4B3R K;  2JLE A;  2ZWH A;  1NK4 A;  1L3V A;  4MDA A;  4KH6 A;  2RHK A;  2FF6 A;  1M1K O;  1ATR A;  2D0A A;  2YI1 A;  2ZD1 A;  5J2Q A;  3ZLJ A;  4DMN A;  4JI6 K;  1CZ9 A;  4QCL A;  3O4Q A;  4DS5 A;  3KLH A;  3TWH A;  2GV9 A;  3O9U A;  4Z94 A;  1X3M A;  4E7I A;  3M8R A;  4NCA A;  5AFU H;  5KTQ A;  5FPN A;  2VQF K;  4FJ8 A;  5CYM A;  1XI1 A;  4IOA L;  2I7P A;  2ZF5 O;  3C0B A;  5A2Q O;  4CJQ A;  5JVH L;  1BWF O;  2O8B B;  1K73 O;  5F2R A;  4ZHR A;  3BUZ B;  4UQG A;  3AA3 A;  3P39 A;  3V1R A;  2NRZ A;  2VWB A;  4H0T B;  4CF0 A;  5MLC Q;  2A41 A;  3J7Z O;  4GV3 A;  2F9T A;  1KRP A;  3PX6 A;  2P9S B;  1GOB A;  1QQO A;  2GEL A;  4HTL A;  4PKH A;  5AQG A;  4PY5 A;  4V19 S;  1JLA A;  1HMV A;  5E41 A;  3VQE A;  3V81 A;  4X65 K;  1REV A;  1HQE A;  1BCM A;  3H3O B;  3ZSZ A;  3FZL A;  1C0U A;  1VQ6 N;  4RTF D;  4CEF A;  1Z25 A;  2G8V A;  3HP6 A;  1WNS A;  4FJL A;  3DYA A;  1K8A O;  1W9H A;  2P9I B;  4RW6 A;  4ILH A;  4B9U A;  4AH9 A;  4CHO A;  3DLL L;  4CBW A;  3CFR A;  2E6M A;  2Z1J A;  3WNE A;  4CEE A;  4PUO A;  2NZT A;  1L3T A;  4LSL A;  3E01 A;  3AO5 A;  1BIZ A;  2QWQ A;  1V4S A;  5LMN K;  3NGY A;  3CQY A;  5AQT A;  3O9S A;  3PX0 A;  1U2V B;  3PSF A;  1HNI A;  4A62 A;  2WC9 A;  3HOT A;  4YFU A;  3VES A;  3M8S A;  1XMO K;  5I42 A;  5AQW A;  2FXU A;  3VQD A;  1LW0 A;  3VEV A;  4BR2 A;  4DQ8 A;  3RVC A;  4DV4 K;  2P1J A;  3QIP A;  4CGH A;  4BQZ A;  3L2U A;  3L6Q A;  1XUP O;  4QS8 A;  5D3G A;  4JI2 K;  2QM1 A;  3HJF A;  3AAP A;  2VWK A;  2HBM A;  1JLQ A;  3EZ5 A;  3KK1 A;  1IG9 A;  4H0Y B;  3GG4 A;  3E9O A;  2BAN A;  4YHH K;  1U6Z A;  3M3Z A;  1CXU A;  4CBU A;  3C7N A;  4B3O A;  4H5W A;  4Z4G A;  2BH1 A;  3RWU A;  3KVG A;  2HHW A;  3B6P A;  2FSJ A;  1VSF A;  5M1O A;  1LWE A;  4O8K A;  4OO1 J;  3AO4 A;  3LDL A;  3ZSR A;  4KH4 A;  4PHT X;  5SZT A;  1HX1 A;  1XC9 A;  3L0Q A;  4DUY K;  1O13 A;  3NH0 A;  3ZX2 A;  3HPH A;  1U45 A;  4FLV A;  1ZBI A;  3RR7 A;  1ASW A;  4KTZ A;  3BF3 A;  1XNR K;  2QXL A;  3THY B;  3LDO A;  3KHY A;  5IWA K;  4DG1 A;  1J53 A;  2YHX A;  3KKS A;  4R79 A;  4J2E A;  5LJW A;  1B9F A;  4FJM A;  1MWM A;  1S22 A;  3SCX A;  4ILG B;  2GUP A;  5M1N A;  4DFK A;  4BQL A;  5JLF A;  3PO4 A;  1SKS A;  2E1Y A;  2E4L A;  3I8D A;  1K8K A;  3AVH A;  3Q7B A;  4BGB A;  1WSI A;  3NMU A;  3MN9 A;  4E3S A;  2GWJ A;  3RMD A;  3NGI A;  4XH5 A;  3LAN A;  4B1Z A;  3IG1 A;  3OYC A;  3VEN A;  5LL6 Z;  3THW A;  1HNX K;  5AQP A;  1YAG A;  4RWT A;  4O0J A;  4JV5 K;  5T7B A;  3K5L A;  2P9S A;  2V7Y A;  4ID5 A;  4IFV A;  