4OKJA

Crystal structure of rnase as from m tuberculosis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
b'VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of RNase AS, a Polyadenylate-Specific Exoribonuclease Affecting Mycobacterial Virulence In Vivo
pubmed doi rcsb
molecule keywords 3'-5' exoribonuclease Rv2179c/MT2234.1
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 50
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4okjA00
3OYMA 4M41A 3QINA 2QKBA 3MECA 4DU4A 1NOZA 2G8WA 4IFVA 3OYBA 3HYFA 1L3UA 3M8PA 3HK2A 4OVLA 2O4IA 1Z25A 4C8MA 3EY1A 4NCGA 1IH7A 4O44A 1Z26A 4CGDA 2A1RA 1HYSA 4IDKA 4GMJB 3SUOA 1KSPA 3PO4A 1VSKA 4W5QA 2R7YA 3SYZA 4DFMA 4Z4IA 4B9LA 4XIUA 4K8XA 4DSLA 4DF8A 1RTDA 4I9LA 4NYNA 4CEDA 3O4NA 3A2FA 5FDLA 4DG1A 3MAQA 4M3YA 3HPGA 3E01A 4CGHA 2E4LA 1X9MA 1TK0A 2ZQBA 1NK9A 1TAUA 2D5RA 4LSLA 3O3HA 2G8VA 1YTAA 1NK8A 3T3FA 3ZSVA 4B3OA 3LWMA 4J2BA 1JL2A 4Z4CA 1GOAA 1RDDA 2Z1IA 1BGXT 4RW8A 4AHCA 3MEEA 3V9UA 2XY5A 4FJ8A 1B9FA 4FZZA 3M8RA 3D45A 5HP1A 3L2WA 2RF2A 1N6QA 2VG6A 3KLHA 1T05A 1HRHA 5J1EA 4E7JA 2P5OA 3C6UA 3K57A 4CEQA 1C1CA 1CXQA 1LAWA 3T1AA 2HNDA 1DLOA 3CM5A 1C1BA 1QHTA 4GW6A 4FW1A 1C6VA 3ZT4A 3TANA 3THVA 2FBYA 4J2DA 1W0HA 3VQ8A 3ZSRA 4O55A 3AO1A 3L8BA 4BDPA 1ZBIA 4CJ5A 3NFAA 4CHQA 5KRSA 4CJPA 3NH0A 5HROA 4AH9A 1NK7A 1T03A 4OLBA 4KV8A 4M3XA 2Q3SA 2F8SA 4B8CA 3OS2A 3OYFA 3AVIA 4OPKA 4KRFA 5C24A 1JL1A 5E41A 3DRRA 2VWKA 4CF2A 5HRNA 3HXMA 2D0CA 4Z0UA 4CEFA 1SKWA 2BANA 5C25A 1BL3A 3SPZA 4OKJA 1ZBLA 2WONA 1R0AA 1JXBA 1QQCA 1FKOA 1I39A 2YNHA 2Z1GA 3NH1A 4DTRA 2PZSA 4B9UA 1ASUA 3CFOA 1TKDA 3SUPA 2IGIA 1SKRA 1U04A 2YHBA 3OYEA 1XHZA 1XWLA 2EHGA 3DI6A 3NAEA 4L8RB 1X1PA 3RWUA 2HB5A 3AVFA 3V9ZA 3KLFA 3CFPA 3OVNA 4WE1A 1D9FA 4C8LA 4CIFA 2KZZA 4N56A 4PWDA 4CFBA 3P83D 3HVTA 3OS0A 4C8NA 4FJNA 2B5JA 4O4GA 3ZSQA 4FLTA 4FLZA 4IBNA 4ZHRA 2GV9A 1HMVA 5K14A 4AHSA 4IG0A 3B6PA 3U3GA 4CERA 4CEBA 4IFYA 4JRQA 1LWFA 1IKWA 5J2PA 1RDAA 3AO5A 1Q9XA 4DSJA 3OYCA 1ZBHA 1YVUA 1DTTA 1D9DA 5FRNA 3O4QA 4LH5A 5JS1A 4Y1CA 2E6LA 1BHLA 5CZ2A 4K8ZA 1X9WA 4B9SA 1IG9A 1LWEA 4DSEA 4FJJA 4FM0A 4DTPA 3RTVA 4F3TA 2HNYA 4BWJA 4KB0A 4W5RA 4LY7A 1S5JA 4CHNA 3VQ5A 3T19A 1XHXA 4OGEA 1S6QA 4HUGA 4CJSA 1BCMA 2D0AA 3VQ6A 4BDYA 4KI4A 3LAMA 2DY4A 2FBXA 1NK5A 4ZTFA 3V1QA 5SZTA 1SV5A 2YKMA 1RTIA 3CM6A 3HL8A 3KKSA 3WNGA 4EP4A 3DRSA 4AILC 4DQIA 4RW4A 2KW4A 4R5PA 2HHWA 5KGWA 3QEVA 4F4KA 4Z4GA 2PYJA 3AVBA 3OYNA 2IAJA 3VQCA 3NHGA 4G1QA 4CJQA 1J5OA 4CK3A 3QERA 3TARA 3LP2A 3OYAA 1L3VA 2HHTA 2B4JA 4HHTA 1RT3A 4H4OA 4DTNA 4KTQA 3H08A 3ZT3A 4CK2A 1FK9A 4KPYA 2KQ2A 1F21A 1KCFA 3FFIA 4I2QA 4FYDA 4FM2A 2HHUA 1JXEA 4NYFA 4N5SA 4KREA 1TKZA 3KLEA 4M3TA 4OKEA 3ZSXA 4KAZA 2BE2A 3K5LA 3LPTA 4CHOA 4KI6A 4OJRA 3TABA 3ZT2A 1L3TA 1BI4B 3K59A 3DLBA 4F8RA 2WOMA 4E7KA 2FC0A 3PX4A 4FK4A 4DF4A 4OPJA 3P5JA 1QSYA 5HLFA 4PUOA 4CGIA 1BCOA 5J2QA 1LW2A 1BIZA 3QNNA 1IO2A 1RT6A 1EXQA 2RKIA 2FBTA 1CZBA 3PUFA 1WSJA 3HP6A 2GUIA 2Y1IA 1S1VA 3C94A 1WSEA 1UOCA 1B92A 3DOKA 3SQ0A 4ZTJA 3QETA 4FJLA 1U45A 3LP0A 3LP1A 4FK0A 1RT2A 5I3UA 2PY5A 3RRHA 1HPZA 4NCAA 2W42A 3ZSYA 3ASMA 5HBMA 3F73A 3K2PA 3IRXA 1RT1A 4F2SA 4J2AA 1MU2A 3QEWA 4CF1A 5C42A 3B6OA 3JSMA 3QNOA 3LANA 2IDOA 1EX4A 3RMBA 1TL1A 3OY9A 1KFDA 3RMCA 4AHRA 3VQ4A 3CYMA 2IS3A 2NUBA 2X6SA 4E1NA 4I2PA 3VA0A 3V81A 3SI6A 2YNFA 5KGXA 4DTOA 3S3NA 4DSFA 2X78A 1IKXA 5CYMA 1VSIA 2YNGA 2HMIA 4FK2A 4Q0BA 4BWMA 3OYJA 4CFDA 1FKPA 3AVJA 1QE1A 3KK2A 1NKCA 1D8YA 2IOCA 2XO7A 3L3VA 4CJ3A 3I0SA 3TAEA 1KRPA 3WNFA 1S1XA 4UQGA 1U49A 4EZ6A 1NK0A 4CJRA 3DLKA 5CYQA 2XY7A 4BE0A 5KRTA 4YNQA 1KVAA 4B9MA 3TAMA 3IG1A 4CGJA 3NCIA 5I42A 4FZXC 4CIGA 3EYZA 3HJFA 5EU7A 3NH2A 1D5AA 3NF9A 1BIUA 3AV9A 1RTJA 1KLNA 4LH4A 3KTQA 4B9VA 1VRUA 5CY4A 2VG7A 1C0TA 2GBZA 4O0JA 4JS4A 4N41A 1A5VA 3QEXA 4CGFA 3NGZA 4E7LA 4H8KA 5D3GA 1TGOA 1WSHA 1RBRA 2XY8A 4CESA 4E0DA 3MEGA 2ATQA 1ZBFA 2X74A 4CJEA 1C1AA 3DLEA 3OS1A 3TAFA 5SWMA 2BGGA 1RBUA 2OPQA 4DFKA 4FJMA 4DTMA 3HSTB 2OPRA 3ZSWA 3AVKA 1RBTA 4ELUA 2HNZA 4FLYA 3HO1A 4BDZA 3L2RA 1J53A 4CEEA 4QAGA 2Z1HA 4KKOA 4AHUA 3PV8A 1NKEA 3JYTA 1EETA 3VQDA 4N76A 4HTUA 3KKRA 3AO3A 4FVMA 4OKKA 4E7HA 1Q9YA 4HCCA 3HPOA 2XY6A 3L2UA 2BDPA 3ZSZA 1U4BA 3K5OA 5JS2A 1BQMA 4CIEA 3OYIA 4KHWA 1RDCA 4KFBA 4KHNA 3TR8A 3VQQA 3WNHA 1TV6A 3K58A 4CEOA 4FLWA 3DLRA 4DSKA 2G8FA 1JLCA 1K6YA 4LSNA 3OYHA 5HRSA 4C8OA 4IKFA 3PX6A 2EX3A 1YTUA 3DLGA 2G8KA 3RRGA 3NGYA 3NF6A 4E89A 1WSIA 2ZE2A 2B6AA 2P5GA 1KLMA 1U47A 4KHYA 4DU1A 4FJXA 3DRPA 2VWJA 1TL3A 3D0PA 1UA0A 1HYZA 4DTXA 1JLAA 4EP5A 1CXUA 4DMNA 3OYGA 1T7PA 1JLGA 3I0RA 3ISNC 3V6DA 4B8AB 2ITGA 3LZIA 4M42A 2RPIA 4JRPA 4DLEA 1JLBA 1KVCA 4H4MA 3AA3A 1B9DA 3OJUA 3HM9A 3NGIA 1NOYA 4M3UA 1UA1A 2DFHA 4CJTA 5KTQA 5FROA 3QEIA 3KLGA 3UIQA 4GVMA 2JGUA 4CGGA 3M8SA 2HW3A 4FLUA 1BQNA 3ITHA 1S9GA 4J2EA 4NCBA 2HVIA 4M45A 3SCXA 2KFNA 4QCLA 4FM1A 4FJ5A 3VQAA 5J2NA 4CFAA 4E1MA 4KHSA 2KFZA 3V1RA 3G0ZA 3KJVA 3EZ5A 3KK1A 3AVCA 1SL0A 3VQ9A 4CEAA 2DTUA 1I3AA 2KZMA 4RG8A 4KHQA 3C95A 2IC3A 3AO4A 3VN5A 2AJQA 1NK4A 4HVJA 3TI0A 3NE6A 2OZSA 4DQPA 1EP4A 1L3SA 1NKBA 4B9NA 3VQ7A 1RBVA 3HVRA 3LALA 2ZD1A 4CJUA 4DTSA 1HNIA 3TAGA 4DSIA 1S1TA 2OPPA 5J2MA 1VSMA 3RMAA 2G8UA 3P1GA 4DS4A 4CECA 1C0MA 2HHQA 3LWLA 3V1OA 4E19A 4CF8A 4DQRA 2XHBA 4CJKA 1WLJA 1JLQA 4FZYA 4BE1A 2D0BA 5DMRA 3L3UA 4C8KA 1IKYA 3CG7A 1UAXA 3L2VA 4AHTA 3LAKA 1FXXA 1JLFA 3SQ2A 4PY5A 3SJJA 2YNIA 1YT3A 2OZMA 1HQEA 4DFPA 2I5JA 1CZ9A 3U3YA 4DU3A 4CHPA 3DOLA 4FJHA 4F2RA 4FJ9A 4FXDA 4LD0A 1WSGA 3M8QA 4RW7A 1VSDA 3WNEA 4W5OA 4CF9A 3MXJA 3K5MA 5FRMA 4M3ZA 1L5UA 3VQPA 4PQUA 3LPUA 4MQ3A 1RTHA 1Y97A 4CJ4A 4QOZB 4Z4EA 5DK5A 3V9WA 3SQ4A 1XI1A 1Q8IA 1N5YA 1KFSA 1SL1A 3ZT1A 3PY8A 1U48A 2LSNA 1VRTA 3BGRA 4FLVA 4DQSA 1VSEA 4B08A 1O1WA 1VSJA 4N47A 4CJFA 1G15A 4BACA 1BI4A 4CJLA 1VSLA 2HVHA 3S3OA 4DTJA 1QTMA 3VQEA 1QSSA 2OYQA 4KTZA 3SV4A 1SL2A 3NBPA 3AVNA 3NF8A 4DLGA 1IKVA 3QLHA 3QESA 4KO0A 4YFUA 1WAFA 3HP9A 3SQ1A 3TAPA 2QKKA 3KD5E 3IS9A 2X6NA 4MFBA 4CCHA 4ELTA 3L2QA 4W5TA 4F3OA 4Y1DA 3LP3A 4I9QA 2F96A 1RT4A 4DWIA 4I7FA 4AHVA 4CJVA 4ELVA 1VSFA 4DQQA 1XC9A 4Z4HA 3NF7A 1TKXA 1REVA 3AVGA 4DFJA 2XRIA 2HHSA 1TKTA 1ZBUA 3RR8A 4FJKA 4Q5VA 1SUQA 1KTQA 4CE9A 5T7BA 3O3GA 3NDKA 2YKNA 3AVLA 2KTQA 3SZ2A 2A1SA 4E3SA 2QK9A 3QIPA 2E6MA 1J9AA 1RT7A 1HQUA 1VK0A 3C6TA 1W9HA 2P1JA 3KLIA 3BDPA 3RR7A 1ASWA 4CHZA 1X9SA 3OYKA 3HPHA 1RILA 1A5WA 4RW6A 4RW9A 1GOCA 1NJZA 2PYLA 2Z1JA 1LW0A 1WNSA 2QXFA 4IG3A 2G8IA 1C0UA 5CZ1A 4CJWA 4OGCA 2P51A 3QO9A 1RDBA 2YV0X 4M3RA 3KD1E 1JLEA 4KB1A 4CK1A 1LWCA 3ULDA 3AA2A 3RMDA 1UWBA 4FCYA 4M3WA 3PO5A 3DMJA 3MXIA 1JKHA 1LAVA 2FBVA 3S9HA 3SNNA 1ITGA 2DFEA 4O5BA 3F9KA 3LZJA 4ID1A 1SKSA 4W5NA 1WN7A 2VG5A 1VSHA 3SPYA 1S1WA 1NK6A 4HCBA 3OYDA 4B9TA 4CFCA 1A5XA 3DM2A 3DYAA 2HHXA 1HYVA 1QSLA 1S9EA 2OPSA 3AO2A 3U6FA 1TK5A 4Z4FA 3VQBA 3ALYA 1WSFA 4KHUA 3SV3A 3CQ8A 3OJSA 1RNHA 2HHVA 3IAYA 1S6PA 1TVRA 1NJWA 2Y1JA 3MXMA 4ID5A 3S3MA 1GOBA 1TK8A 3QIOA 4JS5A 1S1UA 1TAQA 1HJRA 1RBSA 4HUFA 3ZT0A 1WAJA 4BE2A 4FLXA 3AA5X 4PA1A 3I8DA 4E7IA 3AVMA 3SUNA 2OA8A 3OYLA 1ZYQA 3ZSOA 2G8HA 4CF0A 2YHAA 3KK3A 1CLQA 1BISA 1ASVA 1QS4A 4FJGA 3CFRA 1RCHA 4DS5A 3TAQA 1DTQA 4CEZA 3AA4A 4OLAA 3O3FA 2JLEA 3PX0A 3HT3A 3G10A 1HNVA 4KTWA 3LDSA 5KI6A 3V4IA 4JLHA 2RN2A 4FJ7A 2ETJA 1RT5A 2DFFA 4CHYA 3KIOA 1J54A 4O0IA 3QEPA 1EKEA 1NJYA 4FJIA 4TSXA 4ICLA 4DTUA 1LV5A 3AVAA 3DLHA 3ZCMA 3V9XA 2O4GA 3K5NA 4HUEA 2F8TA 4FW2A 3SUQA 1T8EA 4EZ9A 5HRPA 1NJXA 3VA3A 5HRRA 3MEDA 3AVHA 3V9SA 3TWHA 1KVBA
chains in the Genus database with same CATH superfamily
4IFVA 2ZGZA 1GLJO 1L3UA 4GNIA 3HK2A 4OVLA 3EY1A 4C8MA 4NCGA 4GMJB 3SUOA 4W5QA 3SYZA 4Z4IA 3LDQA 4B9LA 4BR7A 4I9LA 1HLUA 4GV9A 3UE5A 2E4LA 2ZQBA 4KH6A 2D5RA 4A57A 2G8VA 2P9NB 1RDDA 2Z1IA 3MEEA 4PL7A 3M8RA 2E2OA 5HP1A 1N6QA 1HRHA 4E7JA 3FGUA 3LDOA 1CXQA 5ADXH 1DLOA 3FZHA 1QHTA 1J5EK 3THVA 1W0HA 4HTLA 3AO1A 4BGBA 4IEIA 4CJ5A 2O8BA 1T03A 1NK7A 4B8CA 3OYFA 3MN9A 5C24A 1JL1A 1NGJA 2BANA 1NBWA 1BL3A 4JKGB 2Z1GA 1QQCA 1FKOA 1I39A 2NRXA 2YNHA 2PZSA 4B9UA 5F2RA 3WXIA 4RCHA 2EHGA 3DI6A 5GAGP 2O8EA 4XH1A 3OVNA 4WE1A 4CIFA 1YHQN 3LDLA 3E9OA 1OH8A 2A42A 4B3SK 2JWLA 4FLTA 4DV7K 5K14A 4X64K 3H1QA 3ZX0A 5DM7L 4JRQA 1IKWA 3FFKB 4JI6K 2ZM6K 1Q9XA 2V51B 3OYCA 1ZBHA 3MCPA 1YJWN 1D9DA 1IG8A 3O4QA 3VEXA 2E6LA 4WYBA 1M90O 4DSEA 4DTPA 3RTVA 4W5RA 2EWSA 1S5JA 4ILJA 3TSUA 4BQLA 5AQIA 3C0BA 4B1XB 2RE2A 1BCMA 4KI4A 3LAMA 1NK5A 4H0XB 4UY8O 5SZTA 1GLEG 1QQMA 1RTIA 4AILC 3WNGA 4R5PA 4Z4GA 4M7YA 3D2FA 3QERA 4BREA 3OYAA 3TTCA 2B4JA 4DTNA 3O9RA 3H08A 4NLBA 3SBTA 3ZT3A 1FK9A 2KQ2A 4FYDA 1JXEA 5AZIB 4CHOA 1L3TA 2WOMA 2FC0A 5AQPA 3BUZB 5GIPA 4CGIA 1BCOA 1BIZA 1RT6A 3CJ9A 1CZBA 5GINA 1S1VA 1UOCA 4K43A 1LOTB 5LY3A 2FSNA 1RDUA 1K73O 3O9QA 4H0YB 1HPZA 3F73A 5C12A 3C7NB 1MU2A 3T69A 4BRKA 4KBOA 3B6OA 5C42A 4IEEA 3LANA 4BRFA 3OY9A 3RMCA 4CBWA 1BA1A 4JKCA 5AQRA 2QEXN 3SI6A 2I7NA 5KGXA 4DSFA 3W3DA 