4OKJA

Crystal structure of rnase as from m tuberculosis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of RNase AS, a Polyadenylate-Specific Exoribonuclease Affecting Mycobacterial Virulence In Vivo
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords 3'-5' exoribonuclease Rv2179c/MT2234.1
total genus 50
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4okjA00
1RILA 4J2AA 2P51A 3QLHA 4FZYA 4KI4A 4CGDA 1A5VA 4CHQA 3V9WA 3DI6A 3PY8A 3KD1E 4W5QA 1RBTA 4B9UA 4YNQA 3AVHA 2YKNA 4CJLA 5CYMA 3TI0A 1ZYQA 3DOLA 3ISNC 3U6FA 1N5YA 1WAJA 2HW3A 2DFEA 3O4NA 1XI1A 3SQ4A 4C8KA 1C0TA 1RBRA 5KGWA 2Z1HA 5JS1A 2GUIA 1KVAA 1IKYA 4FLYA 1Z26A 3O3HA 2G8KA 1FK9A 2G8VA 4EZ9A 3U3YA 5HRRA 3NHGA 3MXJA 1XWLA 1BIUA 3LAMA 3UIQA 3QO9A 2KW4A 4FVMA 3VQEA 5DK5A 3H08A 3ZSVA 2ZQBA 1NOYA 3C6TA 3LZJA 4FJJA 2D0BA 5FRMA 1HRHA 1WSEA 2BANA 3VQ8A 3QIPA 5I3UA 3OJSA 2G8HA 1HPZA 3RMCA 3T3FA 1U45A 3CYMA 4KHQA 4KB1A 3LP1A 4JS5A 1BQMA 2YNFA 4Z4EA 4KTQA 4BE2A 4ELTA 3RRHA 4FLTA 1L3SA 4E0DA 3SV3A 4O0JA 4C8MA 3OYFA 3RMDA 4CFAA 4FJIA 1Y97A 2FBVA 4B9LA 3SQ1A 2YHAA 2HNYA 2HHSA 1IO2A 1NOZA 4N47A 3ALYA 3VQ9A 3O3GA 4DFJA 1R0AA 3HK2A 4CK1A 2PYLA 2VWJA 4FK2A 3QEIA 4B08A 1NK9A 2F8SA 1RT4A 1TAQA 3ZSQA 4DU3A 2HNZA 3ZSRA 3LANA 3JYTA 3KK2A 4FJHA 4B9NA 3DLGA 4M3WA 2ZD1A 5FROA 1LW0A 4CHYA 1EX4A 4K8ZA 1B9FA 1RCHA 5J1EA 4PA1A 4FM2A 1J5OA 4PUOA 4OLBA 3TR8A 3SUNA 3BDPA 1VSKA 4KV8A 1BQNA 1QQCA 3SI6A 1BISA 3TABA 1LWFA 4F4KA 3LWMA 2XY5A 3HVRA 1JL1A 3E01A 1KSPA 3SYZA 3DM2A 3ITHA 4C8NA 1I3AA 3G10A 3RMBA 3DRPA 4KB0A 1JLFA 2I5JA 3ZCMA 4CJKA 4E7IA 4DQRA 3VQAA 4CJ3A 2GBZA 5HRNA 2XY6A 1CXUA 3HXMA 4DF8A 3K5LA 1TK0A 2W42A 4I7FA 4FCYA 4QCLA 1SL2A 3K5NA 2P5OA 4Q0BA 3DRRA 3KKSA 1SL1A 1FXXA 1WLJA 4WE1A 2KQ2A 2D0CA 3VA3A 1TKTA 3OYCA 3CQ8A 1C0MA 4C8LA 4FJ8A 2A1RA 1U49A 1ITGA 2ITGA 4PY5A 2DFHA 1BI4B 3VQCA 1VSEA 1D8YA 4KHYA 3LAKA 2IC3A 2F96A 1Q9XA 3NH2A 4OKJA 4M3UA 2BE2A 1DTTA 3AVFA 2IDOA 3AVJA 2JLEA 3KK1A 3PX6A 1B9DA 4MFBA 3IRXA 4CHPA 3SCXA 2OPSA 2G8WA 4TSXA 3NH1A 3MECA 3SZ2A 4DQQA 3SNNA 3L2WA 3LPTA 4JRQA 5HP1A 3KLGA 3QESA 4OLAA 1HYVA 2YNGA 1L3VA 2O4GA 5KRTA 1GOAA 3IAYA 3AVGA 1JKHA 4CEFA 4CIGA 4DTNA 4JLHA 4N41A 4CEOA 3OYGA 4J2EA 3OYMA 5KRSA 4OGEA 