4M7Y A;  3DJC A;  1SL1 A;  5TKY A;  4AM6 A;  4DTR A;  4BDY A;  3CJA A;  1BA1 A;  4OGC A;  3TPQ A;  1RTJ A;  1IH7 A;  4AQY K;  3VA3 A;  1QQM A;  4BE0 A;  4BWM A;  5FLX O;  1U47 A;  4MO5 A;  3MXM A;  3IRX A;  1EQY A;  3THX A;  3VF2 A;  5FPD A;  1RDU A;  1H1V A;  3MK6 A;  3T1A A;  2YNF A;  1NK0 A;  3ZT4 A;  4WFN L;  1VSL A;  3R8E A;  4FJX A;  1TVR A;  4Z4H A;  4BRO A;  1E4F T;  2W40 A;  4AHU A;  4PKI A;  4EIA A;  4LSN A;  3O4W A;  1C0M A;  4B9M A;  4I2Q A;  3SV4 A;  4LF6 K;  3E66 A;  5ELZ A;  3V6D A;  3KK2 A;  4CZG A;  4O5F A;  1TK5 A;  3PY8 A;  2F7T A;  3U9D A;  1RNH A;  3C6U A;  1U49 A;  3OYB A;  4KHP K;  2IC3 A;  2Q31 A;  5BR8 K;  1ASV A;  3BDP A;  5KI6 A;  3AA5 X;  4A61 A;  3A8Y A;  3WXJ A;  3DOL A;  1NGF A;  4NCB A;  4QOZ B;  1SAZ A;  1UAX A;  4I9L A;  4F2R A;  4YOR A;  3CXC M;  3ZEU B;  4K8X A;  1WSJ A;  3QIO A;  2DFH A;  3LPT A;  2O4G A;  4CEO A;  4CF2 A;  2WON A;  4Y0W A;  3IS9 A;  2XHB A;  4LY7 A;  2ZGZ A;  4LF8 K;  1J54 A;  4FJN A;  3K9K A;  2KZM A;  5J2M A;  1SQK A;  3ULD A;  3ENO A;  2IVP A;  4E19 A;  4L8R B;  5HL7 L;  4CGF A;  2YV0 X;  1HJO A;  5BR9 A;  3VTH A;  5HRS A;  1TK8 A;  5BRH A;  4KHN A;  1N33 K;  2UXD K;  3WQU A;  3SUN A;  4LF7 K;  4KH5 A;  2X6S A;  3NDK A;  3G10 A;  1EXQ A;  2F4V K;  5F0X A;  3WT0 A;  3SPZ A;  4O0I A;  5HLF A;  3VQB A;  1NK8 A;  4FK4 A;  2HF3 A;  4BRC A;  3OS0 A;  1KFS A;  4FYD A;  3FZK A;  1S1V A;  5GAD P;  1BOT O;  5AQO A;  2HND A;  3BEX A;  3M5R A;  1VSD A;  3HPG A;  1WLJ A;  1QSS A;  4DTJ A;  1KVB A;  2YCH A;  3WNG A;  4CW7 B;  5C2D A;  4HHT A;  1TUU A;  2BDP A;  4CGI A;  2VCP A;  1GOA A;  4DV7 K;  4DHY A;  2Z1G A;  4BRN A;  5EOY A;  2FBX A;  3ALY A;  3QFU A;  2YNH A;  3MN7 A;  4KTQ A;  4B3M K;  3HTV A;  3LPU A;  3KLE A;  3CME N;  3J80 O;  3HO1 A;  4XH4 A;  1EWR A;  4DTM A;  3DLE A;  4KHY A;  2Q3S A;  2P5G A;  2GUI A;  4KKO A;  1RTI A;  1QQN A;  2AJQ A;  4J2D A;  1IO2 A;  4GVE A;  4BAC A;  1RBU A;  2D0O A;  1D9D A;  4H5R A;  4H8K A;  2BE2 A;  1JCG A;  4FWO A;  4RW8 A;  3HM9 A;  3OYF A;  4B3S K;  1W7A A;  2YNG A;  4E1N A;  3QER A;  3QEW A;  3GDQ A;  3S9H A;  2Q1N A;  5BPL A;  1C1C A;  4GW6 A;  3ULE B;  5JLH A;  4YOY A;  4FSV A;  2A1R A;  1VQ9 N;  5KRS A;  3O08 A;  1X9W A;  3Q7C A;  3A0I X;  1Q7Y O;  2O8C A;  4H0X B;  4RCH A;  1IV0 A;  4IDK A;  4JKC A;  3B6O A;  1ZBU A;  3HVR A;  2Y1I A;  4CJV A;  5BPM A;  3H3N O;  3VN5 A;  3ZSO A;  4JKF A;  3R6M A;  4WE1 A;  1WSF A;  4GVM A;  1VQ4 N;  3G0Z A;  2E2O A;  4B08 A;  1SS6 A;  3OTO K;  4A2A A;  2NRV A;  2P9U A;  