1IKXA 2HMIA 3OYJA 4CFDA 1VQ5N 1D8YA 2Q1NA 3WNFA 4UQGA 4CJRA 3DLKA 5KRTA 3R9PA 1QQOA 3IG1A 1N36K 4FZXC 4CIGA 5EU7A 3NH2A 1D5AA 1BIUA 4LH4A 3KTQA 1VRUA 1BG3A 2GBZA 4BR4A 1NGEA 4CGFA 1WSHA 4L3QA 4E0DA 2X74A 1C1AA 3KK7A 3OTOK 4DFKA 3CERA 3ZSWA 4XH5A 4FLYA 3S41A 1J53A 4IZ9A 4CEEA 5BRHA 1EETA 4DR5K 4N76A 4HTUA 3U9DA 4OKKA 4HCCA 2V7ZA 2VQEK 3L2UA 3CQYA 3K9KA 4JI7K 4B9QA 1BDGA 1RDCA 4CEOA 4FLWA 4C8OA 4IKFA 3A5OC 4FWMA 1YTUA 3DLGA 4B3TK 4OO1J 4E89A 1WSIA 2B6AA 4JI1K 1KLMA 1U47A 4KHYA 4DU1A 1VQKN 4FJXA 1JLAA 1CXUA 4BC3A 2NLXA 1JLGA 4H5RA 4B8AB 2ITGA 5BR9A 3LZIA 4FSVA 2WFBA 1KVCA 2IVOA 5JICA 3OJUA 3HM9A 1NOYA 2QXLA 3CCJN 1WOQA 3VETA 3HOSA 2P9SB 5AQKA 4CGGA 3VF2A 4FLUA 4J2EA 5KPZA 1OH7A 4QCLA 4M63C 4FM1A 4KHSA 5J2NA 2KLAA 3V1RA 3VMFB 1SL0A 2A41A 2HHHK 3ZX2A 4KHQA 1GLAG 3ZETA 3AO4A 4BVPA 4DV3K 1GLBG 3ZYYX 1YJ9N 2OZSA 4B9NA 3WXMB 3WEEB 3HVRA 2ZD1A 3R8EA 4LC9B 4CJUA 3VEZA 4NO7A 3GOIA 3RMAA 2P9KA 3C6HA 2D4WA 2GX9A 2WC9A 4CF8A 3H6EA 4CJKA 4BE1A 3THYA 1TYQB 1KD1O 5IWAK 3LAKA 1JLFA 4DKWA 1K8KA 4FXDA 1VSDA 3LPUA 2Q31A 1RTHA 1Y97A 3R3LA 4CJ4A 4QOZB 1XI1A 1N5YA 3PY8A 2E2PA 4FLVA 1VSEA 4IOCL 4BQZA 1BI4A 4FWPA 3RSEB 3IDHA 1VSLA 5C0YA 5JMVA 4KTZA 3NBPA 3QLHA 5MLCQ 3AGRA 4KO0A 3SQ1A 3TAPA 4LF8K 3M1FA 4FWLA 2YX6A 4BRIA 2CGLA 3LP3A 4AM6A 1RT4A 4ELVA 1VSFA 5CR4A 3W0LA 1VQ7N 2ZJPL 1REVA 4DFJA 3RR8A 4FJKA 1KTQA 1BO5O 3O3GA 4CZEA 4E3SA 1RT7A 3F9MA 1W9HA 3KLIA 4YDUA 2ZJRL 3EE9A 1LW0A 3CC4N 3NVKA 2QXFA 2G8IA 1KXPA 3QO9A 3KD1E 3MDQA 3RMDA 1UWBA 4A62A 1OKJA 3TU5A 4JI5K 3O9TA 3SNNA 1SKSA 4C1NK 2VG5A 1NM1A 1S1WA 2Q0RA 4BC4A 3OYDA 1NGGA 1YVNA 1A5XA 3DM2A 3DYAA 2HHXA 2OPSA 2BH1A 1TK5A 4Z4FA 5FPEA 3CQ8A 2F9WA 3OJSA 5HL7L 5LJVA 1TK8A 4IOAL 2P9PA 3CJ1A 1Q82O 1WAJA 1ZBIA 4E7IA 1SS6A 3ZSOA 3GL1A 2G8HA 4CF0A 1IV0A 4DR4K 1BISA 2Q36A 3TAQA 3AA4A 3J81O 1NGHA 3CI5A 4BRDA 4KTWA 1N33K 4FJ7A 1NGFA 5EX5A 4CHYA 3MX2A 3IKMA 4O0IA 3QEPA 1NJYA 3C6AA 2HSTA 4ICLA 3DJCA 4DUYK 3ZCMA 5AQLA 3K5NA 3ULEB 2F8TA 4A59A 4X66K 4YHHK 4X62K 2ZF5O 3MEDA 3AVHA 1SAZA 4JI0K 3OYMA 3QINA 2G8WA 1T3VA 5BPNA 3HYFA 3M8PA 3M5RA 1QHAA 3A8YA 2A1RA 2O8CA 1KSPA 4K8XA 3UKUA 2NRWA 4DSLA 3O4NA 4M3YA 3E01A 1X9MA 1NK8A 3ZSVA 4B3OA 1Y64A 3A5NC 4J2BA 3IMXA 4KHPK 2ASPA 3A5MC 4AHCA 2NRZA 4BRPA 2XY5A 4FZZA 2E2NA 4QS8A 4V19S 5AQOA 2VG6A 3KLHA 3LL3A 2P5OA 3K57A 2UUCK 4JD2A 3SLCA 3I8BA 3T1AA 2HNDA 4FW1A 1HJOA 2FBYA 2HBLA 4YOYA 4J2DA 5AQWA 3VGLA 4BDPA 1ZXOA 3P38A 4J8FA 2IVNA 3O1WA 4CJPA 4AH9A 3EEQA 4FVUA 3AVIA 4DR6K 5E41A 2VWKA 5HRNA 4Z0UA 5F0XA 1R0AA 1JXBA 4DHYA 3ZEUA 3NH1A 1TUUA 1TKDA 2YHBA 3SMSA 5BPLA 1XHZA 2P9NA 4M7XA 3MK6A 2HB5A 3V9ZA 4JK9A 3KLFA 4H5WA 3PSFA 4PWDA 1KC8O 4C8NA 3PSIA 2B5JA 1S3XA 3ZSQA 4A2BA 1I94K 4JHDA 3AAPA 4FLZA 1N8RO 4E1JA 3U3GA 4CEBA 3QFPA 2F9TA 5J2PA 4PHTX 1JCFA 4O8KA 2NNWA 3M3ZA 5FRNA 4EHTA 4LH5A 3FE1A 2OANA 2OTLN 1X9WA 3RVCA 5C10A 4FJJA 4FM0A 1ZBSA 1R59O 3VERA 4LY7A 4H03B 5ADXA 4CHNA 3Q7BA 1T44A 1OVYA 4JKGA 3VQ5A 1XHXA 1MWMA 1S6QA 1NMNA 2H3GX 4CJSA 2D0AA 2DY4A 4BDYA 1VQ4N 2FBXA 4ZTFA 4H0PA 3V1QA 3KWIA 2YKMA 4WQ4C 3CETA 2PYJA 3OYNA 1J5OA 5BRDA 2GTDA 3TARA 3LP2A 1L3VA 3BZCA 3F2KA 3A0IX 4KTQA 4CK2A 1F21A 4B1ZA 4JN4A 4N5SA 4FWKA 1MDUB 3VESA 3ZSXA 2BE2A 2FLOA 4OJRA 3TABA 3ZT2A 4F8RA 3WUHA 4CZGA 3PX4A 5M1OA 4DF4A 4PUOA 3P5JA 2GEMA 2ASOA 1EXQA 2RKIA 4AM7A 2FBTA 2FSJA 3PUFA 1WSJA 3HP6A 2Y1IA 2E5LK 3SQ0A 1B92A 1OVQA 3VGKA 3AAQA 3ASMA 5HBMA 3IRXA 1RT1A 4B1WB 3QNOA 1BA0A 3GDQA 1EX4A 3E66A 3RMBA 1KFDA 3VTIA 2VGMA 2UUBK 3VA0A 4I2PA 4MDBA 4CBUA 4DTOA 2X78A 5M1FA 4RTFD 1VSIA 2YNGA 5AQZA 4IO8A 4LFCK 3HZ6A 1QE1A 3KK2A 1YITN 1KRPA 4A5BA 1U49A 4EZ6A 1QVGM 1NK0A 1X9JA 4PKIA 2XY7A 1VQ9N 3TAMA 4CGJA 2YHWA 4B9VA 3NF9A 4LFBK 1MWKA 1KLNA 2E8AA 5CY4A 1C0TA 1DGKN 4JS4A 5EXWA 1TGOA 3MEGA 4CZKA 4DV5K 3QBWA 3OS1A 3C7NA 1DEJA 2QM1A 5AQTA 4DTMA 4GKJK 4O5FA 1RBTA 1XC3A 2HNZA 3EL2A 4BDZA 4QAGA 3PV8A 4KKOA 4AHUA 3I56N 2Q97A 5ELZA 3NVMA 4FVMA 2UXBK 2YI1A 2XY6A 3K5OA 2QWMA 4CIEA 3OYIA 3MX5A 3FR0A 3TR8A 3VQQA 4WCEL 1TV6A 3K58A 2E88A 4DSKA 2EX3A 2G8KA 4IJAA 2ZE2A 1EWRA 4C1NI 4R79A 3AARA 3D0PA 2ZJQL 5JLFA 1T7PA 4M42A 3VF4A 3V6DA 1W97L 4IFEA 1S22A 4DR3K 4H4MA 1YI2N 3O1BA 2E20A 1UA1A 4CJTA 3UIQA 2QWOA 1BQNA 4CZHA 3FZMA 3ITHA 4NCBA 3IUCA 3SCXA 3G4SN 3CHWA 3HOTA 1VHXA 3VQ9A 4YOWA 1I3AA 2DTUA 3C95A 3VN5A 3HBTA 4BC5A 3CMEN 3H3OB 5EVZA 3TI0A 5KPRA 2Q0UA 1RBVA 1HX1A 4DTSA 2OPPA 5J2MA 1BWFO 1SZ2A 2P9UA 3EO3A 4GKKK 2HHQA 3LWLA 4FWQA 3NMUA 4DQRA 2O8DA 1WLJA 1JLQA 2UXDK 1U2VA 3L2VA 4AHTA 1XUPO 2VQFK 3SJJA 1X3NA 2OZMA 2I5JA 1CZ9A 4DU3A 4MO4A 4FJHA 4F2RA 4BRAA 2YCHA 4W5OA 4MLHA 4ILHA 3UKRA 3K5MA 4F9OA 3VQPA 4IOXA 3V9WA 3SQ4A 1Q8IA 3VEVA 2LSNA 3BGRA 4DQSA 2O8EB 4BRLA 1VQNN 1G15A 2HVHA 3THXA 4NXNK 3WEEA 5E26A 2OYQA 1LCUA 3SV4A 1SL2A 4DLGA 1IKVA 3CC2N 5CHIA 3HP9A 1GLDG 3IS9A 1GLLO 2X6NA 1ZC6A 4F3OA 4Y1DA 1YXQA 4I7FA 1RFQA 4CJVA 5BRFA 1XC9A 3L0QA 1TYQA 1HNWK 5AQGA 3NF7A 2VGNA 1T6DA 4BROA 1HR0K 4Q5VA 1SUQA 1HKGA 3H1VX 3SZ2A 2A1SA 2CGKA 4A61A 4DV6K 1Z6RA 2E6MA 1VQ8N 3C6TA 1HQUA 1P8ZA 3BDPA 4IXCA 1ATNA 4EAHD 1X9SA 2PFUA 3T1YK 1XNRK 4U67L 4RW9A 3OW2M 4JKEA 1NJZA 1ATSA 5AQMA 4CD1A 5CZ1A 3RSEA 4CJWA 1RDBA 4M3RA 1GLFO 3CCEN 3CJCA 3ULDA 4JKHA 4GV6A 5AR0A 3AA2A 3BP8A 3R6MA 3MXIA 1JKHA 3S9HA 4NXMK 4QS7A 3FZKA 3O9SA 3BF3A 1ATRA 1NK6A 3U6FA 5AQHA 3QDKA 3ALYA 2P9LB 1WSFA 1M1KO 3VEWA 1RNHA 1TVRA 2Y1JA 1HNXK 3P39A 1EO1A 1NGCA 4FLXA 3AA5X 3I8DA 5FPMA 4LF5K 3AVMA 2CH6A 3O5BA 1DT9A 3KK3A 1VQLN 1YIJN 4FJGA 3CPWM 4CEZA 4JKFA 4OLAA 2JLEA 3PX0A 5AZJB 5B8HA 1KAXA 3H46O 3V4IA 4U7BA 2DFFA 4B1VA 5M1NA 1J54A 2FF3B 4BRNA 1VAZA 1LV5A 3DLHA 1QZ6A 4FW2A 3SUQA 5AFUH 1TUYA 1NJXA 3D7EO 5HRRA 5AJ3K 3U8XA 2O8FA 4M41A 4BRHA 1VQON 2W41A 1IBLK 4LF7K 4JI2K 4BRMA 4DV2K 2O4IA 1HYSA 3QB0A 1IH7A 2NRRA 4CGDA 4IDKA 1RDWX 5C15A 3PO4A 3DXMA 1D4XA 2R7YA 4XIUA 1RTDA 4NYNA 4DG1A 2ZGYA 4B1UB 3HPGA 3EE8A 4PL8A 1YTAA 3TSQA 4WQ5C 1JL2A 4Z4CA 1GOAA 2QI2A 4RW8A 3D45A 3Q7CA 3L2WA 2RF2A 4RWTA 3ULEA 1T05A 5J1EA 4CEQA 1C1CA 4B3MK 1LAWA 3CM5A 5M1PA 3ZT4A 1C6VA 3TANA 4CHQA 3NH0A 5HROA 4OLBA 4CD3A 4KV8A 4M3XA 2VCPA 3MWPA 2GELA 4WQ4A 1T6CA 3DRRA 2D0CA 4CEFA 1SKWA 3SK3A 1SQKA 3SPZA 1ZBLA 1SKRA 3SUPA 3THWA 1XWLA 4I6MB 1ILYA 4CZFA 1X1PA 1NJIO 3RWUA 4YOXA 3KZBA 3CFPA 3D2EB 4CFBA 2V7YA 3HVTA 1Q81O 4FJNA 3DWLA 4IBNA 2WUSA 3JAMO 4EHUA 3B6PA 2KHOA 4CERA 2UXCK 4IFYA 2FF6A 3ZLJA 1G99A 3ZETB 5JS1A 4Y1CA 5CZ2A 1FW6A 4K8ZA 4B9SA 3TTDA 1IG9A 1LWEA 4KB0A 4FWOA 1JCEA 3T19A 4HUGA 3DXKB 1NMDA 2E1YA 4JEPA 4WFNL 4DV4K 3WQUA 5GADP 3TSPA 1WB9A 4DUZK 3HL8A 3KKSA 3CM6A 3EZWA 3MWTA 4RW4A 1MA9B 4MO5A 5KGWA 3AVBA 2IAJA 3NHGA 4CJQA 2HHTA 4CK3A 1K8KB 4BY9C 4H4OA 1EWQA 2QWRA 3BZKA 4FL9A 4KPYA 3CQXA 1KCFA 4DCHA 5GIOA 1X3MA 3CIPA 4NYFA 3F5TA 4KREA 2P9IB 4M3TA 4OKEA 4KAZA 3K5LA 2HF3A 1BI4B 4FK4A 4OPJA 1QSYA 5HLFA 2OTJN 4JKAA 5J2QA 1LW2A 2IIRA 1IO2A 5AQNA 2GUIA 1WSEA 3DOKA 4NB4A 3E9LA 1U45A 3TPQA 3VEYA 3LP0A 3LP1A 3CCMN 4FK0A 4NCAA 3ZSYA 3K2PA 4JI3K 1JJ2M 2A40A 4CJ7A 4CF1A 2IDOA 3HSCA 4G9ZA 4WFAL 4AHRA 3CYMA 2IS3A 4CZIA 3CCVN 3J80O 2YNFA 2WBNA 3S3NA 3T7ZA 2CGJA 1E3MA 4OPAA 5CYMA 4Q0BA 4EFHA 3OBWA 3AVJA 1NKCA 3K9JA 2XO7A 3L3VA 1O13A 4K0KK 2WTUA 4BE0A 4YNQA 4B9MA 2A3ZA 1WBDA 5AQXA 1K8AO 4C23A 4GY2B 1S72N 4WFBL 4O0JA 1A5VA 3NGZA 1RBRA 4CESA 4CJEA 1Q7YO 3DLEA 3TAFA 5SWMA 1RBUA 3ATUA 2OPQA 3LDNA 2OPRA 3AVKA 3HO1A 4ELUA 3KWGA 5DM6L 4DV0K 1NKEA 5FLXO 2NRHA 3KKRA 3AO3A 1NLVA 3E9PA 4FPBA 2QTDA 3HPOA 2BDPA 3ZSZA 5JS2A 1OH6A 1BQMA 4BR2A 4KHWA 4KFBA 4QS9A 1Q86O 2G8FA 1JLCA 1K6YA 4LSNA 5HRSA 2UU9K 3SBGA 4BR0A 3RRGA 3NF6A 2P5GA 3DRPA 2VWJA 1TL3A 4MDAA 1UA0A 3WQTA 1HYZA 4DTXA 4EP5A 1CZAN 5BN9A 4DMNA 4EIAA 3I0RA 3ISNC 3K0SA 2RPIA 4JRPA 5LMUK 3SAHA 1JLBA 1N32K 1QZ5A 1B9DA 3M6GA 4CZMA 5AQJA 3O08A 2DFHA 5FROA 4CVNE 3KLGA 2OCEA 4GVMA 2JGUA 2O8CB 1S9GA 2HVIA 3EN9A 3OA9A 4M45A 4K25A 4A2AA 3QFUA 3VQAA 4E1MA 3T1HK 2KFZA 2UYTA 3G0ZA 3KK1A 3AVCA 4CEAA 2ASMA 4RG8A 2KZMA 4LFAK 2IC3A 1NK4A 4HVJA 3B8AX 3NE6A 4DQPA 3VQ7A 3G25A 4A5AA 3TAGA 1HNIA 1S1TA 1HPMA 3N4QA 1VSMA 3DLLL 4LF9K 2G8UA 3P1GA 4DS4A 4CECA 1V4SA 3V1OA 4E19A 2XHBA 4ISFA 2D0BA 5DMRA 1W7AA 4C8KA 2QWNA 1IKYA 3WXKA 3CG7A 1UAXA 1FXXA 4PY5A 3ENBA 3MMVA 1HQEA 2A5XA 1YJNN 1QVFM 3MN5A 4JI4K 5BN8A 3DOLA 4FJ9A 1WSGA 2IVPA 4RW7A 2GWKA 3WNEA 2F7TA 4CF9A 3MXJA 2W6KA 3LM2A 1L5UA 2AP1A 3BY5A 3ZEUB 1K9MO 4PQUA 4Z4EA 5DK5A 3PLAA 1KFSA 1SL1A 5AZIA 1U48A 1VRTA 3H45C 5EY4A 2GUPA 3MN7A 4B08A 1O1WA 1VSJA 4N47A 4FO0A 4CJFA 5F1XA 4BACA 4CJLA 4DR1K 4DQ8A 1H1VA 1YUWA 4DTJA 2HMPA 1NGIA 3O8MA 1NGAA 3QESA 4JHDB 3TTFA 4YFUA 3KD5E 1WAFA 3WXJA 1EQYA 2BTFA 3R1XA 4DR2K 3C65A 4CCHA 4ELTA 3L2QA 4W5TA 4FWSA 1KAYA 4I9QA 3GE1A 4AHVA 1VQMN 2J4RA 3SJHA 4DQQA 4XEIA 4WF9L 4Z4HA 1TKXA 4CZJA 2HHSA 2XRIA 1ZBUA 4IO9L 3AGKA 3SAFA 4CE9A 5T7BA 2YKNA 2KTQA 5I9EB 4YY3K 2QK9A 3QIPA 4LF6K 1VK0A 4K41A 3WXLA 3HRGA 1YF5L 3RR7A 4JKDA 1V4TA 4BRGA 4CHZA 3HPHA 1A5WA 4RW6A 1GOCA 2PYLA 2Z1JA 1WNSA 4IG3A 