2IGIA 4ICLA 4FM0A 1GOBA 2VG5A 1RDBA 3OS2A 4E7KA 3AA2A 3KLEA 4CEBA 1VRTA 4CF0A 4NCGA 1LWEA 1VSMA 4KRFA 3OS0A 5CZ1A 4M3XA 1WNSA 4FW2A 3THVA 2D0AA 4DLGA 4LSLA 4AHVA 5HLFA 3AVCA 4OKEA 4GW6A 4CF9A 1TAUA 1XHZA 1U47A 2HNDA 4KFBA 3C6UA 3NGIA 3IG1A 4CECA 3AVLA 1HQEA 3DLEA 3B6OA 2IAJA 4ZTFA 4DTRA 4FJ9A 1TL3A 4DSEA 4HUEA 4DG1A 4E19A 4CHNA 1S6PA 4CGHA 5J2QA 2JGUA 3HO1A 3L3UA 2VG6A 4LD0A 3VQ4A 2B6AA 1UOCA 3VQ5A 1S1TA 3AA4A 1RTDA 3ZT3A 3QNOA 3K2PA 3CM6A 4IFVA 4DSIA 1JXEA 3CFOA 2XY7A 3SUPA 5SWMA 3MAQA 5DMRA 3SQ2A 4CFBA 1XHXA 2XO7A 3AVNA 4DSKA 1VSLA 1S9EA 1W9HA 4GVMA 4N5SA 3HP6A 2DTUA 3P5JA 3RR7A 2QKKA 4KHUA 3F73A 4M3TA 1YTUA 1WAFA 2YV0X 3NGZA 1NK7A 1EXQA 1JLCA 4O44A 4FLXA 3LWLA 4DSFA 4ZTJA 4K8XA 3SPYA 3PX4A 2YHBA 2YNIA 3AVKA 3OYHA 4F3TA 3KJVA 1RT2A 1S6QA 1CZ9A 5EU7A 3ZSWA 4E3SA 3K58A 4FJKA 4CK2A 3KD5E 3I0SA 1BCMA 1UA0A 1HYZA 4RW8A 4OKKA 4KAZA 2KFNA 3KKRA 1VSJA 4CF1A 4CFCA 1BCOA 4RG8A 5C25A 3M8SA 3KK3A 1HJRA 1SUQA 2FBYA 1KFSA 4Z4FA 4M41A 3D45A 4CJ4A 1UWBA 1MU2A 3ASMA 4BWMA 4CF2A 4FM1A 4L8RB 1TL1A 2O4IA 2KTQA 3RRGA 3ZT4A 4CCHA 1QTMA 1L5UA 2ETJA 1ZBUA 4CERA 3K5MA 4AH9A 1I39A 1S1VA 4Z4CA 3K5OA 4Z4HA 3VQPA 4CEZA 2P5GA 4DU4A 4DTXA 4CJ5A 4IBNA 3KLHA 1K6YA 5C42A 2VWKA 1CZBA 3AO2A 2IS3A 4M3RA 1NK5A 3AV9A 3DLHA 3WNEA 4UQGA 1QHTA 4OGCA 3I0RA 1REVA 3V81A 1T03A 2ZE2A 1CLQA 3NF9A 2G8UA 1HMVA 2HHQA 4OJRA 3ULDA 3SUQA 1RTJA 4KTWA 1NK0A 3QEVA 3PO4A 1G15A 1KLMA 1W0HA 1S9GA 1RTIA 4G1QA 5HRPA 4LH5A 1NKCA 3OYIA 4E7JA 4Y1DA 3LZIA 2OZSA 3LALA 4DFKA 3HPOA 3O3FA 4M42A 1A5XA 4N76A 1J53A 1RTHA 1VK0A 3V9SA 3CFPA 2QXFA 1X9MA 4ELUA 1KCFA 1Z25A 4B9VA 3OYDA 1B92A 3MXIA 2HHUA 3TWHA 3D0PA 3CG7A 3L2VA 3NF7A 5CZ2A 1NJYA 3F9KA 1ASWA 4FJNA 1ASVA 5D3GA 1TV6A 4RW7A 4J2DA 2WOMA 3AVBA 4RW4A 2G8IA 3HT3A 4DLEA 3TANA 4LY7A 4MQ3A 1HNVA 4H4OA 4W5TA 3ZSOA 4FLVA 2KZMA 4NYFA 4EP4A 3A2FA 2E4LA 4CHOA 1D9FA 2X6SA 3HM9A 3VQBA 3K57A 5J2PA 4B3OA 2HVIA 5C24A 4YFUA 3PUFA 3M8RA 3HVTA 4QOZB 1NKEA 1WSGA 3BGRA 4IFYA 4O55A 4DTOA 1NK4A 4CJTA 4JRPA 3OYLA 1TK8A 3DLRA 4NCAA 1ZBHA 1RDAA 4B9SA 1BI4A 4QAGA 4FJ5A 3ZSXA 2BGGA 4CJUA 3ZSZA 1D5AA 5HROA 4CGIA 3EY1A 3V9ZA 2P1JA 3MEGA 3L2QA 3JSMA 3G0ZA 1C1AA 1SV5A 3TARA 2Q3SA 3V4IA 1RT6A 4FYDA 2QKBA 3TAGA 1SKSA 