3S41 A;  1R59 O;  4B1U B;  3KLI A;  2D4W A;  3SAH A;  3MX5 A;  1QQC A;  4JI8 K;  4LF9 K;  3R9P A;  1NMD A;  1BA0 A;  3O3G A;  3ZT0 A;  2IS3 A;  5M1F A;  1SZ2 A;  4LH5 A;  4CHZ A;  1JXE A;  4CF8 A;  3I56 N;  4I6M B;  2VGN A;  4PA1 A;  5HRO A;  3AGR A;  1LV5 A;  4BR9 A;  3TSP A;  2YJE A;  2EWS A;  3VQP A;  3SLC A;  2EX3 A;  3D45 A;  5HP1 A;  4DB3 A;  5EY4 A;  3P83 D;  1YF5 L;  3PIO L;  4K42 A;  1VSH A;  3WXL A;  3OYD A;  4X66 K;  4B1W B;  3KIO A;  4YOT A;  1KD1 O;  4B9S A;  1GLL O;  4A2B A;  1XHZ A;  4F9O A;  3T69 A;  4E7H A;  1QSL A;  3C95 A;  3ZSV A;  4CHN A;  5JVG L;  2QWL A;  4AIL C;  1KLM A;  1VQ5 N;  4ILJ A;  3CF5 L;  5KGW A;  4JS4 A;  2ASO A;  2X6N A;  3CM6 A;  4DTU A;  1Z6R A;  4TSX A;  4O44 A;  1TK0 A;  5GIN A;  4KBO A;  3GOI A;  3TAB A;  3FZF A;  2OA8 A;  2W6L A;  4GKJ K;  4GY2 B;  1NG9 A;  4FJH A;  2RN2 A;  2QWO A;  4AHV A;  3OYN A;  4BGA A;  2OPR A;  5AQS A;  3I0R A;  1NK5 A;  4NO7 A;  3ZET A;  4WQ5 C;  3J8A A;  5C42 A;  4K25 A;  5FRO A;  1JL1 A;  1MWK A;  2O8E B;  5M1Q A;  4JI3 K;  1Q18 A;  4C1N K;  4FK0 A;  2D1K A;  4A5A A;  3OYM A;  3SK3 A;  4HUG A;  2ETJ A;  2HVI A;  4LD0 A;  1YVU A;  1T6D A;  3C7N B;  4J8F A;  5B8H A;  5KPR A;  1X9M A;  1MU2 A;  2UU9 K;  4K8Z A;  2YJF A;  4B9T A;  1RFQ A;  1BG3 A;  5AZJ A;  2NRT A;  2RF2 A;  3QNN A;  3MMV A;  1NJW A;  2G8H A;  2D0P A;  1KLN A;  2J4R A;  4ICL A;  4KHW A;  1OKJ A;  1CLQ A;  1BGX T;  1JL2 A;  3KLG A;  2RKI A;  3OA9 A;  4HWI A;  3THY A;  1HNZ K;  2E5L K;  4H0V B;  3HPO A;  4CEC A;  4FLY A;  1NK6 A;  2XO7 A;  2Q36 A;  1KC8 O;  2O8B A;  3L3U A;  3QBX A;  3A2F A;  3I8B A;  3OVN A;  3WEE A;  5AQQ A;  1NGB A;  3VQ7 A;  3SV3 A;  1NK7 A;  3CPE A;  4KHQ A;  4GV6 A;  3OYH A;  3QIC A;  1DTT A;  4FZZ A;  2HHV A;  3C6H A;  2G8I A;  2IDO A;  1Y97 A;  4L3Q A;  1VQ7 N;  3U9Z A;  3ZX3 A;  1HJR A;  2YHW A;  2QWP A;  5CE3 A;  3TAN A;  3LAL A;  2VQE K;  1YIJ N;  4BRF A;  2KFZ A;  5GAG P;  4IOX A;  4BRP A;  2FBV A;  5HRN A;  1G15 A;  4BWJ A;  3CJC A;  3V1Q A;  1FKO A;  4BRG A;  3RR8 A;  4N47 A;  3KK7 A;  1VRT A;  3O9R A;  4NLC A;  3KD1 E;  4BR7 A;  1TGO A;  1YUW A;  1X9S A;  4RW4 A;  2AP1 A;  3PIP L;  1RBV A;  4JHD A;  2HHX A;  3UKR B;  3K5N A;  4KHS A;  3L2R A;  2P9I A;  1BQN A;  2GTD A;  3VQC A;  3NH1 A;  3LZJ A;  3ZT2 A;  2UUC K;  2HW3 A;  3O8M A;  3P5J A;  2A3Z A;  1VSJ A;  4M63 C;  4CBX A;  2YHA A;  4CI6 A;  2OTL N;  2HST A;  2CGL A;  5HRP A;  3V4I A;  1RT4 A;  3UIQ A;  1TKX A;  4R5P A;  4M42 A;  3HOS A;  4FOI A;  2G8U A;  2PYL A;  1YIT N;  1NM1 A;  