3CMAN 1C0UA 2PBDA 1JLEA 3CCUN 1LWCA 3DMJA 1LAVA 2FBVA 1ITGA 5IT9O 4O5BA 3LZJA 4K42A 3SPYA 3FZLA 2HBJA 1QSLA 1S9EA 3AO2A 3VQBA 2HHVA 3IAYA 1NJWA 2I7PA 3P4IA 3MXMA 1GOBA 3QIOA 3MN6A 3CXCM 1S1UA 1TAQA 1RBSA 4HUFA 3ZT0A 4WQ5A 2OA8A 5M1KA 3CFRA 2NRVA 3HT3A 3G10A 1HNVA 3LDSA 2QWPA 3U9ZA 4BGAA 2A6AA 4JLHA 2RN2A 3CF5L 4JV5K 4FWRA 4TSXA 1XQSC 1YAGA 4DTUA 3VOVA 3V9XA 1KAZA 4HUEA 1T8EA 5TKWA 2NRTA 4JNEA 1IBKK 1HUXA 1KVBA 2P9LA 2QKBA 3MECA 4DU4A 1NOZA 3OYBA 2UUAK 2BUPA 2O8BB 2P9SA 1Z25A 2VWBA 3ID6A 4O44A 1Z26A 2HBMA 5AQYA 5LJWA 1VSKA 4DFMA 3L6QA 3A5LC 2Q2RA 4H5VA 2NZTA 4GVEA 5JLHA 4DF8A 1BUPA 4CEDA 3MAQA 3A2FA 5FDLA 4OPHA 5AZJA 3J8AA 4CGHA 4H5NA 1TK0A 1NK9A 4LSLA 5TKYA 4BRCA 3O3HA 3T3FA 3LWMA 1BGXT 3V9UA 4FJ8A 1B9FA 4JK8A 3CCLN 2F4VK 2VYPA 4FWNA 3OBYA 3C6UA 4ISEA 1J6ZA 1C1BA 4GW6A 3KVGA 1NG9A 2HOEA 3ENOA 3UB5A 3VQ8A 3ZSRA 4O55A 3QMLA 3L8BA 3NFAA 5KRSA 5AFUA 3HI0A 4CI6A 2Q3SA 2F8SA 3OS2A 4OPKA 4KRFA 4B1YB 4CF2A 3HXMA 5C25A 4YOTA 4OKJA 1XMQK 2WONA 4DTRA 1NGBA 2QA4N 2FSKA 1N34K 1ASUA 3CFOA 1C0FA 2IGIA 4ILGB 1U04A 4CZLA 3OYEA 2GWJA 4FPAA 1WBBA 3NAEA 4L8RB 4BG9A 3AVFA 1D9FA 4C8LA 4N56A 3CCQN 3P83D 3OS0A 3D2FB 3I55N 4O4GA 3VEOA 2HBKA 5BREA 4AF1A 4ZHRA 2GV9A 1HMVA 2ITMA 4AHSA 4BG8A 4IG0A 1LWFA 1XNQK 1JCGA 1RDAA 5GAHP 3AO5A 4DSJA 1NGDA 1DTTA 1YVUA 4KH5A 1BHLA 4IJNA 4F3TA 2HNYA 3G6EN 4BWJA 1W2BM 3BF1A 2JWKA 5KQDA 4CBXA 2P9UB 4OGEA 3VQ6A 4I6MA 3VF6A 2O8DB 1SV5A 1U2VB 4EP4A 4DQIA 3DRSA 4X65K 2E2QA 1RGIA 2KW4A 2HHWA 2ZWHA 3QEVA 4F4KA 3D2EA 4DV1K 3VQCA 4G1QA 1TAUA 3EKUA 1BU6O 3BEXA 4DR7K 4HHTA 1RT3A 3UKRB 4I2QA 3FFIA 1NWKA 4FM2A 2YHXA 2HHUA 5FPDA 1NU0A 1TKZA 4YOUA 4Z94A 3KLEA 1IBMK 3LPTA 4KI6A 2QWQA 3DLBA 3K59A 4E7KA 3THXB 5EOYA 3VTHA 5KPTA 3QNNA 2QW9A 3C94A 4JK7A 3DXKA 4ZTJA 2D0PA 4DB3A 3H3NO 3QETA 4FJLA 3N4PA 1RT2A 5I3UA 1XMOK 2PY5A 3RRHA 2W42A 4BVOA 4F2SA 4J2AA 3U4LA 1HKCA 1C0GA 3PIOL 3QEWA 4BC2A 2D0OA 3JSMA 1TL1A 3VQ4A 3V81A 2X6SA 2NUBA 4E1NA 2CH5A 3ZX3A 4FK2A 4BWMA 3L4QA 1FKPA 2P9IA 3J7ZO 5AQFA 4JKBA 2IOCA 4CJ3A 3WT0A 3I0SA 3TAEA 1S1XA 1GLCG 5CYQA 3J7YP 1KVAA 3NCIA 5I42A 3EYZA 3HJFA 5A2QO 1RTJA 2DPNA 3AV9A 2VG7A 5E84A 2V52B 4N41A 3QEXA 4E7LA 5D3GA 4H8KA 1IJJA 2XY8A 4B3RK 4H0TB 2ATQA 1ZBFA 3QICA 2BGGA 3CJBA 2HF4A 3QBXA 4FJMA 3HSTB 4PKHA 3J7AP 3L2RA 2Z1HA 3JYTA 3VQDA 1QQNA 4E7HA 1Q9YA 1FJGK 4FOIA 1U4BA 2YJEA 2KKZA 4KHNA 3D6RA 3WNHA 2KZZA 3DLRA 4MLEA 3OYHA 3PX6A 3NGYA 4BRQA 2P9KB 3IFRA 1NNEA 3OYGA 2O8FB 4DLEA 4GV3A 2FXUA 3AA3A 3THYB 3ATVA 5FPNA 3LDPA 3NGIA 4M3UA 3I33A 4ISGA 5KTQA 3QEIA 3M8SA 2HW3A 3DXMB 4BR9A 1Z05A 1P90A 2KFNA 4FJ5A 4CFAA 3O9UA 3CPEA 3KJVA 3EZ5A 4NLCA 4XH4A 1VQ6N 1U6ZA 1OH5A 1VQPN 4H0VB 4H5TA 3ID8A 3CJAA 1DKGD 1EP4A 3EKSA 1L3SA 1NKBA 3LALA 3CCRN 5LL6Z 4DSIA 4O8UA 3JS6A 1C0MA 4JYAK 3E1YA 3G71N 4FZYA 4OX9K 2AA4A 1E4GT 3L3UA 3O80A 3PIPL 4JAXA 3SQ2A 2YNIA 1YT3A 5H1SQ 4DFPA 3U3YA 4CHPA 4LD0A 5AQSA 3M8QA 3O4WA 5FRMA 4M3ZA 4MQ3A 3THWB 3O6WA 3JXUA 3ZT1A 3VPZA 5C2DA 5CE3A 3S3OA 4IWVA 1QTMA 3VQEA 5BR8K 1QSSA 3AVNA 3NF8A 5GAEP 1BOTO 2QWLA 2QKKA 4FOEA 4MFBA 5KQ8A 2RHKA 3GBTA 3P31A 2F96A 4DWIA 3GG4A 5C2FA 4PKGA 4BR5A 3AVGA 1TKTA 3MCAB 2W40A 3VENA 3HM8A 3NDKA 4CW7B 3AVLA 2P9PB 1J9AA 5JVGL 2P1JA 5LMNK 1ASWA 3VGMA 3OYKA 1RILA 3FZFA 5AQVA 3DAWA 4IDHA 2YHYA 2AJQA 4OGCA 2E1ZA 2P51A 4KB1A 2YV0X 4CK1A 3HTVA 4FCYA 3CC7N 4M3WA 5HOOA 3PO5A 5AQQA 1E4FT 3LM9A 2DFEA 3F9KA 4ID1A 4W5NA 1WN7A 1VSHA 4YOVA 5JVHL 4HCBA 4B9TA 4Y0WA 4CFCA 2D1KA 1HYVA 1WUAA 4KHUA 1HKBA 3SV3A 1KQSM 1S6PA 4ID5A 3S3MA 4JS5A 5AQUA 1HJRA 3L4IA 3SMPA 5M1QA 4BE2A 4AQYK 4JI8K 4PA1A 3SUNA 1Q18A 3AY9A 3ENHA 3OYLA 1ZYQA 5BPMA 2YHAA 3CD6N 1CLQA 3UKUB 1ASVA 1QS4A 4DS5A 1RCHA 1DTQA 4YORA 3CCSN 3O3FA 2YJFA 2W6LA 5KI6A 4HWIA 2ETJA 1RT5A 2PAVA 3KIOA 3SAGA 1EKEA 4FJIA 3FLCO 4KH4A 4H0OA 4YDUC 3AVAA 1HNZK 1ESVA 2O4GA 3OHRA 4LF4K 4EZ9A 3KHYA 5HRPA 4JD2B 3VA3A 3CJ7A 3V9SA 3TWHA
chains in the Genus database with same CATH topology
3OYMA 4M41A 3QINA 2QKBA 3MECA 4DU4A 1NOZA 2G8WA 4IFVA 3OYBA 3HYFA 1L3UA 3M8PA 3HK2A 4OVLA 2O4IA 1Z25A 4C8MA 3EY1A 4NCGA 1IH7A 4O44A 1Z26A 4CGDA 2A1RA 1HYSA 4IDKA 4GMJB 3SUOA 1KSPA 3PO4A 1VSKA 4W5QA 2R7YA 3SYZA 4DFMA 4Z4IA 4B9LA 4XIUA 4K8XA 4DSLA 4DF8A 1RTDA 4I9LA 4NYNA 4CEDA 3O4NA 3A2FA 5FDLA 4DG1A 3MAQA 4M3YA 3HPGA 3E01A 4CGHA 2E4LA 1X9MA 1TK0A 2ZQBA 1NK9A 1TAUA 2D5RA 4LSLA 3O3HA 2G8VA 1YTAA 1NK8A 3T3FA 3ZSVA 4B3OA 3LWMA 4J2BA 1JL2A 4Z4CA 1GOAA 1RDDA 2Z1IA 1BGXT 4RW8A 4AHCA 3MEEA 3V9UA 2XY5A 4FJ8A 1B9FA 4FZZA 3M8RA 3D45A 5HP1A 3L2WA 2RF2A 1N6QA 2VG6A 3KLHA 1T05A 1HRHA 5J1EA 4E7JA 2P5OA 3C6UA 3K57A 4CEQA 1C1CA 1CXQA 1LAWA 3T1AA 2HNDA 1DLOA 3CM5A 1C1BA 1QHTA 4GW6A 4FW1A 1C6VA 3ZT4A 3TANA 3THVA 2FBYA 4J2DA 1W0HA 3VQ8A 3ZSRA 4O55A 3AO1A 3L8BA 4BDPA 1ZBIA 4CJ5A 3NFAA 4CHQA 5KRSA 4CJPA 3NH0A 5HROA 4AH9A 1NK7A 1T03A 4OLBA 4KV8A 4M3XA 2Q3SA 2F8SA 4B8CA 3OS2A 3OYFA 3AVIA 4OPKA 4KRFA 5C24A 1JL1A 5E41A 3DRRA 2VWKA 4CF2A 5HRNA 3HXMA 2D0CA 4Z0UA 4CEFA 1SKWA 2BANA 5C25A 1BL3A 3SPZA 4OKJA 1ZBLA 2WONA 1R0AA 1JXBA 1QQCA 1FKOA 1I39A 2YNHA 2Z1GA 3NH1A 4DTRA 2PZSA 4B9UA 1ASUA 3CFOA 1TKDA 3SUPA 2IGIA 1SKRA 1U04A 2YHBA 3OYEA 1XHZA 1XWLA 2EHGA 3DI6A 3NAEA 4L8RB 1X1PA 3RWUA 2HB5A 3AVFA 3V9ZA 3KLFA 3CFPA 3OVNA 4WE1A 1D9FA 4C8LA 4CIFA 2KZZA 4N56A 4PWDA 4CFBA 3P83D 3HVTA 3OS0A 4C8NA 4FJNA 2B5JA 4O4GA 3ZSQA 4FLTA 4FLZA 4IBNA 4ZHRA 2GV9A 1HMVA 5K14A 4AHSA 4IG0A 3B6PA 3U3GA 4CERA 4CEBA 4IFYA 4JRQA 1LWFA 1IKWA 5J2PA 1RDAA 3AO5A 1Q9XA 4DSJA 3OYCA 1ZBHA 1YVUA 1DTTA 1D9DA 5FRNA 3O4QA 4LH5A 5JS1A 4Y1CA 2E6LA 1BHLA 5CZ2A 4K8ZA 1X9WA 4B9SA 1IG9A 1LWEA 4DSEA 4FJJA 4FM0A 4DTPA 3RTVA 4F3TA 2HNYA 4BWJA 4KB0A 4W5RA 4LY7A 1S5JA 4CHNA 3VQ5A 3T19A 1XHXA 4OGEA 1S6QA 4HUGA 4CJSA 1BCMA 2D0AA 3VQ6A 4BDYA 4KI4A 3LAMA 2DY4A 2FBXA 1NK5A 4ZTFA 3V1QA 5SZTA 1SV5A 2YKMA 1RTIA 3CM6A 3HL8A 3KKSA 3WNGA 4EP4A 3DRSA 4AILC 4DQIA 4RW4A 2KW4A 4R5PA 2HHWA 5KGWA 3QEVA 4F4KA 4Z4GA 2PYJA 3AVBA 3OYNA 2IAJA 3VQCA 3NHGA 4G1QA 4CJQA 1J5OA 4CK3A 3QERA 3TARA 3LP2A 3OYAA 1L3VA 2HHTA 2B4JA 4HHTA 1RT3A 4H4OA 4DTNA 4KTQA 3H08A 3ZT3A 4CK2A 1FK9A 4KPYA 2KQ2A 1F21A 1KCFA 3FFIA 4I2QA 4FYDA 4FM2A 2HHUA 1JXEA 4NYFA 4N5SA 4KREA 1TKZA 3KLEA 4M3TA 4OKEA 3ZSXA 4KAZA 2BE2A 3K5LA 3LPTA 4CHOA 4KI6A 4OJRA 3TABA 3ZT2A 1L3TA 1BI4B 3K59A 3DLBA 4F8RA 2WOMA 4E7KA 2FC0A 3PX4A 4FK4A 4DF4A 4OPJA 3P5JA 1QSYA 5HLFA 4PUOA 4CGIA 1BCOA 5J2QA 1LW2A 1BIZA 3QNNA 1IO2A 1RT6A 1EXQA 2RKIA 2FBTA 1CZBA 3PUFA 1WSJA 3HP6A 2GUIA 2Y1IA 1S1VA 3C94A 1WSEA 1UOCA 1B92A 3DOKA 3SQ0A 4ZTJA 3QETA 4FJLA 1U45A 3LP0A 3LP1A 4FK0A 1RT2A 5I3UA 2PY5A 3RRHA 1HPZA 4NCAA 2W42A 3ZSYA 3ASMA 5HBMA 3F73A 3K2PA 3IRXA 1RT1A 4F2SA 4J2AA 1MU2A 3QEWA 4CF1A 5C42A 3B6OA 3JSMA 3QNOA 3LANA 2IDOA 1EX4A 3RMBA 1TL1A 3OY9A 1KFDA 3RMCA 4AHRA 3VQ4A 3CYMA 2IS3A 2NUBA 2X6SA 4E1NA 4I2PA 3VA0A 3V81A 3SI6A 2YNFA 5KGXA 4DTOA 3S3NA 4DSFA 2X78A 1IKXA 5CYMA 1VSIA 2YNGA 2HMIA 4FK2A 4Q0BA 4BWMA 3OYJA 4CFDA 1FKPA 3AVJA 1QE1A 3KK2A 1NKCA 1D8YA 2IOCA 2XO7A 3L3VA 4CJ3A 3I0SA 3TAEA 1KRPA 3WNFA 1S1XA 4UQGA 1U49A 4EZ6A 1NK0A 4CJRA 3DLKA 5CYQA 2XY7A 4BE0A 5KRTA 4YNQA 1KVAA 4B9MA 3TAMA 3IG1A 4CGJA 3NCIA 5I42A 4FZXC 4CIGA 3EYZA 3HJFA 5EU7A 3NH2A 1D5AA 3NF9A 1BIUA 3AV9A 1RTJA 1KLNA 4LH4A 3KTQA 4B9VA 1VRUA 5CY4A 2VG7A 1C0TA 2GBZA 4O0JA 4JS4A 4N41A 1A5VA 3QEXA 4CGFA 3NGZA 4E7LA 4H8KA 5D3GA 1TGOA 1WSHA 1RBRA 2XY8A 4CESA 4E0DA 3MEGA 2ATQA 1ZBFA 2X74A 4CJEA 1C1AA 3DLEA 3OS1A 3TAFA 5SWMA 2BGGA 1RBUA 2OPQA 4DFKA 4FJMA 4DTMA 3HSTB 2OPRA 3ZSWA 3AVKA 1RBTA 4ELUA 2HNZA 4FLYA 3HO1A 4BDZA 3L2RA 1J53A 4CEEA 4QAGA 2Z1HA 4KKOA 4AHUA 3PV8A 1NKEA 3JYTA 1EETA 3VQDA 4N76A 4HTUA 3KKRA 3AO3A 4FVMA 4OKKA 4E7HA 1Q9YA 4HCCA 3HPOA 2XY6A 3L2UA 2BDPA 3ZSZA 1U4BA 3K5OA 5JS2A 1BQMA 4CIEA 3OYIA 4KHWA 1RDCA 4KFBA 4KHNA 3TR8A 3VQQA 3WNHA 1TV6A 3K58A 4CEOA 4FLWA 3DLRA 4DSKA 2G8FA 1JLCA 1K6YA 4LSNA 3OYHA 5HRSA 4C8OA 4IKFA 3PX6A 2EX3A 1YTUA 3DLGA 2G8KA 3RRGA 3NGYA 3NF6A 4E89A 1WSIA 2ZE2A 2B6AA 2P5GA 1KLMA 1U47A 4KHYA 4DU1A 4FJXA 3DRPA 2VWJA 1TL3A 3D0PA 1UA0A 1HYZA 4DTXA 1JLAA 4EP5A 1CXUA 4DMNA 3OYGA 1T7PA 1JLGA 3I0RA 3ISNC 3V6DA 4B8AB 2ITGA 3LZIA 4M42A 2RPIA 4JRPA 4DLEA 1JLBA 1KVCA 4H4MA 3AA3A 1B9DA 3OJUA 3HM9A 3NGIA 1NOYA 4M3UA 1UA1A 2DFHA 4CJTA 5KTQA 5FROA 3QEIA 3KLGA 3UIQA 4GVMA 2JGUA 4CGGA 3M8SA 2HW3A 4FLUA 1BQNA 3ITHA 1S9GA 4J2EA 4NCBA 2HVIA 4M45A 3SCXA 2KFNA 4QCLA 4FM1A 4FJ5A 3VQAA 5J2NA 4CFAA 4E1MA 4KHSA 2KFZA 3V1RA 3G0ZA 3KJVA 3EZ5A 3KK1A 3AVCA 1SL0A 3VQ9A 4CEAA 2DTUA 1I3AA 2KZMA 4RG8A 4KHQA 3C95A 2IC3A 3AO4A 3VN5A 2AJQA 1NK4A 4HVJA 3TI0A 3NE6A 2OZSA 4DQPA 1EP4A 1L3SA 1NKBA 4B9NA 3VQ7A 1RBVA 3HVRA 3LALA 2ZD1A 4CJUA 4DTSA 1HNIA 3TAGA 4DSIA 1S1TA 2OPPA 5J2MA 1VSMA 3RMAA 2G8UA 3P1GA 4DS4A 4CECA 1C0MA 2HHQA 3LWLA 3V1OA 4E19A 4CF8A 4DQRA 2XHBA 4CJKA 1WLJA 1JLQA 4FZYA 4BE1A 2D0BA 5DMRA 3L3UA 4C8KA 1IKYA 3CG7A 1UAXA 3L2VA 4AHTA 3LAKA 1FXXA 1JLFA 3SQ2A 4PY5A 3SJJA 2YNIA 1YT3A 2OZMA 1HQEA 4DFPA 2I5JA 1CZ9A 