1JXBA 1RT5A 4DF4A 3TAMA 1C6VA 3OYEA 3VQDA 3NDKA 4FW1A 1J9AA 4CF8A 4O0IA 3NCIA 3NH0A 3LP0A 3RR8A 4RW6A 4CK3A 4C8OA 4DTJA 1WSIA 1XC9A 1IG9A 1NJWA 1QS4A 4E7LA 1C0UA 2EHGA 3OYNA 2QK9A 4KHSA 5J2MA 1SKWA 3TAPA 4R5PA 4EP5A 1JLAA 1RT1A 3L2RA 4M45A 2PZSA 4KREA 4NCBA 3NE6A 5JS2A 1WN7A 3O4QA 3RTVA 4B9TA 4F8RA 4ID1A 1LWCA 5HBMA 4FLWA 1L3TA 2Z1IA 4CJVA 1IKWA 4DWIA 4LSNA 2A1SA 4O4GA 1EETA 1GOCA 4FJLA 1KRPA 4FZZA 3ZT2A 1U04A 4E7HA 2WONA 1JLBA 1KVBA 4DU1A 4ELVA 2RF2A 4HCCA 4FJ7A 1TVRA 2KZZA 3OYBA 3V1OA 3DLBA 1RDDA 3T19A 5KGXA 4FXDA 1C1BA 4J2BA 2OPPA 4CGJA 3V1QA 2HB5A 3PX0A 1EKEA 1QE1A 3DOKA 4Y1CA 3ZSYA 4AHCA 3S3MA 2OA8A 2YNHA 1VRUA 4N56A 4I2PA 1SKRA 1LW2A 1A5WA 1ASUA 3T1AA 4CJWA 4OPJA 2DY4A 1JLEA 4AHTA 4CGFA 1SL0A 2XRIA 4CEEA 4W5OA 1QSYA 3LP2A 3QERA 5CY4A 4KTZA 1NK8A 4F2RA 4EZ6A 1C1CA 1O1WA 4Z4IA 1NJXA 2HMIA 3VQ7A 1HYSA 3HYFA 4F2SA 4DQIA 2E6MA 2RPIA 2HVHA 2RN2A 4CEDA 3AA5X 3SUOA 1QSLA 2HHTA 2F8TA 4HCBA 4ID5A 4CJRA 4DFPA 2X6NA 4H8KA 3VA0A 4W5RA 4FJMA 3QEPA 3OYKA 1RBSA 4FJXA 1S1UA 2Z1GA 3U3GA 3AVAA 1DLOA 4PWDA 3OYAA 3OY9A 4PQUA 5KTQA 5FRNA 3RMAA 3QNNA 4I9QA 1VSHA 4DTPA 3V9UA 4FLUA 5J2NA 2HHWA 4M3ZA 3QINA 1NJZA 2B5JA 5HRSA 2FC0A 2XHBA 1VSFA 3I8DA 1F21A 1TKXA 4CHZA 2BDPA 3FFIA 4IG0A 3LDSA 3CFRA 4BDZA 2EX3A 2Z1JA 3HSTB 1FKOA 2RKIA 4E89A 1RT3A 1S1XA 2AJQA 4E1MA 4H4MA 1IKXA 1T8EA 3NGYA 1RNHA 1JL2A 1WSJA 2Y1JA 4DSLA 1JLQA 1TGOA 1VSIA 3DMJA 4CEAA 3VQQA 2HHVA 4BE1A 4DTMA 5I42A 4CJSA 1QSSA 3L3VA 4I9LA 2OYQA 3HPGA 2YKMA 4BWJA 1KVCA 5CYQA 2R7YA 1KTQA 4KKOA 3NFAA 3HPHA 1WSHA 3WNFA 3P83D 4CGGA 3S9HA 1D9DA 1CXQA 3AA3A 1X9SA 3KLFA 3EZ5A 3SQ0A 4Z4GA 3WNHA 3HJFA 2E6LA 1J54A 1RBUA 1YT3A 4LH4A 3OJUA 3NF6A 2ATQA 3PV8A 4CESA 4CFDA 3TAQA 4KI6A 1BL3A 2HHXA 3OVNA 4FZXC 4CIFA 1YTAA 4OPKA 4W5NA 1HNIA 2OPQA 4B9MA 3MEEA 1L3UA 3PO5A 3C95A 1LV5A 3LPUA 2Y1IA 4CJFA 3B6PA 4DTUA 1RT7A 3KIOA 1ZBFA 1FKPA 3NF8A 3WNGA 4JS4A 3OS1A 4DS5A 4BDPA 2FBTA 3QIOA 2FBXA 3L2UA 1ZBLA 1U4BA 1U48A 1X9WA 4F3OA 4CIEA 1WSFA 1Q8IA 1TKZA 3HP9A 3S3NA 2PYJA 4I2QA 1DTQA 3KTQA 4KHNA 2GV9A 3ZT0A 2PY5A 2D5RA 4CJPA 1UA1A 1T05A 3C94A 4AHSA 1EP4A 1S5JA 1NK6A 4M3YA 4HVJA 3V9XA 4BACA 3K59A 5KI6A 4AILC 4RW9A 3VQ6A 3NAEA 3AO1A 4DFMA 1LAVA 3MXMA 1T7PA 3S3OA 1UAXA 