4E1M A;  4H5N A;  4YOV A;  1WSG A;  3QEV A;  4QS7 A;  5CZ2 A;  4FJ9 A;  5HBM A;  3VQQ A;  5K14 A;  5AQH A;  4IG3 A;  1ESV A;  2A5X A;  1LAV A;  4O55 A;  5IT9 O;  4B1X B;  4QS9 A;  4MFB A;  2ZJQ L;  3SPY A;  3C6T A;  3BZK A;  3JXU A;  1LWF A;  4EHT A;  2QTD A;  3IMX A;  2VWJ A;  1BQM A;  3IAY A;  3CMA N;  3HYF A;  1TUY A;  1YI2 N;  5DM6 L;  2E88 A;  1I94 K;  4M3W A;  3OJS A;  4W5N A;  3FFI A;  2PFU A;  4DSL A;  3VEZ A;  4JS5 A;  1ZXO A;  3VTI A;  3HXM A;  4U7B A;  3MWP A;  1BI4 A;  3I33 A;  2VG6 A;  4AF1 A;  4FWS A;  4NXN K;  3DXM B;  2FSN A;  4BRA A;  1VSM A;  4ELU A;  1WUA A;  1VQP N;  4Q5V A;  1GLF O;  2P51 A;  4JKB A;  4NB4 A;  1I39 A;  1ZC6 A;  4WQ4 A;  3NHG A;  3L2Q A;  3CQ8 A;  4JKH A;  3ATU A;  3TAG A;  1QE1 A;  3CJ9 A;  1VQL N;  1BL3 A;  1WOQ A;  5AQL A;  4BG9 A;  3QNO A;  2GEM A;  4WYB A;  3CC7 N;  3H1Q A;  4KRE A;  3ID8 A;  1N5Y A;  3U3G A;  4B8A B;  3F9K A;  4WQ5 A;  4ISG A;  2VYP A;  3NVM A;  1XQS C;  1GLB G;  2PBD A;  5AQM A;  3VGL A;  4RG8 A;  4CK2 A;  1RDC A;  3CFO A;  1T03 A;  1N8R O;  2A6A A;  3O5B A;  1S5J A;  1Z05 A;  1SKW A;  3P38 A;  1EP4 A;  4ZTF A;  3WXM B;  2HHS A;  3C94 A;  1VQ8 N;  4CE9 A;  4E1J A;  3AVI A;  3DI6 A;  3OYL A;  1L3U A;  1CZB A;  3ZCM A;  3O80 A;  4K0K K;  4M41 A;  4CF1 A;  2KHO A;  3HL8 A;  3KKR A;  4CJ4 A;  4BC2 A;  5GAE P;  1RTD A;  3H1V X;  4O4G A;  4H0P A;  4H03 B;  4DSJ A;  4DWI A;  4OKE A;  1FW6 A;  4XIU A;  3RSE B;  1OVQ A;  4CHY A;  3VGK A;  2UUB K;  3JSM A;  1DEJ A;  1FXX A;  1N36 K;  1NWK A;  3HI0 A;  5GIP A;  4DQP A;  1ATN A;  4DCH A;  1VRU A;  4M7X A;  3RRH A;  3TTD A;  3L2V A;  4AHR A;  1A5W A;  3AAQ A;  4E89 A;  2GWK A;  4BR4 A;  1OH5 A;  3H08 A;  4KO0 A;  2W42 A;  5GIO A;  1WN7 A;  4DV2 K;  4ZTJ A;  5AQR A;  3HVT A;  5AQI A;  4CZK A;  1JLC A;  1C0F A;  3FFK B;  4OPA A;  4YDU C;  1OH6 A;  2RE2 A;  2GX9 A;  4DV5 K;  3HSC A;  3CM5 A;  2B5J A;  4J2B A;  4W5T A;  1QTM A;  3SQ0 A;  4DV0 K;  3FE1 A;  3PX4 A;  1RIL A;  1YXQ A;  4B8C A;  2DFE A;  1EX4 A;  3EEQ A;  2H3G X;  3OYJ A;  1RGI A;  1RTH A;  4BVP A;  3A5O C;  3VEY A;  4EZ6 A;  2IVN A;  4KFB A;  4DS4 A;  4M3Y A;  2F9W A;  1ZBH A;  4J2A A;  4E7L A;  4GMJ B;  4DQI A;  3ZEU A;  5GAH P;  4WF9 L;  5CZ1 A;  4EP5 A; 
#chains in the Genus database with same CATH homology