3U3YA 4DU3A 4CHPA 3DOLA 4FJHA 4F2RA 4FJ9A 4FXDA 4LD0A 1WSGA 3M8QA 4RW7A 1VSDA 3WNEA 4W5OA 4CF9A 3MXJA 3K5MA 5FRMA 4M3ZA 1L5UA 3VQPA 4PQUA 3LPUA 4MQ3A 1RTHA 1Y97A 4CJ4A 4QOZB 4Z4EA 5DK5A 3V9WA 3SQ4A 1XI1A 1Q8IA 1N5YA 1KFSA 1SL1A 3ZT1A 3PY8A 1U48A 2LSNA 1VRTA 3BGRA 4FLVA 4DQSA 1VSEA 4B08A 1O1WA 1VSJA 4N47A 4CJFA 1G15A 4BACA 1BI4A 4CJLA 1VSLA 2HVHA 3S3OA 4DTJA 1QTMA 3VQEA 1QSSA 2OYQA 4KTZA 3SV4A 1SL2A 3NBPA 3AVNA 3NF8A 4DLGA 1IKVA 3QLHA 3QESA 4KO0A 4YFUA 1WAFA 3HP9A 3SQ1A 3TAPA 2QKKA 3KD5E 3IS9A 2X6NA 4MFBA 4CCHA 4ELTA 3L2QA 4W5TA 4F3OA 4Y1DA 3LP3A 4I9QA 2F96A 1RT4A 4DWIA 4I7FA 4AHVA 4CJVA 4ELVA 1VSFA 4DQQA 1XC9A 4Z4HA 3NF7A 1TKXA 1REVA 3AVGA 4DFJA 2XRIA 2HHSA 1TKTA 1ZBUA 3RR8A 4FJKA 4Q5VA 1SUQA 1KTQA 4CE9A 5T7BA 3O3GA 3NDKA 2YKNA 3AVLA 2KTQA 3SZ2A 2A1SA 4E3SA 2QK9A 3QIPA 2E6MA 1J9AA 1RT7A 1HQUA 1VK0A 3C6TA 1W9HA 2P1JA 3KLIA 3BDPA 3RR7A 1ASWA 4CHZA 1X9SA 3OYKA 3HPHA 1RILA 1A5WA 4RW6A 4RW9A 1GOCA 1NJZA 2PYLA 2Z1JA 1LW0A 1WNSA 2QXFA 4IG3A 2G8IA 1C0UA 5CZ1A 4CJWA 4OGCA 2P51A 3QO9A 1RDBA 2YV0X 4M3RA 3KD1E 1JLEA 4KB1A 4CK1A 1LWCA 3ULDA 3AA2A 3RMDA 1UWBA 4FCYA 4M3WA 3PO5A 3DMJA 3MXIA 1JKHA 1LAVA 2FBVA 3S9HA 3SNNA 1ITGA 2DFEA 4O5BA 3F9KA 3LZJA 4ID1A 1SKSA 4W5NA 1WN7A 2VG5A 1VSHA 3SPYA 1S1WA 1NK6A 4HCBA 3OYDA 4B9TA 4CFCA 1A5XA 3DM2A 3DYAA 2HHXA 1HYVA 1QSLA 1S9EA 2OPSA 3AO2A 3U6FA 1TK5A 4Z4FA 3VQBA 3ALYA 1WSFA 4KHUA 3SV3A 3CQ8A 3OJSA 1RNHA 2HHVA 3IAYA 1S6PA 1TVRA 1NJWA 2Y1JA 3MXMA 4ID5A 3S3MA 1GOBA 1TK8A 3QIOA 4JS5A 1S1UA 1TAQA 1HJRA 1RBSA 4HUFA 3ZT0A 1WAJA 4BE2A 4FLXA 3AA5X 4PA1A 3I8DA 4E7IA 3AVMA 3SUNA 2OA8A 3OYLA 1ZYQA 3ZSOA 2G8HA 4CF0A 2YHAA 3KK3A 1CLQA 1BISA 1ASVA 1QS4A 4FJGA 3CFRA 1RCHA 4DS5A 3TAQA 1DTQA 4CEZA 3AA4A 4OLAA 3O3FA 2JLEA 3PX0A 3HT3A 3G10A 1HNVA 4KTWA 3LDSA 5KI6A 3V4IA 4JLHA 2RN2A 4FJ7A 2ETJA 1RT5A 2DFFA 4CHYA 3KIOA 1J54A 4O0IA 3QEPA 1EKEA 1NJYA 4FJIA 4TSXA 4ICLA 4DTUA 1LV5A 3AVAA 3DLHA 3ZCMA 3V9XA 2O4GA 3K5NA 4HUEA 2F8TA 4FW2A 3SUQA 1T8EA 4EZ9A 5HRPA 1NJXA 3VA3A 5HRRA 3MEDA 3AVHA 3V9SA 3TWHA 1KVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYM A;  4M41 A;  3QIN A;  2QKB A;  3MEC A;  4DU4 A;  1NOZ A;  2G8W A;  4IFV A;  3OYB A;  3HYF A;  1L3U A;  3M8P A;  3HK2 A;  4OVL A;  2O4I A;  1Z25 A;  4C8M A;  3EY1 A;  4NCG A;  1IH7 A;  4O44 A;  1Z26 A;  4CGD A;  2A1R A;  1HYS A;  4IDK A;  4GMJ B;  3SUO A;  1KSP A;  3PO4 A;  1VSK A;  4W5Q A;  2R7Y A;  3SYZ A;  4DFM A;  4Z4I A;  4B9L A;  4XIU A;  4K8X A;  4DSL A;  4DF8 A;  1RTD A;  4I9L A;  4NYN A;  4CED A;  3O4N A;  3A2F A;  5FDL A;  4DG1 A;  3MAQ A;  4M3Y A;  3HPG A;  3E01 A;  4CGH A;  2E4L A;  1X9M A;  1TK0 A;  2ZQB A;  1NK9 A;  1TAU A;  2D5R A;  4LSL A;  3O3H A;  2G8V A;  1YTA A;  1NK8 A;  3T3F A;  3ZSV A;  4B3O A;  3LWM A;  4J2B A;  1JL2 A;  4Z4C A;  1GOA A;  1RDD A;  2Z1I A;  1BGX T;  4RW8 A;  4AHC A;  3MEE A;  3V9U A;  2XY5 A;  4FJ8 A;  1B9F A;  4FZZ A;  3M8R A;  3D45 A;  5HP1 A;  3L2W A;  2RF2 A;  1N6Q A;  2VG6 A;  3KLH A;  1T05 A;  1HRH A;  5J1E A;  4E7J A;  2P5O A;  3C6U A;  3K57 A;  4CEQ A;  1C1C A;  1CXQ A;  1LAW A;  3T1A A;  2HND A;  1DLO A;  3CM5 A;  1C1B A;  1QHT A;  4GW6 A;  4FW1 A;  1C6V A;  3ZT4 A;  3TAN A;  3THV A;  2FBY A;  4J2D A;  1W0H A;  3VQ8 A;  3ZSR A;  4O55 A;  3AO1 A;  3L8B A;  4BDP A;  1ZBI A;  4CJ5 A;  3NFA A;  4CHQ A;  5KRS A;  4CJP A;  3NH0 A;  5HRO A;  4AH9 A;  1NK7 A;  1T03 A;  4OLB A;  4KV8 A;  4M3X A;  2Q3S A;  2F8S A;  4B8C A;  3OS2 A;  3OYF A;  3AVI A;  4OPK A;  4KRF A;  5C24 A;  1JL1 A;  5E41 A;  3DRR A;  2VWK A;  4CF2 A;  5HRN A;  3HXM A;  2D0C A;  4Z0U A;  4CEF A;  1SKW A;  2BAN A;  5C25 A;  1BL3 A;  3SPZ A;  4OKJ A;  1ZBL A;  2WON A;  1R0A A;  1JXB A;  1QQC A;  1FKO A;  1I39 A;  2YNH A;  2Z1G A;  3NH1 A;  4DTR A;  2PZS A;  4B9U A;  1ASU A;  3CFO A;  1TKD A;  3SUP A;  2IGI A;  1SKR A;  1U04 A;  2YHB A;  3OYE A;  1XHZ A;  1XWL A;  2EHG A;  3DI6 A;  3NAE A;  4L8R B;  1X1P A;  3RWU A;  2HB5 A;  3AVF A;  3V9Z A;  3KLF A;  3CFP A;  3OVN A;  4WE1 A;  1D9F A;  4C8L A;  4CIF A;  2KZZ A;  4N56 A;  4PWD A;  4CFB A;  3P83 D;  3HVT A;  3OS0 A;  4C8N A;  4FJN A;  2B5J A;  4O4G A;  3ZSQ A;  4FLT A;  4FLZ A;  4IBN A;  4ZHR A;  2GV9 A;  1HMV A;  5K14 A;  4AHS A;  4IG0 A;  3B6P A;  3U3G A;  4CER A;  4CEB A;  4IFY A;  4JRQ A;  1LWF A;  1IKW A;  5J2P A;  1RDA A;  3AO5 A;  1Q9X A;  4DSJ A;  3OYC A;  1ZBH A;  1YVU A;  1DTT A;  1D9D A;  5FRN A;  3O4Q A;  4LH5 A;  5JS1 A;  4Y1C A;  2E6L A;  1BHL A;  5CZ2 A;  4K8Z A;  1X9W A;  4B9S A;  1IG9 A;  1LWE A;  4DSE A;  4FJJ A;  4FM0 A;  4DTP A;  3RTV A;  4F3T A;  2HNY A;  4BWJ A;  4KB0 A;  4W5R A;  4LY7 A;  1S5J A;  4CHN A;  3VQ5 A;  3T19 A;  1XHX A;  4OGE A;  1S6Q A;  4HUG A;  4CJS A;  1BCM A;  2D0A A;  3VQ6 A;  4BDY A;  4KI4 A;  3LAM A;  2DY4 A;  2FBX A;  1NK5 A;  4ZTF A;  3V1Q A;  5SZT A;  1SV5 A;  2YKM A;  1RTI A;  3CM6 A;  3HL8 A;  3KKS A;  3WNG A;  4EP4 A;  3DRS A;  4AIL C;  4DQI A;  4RW4 A;  2KW4 A;  4R5P A;  2HHW A;  5KGW A;  3QEV A;  4F4K A;  4Z4G A;  2PYJ A;  3AVB A;  3OYN A;  2IAJ A;  3VQC A;  3NHG A;  4G1Q A;  4CJQ A;  1J5O A;  4CK3 A;  3QER A;  3TAR A;  3LP2 A;  3OYA A;  1L3V A;  2HHT A;  2B4J A;  4HHT A;  1RT3 A;  4H4O A;  4DTN A;  4KTQ A;  3H08 A;  3ZT3 A;  4CK2 A;  1FK9 A;  4KPY A;  2KQ2 A;  1F21 A;  1KCF A;  3FFI A;  4I2Q A;  4FYD A;  4FM2 A;  2HHU A;  1JXE A;  4NYF A;  4N5S A;  4KRE A;  1TKZ A;  3KLE A;  4M3T A;  4OKE A;  3ZSX A;  4KAZ A;  2BE2 A;  3K5L A;  3LPT A;  4CHO A;  4KI6 A;  4OJR A;  3TAB A;  3ZT2 A;  1L3T A;  1BI4 B;  3K59 A;  3DLB A;  4F8R A;  2WOM A;  4E7K A;  2FC0 A;  3PX4 A;  4FK4 A;  4DF4 A;  4OPJ A;  3P5J A;  1QSY A;  5HLF A;  4PUO A;  4CGI A;  1BCO A;  5J2Q A;  1LW2 A;  1BIZ A;  3QNN A;  1IO2 A;  1RT6 A;  1EXQ A;  2RKI A;  2FBT A;  1CZB A;  3PUF A;  1WSJ A;  3HP6 A;  2GUI A;  2Y1I A;  1S1V A;  3C94 A;  1WSE A;  1UOC A;  1B92 A;  3DOK A;  3SQ0 A;  4ZTJ A;  3QET A;  4FJL A;  1U45 A;  3LP0 A;  3LP1 A;  4FK0 A;  1RT2 A;  5I3U A;  2PY5 A;  3RRH A;  1HPZ A;  4NCA A;  2W42 A;  3ZSY A;  3ASM A;  5HBM A;  3F73 A;  3K2P A;  3IRX A;  1RT1 A;  4F2S A;  4J2A A;  1MU2 A;  3QEW A;  4CF1 A;  5C42 A;  3B6O A;  3JSM A;  3QNO A;  3LAN A;  2IDO A;  1EX4 A;  3RMB A;  1TL1 A;  3OY9 A;  1KFD A;  3RMC A;  4AHR A;  3VQ4 A;  3CYM A;  2IS3 A;  2NUB A;  2X6S A;  4E1N A;  4I2P A;  3VA0 A;  3V81 A;  3SI6 A;  2YNF A;  5KGX A;  4DTO A;  3S3N A;  4DSF A;  2X78 A;  1IKX A;  5CYM A;  1VSI A;  2YNG A;  2HMI A;  4FK2 A;  4Q0B A;  4BWM A;  3OYJ A;  4CFD A;  1FKP A;  3AVJ A;  1QE1 A;  3KK2 A;  1NKC A;  1D8Y A;  2IOC A;  2XO7 A;  3L3V A;  4CJ3 A;  3I0S A;  3TAE A;  1KRP A;  3WNF A;  1S1X A;  4UQG A;  1U49 A;  4EZ6 A;  1NK0 A;  4CJR A;  3DLK A;  5CYQ A;  2XY7 A;  4BE0 A;  5KRT A;  4YNQ A;  1KVA A;  4B9M A;  3TAM A;  3IG1 A;  4CGJ A;  3NCI A;  5I42 A;  4FZX C;  4CIG A;  3EYZ A;  3HJF A;  5EU7 A;  3NH2 A;  1D5A A;  3NF9 A;  1BIU A;  3AV9 A;  1RTJ A;  1KLN A;  4LH4 A;  3KTQ A;  4B9V A;  1VRU A;  5CY4 A;  2VG7 A;  1C0T A;  2GBZ A;  4O0J A;  4JS4 A;  4N41 A;  1A5V A;  3QEX A;  4CGF A;  3NGZ A;  4E7L A;  4H8K A;  5D3G A;  1TGO A;  1WSH A;  1RBR A;  2XY8 A;  4CES A;  4E0D A;  3MEG A;  2ATQ A;  1ZBF A;  2X74 A;  4CJE A;  1C1A A;  3DLE A;  3OS1 A;  3TAF A;  5SWM A;  2BGG A;  1RBU A;  2OPQ A;  4DFK A;  4FJM A;  4DTM A;  3HST B;  2OPR A;  3ZSW A;  3AVK A;  1RBT A;  4ELU A;  2HNZ A;  4FLY A;  3HO1 A;  4BDZ A;  3L2R A;  1J53 A;  4CEE A;  4QAG A;  2Z1H A;  4KKO A;  4AHU A;  3PV8 A;  1NKE A;  3JYT A;  1EET A;  3VQD A;  4N76 A;  4HTU A;  3KKR A;  3AO3 A;  4FVM A;  4OKK A;  4E7H A;  1Q9Y A;  4HCC A;  3HPO A;  2XY6 A;  3L2U A;  2BDP A;  3ZSZ A;  1U4B A;  3K5O A;  5JS2 A;  1BQM A;  4CIE A;  3OYI A;  4KHW A;  1RDC A;  4KFB A;  4KHN A;  3TR8 A;  3VQQ A;  3WNH A;  1TV6 A;  3K58 A;  4CEO A;  4FLW A;  3DLR A;  4DSK A;  2G8F A;  1JLC A;  1K6Y A;  4LSN A;  3OYH A;  5HRS A;  4C8O A;  4IKF A;  3PX6 A;  2EX3 A;  1YTU A;  3DLG A;  2G8K A;  3RRG A;  3NGY A;  3NF6 A;  4E89 A;  1WSI A;  2ZE2 A;  2B6A A;  2P5G A;  1KLM A;  1U47 A;  4KHY A;  4DU1 A;  4FJX A;  3DRP A;  2VWJ A;  1TL3 A;  3D0P A;  1UA0 A;  1HYZ A;  4DTX A;  1JLA A;  4EP5 A;  1CXU A;  4DMN A;  3OYG A;  1T7P A;  1JLG A;  3I0R A;  3ISN C;  3V6D A;  4B8A B;  2ITG A;  3LZI A;  4M42 A;  2RPI A;  4JRP A;  4DLE A;  1JLB A;  1KVC A;  4H4M A;  3AA3 A;  1B9D A;  3OJU A;  3HM9 A;  3NGI A;  1NOY A;  4M3U A;  1UA1 A;  2DFH A;  4CJT A;  5KTQ A;  5FRO A;  3QEI A;  3KLG A;  3UIQ A;  4GVM A;  2JGU A;  4CGG A;  3M8S A;  2HW3 A;  4FLU A;  1BQN A;  3ITH A;  1S9G A;  4J2E A;  4NCB A;  2HVI A;  4M45 A;  3SCX A;  2KFN A;  4QCL A;  4FM1 A;  4FJ5 A;  3VQA A;  5J2N A;  4CFA A;  4E1M A;  4KHS A;  2KFZ A;  3V1R A;  3G0Z A;  3KJV A;  3EZ5 A;  3KK1 A;  3AVC A;  1SL0 A;  3VQ9 A;  4CEA A;  2DTU A;  1I3A A;  2KZM A;  4RG8 A;  4KHQ A;  3C95 A;  2IC3 