4IDKA 4FJGA 4DQPA 4DMNA 3M8PA 4AHRA 5E41A 4BE0A 4DTSA 2OZMA 4FK4A 3LP3A 4CEQA 4HTUA 4DSJA 2OPRA 4AHUA 3AVMA 4IG3A 4DS4A 3V6DA 1LAWA 4B8AB 4HHTA 4BDYA 3AO5A 5T7BA 1Q9YA 4IKFA 3SJJA 4Z0UA 2DFFA 3AVIA 4GMJB 4HUFA 3AO3A 1TKDA 3TAFA 4NYNA 3QEWA 2IOCA 3AO4A 4ZHRA 3KLIA 3SPZA 1IH7A 3IS9A 1JLGA 3SV4A 1ZBIA 4CJEA 1KFDA 4HUGA 3MEDA 2X78A 1BHLA 4KO0A 4O5BA 2VG7A 3DRSA 1YVUA 4XIUA 1TK5A 5SZTA 3L8BA 2XY8A 3VN5A 3DLKA 1N6QA 4Q5VA 3RWUA 1IKVA 4CE9A 3QEXA 2KFZA 1KLNA 3NBPA 3OYJA 2X74A 1BGXT 1NKBA 3V1RA 1BIZA 2B4JA 4B8CA 4KPYA 1HQUA 4OVLA 4FK0A 4DQSA 5K14A 3TAEA 4E1NA 2LSNA 1RDCA 3M8QA 3P1GA 3QETA 3HL8A 2G8FA 4CJQA 1RBVA 1VSDA 1X1PA 3ZT1A 3CM5A 4KHWA 5FDLA 3DYAA 3EYZA 2NUBA 1S1WA 4FLZA
chains in the Genus database with same CATH superfamily
1RILA 2P51A 2ITMA 1KD1O 4KI4A 3TSUA 5BR8K 5AFUA 3KD1E 4W5QA 1RBTA 2Q36A 2HW3A 4BRPA 3N4QA 4BG8A 4C8KA 1Q81O 1KVAA 1IKYA 4FWOA 1Z26A 1KQSM 2PBDA 2G8VA 4LF6K 3U3YA 5ADXA 5F2RA 1K73O 3NHGA 3MXJA 3T69A 3PLAA 1BIUA 3LAMA 3QO9A 3VENA 1HJOA 4FJJA 3ZSVA 1NOYA 3AGKA 3VQ8A 1NGHA 3ZETA 3JS6A 4BRHA 4JS5A 2YNFA 3RRHA 4FLTA 1L3SA 1RFQA 2O8BA 4C8MA 4JKGA 3RMDA 4FJIA 3O1BA 4BR0A 2FBVA 2ZWHA 4DCHA 1HNZK 3ALYA 2PYLA 2VWJA 3QEIA 1NK9A 4A5BA 3ZSQA 5AQQA 3EO3A 1J6ZA 4B9NA 3DLGA 4M3WA 2ZD1A 1LW0A 4K8ZA 4B1WB 1P8ZA 3W0LA 3SUNA 3BDPA 1VSKA 1QQCA 3SI6A 1BISA 2Q97A 3M6GA 3HVRA 4H0TB 1KSPA 5E84A 4BR4A 4C8NA 3G10A 1SAZA 4DQRA 2I5JA 4E7IA 2E2NA 1FJGK 3VEOA 4Q0BA 3UKUA 4A2AA 1SL1A 4JHDA 1WLJA 2KQ2A 2ASOA 3OYCA 4PY5A 1ITGA 2IVPA 4KHYA 1VQKN 3NH2A 1VQ4N 4OKJA 1DTTA 3KK1A 4MFBA 3SMSA 2G8WA 1NNEA 4BRIA 3SNNA 4LC9B 5C0YA 4CZGA 3QESA 3KVGA 5KRTA 1GOAA 3CCSN 3AVGA 1JKHA 4CIGA 1VQ9N 2FSNA 4JLHA 3OYGA 4J2EA 4NO7A 4OGEA 2IGIA 4FM0A 5FPDA 1RDBA 4LFAK 3KLEA 3TPQA 5AQJA 5CZ1A 4M3XA 4IOAL 4CBUA 4CF9A 5BPLA 1TAUA 4YY3K 3WT0A 3IG1A 3AVLA 3DLEA 4CD1A 3B6OA 4GVEA 2IAJA 3WXIA 4DG1A 1S6PA 3HO1A 2VG6A 2NNWA 3VQ5A 1LCUA 3AA4A 4JD2A 2AP1A 2ZJPL 3CM6A 4IFVA 4WQ5C 4DSIA 5SWMA 5DMRA 4DSKA 1HLUA 4N5SA 4YOUA 4IOXA 5LMUK 3KWIA 4DKWA 3NGZA 4DV7K 4FOIA 4O44A 4G9ZA 3H6EA 2YNIA 4A2BA 4GV9A 3MK6A 4FJKA 4E3SA 3I0SA 1UA0A 4RW8A 2KFNA 3IKMA 1VQ7N 2CGLA 1NJIO 5C25A 2CGJA 1WBBA 3UKRA 3L4IA 4BWMA 3P39A 2KTQA 3LM2A 