 2Z1H A;  3K58 A;  4Z4I A;  2YNG A;  4E1N A;  3QER A;  3SQ2 A;  1BIU A;  3QEW A;  1NJX A;  3S9H A;  4FLT A;  4KHU A;  1VSK A;  3NCI A;  1C1C A;  1RBT A;  4GW6 A;  2QKK A;  4O5B A;  1HNV A;  1U4B A;  3L2W A;  4C8L A;  1BI4 B;  1KVC A;  2A1R A;  2OZM A;  4CEQ A;  1VSI A;  2F96 A;  4I7F A;  4KV8 A;  3VQ8 A;  5KRS A;  3QEI A;  3SI6 A;  4DLE A;  1X9W A;  3NGZ A;  4CED A;  3SNN A;  4AHC A;  3HK2 A;  3V9X A;  1JLE A;  3LDS A;  2QXF A;  3K5M A;  4IDK A;  4CJT A;  3RMA A;  3B6O A;  1ZBU A;  3HVR A;  2Y1I A;  3WNF A;  1RT3 A;  4F3T A;  4CJV A;  4W5O A;  3NH2 A;  3VN5 A;  4OPK A;  1QHT A;  3ZSO A;  3OYE A;  4PWD A;  1KSP A;  4WE1 A;  1WSF A;  4E0D A;  2BGG A;  3AO1 A;  4HUF A;  4GVM A;  4C8O A;  3G0Z A;  2KFN A;  4B08 A;  1B92 A;  3LZI A;  5FDL A;  3ZSQ A;  4Z0U A;  1KCF A;  3DM2 A;  4HCC A;  5CYQ A;  1Q8I A;  4MQ3 A;  4CJ3 A;  3I0S A;  2OYQ A;  2ZE2 A;  3KLI A;  1N6Q A;  4KTW A;  2YKM A;  1KVA A;  4KB1 A;  3JYT A;  1VSE A;  1S6Q A;  1SUQ A;  4KPY A;  4FXD A;  1QQC A;  3U6F A;  4B9V A;  4OKJ A;  1QSY A;  4IBN A;  3AVJ A;  3DMJ A;  3OJU A;  4DQQ A;  3AVN A;  5FRN A;  3NF6 A;  2HNY A;  2VG7 A;  3HST B;  3AA4 A;  3O3G A;  3SUO A;  3MED A;  2JLE A;  1RT6 A;  3LP1 A;  3ZT0 A;  2IS3 A;  1O1W A;  2R7Y A;  1NK4 A;  3TAR A;  3AVL A;  3OS2 A;  1SKR A;  4LH5 A;  4CHZ A;  1JXE A;  1L3V A;  4CF8 A;  1C6V A;  4CK3 A;  3KD5 E;  1X1P A;  3KTQ A;  2D0A A;  3MXI A;  3BGR A;  4PA1 A;  1IKV A;  1RT5 A;  1SL2 A;  2ZD1 A;  5J2Q A;  4FJK A;  5HRO A;  4DMN A;  3KLF A;  3DOK A;  3KJV A;  1LV5 A;  4EP4 A;  1CZ9 A;  5J2P A;  4QCL A;  3O4Q A;  4DS5 A;  3DLR A;  3KLH A;  5C24 A;  2OPQ A;  3TWH A;  2GV9 A;  2HHS A;  2NUB A;  4CFB A;  4FJ5 A;  3VQP A;  4E7I A;  3M8R A;  2EX3 A;  4NCA A;  3MEE A;  3D45 A;  5KTQ A;  1RDD A;  5HP1 A;  2JGU A;  3P83 D;  4KRF A;  1IKW A;  4FJ8 A;  5CYM A;  1VSH A;  2D5R A;  1XI1 A;  3OYD A;  2IOC A;  4CJQ A;  1S1W A;  3KIO A;  4NCG A;  1QS4 A;  4B9S A;  4FLZ A;  3AVF A;  2HNZ A;  1XHZ A;  2IGI A;  4ZHR A;  3O3F A;  1TL3 A;  3AVC A;  1SL0 A;  4F3O A;  2OPS A;  2XY8 A;  4E7H A;  3TAE A;  4FJG A;  4UQG A;  1QSL A;  3AA3 A;  3C95 A;  3WNH A;  3NBP A;  2DTU A;  1ITG A;  3V1R A;  4DSF A;  3ZSV A;  4I9Q A;  4CHN A;  3PUF A;  3AO3 A;  4G1Q A;  4CF0 A;  4DFP A;  4AIL C;  3AVM A;  1KLM A;  4OLA A;  2B6A A;  3AVA A;  5KGW A;  2YHB A;  4HCB A;  4JS4 A;  2X6N A;  4BE1 A;  1CXQ A;  2G8F A;  1KRP A;  4FZX C;  2ZQB A;  3CM6 A;  3PX6 A;  4N56 A;  4DU4 A;  4KAZ A;  1GOB A;  4DTU A;  3ITH A;  4PY5 A;  4OVL A;  1BHL A;  1JLA A;  1HMV A;  2FBT A;  4TSX A;  4O44 A;  5E41 A;  3AO2 A;  3VQE A;  1TK0 A;  3LWL A;  1EET A;  2ITG A;  3V81 A;  1REV A;  1Z26 A;  1HQE A;  1BCM A;  2P5O A;  3T19 A;  3ZSZ A;  3S3M A;  1RT1 A;  3TAB A;  4DQS A;  1W0H A;  4IKF A;  4DTN