A;  3AO4 A;  3VN5 A;  2AJQ A;  1NK4 A;  4HVJ A;  3TI0 A;  3NE6 A;  2OZS A;  4DQP A;  1EP4 A;  1L3S A;  1NKB A;  4B9N A;  3VQ7 A;  1RBV A;  3HVR A;  3LAL A;  2ZD1 A;  4CJU A;  4DTS A;  1HNI A;  3TAG A;  4DSI A;  1S1T A;  2OPP A;  5J2M A;  1VSM A;  3RMA A;  2G8U A;  3P1G A;  4DS4 A;  4CEC A;  1C0M A;  2HHQ A;  3LWL A;  3V1O A;  4E19 A;  4CF8 A;  4DQR A;  2XHB A;  4CJK A;  1WLJ A;  1JLQ A;  4FZY A;  4BE1 A;  2D0B A;  5DMR A;  3L3U A;  4C8K A;  1IKY A;  3CG7 A;  1UAX A;  3L2V A;  4AHT A;  3LAK A;  1FXX A;  1JLF A;  3SQ2 A;  4PY5 A;  3SJJ A;  2YNI A;  1YT3 A;  2OZM A;  1HQE A;  4DFP A;  2I5J A;  1CZ9 A;  3U3Y A;  4DU3 A;  4CHP A;  3DOL A;  4FJH A;  4F2R A;  4FJ9 A;  4FXD A;  4LD0 A;  1WSG A;  3M8Q A;  4RW7 A;  1VSD A;  3WNE A;  4W5O A;  4CF9 A;  3MXJ A;  3K5M A;  5FRM A;  4M3Z A;  1L5U A;  3VQP A;  4PQU A;  3LPU A;  4MQ3 A;  1RTH A;  1Y97 A;  4CJ4 A;  4QOZ B;  4Z4E A;  5DK5 A;  3V9W A;  3SQ4 A;  1XI1 A;  1Q8I A;  1N5Y A;  1KFS A;  1SL1 A;  3ZT1 A;  3PY8 A;  1U48 A;  2LSN A;  1VRT A;  3BGR A;  4FLV A;  4DQS A;  1VSE A;  4B08 A;  1O1W A;  1VSJ A;  4N47 A;  4CJF A;  1G15 A;  4BAC A;  1BI4 A;  4CJL A;  1VSL A;  2HVH A;  3S3O A;  4DTJ A;  1QTM A;  3VQE A;  1QSS A;  2OYQ A;  4KTZ A;  3SV4 A;  1SL2 A;  3NBP A;  3AVN A;  3NF8 A;  4DLG A;  1IKV A;  3QLH A;  3QES A;  4KO0 A;  4YFU A;  1WAF A;  3HP9 A;  3SQ1 A;  3TAP A;  2QKK A;  3KD5 E;  3IS9 A;  2X6N A;  4MFB A;  4CCH A;  4ELT A;  3L2Q A;  4W5T A;  4F3O A;  4Y1D A;  3LP3 A;  4I9Q A;  2F96 A;  1RT4 A;  4DWI A;  4I7F A;  4AHV A;  4CJV A;  4ELV A;  1VSF A;  4DQQ A;  1XC9 A;  4Z4H A;  3NF7 A;  1TKX A;  1REV A;  3AVG A;  4DFJ A;  2XRI A;  2HHS A;  1TKT A;  1ZBU A;  3RR8 A;  4FJK A;  4Q5V A;  1SUQ A;  1KTQ A;  4CE9 A;  5T7B A;  3O3G A;  3NDK A;  2YKN A;  3AVL A;  2KTQ A;  3SZ2 A;  2A1S A;  4E3S A;  2QK9 A;  3QIP A;  2E6M A;  1J9A A;  1RT7 A;  1HQU A;  1VK0 A;  3C6T A;  1W9H A;  2P1J A;  3KLI A;  3BDP A;  3RR7 A;  1ASW A;  4CHZ A;  1X9S A;  3OYK A;  3HPH A;  1RIL A;  1A5W A;  4RW6 A;  4RW9 A;  1GOC A;  1NJZ A;  2PYL A;  2Z1J A;  1LW0 A;  1WNS A;  2QXF A;  4IG3 A;  2G8I A;  1C0U A;  5CZ1 A;  4CJW A;  4OGC A;  2P51 A;  3QO9 A;  1RDB A;  2YV0 X;  4M3R A;  3KD1 E;  1JLE A;  4KB1 A;  4CK1 A;  1LWC A;  3ULD A;  3AA2 A;  3RMD A;  1UWB A;  4FCY A;  4M3W A;  3PO5 A;  3DMJ A;  3MXI A;  1JKH A;  1LAV A;  2FBV A;  3S9H A;  3SNN A;  1ITG A;  2DFE A;  4O5B A;  3F9K A;  3LZJ A;  4ID1 A;  1SKS A;  4W5N A;  1WN7 A;  2VG5 A;  1VSH A;  3SPY A;  1S1W A;  1NK6 A;  4HCB A;  3OYD A;  4B9T A;  4CFC A;  1A5X A;  3DM2 A;  3DYA A;  2HHX A;  1HYV A;  1QSL A;  1S9E A;  2OPS A;  3AO2 A;  3U6F A;  1TK5 A;  4Z4F A;  3VQB A;  3ALY A;  1WSF A;  4KHU A;  3SV3 A;  3CQ8 A;  3OJS A;  1RNH A;  2HHV A;  3IAY A;  1S6P A;  1TVR A;  1NJW A;  2Y1J A;  3MXM A;  4ID5 A;  3S3M A;  1GOB A;  1TK8 A;  3QIO A;  4JS5 A;  1S1U A;  1TAQ A;  1HJR A;  1RBS A;  4HUF A;  3ZT0 A;  1WAJ A;  4BE2 A;  4FLX A;  3AA5 X;  4PA1 A;  3I8D A;  4E7I A;  3AVM A;  3SUN A;  2OA8 A;  3OYL A;  1ZYQ A;  3ZSO A;  2G8H A;  4CF0 A;  2YHA A;  3KK3 A;  1CLQ A;  1BIS A;  1ASV A;  1QS4 A;  4FJG A;  3CFR A;  1RCH A;  4DS5 A;  3TAQ A;  1DTQ A;  4CEZ A;  3AA4 A;  4OLA A;  3O3F A;  2JLE A;  3PX0 A;  3HT3 A;  3G10 A;  1HNV A;  4KTW A;  3LDS A;  5KI6 A;  3V4I A;  4JLH A;  2RN2 A;  4FJ7 A;  2ETJ A;  1RT5 A;  2DFF A;  4CHY A;  3KIO A;  1J54 A;  4O0I A;  3QEP A;  1EKE A;  1NJY A;  4FJI A;  4TSX A;  4ICL A;  4DTU A;  1LV5 A;  3AVA A;  3DLH A;  3ZCM A;  3V9X A;  2O4G A;  3K5N A;  4HUE A;  2F8T A;  4FW2 A;  3SUQ A;  1T8E A;  4EZ9 A;  5HRP A;  1NJX A;  3VA3 A;  5HRR A;  3MED A;  3AVH A;  3V9S A;  3TWH A;  1KVB A; 
#chains in the Genus database with same CATH topology
 4IFV A;  2ZGZ A;  1GLJ O;  1L3U A;  4GNI A;  3HK2 A;  4OVL A;  3EY1 A;  4C8M A;  4NCG A;  4GMJ B;  3SUO A;  4W5Q A;  3SYZ A;  4Z4I A;  3LDQ A;  4B9L A;  4BR7 A;  4I9L A;  1HLU A;  4GV9 A;  3UE5 A;  2E4L A;  2ZQB A;  4KH6 A;  2D5R A;  4A57 A;  2G8V A;  2P9N B;  1RDD A;  2Z1I A;  3MEE A;  4PL7 A;  3M8R A;  2E2O A;  5HP1 A;  1N6Q A;  1HRH A;  4E7J A;  3FGU A;  3LDO A;  1CXQ A;  5ADX H;  1DLO A;  3FZH A;  1QHT A;  1J5E K;  3THV A;  1W0H A;  4HTL A;  3AO1 A;  4BGB A;  4IEI A;  4CJ5 A;  2O8B A;  1T03 A;  1NK7 A;  4B8C A;  3OYF A;  3MN9 A;  5C24 A;  1JL1 A;  1NGJ A;  2BAN A;  1NBW A;  1BL3 A;  4JKG B;  2Z1G A;  1QQC A;  1FKO A;  1I39 A;  2NRX A;  2YNH A;  2PZS A;  4B9U A;  5F2R A;  3WXI A;  4RCH A;  2EHG A;  3DI6 A;  5GAG P;  2O8E A;  4XH1 A;  3OVN A;  4WE1 A;  4CIF A;  1YHQ N;  3LDL A;  3E9O A;  1OH8 A;  2A42 A;  4B3S K;  2JWL A;  4FLT A;  4DV7 K;  5K14 A;  4X64 K;  3H1Q A;  3ZX0 A;  5DM7 L;  4JRQ A;  1IKW A;  3FFK B;  4JI6 K;  2ZM6 K;  1Q9X A;  2V51 B;  3OYC A;  1ZBH A;  3MCP A;  1YJW N;  1D9D A;  1IG8 A;  3O4Q A;  3VEX A;  2E6L A;  4WYB A;  1M90 O;  4DSE A;  4DTP A;  3RTV A;  4W5R A;  2EWS A;  1S5J A;  4ILJ A;  3TSU A;  4BQL A;  5AQI A;  3C0B A;  4B1X B;  2RE2 A;  1BCM A;  4KI4 A;  3LAM A;  1NK5 A;  4H0X B;  4UY8 O;  5SZT A;  1GLE G;  1QQM A;  1RTI A;  4AIL C;  3WNG A;  4R5P A;  4Z4G A;  4M7Y A;  3D2F A;  3QER A;  4BRE A;  3OYA A;  3TTC A;  2B4J A;  4DTN A;  3O9R A;  3H08 A;  4NLB A;  3SBT A;  3ZT3 A;  1FK9 A;  2KQ2 A;  4FYD A;  1JXE A;  5AZI B;  4CHO A;  1L3T A;  2WOM A;  2FC0 A;  5AQP A;  3BUZ B;  5GIP A;  4CGI A;  1BCO A;  1BIZ A;  1RT6 A;  3CJ9 A;  1CZB A;  5GIN A;  1S1V A;  1UOC A;  4K43 A;  1LOT B;  5LY3 A;  2FSN A;  1RDU A;  1K73 O;  3O9Q A;  4H0Y B;  1HPZ A;  3F73 A;  5C12 A;  3C7N B;  1MU2 A;  3T69 A;  4BRK A;  4KBO A;  3B6O A;  5C42 A;  4IEE A;  3LAN A;  4BRF A;  3OY9 A;  3RMC A;  4CBW A;  1BA1 A;  4JKC A;  5AQR A;  2QEX N;  3SI6 A;  2I7N A;  5KGX A;  4DSF A;  3W3D A;  1IKX A;  2HMI A;  3OYJ A;  4CFD A;  1VQ5 N;  1D8Y A;  2Q1N A;  3WNF A;  4UQG A;  4CJR A;  3DLK A;  5KRT A;  3R9P A;  1QQO A;  3IG1 A;  1N36 K;  4FZX C;  4CIG A;  5EU7 A;  3NH2 A;  1D5A A;  1BIU A;  4LH4 A;  3KTQ A;  1VRU A;  1BG3 A;  2GBZ A;  4BR4 A;  1NGE A;  4CGF A;  1WSH A;  4L3Q A;  4E0D A;  2X74 A;  1C1A A;  3KK7 A;  3OTO K;  4DFK A;  3CER A;  3ZSW A;  4XH5 A;  4FLY A;  3S41 A;  1J53 A;  4IZ9 A;  4CEE A;  5BRH A;  1EET A;  4DR5 K;  4N76 A;  4HTU A;  3U9D A;  4OKK A;  4HCC A;  2V7Z A;  2VQE K;  3L2U A;  3CQY A;  3K9K A;  4JI7 K;  4B9Q A;  1BDG A;  1RDC A;  4CEO A;  4FLW A;  4C8O A;  4IKF A;  3A5O C;  4FWM A;  1YTU A;  3DLG A;  4B3T K;  4OO1 J;  4E89 A;  1WSI A;  2B6A A;  4JI1 K;  1KLM A;  1U47 A;  4KHY A;  4DU1 A;  1VQK N;  4FJX A;  1JLA A;  1CXU A;  4BC3 A;  2NLX A;  1JLG A;  4H5R A;  4B8A B;  2ITG A;  5BR9 A;  3LZI A;  4FSV A;  2WFB A;  1KVC A;  2IVO A;  5JIC A;  3OJU A;  3HM9 A;  1NOY A;  2QXL A;  3CCJ N;  1WOQ A;  3VET A;  3HOS A;  2P9S B;  5AQK A;  4CGG A;  3VF2 A;  4FLU A;  4J2E A;  5KPZ A;  1OH7 A;  4QCL A;  4M63 C;  4FM1 A;  4KHS A;  5J2N A;  2KLA A;  3V1R A;  3VMF B;  1SL0 A;  2A41 A;  2HHH K;  3ZX2 A;  4KHQ A;  1GLA G;  3ZET A;  3AO4 A;  4BVP A;  4DV3 K;  1GLB G;  3ZYY X;  1YJ9 N;  2OZS A;  4B9N A;  3WXM B;  3WEE B;  3HVR A;  2ZD1 A;  3R8E A;  4LC9 B;  4CJU A;  3VEZ A;  4NO7 A;  3GOI A;  3RMA A;  2P9K A;  3C6H A;  2D4W A;  2GX9 A;  2WC9 A;  4CF8 A;  3H6E A;  4CJK A;  4BE1 A;  3THY A;  1TYQ B;  1KD1 O;  5IWA K;  3LAK A;  1JLF A;  4DKW A;  1K8K A;  4FXD A;  1VSD A;  3LPU A;  2Q31 A;  1RTH A;  1Y97 A;  3R3L A;  4CJ4 A;  4QOZ B;  1XI1 A;  1N5Y A;  3PY8 A;  2E2P A;  4FLV A;  1VSE A;  4IOC L;  4BQZ A;  1BI4 A;  4FWP A;  3RSE B;  3IDH A;  1VSL A;  5C0Y A;  5JMV A;  4KTZ A;  3NBP A;  3QLH A;  5MLC Q;  3AGR A;  4KO0 A;  3SQ1 A;  3TAP A;  4LF8 K;  3M1F A;  4FWL A;  2YX6 A;  4BRI A;  2CGL A;  3LP3 A;  4AM6 A;  1RT4 A;  4ELV A;  1VSF A;  5CR4 A;  3W0L A;  1VQ7 N;  2ZJP L;  1REV A;  4DFJ A;  3RR8 A;  4FJK A;  1KTQ A;  1BO5 O;  3O3G A;  4CZE A;  4E3S A;  1RT7 A;  3F9M A;  1W9H A;  3KLI A;  4YDU A;  2ZJR L;  3EE9 A;  1LW0 A;  3CC4 N;  3NVK A;  2QXF A;  2G8I A;  1KXP A;  3QO9 A;  3KD1 E;  3MDQ A;  3RMD A;  1UWB A;  4A62 A;  1OKJ A;  3TU5 A;  4JI5 K;  3O9T A;  3SNN A;  1SKS A;  4C1N K;  2VG5 A;  1NM1 A;  1S1W A;  2Q0R A;  4BC4 A;  3OYD A;  1NGG A;  1YVN A;  1A5X A;  3DM2 A;  3DYA A;  2HHX A;  2OPS A;  2BH1 A;  1TK5 A;  4Z4F A;  5FPE A;  3CQ8 A;  2F9W A;  3OJS A;  5HL7 L;  5LJV A;  1TK8 A;  4IOA L;  2P9P A;  3CJ1 A;  1Q82 O;  1WAJ A;  1ZBI A;  4E7I A;  1SS6 A;  3ZSO A;  3GL1 A;  2G8H A;  4CF0 A;  1IV0 A;  4DR4 K;  1BIS A;  2Q36 A;  3TAQ A;  3AA4 A;  3J81 O;  1NGH A;  3CI5 A;  4BRD A;  4KTW A;  1N33 K;  4FJ7 A;  1NGF A;  5EX5 A;  4CHY A;  3MX2 A;  3IKM A;  4O0I A;  3QEP A;  1NJY A;  3C6A A;  2HST A;  4ICL A;  3DJC A;  4DUY K;  3ZCM A;  5AQL A;  3K5N A;  3ULE B;  2F8T A;  4A59 A;  4X66 K;  4YHH K;  4X62 K;  2ZF5 O;  3MED A;  3AVH A;  1SAZ A;  4JI0 K;  3OYM A;  3QIN A;  2G8W A;  1T3V