1L5UA 1KC8O 4BRMA 5BPNA 3OA9A 3K5OA 3I33A 2P5GA 2DPNA 4CJ5A 5C12A 3AO2A 2IS3A 1NLVA 1QHTA 4OGCA 3I0RA 1REVA 4CW7B 3NF9A 1HMVA 4B9QA 4OJRA 4X65K 2P9SB 1E4GT 1KLMA 4U67L 4G1QA 4H0XB 5HRPA 2OZSA 1NKCA 4FJNA 3LALA 4DFKA 2UUCK 3CJBA 1VK0A 1X9MA 4ELUA 4B9VA 3OYDA 4M63C 2D0OA 5GAEP 4X64K 3VOVA 3NF7A 5CZ2A 3F9KA 3CCJN 4C1NI 5A2QO 3SJHA 4BR5A 2G8IA 4BC5A 4LY7A 4MQ3A 1JCEA 4CZHA 4DV0K 3MN7A 3ZSOA 2E8AA 3HTVA 4HWIA 4U7BA 2X6SA 3MN9A 3SBTA 3VEXA 3HM9A 5C24A 4FWPA 4O55A 4DR2K 1TK8A 4DV6K 2HF4A 3EY1A 3G0ZA 1C1AA 2Q3SA 2QKBA 3DXKB 1SKSA 1C6VA 3NDKA 3NH0A 3R1XA 1RGIA 4IWVA 4DV4K 4EHUA 1WSIA 3ZEUA 1QS4A 1C0UA 2QK9A 1SQKA 4EP5A 4KREA 3EE9A 4X66K 4FLWA 4DWIA 1GOCA 1KRPA 4LF5K 1KVBA 4JI5K 1VQNN 3VTHA 4EIAA 3T19A 3U9DA 3PIOL 4L3QA 2OPPA 3F9MA 3PX0A 1EKEA 3DOKA 4Y1CA 3CMAN 1EO1A 1TYQA 1SKRA 1A5WA 2V7YA 2DY4A 3MWPA 1JLEA 3F5TA 4W5OA 3DJCA 4F2RA 3VETA 2HMIA 5AQLA 1HYSA 2NZTA 3RVCA 2E6MA 3CC7N 2RN2A 2QWPA 4QS7A 3ZX3A 1QSLA 2HHTA 3DXMB 2NRZA 5LMNK 4LFBK 2FXUA 1MDUB 2O8FA 4DTPA 5J2NA 3AARA 5BRHA 4M3ZA 3QINA 1X9JA 1XNRK 1QVGM 2ZGZA 3FFIA 3CFRA 3VEVA 1FKOA 3OBYA 2AJQA 4E1MA 4GNIA 4H5NA 4ISEA 1T8EA 2Y1JA 1WSJA 1XMOK 1JLQA 1N34K 2WUSA 5I42A 4CJSA 4BRKA 3MN5A 4H5WA 2Q1NA 2YKMA 2W40A 1WSHA 3WNFA 4PKHA 3IMXA 2P9UA 1CXQA 3KLFA 3SLCA 3HJFA 2FF6A 3I55N 1YT3A 3O5BA 3OJUA 3PV8A 4CFDA 3TAQA 1BL3A 4CIFA 4W5NA 3LL3A 2OPQA 4B9MA 3O9SA 3UKRB 2OTLN 3LPUA 2Y1IA 4JS4A 1S72N 2FBTA 3QIOA 1H1VA 2FBXA 4F3OA 1Q8IA 1TKZA 3HP9A 5BN8A 2PYJA 3KTQA 4V19S 3ZT0A 2PY5A 1GLCG 3U8XA 3C94A 1EP4A 1FW6A 4HVJA 3K59A 2QM1A 4H5VA 4DFMA 1UAXA 4BRGA 4FK4A 4DV2K 4OX9K 1Q18A 4JD2B 3V6DA 4B8AB 3AO5A 4IKFA 2DFFA 4HUFA 4O5FA 5H1SQ 4JYAK 5C15A 3GG4A 3QBXA 2YHYA 2IOCA 3AO4A 3QMLA 4BRDA 4HTLA 1IH7A 3L0QA 3IS9A 1ZBIA 5AQYA 1BHLA 4K25A 1N6QA 2HOEA 3RWUA 3QEXA 2KFZA 1KLNA 2QEXN 4QS9A 1ZBSA 4B8CA 1HQUA 4DQSA 1RDCA 1C0FA 3P1GA 4CJQA 5AQSA 1HX1A 3ZT1A 2WBNA 3H1QA 1S1WA 4AQYK 2A40A 4H0YB 4J2AA 4FZYA 2HMPA 4CGDA 2A5XA 4CHQA 3V9WA 3DI6A 1OH6A 5EX5A 4B9UA 4YNQA 1ZYQA 3TI0A 3A5NC 1HKCA 3AY9A 4Z94A 1N5YA 3O4NA 1E4FT 1X3NA 2HBLA 3CD6N 1YHQN 2Z1HA 3MN6A 4IFEA 4BVPA 1FK9A 1YXQA 4JHDB 2QWRA 1J5EK 4RTFD 1WOQA 5EOYA 1K8KA 3VQEA 5FRMA 2ZQBA 3LZJA 2D0BA 1HRHA 2D4WA 3QIPA 