A;  1C0U A;  2OA8 A;  4Z4C A;  4CEF A;  1Z25 A;  2QK9 A;  4IFY A;  3HP6 A;  2G8V A;  1WNS A;  4FJL A;  2OPP A;  4FJH A;  2RN2 A;  3DYA A;  4BE2 A;  1W9H A;  4RW6 A;  5HRR A;  4AHV A;  4B9U A;  1GOC A;  4AH9 A;  4CHO A;  4CFC A;  1JKH A;  4DSI A;  3OYN A;  4AHS A;  4CGG A;  2GBZ A;  1WAF A;  2EHG A;  5SWM A;  2OPR A;  4CFA A;  3MEC A;  3CFR A;  2E6M A;  5J1E A;  2Z1J A;  3WNE A;  3I0R A;  4CEE A;  4PUO A;  3LWM A;  1NK5 A;  4LSL A;  1L3T A;  3E01 A;  1XWL A;  4KB0 A;  3AO5 A;  1BIZ A;  4M3Z A;  3NGY A;  5C42 A;  5FRO A;  1JL1 A;  3QIN A;  3PX0 A;  1HNI A;  3L3V A;  2FBY A;  4FK0 A;  4CJS A;  4FVM A;  4M3X A;  3OYM A;  1YTU A;  2HVH A;  4Z4E A;  3SUQ A;  4YFU A;  3M8S A;  3OYI A;  2HHT A;  3MXJ A;  4HUG A;  2HVI A;  2ETJ A;  1C0T A;  4LD0 A;  3ISN C;  1DTQ A;  1YVU A;  5I42 A;  3QLH A;  3VQD A;  1LW0 A;  3NAE A;  1X9M A;  1MU2 A;  1EKE A;  3F73 A;  1NOZ A;  4K8Z A;  5J2N A;  2P1J A;  3QIP A;  5JS2 A;  4CGH A;  4DU3 A;  4JLH A;  2IAJ A;  3L2U A;  4B9T A;  1WSE A;  3OS1 A;  3CG7 A;  2HHQ A;  5D3G A;  3VA0 A;  2G8H A;  3QNN A;  2RF2 A;  1NJW A;  1K6Y A;  4ID1 A;  1S1T A;  3HJF A;  3RMC A;  1KLN A;  4HUE A;  2KTQ A;  4ICL A;  2VWK A;  4KHW A;  3EZ5 A;  1JLQ A;  2X74 A;  1CLQ A;  3KK1 A;  1IG9 A;  4FLX A;  1BGX T;  1RDA A;  2BAN A;  2YKN A;  1CXU A;  1JL2 A;  3QO9 A;  2F8T A;  3KLG A;  4B3O A;  2RKI A;  4FW2 A;  1A5X A;  1S6P A;  4Z4G A;  3RWU A;  4H4O A;  3HPO A;  1RT7 A;  3MEG A;  1J5O A;  4CEC A;  4FLY A;  1NK6 A;  2XO7 A;  3AA2 A;  2HHW A;  3EYZ A;  3B6P A;  1VK0 A;  3L3U A;  3A2F A;  1T05 A;  4IG0 A;  4E7K A;  3DLH A;  1VSF A;  3OVN A;  5DK5 A;  1LWE A;  2VG5 A;  4CEZ A;  3AO4 A;  1HYZ A;  3VQ7 A;  3ZSR A;  4I2P A;  3SV3 A;  1JLG A;  5SZT A;  1XC9 A;  1NK7 A;  4CCH A;  4KI6 A;  4KHQ A;  3NH0 A;  3OYH A;  2PYJ A;  4CJR A;  1DTT A;  4FZZ A;  3HPH A;  1ZYQ A;  2PZS A;  2WOM A;  2HHV A;  4W5Q A;  1U45 A;  1TKD A;  1HPZ A;  4FLV A;  2IDO A;  4DQR A;  3RR7 A;  1ASW A;  1Y97 A;  1ZBI A;  2G8I A;  4KTZ A;  4BDP A;  4CGJ A;  1HJR A;  3NF7 A;  3TAN A;  1NK9 A;  3ZSX A;  1D9F A;  4DG1 A;  1J53 A;  3KKS A;  1YTA A;  3LAL A;  4J2E A;  4FK2 A;  1NJY A;  1B9F A;  2LSN A;  1SV5 A;  2KFZ A;  4FJM A;  1TKT A;  2FBV A;  3DRR A;  3RTV A;  5HRN A;  1G15 A;  4BWJ A;  3V1Q A;  3OYK A;  1FKO A;  3TAQ A;  2Y1J A;  3SCX A;  3K59 A;  2XY6 A;  4DFK A;  3RR8 A;  4N47 A;  4FCY A;  3PO4 A;  1VRT A;  4M3R A;  1LW2 A;  3SQ4 A;  1SKS A;  3ZSY A;  3VQ6 A;  3KD1 E;  1TGO A;  1X9S A;  2E4L A;  4M45 A;  1S9G A;  3K57 A;  4RW4 A;  3VQA