A;  5BPN A;  3HYF A;  3M8P A;  3M5R A;  1QHA A;  3A8Y A;  2A1R A;  2O8C A;  1KSP A;  4K8X A;  3UKU A;  2NRW A;  4DSL A;  3O4N A;  4M3Y A;  3E01 A;  1X9M A;  1NK8 A;  3ZSV A;  4B3O A;  1Y64 A;  3A5N C;  4J2B A;  3IMX A;  4KHP K;  2ASP A;  3A5M C;  4AHC A;  2NRZ A;  4BRP A;  2XY5 A;  4FZZ A;  2E2N A;  4QS8 A;  4V19 S;  5AQO A;  2VG6 A;  3KLH A;  3LL3 A;  2P5O A;  3K57 A;  2UUC K;  4JD2 A;  3SLC A;  3I8B A;  3T1A A;  2HND A;  4FW1 A;  1HJO A;  2FBY A;  2HBL A;  4YOY A;  4J2D A;  5AQW A;  3VGL A;  4BDP A;  1ZXO A;  3P38 A;  4J8F A;  2IVN A;  3O1W A;  4CJP A;  4AH9 A;  3EEQ A;  4FVU A;  3AVI A;  4DR6 K;  5E41 A;  2VWK A;  5HRN A;  4Z0U A;  5F0X A;  1R0A A;  1JXB A;  4DHY A;  3ZEU A;  3NH1 A;  1TUU A;  1TKD A;  2YHB A;  3SMS A;  5BPL A;  1XHZ A;  2P9N A;  4M7X A;  3MK6 A;  2HB5 A;  3V9Z A;  4JK9 A;  3KLF A;  4H5W A;  3PSF A;  4PWD A;  1KC8 O;  4C8N A;  3PSI A;  2B5J A;  1S3X A;  3ZSQ A;  4A2B A;  1I94 K;  4JHD A;  3AAP A;  4FLZ A;  1N8R O;  4E1J A;  3U3G A;  4CEB A;  3QFP A;  2F9T A;  5J2P A;  4PHT X;  1JCF A;  4O8K A;  2NNW A;  3M3Z A;  5FRN A;  4EHT A;  4LH5 A;  3FE1 A;  2OAN A;  2OTL N;  1X9W A;  3RVC A;  5C10 A;  4FJJ A;  4FM0 A;  1ZBS A;  1R59 O;  3VER A;  4LY7 A;  4H03 B;  5ADX A;  4CHN A;  3Q7B A;  1T44 A;  1OVY A;  4JKG A;  3VQ5 A;  1XHX A;  1MWM A;  1S6Q A;  1NMN A;  2H3G X;  4CJS A;  2D0A A;  2DY4 A;  4BDY A;  1VQ4 N;  2FBX A;  4ZTF A;  4H0P A;  3V1Q A;  3KWI A;  2YKM A;  4WQ4 C;  3CET A;  2PYJ A;  3OYN A;  1J5O A;  5BRD A;  2GTD A;  3TAR A;  3LP2 A;  1L3V A;  3BZC A;  3F2K A;  3A0I X;  4KTQ A;  4CK2 A;  1F21 A;  4B1Z A;  4JN4 A;  4N5S A;  4FWK A;  1MDU B;  3VES A;  3ZSX A;  2BE2 A;  2FLO A;  4OJR A;  3TAB A;  3ZT2 A;  4F8R A;  3WUH A;  4CZG A;  3PX4 A;  5M1O A;  4DF4 A;  4PUO A;  3P5J A;  2GEM A;  2ASO A;  1EXQ A;  2RKI A;  4AM7 A;  2FBT A;  2FSJ A;  3PUF A;  1WSJ A;  3HP6 A;  2Y1I A;  2E5L K;  3SQ0 A;  1B92 A;  1OVQ A;  3VGK A;  3AAQ A;  3ASM A;  5HBM A;  3IRX A;  1RT1 A;  4B1W B;  3QNO A;  1BA0 A;  3GDQ A;  1EX4 A;  3E66 A;  3RMB A;  1KFD A;  3VTI A;  2VGM A;  2UUB K;  3VA0 A;  4I2P A;  4MDB A;  4CBU A;  4DTO A;  2X78 A;  5M1F A;  4RTF D;  1VSI A;  2YNG A;  5AQZ A;  4IO8 A;  4LFC K;  3HZ6 A;  1QE1 A;  3KK2 A;  1YIT N;  1KRP A;  4A5B A;  1U49 A;  4EZ6 A;  1QVG M;  1NK0 A;  1X9J A;  4PKI A;  2XY7 A;  1VQ9 N;  3TAM A;  4CGJ A;  2YHW A;  4B9V A;  3NF9 A;  4LFB K;  1MWK A;  1KLN A;  2E8A A;  5CY4 A;  1C0T A;  1DGK N;  4JS4 A;  5EXW A;  1TGO A;  3MEG A;  4CZK A;  4DV5 K;  3QBW A;  3OS1 A;  3C7N A;  1DEJ A;  2QM1 A;  5AQT A;  4DTM A;  4GKJ K;  4O5F A;  1RBT A;  1XC3 A;  2HNZ A;  3EL2 A;  4BDZ A;  4QAG A;  3PV8 A;  4KKO A;  4AHU A;  3I56 N;  2Q97 A;  5ELZ A;  3NVM A;  4FVM A;  2UXB K;  2YI1 A;  2XY6 A;  3K5O A;  2QWM A;  4CIE A;  3OYI A;  3MX5 A;  3FR0 A;  3TR8 A;  3VQQ A;  4WCE L;  1TV6 A;  3K58 A;  2E88 A;  4DSK A;  2EX3 A;  2G8K A;  4IJA A;  2ZE2 A;  1EWR A;  4C1N I;  4R79 A;  3AAR A;  3D0P A;  2ZJQ L;  5JLF A;  1T7P A;  4M42 A;  3VF4 A;  3V6D A;  1W97 L;  4IFE A;  1S22 A;  4DR3 K;  4H4M A;  1YI2 N;  3O1B A;  2E20 A;  1UA1 A;  4CJT A;  3UIQ A;  2QWO A;  1BQN A;  4CZH A;  3FZM A;  3ITH A;  4NCB A;  3IUC A;  3SCX A;  3G4S N;  3CHW A;  3HOT A;  1VHX A;  3VQ9 A;  4YOW A;  1I3A A;  2DTU A;  3C95 A;  3VN5 A;  3HBT A;  4BC5 A;  3CME N;  3H3O B;  5EVZ A;  3TI0 A;  5KPR A;  2Q0U A;  1RBV A;  1HX1 A;  4DTS A;  2OPP A;  5J2M A;  1BWF O;  1SZ2 A;  2P9U A;  3EO3 A;  4GKK K;  2HHQ A;  3LWL A;  4FWQ A;  3NMU A;  4DQR A;  2O8D A;  1WLJ A;  1JLQ A;  2UXD K;  1U2V A;  3L2V A;  4AHT A;  1XUP O;  2VQF K;  3SJJ A;  1X3N A;  2OZM A;  2I5J A;  1CZ9 A;  4DU3 A;  4MO4 A;  4FJH A;  4F2R A;  4BRA A;  2YCH A;  4W5O A;  4MLH A;  4ILH A;  3UKR A;  3K5M A;  4F9O A;  3VQP A;  4IOX A;  3V9W A;  3SQ4 A;  1Q8I A;  3VEV A;  2LSN A;  3BGR A;  4DQS A;  2O8E B;  4BRL A;  1VQN N;  1G15 A;  2HVH A;  3THX A;  4NXN K;  3WEE A;  5E26 A;  2OYQ A;  1LCU A;  3SV4 A;  1SL2 A;  4DLG A;  1IKV A;  3CC2 N;  5CHI A;  3HP9 A;  1GLD G;  3IS9 A;  1GLL O;  2X6N A;  1ZC6 A;  4F3O A;  4Y1D A;  1YXQ A;  4I7F A;  1RFQ A;  4CJV A;  5BRF A;  1XC9 A;  3L0Q A;  1TYQ A;  1HNW K;  5AQG A;  3NF7 A;  2VGN A;  1T6D A;  4BRO A;  1HR0 K;  4Q5V A;  1SUQ A;  1HKG A;  3H1V X;  3SZ2 A;  2A1S A;  2CGK A;  4A61 A;  4DV6 K;  1Z6R A;  2E6M A;  1VQ8 N;  3C6T A;  1HQU A;  1P8Z A;  3BDP A;  4IXC A;  1ATN A;  4EAH D;  1X9S A;  2PFU A;  3T1Y K;  1XNR K;  4U67 L;  4RW9 A;  3OW2 M;  4JKE A;  1NJZ A;  1ATS A;  5AQM A;  4CD1 A;  5CZ1 A;  3RSE A;  4CJW A;  1RDB A;  4M3R A;  1GLF O;  3CCE N;  3CJC A;  3ULD A;  4JKH A;  4GV6 A;  5AR0 A;  3AA2 A;  3BP8 A;  3R6M A;  3MXI A;  1JKH A;  3S9H A;  4NXM K;  4QS7 A;  3FZK A;  3O9S A;  3BF3 A;  1ATR A;  1NK6 A;  3U6F A;  5AQH A;  3QDK A;  3ALY A;  2P9L B;  1WSF A;  1M1K O;  3VEW A;  1RNH A;  1TVR A;  2Y1J A;  1HNX K;  3P39 A;  1EO1 A;  1NGC A;  4FLX A;  3AA5 X;  3I8D A;  5FPM A;  4LF5 K;  3AVM A;  2CH6 A;  3O5B A;  1DT9 A;  3KK3 A;  1VQL N;  1YIJ N;  4FJG A;  3CPW M;  4CEZ A;  4JKF A;  4OLA A;  2JLE A;  3PX0 A;  5AZJ B;  5B8H A;  1KAX A;  3H46 O;  3V4I A;  4U7B A;  2DFF A;  4B1V A;  5M1N A;  1J54 A;  2FF3 B;  4BRN A;  1VAZ A;  1LV5 A;  3DLH A;  1QZ6 A;  4FW2 A;  3SUQ A;  5AFU H;  1TUY A;  1NJX A;  3D7E O;  5HRR A;  5AJ3 K;  3U8X A;  2O8F A;  4M41 A;  4BRH A;  1VQO N;  2W41 A;  1IBL K;  4LF7 K;  4JI2 K;  4BRM A;  4DV2 K;  2O4I A;  1HYS A;  3QB0 A;  1IH7 A;  2NRR A;  4CGD A;  4IDK A;  1RDW X;  5C15 A;  3PO4 A;  3DXM A;  1D4X A;  2R7Y A;  4XIU A;  1RTD A;  4NYN A;  4DG1 A;  2ZGY A;  4B1U B;  3HPG A;  3EE8 A;  4PL8 A;  1YTA A;  3TSQ A;  4WQ5 C;  1JL2 A;  4Z4C A;  1GOA A;  2QI2 A;  4RW8 A;  3D45 A;  3Q7C A;  3L2W A;  2RF2 A;  4RWT A;  3ULE A;  1T05 A;  5J1E A;  4CEQ A;  1C1C A;  4B3M K;  1LAW A;  3CM5 A;  5M1P A;  3ZT4 A;  1C6V A;  3TAN A;  4CHQ A;  3NH0 A;  5HRO A;  4OLB A;  4CD3 A;  4KV8 A;  4M3X A;  2VCP A;  3MWP A;  2GEL A;  4WQ4 A;  1T6C A;  3DRR A;  2D0C A;  4CEF A;  1SKW A;  3SK3 A;  1SQK A;  3SPZ A;  1ZBL A;  1SKR A;  3SUP A;  3THW A;  1XWL A;  4I6M B;  1ILY A;  4CZF A;  1X1P A;  1NJI O;  3RWU A;  4YOX A;  3KZB A;  3CFP A;  3D2E B;  4CFB A;  2V7Y A;  3HVT A;  1Q81 O;  4FJN A;  3DWL A;  4IBN A;  2WUS A;  3JAM O;  4EHU A;  3B6P A;  2KHO A;  4CER A;  2UXC K;  4IFY A;  2FF6 A;  3ZLJ A;  1G99 A;  3ZET B;  5JS1 A;  4Y1C A;  5CZ2 A;  1FW6 A;  4K8Z A;  4B9S A;  3TTD A;  1IG9 A;  1LWE A;  4KB0 A;  4FWO A;  1JCE A;  3T19 A;  4HUG A;  3DXK B;  1NMD A;  2E1Y A;  4JEP A;  4WFN L;  4DV4 K;  3WQU A;  5GAD P;  3TSP A;  1WB9 A;  4DUZ K;  3HL8 A;  3KKS A;  3CM6 A;  3EZW A;  3MWT A;  4RW4 A;  1MA9 B;  4MO5 A;  5KGW A;  3AVB A;  2IAJ A;  3NHG A;  4CJQ A;  2HHT A;  4CK3 A;  1K8K B;  4BY9 C;  4H4O A;  1EWQ A;  2QWR A;  3BZK A;  4FL9 A;  4KPY A;  3CQX A;  1KCF A;  4DCH A;  5GIO A;  1X3M A;  3CIP A;  4NYF A;  3F5T A;  4KRE A;  2P9I B;  4M3T A;  4OKE A;  4KAZ A;  3K5L A;  2HF3 A;  1BI4 B;  4FK4 A;  4OPJ A;  1QSY A;  5HLF A;  2OTJ N;  4JKA A;  5J2Q A;  1LW2 A;  2IIR A;  1IO2 A;  5AQN A;  2GUI A;  1WSE A;  3DOK A;  4NB4 A;  3E9L A;  1U45 A;  3TPQ A;  3VEY A;  3LP0 A;  3LP1 A;  3CCM N;  4FK0 A;  4NCA A;  3ZSY A;  3K2P A;  4JI3 K;  1JJ2 M;  2A40 A;  4CJ7 A;  4CF1 A;  2IDO A;  3HSC A;  4G9Z A;  4WFA L;  4AHR A;  3CYM A;  2IS3 A;  4CZI A;  3CCV N;  3J80 O;  2YNF A;  2WBN A;  3S3N A;  3T7Z A;  2CGJ A;  1E3M A;  4OPA A;  5CYM A;  4Q0B A;  4EFH A;  3OBW A;  3AVJ A;  1NKC A;  3K9J A;  2XO7 A;  3L3V A;  1O13 A;  4K0K K;  2WTU A;  4BE0 A;  4YNQ A;  4B9M A;  2A3Z A;  1WBD A;  5AQX A;  1K8A O;  4C23 A;  4GY2 B;  1S72 N;  4WFB L;  4O0J A;  1A5V A;  3NGZ A;  1RBR A;  4CES A;  4CJE A;  1Q7Y O;  3DLE A;  3TAF A;  5SWM A;  1RBU A;  3ATU A;  2OPQ A;  3LDN A;  2OPR A;  3AVK A;  3HO1 A;  4ELU A;  3KWG A;  5DM6 L;  4DV0 K;  1NKE A;  5FLX O;  2NRH A;  3KKR A;  3AO3 A;  1NLV A;  3E9P A;  4FPB A;  2QTD A;  3HPO A;  2BDP A;  3ZSZ A;  5JS2 A;  1OH6 A;  1BQM A;  4BR2 A;  4KHW A;  4KFB A;  4QS9 A;  1Q86 O;  2G8F A;  1JLC A;  1K6Y A;  4LSN A;  5HRS A;  2UU9 K;  3SBG A;  4BR0 A;  3RRG A;  3NF6 A;  2P5G A;  3DRP A;  2VWJ A;  1TL3 A;  4MDA A;  1UA0 A;  3WQT A;  1HYZ A;  4DTX A;  4EP5 A;  1CZA N;  5BN9 A;  4DMN A;  4EIA A;  3I0R A;  3ISN C;  3K0S A;  2RPI A;  4JRP A;  5LMU K;  3SAH A;  1JLB A;  1N32 K;  1QZ5 A;  1B9D A;  3M6G A;  4CZM A;  5AQJ A;  3O08 A;  2DFH A;  5FRO A;  4CVN E;  3KLG A;  2OCE A;  4GVM A;  2JGU A;  2O8C B;  1S9G A;  2HVI A;  3EN9 A;  3OA9 A;  4M45 A;  4K25 A;  4A2A A;  3QFU A;  3VQA A;  4E1M A;  3T1H K;  2KFZ A;  2UYT A;  3G0Z A;  3KK1 A;  3AVC A;  4CEA A;  2ASM A;  4RG8 A;  2KZM A;  4LFA K;  2IC3 A;  1NK4 A;  4HVJ A;  3B8A X;  3NE6 A;  4DQP A;  3VQ7 A;  3G25 A;  4A5A A;  3TAG A;  1HNI A;  1S1T A;  1HPM A;  3N4Q A;  1VSM A;  3DLL