1YAGA 3OJSA 2G8HA 3RMCA 4KHQA 3T3FA 3CYMA 4KB1A 3LP1A 4Z4EA 3Q7CA 3CCRN 4KTQA 4IZ9A 4FL9A 3SV3A 4DQ8A 3W3DA 2VGNA 3FFKB 1Y97A 5FPNA 4WCEL 5BREA 2YHAA 1MWKA 2HHSA 4CK1A 2VCPA 4B08A 3O6WA 1RT4A 4DU3A 3HSCA 2HNZA 3ZSRA 3JYTA 2D0PA 5HOOA 2P9IB 3CJCA 3TTDA 5FROA 1B9FA 3E9LA 4FM2A 4OLBA 3TR8A 3R9PA 4B1VA 1BQNA 2ZF5O 3TABA 2P9SA 1JL1A 3E01A 2JWLA 2NRWA 1Y64A 3VF2A 1I3AA 1WBDA 3CCQN 2VQEK 4KB0A 3ZCMA 4CJKA 1CXUA 3HXMA 3K5LA 1TK0A 1EQYA 4BC4A 1W7AA 2P5OA 1FXXA 4IDHA 2D0CA 3VA3A 3GBTA 3CQ8A 4FJ8A 1U49A 2GWKA 1IV0A 1BI4B 4B1UB 3VQCA 4JN4A 1Q9XA 4KH5A 5BN9A 4JI0K 5LJVA 3HOTA 3CQYA 3AVFA 3BF3A 4H5RA 2JLEA 3PX6A 3L2WA 5AR0A 4IO8A 1E3MA 2YNGA 1L3VA 3GDQA 2ZJRL 3MMVA 3G25A 5KRSA 1G99A 4ICLA 4YDUC 3ATUA 3OS2A 1NBWA 4CEBA 1KAZA 4KRFA 1VAZA 4FW2A 2D0AA 5HLFA 4OKEA 1DKGD 1W2BM 4GW6A 5KPTA 1U47A 3J80O 4KFBA 1OVYA 4I6MB 4FJ9A 3DLLL 4HUEA 2IVNA 2QA4N 3VQ4A 4LD0A 4WYBA 3FZFA 1MA9B 3ZT3A 5GIPA 3LM9A 1XHXA 3AVNA 3AGRA 1YUWA 3HP6A 4XH5A 5JMVA 3MX2A 2QKKA 1BDGA 3RR7A 3F73A 1YTUA 1WAFA 1EXQA 1JLCA 4DSFA 3LWLA 3NMUA 3D2FB 1RT2A 1S6QA 3K58A 1XQSC 3O1WA 3FGUA 4KAZA 3KKRA 1VSJA 4CF1A 1BCOA 2GUPA 4Z4FA 4JI1K 4BVOA 3SAGA 2YJEA 3BUZB 4YOXA 3ZT4A 4QS8A 1QTMA 1NGAA 1S1VA 4Z4CA 5FPEA 4DTXA 1NMDA 3KLHA 1K6YA 5C42A 1CZBA 3R6MA 3AV9A 4UQGA 1T03A 1CLQA 3ULDA 3SUQA 1NK0A 3PO4A 5FLXO 1G15A 4CZFA 4OPAA 3O80A 1W0HA 4H0VB 4E7JA 4Y1DA 3LZIA 3CJ9A 3HPOA 1A5XA 4N76A 3SAHA 1J53A 3CFPA 1KCFA 1Z25A 4BREA 1B92A 5I9EB 3BEXA 1OVQA 2IIRA 3L2VA 1ASWA 1R59O 3QDKA 3CJAA 4RW7A 3S41A 3Q7BA 1HNVA 2GTDA 1HPMA 3J8AA 4H0PA 3VGLA 4DR1K 4W5TA 4ISGA 5KPRA 3VQBA 5J2PA 3M8RA 4X62K 3MWTA 1NKEA 4B3TK 1WSGA 4WFNL 4DTOA 1U6ZA 3M1FA 4CJTA 4JRPA 1NK4A 3DLRA 3VGKA 4B9SA 1BI4A 4CJUA 5HROA 3V9ZA 5AZIB 3IUCA 3CCLN 4FYDA 3TAGA 4CZKA 4DF4A 4Y0WA 2QWNA 3OYEA 2ZM6K 1J9AA 4RW6A 4H03B 2P9NB 1XC9A 1GLLO 1IG9A 1NJWA 3J7YP 3ATVA 4CJ7A 3M5RA 4BR7A 1SKWA 2WFBA 4M45A 2PZSA 3NE6A 3RTVA 4ID1A 1LWCA 3VF6A 2KHOA 2Z1IA 4IOCL 4LSNA 4O4GA 1EETA 3I56N 1U04A 2WONA 4JK8A 4DU1A 4A62A 3VMFB 2HBKA 3G71N 1TVRA 3OYBA 3FZKA 1RDDA 1YVNA 4M7YA 3GOIA 4J2BA 3S3MA 4R79A 4WQ5A 3WQUA 4OPJA 1ASUA 4MDBA 2Q0UA 1SL0A 2XRIA 5CY4A 4KTZA 5AQXA 1NK8A 1C0GA 1O1WA 1W97L 3VQ7A 4DQIA 2RPIA 3G6EN 