A;  4F4K A;  1RBV A;  3PV8 A;  3I8D A;  3MAQ A;  3AVH A;  3DRP A;  1HYS A;  2HHX A;  3OYA A;  3OYG A;  1ASU A;  3K5N A;  4KHS A;  5EU7 A;  3L2R A;  1BQN A;  1WSI A;  1S9E A;  3VQC A;  4HVJ A;  3NH1 A;  3LZJ A;  3ZT2 A;  4E3S A;  1C1A A;  3RMD A;  4LH4 A;  3NGI A;  2HW3 A;  3P5J A;  3LAN A;  3IG1 A;  2KW4 A;  3K2P A;  4CEB A;  3OYC A;  4FLU A;  1UA0 A;  1YT3 A;  1VSJ A;  3M8Q A;  4NYN A;  1C1B A;  2YHA A;  3HT3 A;  3D0P A;  4FJJ A;  3OY9 A;  3V1O A;  4C8N A;  4O0J A;  5HRP A;  5T7B A;  3V4I A;  1RDB A;  1RT4 A;  1L3S A;  3UIQ A;  3ASM A;  1NJZ A;  1TKX A;  4R5P A;  3K5L A;  4M42 A;  4ID5 A;  4IFV A;  1NKE A;  1A5V A;  5JS1 A;  2PYL A;  1XHX A;  2G8U A;  1TV6 A;  4E1M A;  3THV A;  1JXB A;  3SUP A;  1KFD A;  1WSG A;  1SL1 A;  4ELT A;  3QEV A;  4DTR A;  5DMR A;  4BDY A;  5CZ2 A;  1TAQ A;  3V9S A;  4DTP A;  4OGC A;  4AHT A;  4CIE A;  4FJ9 A;  1TKZ A;  1RTJ A;  3AVK A;  3SJJ A;  1IH7 A;  5HBM A;  3VQQ A;  5K14 A;  3K5O A;  4CFD A;  4IG3 A;  3VA3 A;  1BIS A;  4CJP A;  4BE0 A;  4BWM A;  1U47 A;  4CJF A;  1LAV A;  1UOC A;  2HB5 A;  2Z1I A;  3IRX A;  4O55 A;  4RW7 A;  3MXM A;  1ZBL A;  2G8K A;  3QEX A;  3S3N A;  4FJI A;  4N41 A;  1RBR A;  4MFB A;  1HYV A;  3C6T A;  1BCO A;  1D5A A;  4DTO A;  1LWF A;  3SPY A;  3T1A A;  2YNF A;  4CER A;  2VWJ A;  4DF8 A;  2X78 A;  3ZT4 A;  1NK0 A;  1BQM A;  1VSL A;  3IAY A;  3HYF A;  4FJX A;  1TVR A;  1WAJ A;  4Z4H A;  4C8K A;  4ELV A;  4DSK A;  2HHU A;  3QET A;  4DF4 A;  4M3W A;  4KI4 A;  4E7J A;  3OJS A;  4AHU A;  3TI0 A;  3FFI A;  1JLB A;  1LAW A;  4FLW A;  4DSL A;  4LSN A;  1LWC A;  3VQ9 A;  4JS5 A;  1C0M A;  4B9N A;  4B9M A;  4I2Q A;  3HXM A;  4CJU A;  2F8S A;  1BI4 A;  3SV4 A;  4BDZ A;  2VG6 A;  1FKP A;  1HRH A;  3V6D A;  3KK2 A;  3QEP A;  1TK5 A;  3PY8 A;  4DTS A;  1VSM A;  4ELU A;  4DLG A;  1RNH A;  3C6U A;  1U49 A;  3OYB A;  1WSH A;  3O4N A;  2IC3 A;  4RW9 A;  3TAM A;  4Q5V A;  1ASV A;  4DU1 A;  3AVB A;  3QES A;  5KI6 A;  2P51 A;  3AA5 X;  4CJW A;  4YNQ A;  3BDP A;  1I39 A;  3NHG A;  3L2Q A;  3DOL A;  3CQ8 A;  2KQ2 A;  4NCB A;  4QOZ B;  1T8E A;  3TAG A;  1UAX A;  1QE1 A;  1TL1 A;  4CJE A;  1BL3 A;  1RBS A;  3V9Z A;  1U48 A;  4I9L A;  4CIF A;  4FZY A;  2B4J A;  3QNO A;  4F2R A;  4CK1 A;  2DY4 A;  4M3T A;  4KRE A;  4K8X A;  1N5Y A;  2ATQ A;  3U3G A;  4CHP A;  4B8A B;  3CFP A;  3L8B A;  1WSJ A;  3F9K A;  3QIO A;  2DFH A;  1DLO A;  3LPT A;  4JRP A;  2XY7 A;  2O4G A;  3O3H A;  4DSE A;  4M3U A;  3LP3 A;  3SZ2 A;  3SQ1 A;  1L5U A;  1R0A A;  1Q9Y A;  5FRM A;  2DFF A;  4CEO