L;  4LF9 K;  2G8U A;  3P1G A;  4DS4 A;  4CEC A;  1V4S A;  3V1O A;  4E19 A;  2XHB A;  4ISF A;  2D0B A;  5DMR A;  1W7A A;  4C8K A;  2QWN A;  1IKY A;  3WXK A;  3CG7 A;  1UAX A;  1FXX A;  4PY5 A;  3ENB A;  3MMV A;  1HQE A;  2A5X A;  1YJN N;  1QVF M;  3MN5 A;  4JI4 K;  5BN8 A;  3DOL A;  4FJ9 A;  1WSG A;  2IVP A;  4RW7 A;  2GWK A;  3WNE A;  2F7T A;  4CF9 A;  3MXJ A;  2W6K A;  3LM2 A;  1L5U A;  2AP1 A;  3BY5 A;  3ZEU B;  1K9M O;  4PQU A;  4Z4E A;  5DK5 A;  3PLA A;  1KFS A;  1SL1 A;  5AZI A;  1U48 A;  1VRT A;  3H45 C;  5EY4 A;  2GUP A;  3MN7 A;  4B08 A;  1O1W A;  1VSJ A;  4N47 A;  4FO0 A;  4CJF A;  5F1X A;  4BAC A;  4CJL A;  4DR1 K;  4DQ8 A;  1H1V A;  1YUW A;  4DTJ A;  2HMP A;  1NGI A;  3O8M A;  1NGA A;  3QES A;  4JHD B;  3TTF A;  4YFU A;  3KD5 E;  1WAF A;  3WXJ A;  1EQY A;  2BTF A;  3R1X A;  4DR2 K;  3C65 A;  4CCH A;  4ELT A;  3L2Q A;  4W5T A;  4FWS A;  1KAY A;  4I9Q A;  3GE1 A;  4AHV A;  1VQM N;  2J4R A;  3SJH A;  4DQQ A;  4XEI A;  4WF9 L;  4Z4H A;  1TKX A;  4CZJ A;  2HHS A;  2XRI A;  1ZBU A;  4IO9 L;  3AGK A;  3SAF A;  4CE9 A;  5T7B A;  2YKN A;  2KTQ A;  5I9E B;  4YY3 K;  2QK9 A;  3QIP A;  4LF6 K;  1VK0 A;  4K41 A;  3WXL A;  3HRG A;  1YF5 L;  3RR7 A;  4JKD A;  1V4T A;  4BRG A;  4CHZ A;  3HPH A;  1A5W A;  4RW6 A;  1GOC A;  2PYL A;  2Z1J A;  1WNS A;  4IG3 A;  3CMA N;  1C0U A;  2PBD A;  1JLE A;  3CCU N;  1LWC A;  3DMJ A;  1LAV A;  2FBV A;  1ITG A;  5IT9 O;  4O5B A;  3LZJ A;  4K42 A;  3SPY A;  3FZL A;  2HBJ A;  1QSL A;  1S9E A;  3AO2 A;  3VQB A;  2HHV A;  3IAY A;  1NJW A;  2I7P A;  3P4I A;  3MXM A;  1GOB A;  3QIO A;  3MN6 A;  3CXC M;  1S1U A;  1TAQ A;  1RBS A;  4HUF A;  3ZT0 A;  4WQ5 A;  2OA8 A;  5M1K A;  3CFR A;  2NRV A;  3HT3 A;  3G10 A;  1HNV A;  3LDS A;  2QWP A;  3U9Z A;  4BGA A;  2A6A A;  4JLH A;  2RN2 A;  3CF5 L;  4JV5 K;  4FWR A;  4TSX A;  1XQS C;  1YAG A;  4DTU A;  3VOV A;  3V9X A;  1KAZ A;  4HUE A;  1T8E A;  5TKW A;  2NRT A;  4JNE A;  1IBK K;  1HUX A;  1KVB A;  2P9L A;  2QKB A;  3MEC A;  4DU4 A;  1NOZ A;  3OYB A;  2UUA K;  2BUP A;  2O8B B;  2P9S A;  1Z25 A;  2VWB A;  3ID6 A;  4O44 A;  1Z26 A;  2HBM A;  5AQY A;  5LJW A;  1VSK A;  4DFM A;  3L6Q A;  3A5L C;  2Q2R A;  4H5V A;  2NZT A;  4GVE A;  5JLH A;  4DF8 A;  1BUP A;  4CED A;  3MAQ A;  3A2F A;  5FDL A;  4OPH A;  5AZJ A;  3J8A A;  4CGH A;  4H5N A;  1TK0 A;  1NK9 A;  4LSL A;  5TKY A;  4BRC A;  3O3H A;  3T3F A;  3LWM A;  1BGX T;  3V9U A;  4FJ8 A;  1B9F A;  4JK8 A;  3CCL N;  2F4V K;  2VYP A;  4FWN A;  3OBY A;  3C6U A;  4ISE A;  1J6Z A;  1C1B A;  4GW6 A;  3KVG A;  1NG9 A;  2HOE A;  3ENO A;  3UB5 A;  3VQ8 A;  3ZSR A;  4O55 A;  3QML A;  3L8B A;  3NFA A;  5KRS A;  5AFU A;  3HI0 A;  4CI6 A;  2Q3S A;  2F8S A;  3OS2 A;  4OPK A;  4KRF A;  4B1Y B;  4CF2 A;  3HXM A;  5C25 A;  4YOT A;  4OKJ A;  1XMQ K;  2WON A;  4DTR A;  1NGB A;  2QA4 N;  2FSK A;  1N34 K;  1ASU A;  3CFO A;  1C0F A;  2IGI A;  4ILG B;  1U04 A;  4CZL A;  3OYE A;  2GWJ A;  4FPA A;  1WBB A;  3NAE A;  4L8R B;  4BG9 A;  3AVF A;  1D9F A;  4C8L A;  4N56 A;  3CCQ N;  3P83 D;  3OS0 A;  3D2F B;  3I55 N;  4O4G A;  3VEO A;  2HBK A;  5BRE A;  4AF1 A;  4ZHR A;  2GV9 A;  1HMV A;  2ITM A;  4AHS A;  4BG8 A;  4IG0 A;  1LWF A;  1XNQ K;  1JCG A;  1RDA A;  5GAH P;  3AO5 A;  4DSJ A;  1NGD A;  1DTT A;  1YVU A;  4KH5 A;  1BHL A;  4IJN A;  4F3T A;  2HNY A;  3G6E N;  4BWJ A;  1W2B M;  3BF1 A;  2JWK A;  5KQD A;  4CBX A;  2P9U B;  4OGE A;  3VQ6 A;  4I6M A;  3VF6 A;  2O8D B;  1SV5 A;  1U2V B;  4EP4 A;  4DQI A;  3DRS A;  4X65 K;  2E2Q A;  1RGI A;  2KW4 A;  2HHW A;  2ZWH A;  3QEV A;  4F4K A;  3D2E A;  4DV1 K;  3VQC A;  4G1Q A;  1TAU A;  3EKU A;  1BU6 O;  3BEX A;  4DR7 K;  4HHT A;  1RT3 A;  3UKR B;  4I2Q A;  3FFI A;  1NWK A;  4FM2 A;  2YHX A;  2HHU A;  5FPD A;  1NU0 A;  1TKZ A;  4YOU A;  4Z94 A;  3KLE A;  1IBM K;  3LPT A;  4KI6 A;  2QWQ A;  3DLB A;  3K59 A;  4E7K A;  3THX B;  5EOY A;  3VTH A;  5KPT A;  3QNN A;  2QW9 A;  3C94 A;  4JK7 A;  3DXK A;  4ZTJ A;  2D0P A;  4DB3 A;  3H3N O;  3QET A;  4FJL A;  3N4P A;  1RT2 A;  5I3U A;  1XMO K;  2PY5 A;  3RRH A;  2W42 A;  4BVO A;  4F2S A;  4J2A A;  3U4L A;  1HKC A;  1C0G A;  3PIO L;  3QEW A;  4BC2 A;  2D0O A;  3JSM A;  1TL1 A;  3VQ4 A;  3V81 A;  2X6S A;  2NUB A;  4E1N A;  2CH5 A;  3ZX3 A;  4FK2 A;  4BWM A;  3L4Q A;  1FKP A;  2P9I A;  3J7Z O;  5AQF A;  4JKB A;  2IOC A;  4CJ3 A;  3WT0 A;  3I0S A;  3TAE A;  1S1X A;  1GLC G;  5CYQ A;  3J7Y P;  1KVA A;  3NCI A;  5I42 A;  3EYZ A;  3HJF A;  5A2Q O;  1RTJ A;  2DPN A;  3AV9 A;  2VG7 A;  5E84 A;  2V52 B;  4N41 A;  3QEX A;  4E7L A;  5D3G A;  4H8K A;  1IJJ A;  2XY8 A;  4B3R K;  4H0T B;  2ATQ A;  1ZBF A;  3QIC A;  2BGG A;  3CJB A;  2HF4 A;  3QBX A;  4FJM A;  3HST B;  4PKH A;  3J7A P;  3L2R A;  2Z1H A;  3JYT A;  3VQD A;  1QQN A;  4E7H A;  1Q9Y A;  1FJG K;  4FOI A;  1U4B A;  2YJE A;  2KKZ A;  4KHN A;  3D6R A;  3WNH A;  2KZZ A;  3DLR A;  4MLE A;  3OYH A;  3PX6 A;  3NGY A;  4BRQ A;  2P9K B;  3IFR A;  1NNE A;  3OYG A;  2O8F B;  4DLE A;  4GV3 A;  2FXU A;  3AA3 A;  3THY B;  3ATV A;  5FPN A;  3LDP A;  3NGI A;  4M3U A;  3I33 A;  4ISG A;  5KTQ A;  3QEI A;  3M8S A;  2HW3 A;  3DXM B;  4BR9 A;  1Z05 A;  1P90 A;  2KFN A;  4FJ5 A;  4CFA A;  3O9U A;  3CPE A;  3KJV A;  3EZ5 A;  4NLC A;  4XH4 A;  1VQ6 N;  1U6Z A;  1OH5 A;  1VQP N;  4H0V B;  4H5T A;  3ID8 A;  3CJA A;  1DKG D;  1EP4 A;  3EKS A;  1L3S A;  1NKB A;  3LAL A;  3CCR N;  5LL6 Z;  4DSI A;  4O8U A;  3JS6 A;  1C0M A;  4JYA K;  3E1Y A;  3G71 N;  4FZY A;  4OX9 K;  2AA4 A;  1E4G T;  3L3U A;  3O80 A;  3PIP L;  4JAX A;  3SQ2 A;  2YNI A;  1YT3 A;  5H1S Q;  4DFP A;  3U3Y A;  4CHP A;  4LD0 A;  5AQS A;  3M8Q A;  3O4W A;  5FRM A;  4M3Z A;  4MQ3 A;  3THW B;  3O6W A;  3JXU A;  3ZT1 A;  3VPZ A;  5C2D A;  5CE3 A;  3S3O A;  4IWV A;  1QTM A;  3VQE A;  5BR8 K;  1QSS A;  3AVN A;  3NF8 A;  5GAE P;  1BOT O;  2QWL A;  2QKK A;  4FOE A;  4MFB A;  5KQ8 A;  2RHK A;  3GBT A;  3P31 A;  2F96 A;  4DWI A;  3GG4 A;  5C2F A;  4PKG A;  4BR5 A;  3AVG A;  1TKT A;  3MCA B;  2W40 A;  3VEN A;  3HM8 A;  3NDK A;  4CW7 B;  3AVL A;  2P9P B;  1J9A A;  5JVG L;  2P1J A;  5LMN K;  1ASW A;  3VGM A;  3OYK A;  1RIL A;  3FZF A;  5AQV A;  3DAW A;  4IDH A;  2YHY A;  2AJQ A;  4OGC A;  2E1Z A;  2P51 A;  4KB1 A;  2YV0 X;  4CK1 A;  3HTV A;  4FCY A;  3CC7 N;  4M3W A;  5HOO A;  3PO5 A;  5AQQ A;  1E4F T;  3LM9 A;  2DFE A;  3F9K A;  4ID1 A;  4W5N A;  1WN7 A;  1VSH A;  4YOV A;  5JVH L;  4HCB A;  4B9T A;  4Y0W A;  4CFC A;  2D1K A;  1HYV A;  1WUA A;  4KHU A;  1HKB A;  3SV3 A;  1KQS M;  1S6P A;  4ID5 A;  3S3M A;  4JS5 A;  5AQU A;  1HJR A;  3L4I A;  3SMP A;  5M1Q A;  4BE2 A;  4AQY K;  4JI8 K;  4PA1 A;  3SUN A;  1Q18 A;  3AY9 A;  3ENH A;  3OYL A;  1ZYQ A;  5BPM A;  2YHA A;  3CD6 N;  1CLQ A;  3UKU B;  1ASV A;  1QS4 A;  4DS5 A;  1RCH A;  1DTQ A;  4YOR A;  3CCS N;  3O3F A;  2YJF A;  2W6L A;  5KI6 A;  4HWI A;  2ETJ A;  1RT5 A;  2PAV A;  3KIO A;  3SAG A;  1EKE A;  4FJI A;  3FLC O;  4KH4 A;  4H0O A;  4YDU C;  3AVA A;  1HNZ K;  1ESV A;  2O4G A;  3OHR A;  4LF4 K;  4EZ9 A;  3KHY A;  5HRP A;  4JD2 B;  3VA3 A;  3CJ7 A;  3V9S A;  3TWH A; 
#chains in the Genus database with same CATH homology
 3OYM A;  4M41 A;  3QIN A;  2QKB A;  3MEC A;  4DU4 A;  1NOZ A;  2G8W A;  4IFV A;  3OYB A;  3HYF A;  1L3U A;  3M8P A;  3HK2 A;  4OVL A;  2O4I A;  1Z25 A;  4C8M A;  3EY1 A;  4NCG A;  1IH7 A;  4O44 A;  1Z26 A;  4CGD A;  2A1R A;  1HYS A;  4IDK A;  4GMJ B;  3SUO A;  1KSP A;  3PO4 A;  1VSK A;  4W5Q A;  2R7Y A;  3SYZ A;  4DFM A;  4Z4I A;  4B9L A;  4XIU A;  4K8X A;  4DSL A;  4DF8 A;  1RTD A;  4I9L A;  4NYN A;  4CED A;  3O4N A;  3A2F A;  5FDL A;  4DG1 A;  3MAQ A;  4M3Y A;  3HPG A;  3E01 A;  4CGH A;  2E4L A;  1X9M A;  1TK0 A;  2ZQB A;  1NK9 A;  1TAU A;  2D5R A;  4LSL A;  3O3H A;  2G8V A;  1YTA A;  1NK8 A;  3T3F A;  3ZSV A;  4B3O A;  3LWM A;  4J2B A;  1JL2 A;  4Z4C A;  1GOA A;  1RDD A;  2Z1I A;  1BGX T;  4RW8 A;  4AHC A;  3MEE A;  3V9U A;  2XY5 A;  4FJ8 A;  1B9F A;  4FZZ A;  3M8R A;  3D45 A;  5HP1 A;  3L2W A;  2RF2 A;  1N6Q A;  2VG6 A;  3KLH A;  1T05 A;  1HRH A;  5J1E A;  4E7J A;  2P5O A;  3C6U A;  3K57 A;  4CEQ A;  1C1C A;  1CXQ A;  1LAW A;  3T1A A;  2HND A;  1DLO A;  3CM5 A;  1C1B A;  1QHT A;  4GW6 A;  4FW1 A;  1C6V A;  3ZT4 A;  3TAN A;  3THV A;  2FBY A;  4J2D A;  1W0H A;  3VQ8 A;  3ZSR A;  4O55 A;  3AO1 A;  3L8B A;  4BDP A;  1ZBI A;  4CJ5 A;  3NFA A;  4CHQ A;  5KRS A;  4CJP A;  3NH0 A;  5HRO A;  4AH9 A;  1NK7 A;  1T03 A;  4OLB A;  4KV8 A;  4M3X A;  2Q3S A;  2F8S A;  4B8C A;  3OS2 A;  3OYF A;  3AVI A;  4OPK A;  4KRF A;  5C24 A;  1JL1 A;  5E41 A;  3DRR A;  2VWK A;  4CF2 A;  5HRN A;  3HXM A;  2D0C A;  4Z0U A;  4CEF A;  1SKW A;  2BAN A;  5C25 A;  1BL3 A;  3SPZ A;  4OKJ A;  1ZBL A;  2WON A;  1R0A A;  1JXB A;  1QQC A;  1FKO A;  1I39 A;  2YNH A;  2Z1G A;  3NH1 A;  4DTR