4CEDA 4B3RK 1K8KB 4ID5A 1XC3A 4PL8A 2Q31A 3EN9A 4H8KA 3OYKA 1RBSA 1U2VA 1TYQB 2E88A 1DLOA 3AVAA 3CJ1A 5M1OA 4PWDA 3JAMO 3E1YA 2IVOA 5KTQA 5FRNA 2VQFK 4I9QA 1NGCA 3V9UA 4F9OA 2E2OA 4FLUA 1NG9A 1RDUA 2HHWA 1NJZA 3D2EA 1HNWK 1F21A 3BZKA 1TKXA 4JKGB 4IG0A 3HSTB 1RT3A 4LFCK 1Q7YO 1LOTB 1RNHA 1JL2A 3EKSA 4JEPA 4CEAA 3VQQA 4OO1J 3WXKA 4FPAA 1OH5A 3HPGA 1KAYA 1NGBA 4BWJA 5CYQA 2R7YA 3WXLA 3ID6A 1D9DA 1X9SA 3AA3A 3EZ5A 3SBGA 1BA1A 4Z4GA 4FWNA 1J54A 3P4IA 4LH4A 4KI6A 2ATQA 3OVNA 1X3MA 5GIOA 4OPKA 3R8EA 1VQLN 3C95A 4CJFA 4XH4A 1RT7A 1FKPA 3NF8A 3WNGA 3VESA 4BDPA 2NLXA 4CZJA 1U4BA 1U48A 3OBWA 1T3VA 4MLHA 1GLDG 4KHNA 1DTQA 3QB0A 3KWGA 2GV9A 4CJPA 4CVNE 3H3NO 1NK6A 3VQ6A 5EXWA 1N32K 1N8RO 4DQPA 4DMNA 4BE0A 3HM8A 2W6LA 4FWSA 1HNXK 4DS4A 4DUZK 1LAWA 5EVZA 1Q9YA 3SJJA 2CGKA 4Z0UA 3AO3A 3RSEA 5AQIA 4ZHRA 4JKCA 3SV4A 4EHTA 3THYB 1VQ6N 1TK5A 1YVUA 4XIUA 2XY8A 5FPMA 2Q2RA 4CE9A 1BGXT 3ZLJA 1BIZA 4BC2A 1DEJA 4OVLA 1N36K 3WXJA 2LSNA 3QETA 4J8FA 3WEEB 3R3LA 5FDLA 3CPWM 3J7ZO 5EY4A 5GAHP 4FLZA 5KPZA 3TTFA 3BY5A 3NVMA 1A5VA 3TSQA 3AVHA 3NVKA 2Q0RA 3DOLA 5C2DA 1WAJA 2DFEA 5AQFA 5M1PA 4BRAA 2O8DB 1C0TA 5AFUH 1RBRA 5KGWA 5JS1A 4K0KK 5IWAK 4FLYA 2BUPA 2G8KA 2KKZA 3TTCA 5HRRA 3OW2M 1IG8A 4BQZA 3UIQA 2KW4A 4FVMA 3THXA 3FR0A 3H08A 5AQMA 2BANA 2I7PA 4PL7A 1HPZA 5JVGL 4BR2A 5CHIA 4BE2A 3THWB 3U4LA 3OYFA 1SZ2A 4NLBA 4B9LA 3EE8A 1IO2A 4N47A 3IDHA 3VQ9A 1R0AA 3HK2A 3WEEA 4DHYA 4FK2A 4B3MK 1TAQA 4GKKK 3LANA 3KK2A 5LL6Z 3F2KA 4M7XA 1VQ5N 4CHYA 5J1EA 4PUOA 1J5OA 5ELZA 1JJ2M 4KV8A 5M1NA 4F4KA 3LWMA 2O8EA 4JI7K 4BRNA 3SYZA 2UXBK 3DM2A 3ITHA 3DRPA 1ILYA 1JLFA 3VQAA 2GBZA 3EKUA 2XY6A 2W42A 1WB9A 2V7ZA 3K5NA 1ATNA 3DRRA 3KKSA 3O4WA 2O8CB 4C8LA 1C0MA 4GY2B 4WF9L 2E20A 1VSEA 2F96A 3O9UA 3UB5A 4ILGB 3ZYYX 3BP8A 4M3UA 1T6CA 1B9DA 3IRXA 4CHPA 4C23A 4TSXA 3NH1A 2YHWA 4KHPK 3LPTA 3CCMN 3KLGA 4OLAA 1RDWX 4BRFA 4LF8K 4FWLA 2QTDA 3SK3A 1QHAA 4CBWA 1Q82O 3AAQA 4PHTX 2VG5A 4YORA 4MLEA 3EEQA 3AA2A 4CF0A 5BRFA 1LWEA 3OS0A 3THVA 4DLGA 4LSLA 4BRCA 4CBXA 5BPMA 3C7NB 3C6UA 4BY9C 4ZTFA 4DTRA 4DSEA 2P9LA 4CGHA 5J2QA 1GLFO 5TKWA 1NWKA 2B6AA 1XUPO 2HBJA 1S1TA 3CIPA 3E9PA 4DV5K 4IO9L 3QNOA 2W41A 3K2PA 4FSVA 1JXEA 4EFHA 3THYA 5AQZA 2XO7A 