A;  2O4I A;  4RG8 A;  2A1S A;  4CK2 A;  1RDC A;  2WON A;  3IS9 A;  4CF2 A;  3CFO A;  1UWB A;  4LY7 A;  2XHB A;  1U04 A;  4W5R A;  3NE6 A;  3V9W A;  1T03 A;  1J54 A;  4JRQ A;  4FJN A;  2KZM A;  5CY4 A;  4DFJ A;  5J2M A;  1S5J A;  4CJK A;  3ULD A;  4F8R A;  5C25 A;  4PQU A;  4E19 A;  1SKW A;  4L8R B;  1NOY A;  4B9L A;  1I3A A;  1EP4 A;  4CGF A;  3SUN A;  1D8Y A;  4ZTF A;  2YV0 X;  5HRS A;  4FJ7 A;  1TK8 A;  3C94 A;  3NF8 A;  2PY5 A;  1JLF A;  4CE9 A;  3DLK A;  4KHN A;  1B9D A;  4CIG A;  3RMB A;  5KGX A;  3AVI A;  2HMI A;  1RCH A;  3DI6 A;  4DTX A;  2YNI A;  3DRS A;  3OYL A;  2X6S A;  3NDK A;  3G10 A;  1CZB A;  4OPJ A;  1L3U A;  3ZCM A;  3OYF A;  1EXQ A;  1NKC A;  1Q9X A;  3SPZ A;  3LP2 A;  3NF9 A;  4O0I A;  5HLF A;  3VQB A;  4M41 A;  1ZBF A;  1NK8 A;  4FK4 A;  4CF1 A;  4CGD A;  1S1U A;  3VQ5 A;  3ZT3 A;  3HL8 A;  3OS0 A;  3HP9 A;  1KFS A;  3KKR A;  4CJ4 A;  4FYD A;  3LAM A;  1IKX A;  2G8W A;  2OZS A;  3TR8 A;  1NKB A;  1S1V A;  4FM0 A;  3TAP A;  1RTD A;  4O4G A;  2HND A;  4DSJ A;  4DWI A;  3ZT1 A;  4OKE A;  3LAK A;  4HTU A;  1HQU A;  4XIU A;  4FW1 A;  2KZZ A;  1RT2 A;  4CHY A;  1VSD A;  4OLB A;  3JSM A;  4CF9 A;  1FXX A;  3SYZ A;  3HPG A;  1WLJ A;  4W5N A;  4NYF A;  1QSS A;  4DTJ A;  1KVB A;  3EY1 A;  3WNG A;  3PO5 A;  1F21 A;  3KK3 A;  4HHT A;  4DQP A;  2BDP A;  4CGI A;  1VRU A;  3RRH A;  3L2V A;  1GOA A;  1A5W A;  4AHR A;  4E89 A;  4FM1 A;  3H08 A;  4KO0 A;  4H4M A;  2W42 A;  3S3O A;  1WN7 A;  4CJL A;  4ZTJ A;  3DLG A;  3HVT A;  2Z1G A;  3RRG A;  3CYM A;  3V9U A;  1JLC A;  2FBX A;  3ALY A;  3P1G A;  2YNH A;  4KTQ A;  1KTQ A;  1J9A A;  3LPU A;  3KLE A;  5KRT A;  2E6L A;  2XRI A;  4C8M A;  3CM5 A;  3HO1 A;  2B5J A;  3T3F A;  4FM2 A;  4DTM A;  4QAG A;  4OGE A;  2QKB A;  1T7P A;  4F2S A;  3DLE A;  4EZ9 A;  3ZSW A;  4W5T A;  2XY5 A;  3SQ0 A;  1QTM A;  2Q3S A;  4OKK A;  3LP0 A;  4J2B A;  4KHY A;  3TAF A;  2P5G A;  2GUI A;  3PX4 A;  1RIL A;  1IKY A;  4B8C A;  2DFE A;  1EX4 A;  1RTI A;  4KKO A;  4CHQ A;  3OYJ A;  4CES A;  3U3Y A;  3M8P A;  3VQ4 A;  1UA1 A;  2D0C A;  4Z4F A;  2AJQ A;  4CJ5 A;  1RTH A;  4J2D A;  2RPI A;  4EZ6 A;  1IO2 A;  4KFB A;  1S1X A;  4BAC A;  4OJR A;  3AVG A;  4DS4 A;  2I5J A;  4M3Y A;  1RBU A;  4N76 A;  1D9D A;  1ZBH A;  1FK9 A;  4J2A A;  4E7L A;  3NFA A;  1TAU A;  4GMJ B;  3DLB A;  4H8K A;  2BE2 A;  2D0B A;  4N5S A;  4Q0B A;  4DQI A;  5I3U A;  4RW8 A;  2FC0 A;  4DFM A;  4CEA A;  3HM9 A;  4Y1D A;  5CZ1 A;  4EP5 A;  3AV9 A;  4Y1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...