A;  2PZS A;  4B9U A;  1ASU A;  3CFO A;  1TKD A;  3SUP A;  2IGI A;  1SKR A;  1U04 A;  2YHB A;  3OYE A;  1XHZ A;  1XWL A;  2EHG A;  3DI6 A;  3NAE A;  4L8R B;  1X1P A;  3RWU A;  2HB5 A;  3AVF A;  3V9Z A;  3KLF A;  3CFP A;  3OVN A;  4WE1 A;  1D9F A;  4C8L A;  4CIF A;  2KZZ A;  4N56 A;  4PWD A;  4CFB A;  3P83 D;  3HVT A;  3OS0 A;  4C8N A;  4FJN A;  2B5J A;  4O4G A;  3ZSQ A;  4FLT A;  4FLZ A;  4IBN A;  4ZHR A;  2GV9 A;  1HMV A;  5K14 A;  4AHS A;  4IG0 A;  3B6P A;  3U3G A;  4CER A;  4CEB A;  4IFY A;  4JRQ A;  1LWF A;  1IKW A;  5J2P A;  1RDA A;  3AO5 A;  1Q9X A;  4DSJ A;  3OYC A;  1ZBH A;  1YVU A;  1DTT A;  1D9D A;  5FRN A;  3O4Q A;  4LH5 A;  5JS1 A;  4Y1C A;  2E6L A;  1BHL A;  5CZ2 A;  4K8Z A;  1X9W A;  4B9S A;  1IG9 A;  1LWE A;  4DSE A;  4FJJ A;  4FM0 A;  4DTP A;  3RTV A;  4F3T A;  2HNY A;  4BWJ A;  4KB0 A;  4W5R A;  4LY7 A;  1S5J A;  4CHN A;  3VQ5 A;  3T19 A;  1XHX A;  4OGE A;  1S6Q A;  4HUG A;  4CJS A;  1BCM A;  2D0A A;  3VQ6 A;  4BDY A;  4KI4 A;  3LAM A;  2DY4 A;  2FBX A;  1NK5 A;  4ZTF A;  3V1Q A;  5SZT A;  1SV5 A;  2YKM A;  1RTI A;  3CM6 A;  3HL8 A;  3KKS A;  3WNG A;  4EP4 A;  3DRS A;  4AIL C;  4DQI A;  4RW4 A;  2KW4 A;  4R5P A;  2HHW A;  5KGW A;  3QEV A;  4F4K A;  4Z4G A;  2PYJ A;  3AVB A;  3OYN A;  2IAJ A;  3VQC A;  3NHG A;  4G1Q A;  4CJQ A;  1J5O A;  4CK3 A;  3QER A;  3TAR A;  3LP2 A;  3OYA A;  1L3V A;  2HHT A;  2B4J A;  4HHT A;  1RT3 A;  4H4O A;  4DTN A;  4KTQ A;  3H08 A;  3ZT3 A;  4CK2 A;  1FK9 A;  4KPY A;  2KQ2 A;  1F21 A;  1KCF A;  3FFI A;  4I2Q A;  4FYD A;  4FM2 A;  2HHU A;  1JXE A;  4NYF A;  4N5S A;  4KRE A;  1TKZ A;  3KLE A;  4M3T A;  4OKE A;  3ZSX A;  4KAZ A;  2BE2 A;  3K5L A;  3LPT A;  4CHO A;  4KI6 A;  4OJR A;  3TAB A;  3ZT2 A;  1L3T A;  1BI4 B;  3K59 A;  3DLB A;  4F8R A;  2WOM A;  4E7K A;  2FC0 A;  3PX4 A;  4FK4 A;  4DF4 A;  4OPJ A;  3P5J A;  1QSY A;  5HLF A;  4PUO A;  4CGI A;  1BCO A;  5J2Q A;  1LW2 A;  1BIZ A;  3QNN A;  1IO2 A;  1RT6 A;  1EXQ A;  2RKI A;  2FBT A;  1CZB A;  3PUF A;  1WSJ A;  3HP6 A;  2GUI A;  2Y1I A;  1S1V A;  3C94 A;  1WSE A;  1UOC A;  1B92 A;  3DOK A;  3SQ0 A;  4ZTJ A;  3QET A;  4FJL A;  1U45 A;  3LP0 A;  3LP1 A;  4FK0 A;  1RT2 A;  5I3U A;  2PY5 A;  3RRH A;  1HPZ A;  4NCA A;  2W42 A;  3ZSY A;  3ASM A;  5HBM A;  3F73 A;  3K2P A;  3IRX A;  1RT1 A;  4F2S A;  4J2A A;  1MU2 A;  3QEW A;  4CF1 A;  5C42 A;  3B6O A;  3JSM A;  3QNO A;  3LAN A;  2IDO A;  1EX4 A;  3RMB A;  1TL1 A;  3OY9 A;  1KFD A;  3RMC A;  4AHR A;  3VQ4 A;  3CYM A;  2IS3 A;  2NUB A;  2X6S A;  4E1N A;  4I2P A;  3VA0 A;  3V81 A;  3SI6 A;  2YNF A;  5KGX A;  4DTO A;  3S3N A;  4DSF A;  2X78 A;  1IKX A;  5CYM A;  1VSI A;  2YNG A;  2HMI A;  4FK2 A;  4Q0B A;  4BWM A;  3OYJ A;  4CFD A;  1FKP A;  3AVJ A;  1QE1 A;  3KK2 A;  1NKC A;  1D8Y A;  2IOC A;  2XO7 A;  3L3V A;  4CJ3 A;  3I0S A;  3TAE A;  1KRP A;  3WNF A;  1S1X A;  4UQG A;  1U49 A;  4EZ6 A;  1NK0 A;  4CJR A;  3DLK A;  5CYQ A;  2XY7 A;  4BE0 A;  5KRT A;  4YNQ A;  1KVA A;  4B9M A;  3TAM A;  3IG1 A;  4CGJ A;  3NCI A;  5I42 A;  4FZX C;  4CIG A;  3EYZ A;  3HJF A;  5EU7 A;  3NH2 A;  1D5A A;  3NF9 A;  1BIU A;  3AV9 A;  1RTJ A;  1KLN A;  4LH4 A;  3KTQ A;  4B9V A;  1VRU A;  5CY4 A;  2VG7 A;  1C0T A;  2GBZ A;  4O0J A;  4JS4 A;  4N41 A;  1A5V A;  3QEX A;  4CGF A;  3NGZ A;  4E7L A;  4H8K A;  5D3G A;  1TGO A;  1WSH A;  1RBR A;  2XY8 A;  4CES A;  4E0D A;  3MEG A;  2ATQ A;  1ZBF A;  2X74 A;  4CJE A;  1C1A A;  3DLE A;  3OS1 A;  3TAF A;  5SWM A;  2BGG A;  1RBU A;  2OPQ A;  4DFK A;  4FJM A;  4DTM A;  3HST B;  2OPR A;  3ZSW A;  3AVK A;  1RBT A;  4ELU A;  2HNZ A;  4FLY A;  3HO1 A;  4BDZ A;  3L2R A;  1J53 A;  4CEE A;  4QAG A;  2Z1H A;  4KKO A;  4AHU A;  3PV8 A;  1NKE A;  3JYT A;  1EET A;  3VQD A;  4N76 A;  4HTU A;  3KKR A;  3AO3 A;  4FVM A;  4OKK A;  4E7H A;  1Q9Y A;  4HCC A;  3HPO A;  2XY6 A;  3L2U A;  2BDP A;  3ZSZ A;  1U4B A;  3K5O A;  5JS2 A;  1BQM A;  4CIE A;  3OYI A;  4KHW A;  1RDC A;  4KFB A;  4KHN A;  3TR8 A;  3VQQ A;  3WNH A;  1TV6 A;  3K58 A;  4CEO A;  4FLW A;  3DLR A;  4DSK A;  2G8F A;  1JLC A;  1K6Y A;  4LSN A;  3OYH A;  5HRS A;  4C8O A;  4IKF A;  3PX6 A;  2EX3 A;  1YTU A;  3DLG A;  2G8K A;  3RRG A;  3NGY A;  3NF6 A;  4E89 A;  1WSI A;  2ZE2 A;  2B6A A;  2P5G A;  1KLM A;  1U47 A;  4KHY A;  4DU1 A;  4FJX A;  3DRP A;  2VWJ A;  1TL3 A;  3D0P A;  1UA0 A;  1HYZ A;  4DTX A;  1JLA A;  4EP5 A;  1CXU A;  4DMN A;  3OYG A;  1T7P A;  1JLG A;  3I0R A;  3ISN C;  3V6D A;  4B8A B;  2ITG A;  3LZI A;  4M42 A;  2RPI A;  4JRP A;  4DLE A;  1JLB A;  1KVC A;  4H4M A;  3AA3 A;  1B9D A;  3OJU A;  3HM9 A;  3NGI A;  1NOY A;  4M3U A;  1UA1 A;  2DFH A;  4CJT A;  5KTQ A;  5FRO A;  3QEI A;  3KLG A;  3UIQ A;  4GVM A;  2JGU A;  4CGG A;  3M8S A;  2HW3 A;  4FLU A;  1BQN A;  3ITH A;  1S9G A;  4J2E A;  4NCB A;  2HVI A;  4M45 A;  3SCX A;  2KFN A;  4QCL A;  4FM1 A;  4FJ5 A;  3VQA A;  5J2N A;  4CFA A;  4E1M A;  4KHS A;  2KFZ A;  3V1R A;  3G0Z A;  3KJV A;  3EZ5 A;  3KK1 A;  3AVC A;  1SL0 A;  3VQ9 A;  4CEA A;  2DTU A;  1I3A A;  2KZM A;  4RG8 A;  4KHQ A;  3C95 A;  2IC3 A;  3AO4 A;  3VN5 A;  2AJQ A;  1NK4 A;  4HVJ A;  3TI0 A;  3NE6 A;  2OZS A;  4DQP A;  1EP4 A;  1L3S A;  1NKB A;  4B9N A;  3VQ7 A;  1RBV A;  3HVR A;  3LAL A;  2ZD1 A;  4CJU A;  4DTS A;  1HNI A;  3TAG A;  4DSI A;  1S1T A;  2OPP A;  5J2M A;  1VSM A;  3RMA A;  2G8U A;  3P1G A;  4DS4 A;  4CEC A;  1C0M A;  2HHQ A;  3LWL A;  3V1O A;  4E19 A;  4CF8 A;  4DQR A;  2XHB A;  4CJK A;  1WLJ A;  1JLQ A;  4FZY A;  4BE1 A;  2D0B A;  5DMR A;  3L3U A;  4C8K A;  1IKY A;  3CG7 A;  1UAX A;  3L2V A;  4AHT A;  3LAK A;  1FXX A;  1JLF A;  3SQ2 A;  4PY5 A;  3SJJ A;  2YNI A;  1YT3 A;  2OZM A;  1HQE A;  4DFP A;  2I5J A;  1CZ9 A;  3U3Y A;  4DU3 A;  4CHP A;  3DOL A;  4FJH A;  4F2R A;  4FJ9 A;  4FXD A;  4LD0 A;  1WSG A;  3M8Q A;  4RW7 A;  1VSD A;  3WNE A;  4W5O A;  4CF9 A;  3MXJ A;  3K5M A;  5FRM A;  4M3Z A;  1L5U A;  3VQP A;  4PQU A;  3LPU A;  4MQ3 A;  1RTH A;  1Y97 A;  4CJ4 A;  4QOZ B;  4Z4E A;  5DK5 A;  3V9W A;  3SQ4 A;  1XI1 A;  1Q8I A;  1N5Y A;  1KFS A;  1SL1 A;  3ZT1 A;  3PY8 A;  1U48 A;  2LSN A;  1VRT A;  3BGR A;  4FLV A;  4DQS A;  1VSE A;  4B08 A;  1O1W A;  1VSJ A;  4N47 A;  4CJF A;  1G15 A;  4BAC A;  1BI4 A;  4CJL A;  1VSL A;  2HVH A;  3S3O A;  4DTJ A;  1QTM A;  3VQE A;  1QSS A;  2OYQ A;  4KTZ A;  3SV4 A;  1SL2 A;  3NBP A;  3AVN A;  3NF8 A;  4DLG A;  1IKV A;  3QLH A;  3QES A;  4KO0 A;  4YFU A;  1WAF A;  3HP9 A;  3SQ1 A;  3TAP A;  2QKK A;  3KD5 E;  3IS9 A;  2X6N A;  4MFB A;  4CCH A;  4ELT A;  3L2Q A;  4W5T A;  4F3O A;  4Y1D A;  3LP3 A;  4I9Q A;  2F96 A;  1RT4 A;  4DWI A;  4I7F A;  4AHV A;  4CJV A;  4ELV A;  1VSF A;  4DQQ A;  1XC9 A;  4Z4H A;  3NF7 A;  1TKX A;  1REV A;  3AVG A;  4DFJ A;  2XRI A;  2HHS A;  1TKT A;  1ZBU A;  3RR8 A;  4FJK A;  4Q5V A;  1SUQ A;  1KTQ A;  4CE9 A;  5T7B A;  3O3G A;  3NDK A;  2YKN A;  3AVL A;  2KTQ A;  3SZ2 A;  2A1S A;  4E3S A;  2QK9 A;  3QIP A;  2E6M A;  1J9A A;  1RT7 A;  1HQU A;  1VK0 A;  3C6T A;  1W9H A;  2P1J A;  3KLI A;  3BDP A;  3RR7 A;  1ASW A;  4CHZ A;  1X9S A;  3OYK A;  3HPH A;  1RIL A;  1A5W A;  4RW6 A;  4RW9 A;  1GOC A;  1NJZ A;  2PYL A;  2Z1J A;  1LW0 A;  1WNS A;  2QXF A;  4IG3 A;  2G8I A;  1C0U A;  5CZ1 A;  4CJW A;  4OGC A;  2P51 A;  3QO9 A;  1RDB A;  2YV0 X;  4M3R A;  3KD1 E;  1JLE A;  4KB1 A;  4CK1 A;  1LWC A;  3ULD A;  3AA2 A;  3RMD A;  1UWB A;  4FCY A;  4M3W A;  3PO5 A;  3DMJ A;  3MXI A;  1JKH A;  1LAV A;  2FBV A;  3S9H A;  3SNN A;  1ITG A;  2DFE A;  4O5B A;  3F9K A;  3LZJ A;  4ID1 A;  1SKS A;  4W5N A;  1WN7 A;  2VG5 A;  1VSH A;  3SPY A;  1S1W A;  1NK6 A;  4HCB A;  3OYD A;  4B9T A;  4CFC A;  1A5X A;  3DM2 A;  3DYA A;  2HHX A;  1HYV A;  1QSL A;  1S9E A;  2OPS A;  3AO2 A;  3U6F A;  1TK5 A;  4Z4F A;  3VQB A;  3ALY A;  1WSF A;  4KHU A;  3SV3 A;  3CQ8 A;  3OJS A;  1RNH A;  2HHV A;  3IAY A;  1S6P A;  1TVR A;  1NJW A;  2Y1J A;  3MXM A;  4ID5 A;  3S3M A;  1GOB A;  1TK8 A;  3QIO A;  4JS5 A;  1S1U A;  1TAQ A;  1HJR A;  1RBS A;  4HUF A;  3ZT0 A;  1WAJ A;  4BE2 A;  4FLX A;  3AA5 X;  4PA1 A;  3I8D A;  4E7I A;  3AVM A;  3SUN A;  2OA8 A;  3OYL A;  1ZYQ A;  3ZSO A;  2G8H A;  4CF0 A;  2YHA A;  3KK3 A;  1CLQ A;  1BIS A;  1ASV A;  1QS4 A;  4FJG A;  3CFR A;  1RCH A;  4DS5 A;  3TAQ A;  1DTQ A;  4CEZ A;  3AA4 A;  4OLA A;  3O3F A;  2JLE A;  3PX0 A;  3HT3 A;  3G10 A;  1HNV A;  4KTW A;  3LDS A;  5KI6 A;  3V4I A;  4JLH A;  2RN2 A;  4FJ7 A;  2ETJ A;  1RT5 A;  2DFF A;  4CHY A;  3KIO A;  1J54 A;  4O0I A;  3QEP A;  1EKE A;  1NJY A;  4FJI A;  4TSX A;  4ICL A;  4DTU A;  1LV5 A;  3AVA A;  3DLH A;  3ZCM A;  3V9X A;  2O4G A;  3K5N A;  4HUE A;  2F8T A;  4FW2 A;  3SUQ A;  1T8E A;  4EZ9 A;  5HRP A;  1NJX A;  3VA3 A;  5HRR A;  3MED A;  3AVH A;  3V9S A;  3TWH A;  1KVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...