3P38A 4JNEA 4IJAA 1W9HA 4GVMA 3P5JA 1HUXA 4KHUA 4AM7A 3KHYA 1NK7A 4K8XA 2ZGYA 2YHBA 3E9OA 3AVKA 3OYHA 4F3TA 3OHRA 4B3SK 1CZ9A 5EU7A 3KD5E 1BCMA 2NRXA 4CFCA 1M90O 4RG8A 3M8SA 2P9PB 4M41A 3KK7A 5LJWA 3D45A 4CI6A 3ASMA 4FM1A 3VPZA 4CF2A 1TL1A 3H46O 5JLFA 4FWQA 2PFUA 5AZJB 2ETJA 4I6MA 4CERA 1I39A 4IEEA 4Z4HA 2O8BB 4DU4A 4IBNA 4NB4A 2VWKA 3DLHA 1Q86O 1P90A 3WNEA 3V81A 4A61A 3MCAB 2G8UA 2HHQA 3ENOA 4JAXA 1RTJA 2ASMA 3J7AP 1OH8A 4DV1K 2D1KA 4BROA 5CE3A 2RE2A 4FO0A 1Z05A 5F0XA 3WUHA 4B1XB 5HL7L 4LF7K 3O3FA 3ZX0A 2UYTA 4FOEA 2QXFA 1KAXA 1V4TA 4YDUA 3MXIA 2HHUA 2CH6A 3TWHA 3D0PA 1NJYA 2P9NA 1ASVA 3CQXA 1OH7A 1TV6A 4J2DA 2WOMA 2A41A 3AVBA 4RW4A 3HT3A 1QVFM 5AQUA 3CERA 4FLVA 2KZMA 5AZJA 3CC2N 3A2FA 2E4LA 4CHOA 4B3OA 1NU0A 2QWMA 2HVIA 4YFUA 4OPHA 2F9WA 4IFYA 4NCAA 1ZBHA 3TSPA 4QAGA 4FJ5A 4B1YB 3ZSZA 4CGIA 1WUAA 2P1JA 3MEGA 3V4IA 4K41A 1JXBA 1RT5A 3TAMA 4FW1A 4O0IA 3NCIA 3RR8A 3LP0A 4CK3A 4C8OA 4DTJA 1K8AO 1NGGA 1MWMA 3CC4N 4C1NK 3QICA 5J2MA 4R5PA 1RT1A 3L2RA 3A5MC 5JS2A 1WN7A 3O4QA 1V4SA 4B9TA 2HSTA 5HBMA 1N33K 1L3TA 4K42A 3MCPA 2A1SA 4FJLA 3ZT2A 4ELVA 1JLBA 2RF2A 4HCCA 4BGBA 4WFAL 2VWBA 3DLBA 4FXDA 5KGXA 1C1BA 2QW9A 3V1QA 2HB5A 2OA8A 1QE1A 3ZSYA 2YNHA 1VRUA 4N56A 3CETA 4FWRA 1SS6A 4CGFA 4CEEA 1QSYA 3QERA 2RHKA 1XNQK 1C1CA 1NJXA 3ZETB 2CH5A 3HYFA 4F2SA 3O08A 4JKFA 5BRDA 2E1ZA 3SUOA 4FWMA 2F8TA 4YOYA 2E2PA 4JKDA 4HCBA 4DFPA 3VA0A 4FJMA 3QEPA 4AF1A 3MDQA 1S1UA 1T6DA 2P9KA 2WTUA 4PQUA 1BU6O 1YJNN 1NGIA 3CXCM 5AJ3K 5KQDA 4JK7A 2FC0A 4DR4K 1VSFA 4PKGA 3I8DA 4CHZA 2BDPA 4NXMK 3LDSA 4BDZA 3A5OC 1S1XA 2GEMA 1IKXA 5GAGP 4DSLA 4CD3A 2YCHA 2PAVA 3DMJA 2QXLA 3U9ZA 2HHVA 4BE1A 4DTMA 2P9IA 4JK9A 1HR0K 1QSSA 4I9LA 4RWTA 3K0SA 3NFAA 3QFUA 4CGGA 3P83D 5F1XA 4A59A 3WNHA 1NGFA 3NF6A 5CR4A 2HHXA 2O8CA 5AQPA 1GLAG 2OCEA 1NGEA 1YTAA 1M1KO 3MEEA 3PO5A 2ASPA 2EWSA 4XEIA 3J81O 4PKIA 1JCGA 1U2VB 4A57A 3KIOA 4AM6A 2HBMA 1ZBLA 1XMQK 3L2UA 1HKGA 4CIEA 1WSFA 4I2QA 4GV3A 5DM7L 5AQTA 1TUYA 3ENBA 4YHHK 5AQOA 3C65A 1S5JA 4M3YA 4AILC 4BACA 5AQNA 3NAEA 3AO1A 1LAVA 4IDKA 4FJGA 4DTSA 2F7TA 5M1KA 3LP3A 4CEQA 4HTUA 2V51B 1VQON 2OPRA 3FZMA 3AVMA 4AHUA 2YI1A 3O9RA 4HHTA 5T7BA 4XH1A 3SMPA 4EAHD 1VQMN 5C2FA 1I94K 4ISFA 3T1YK 3AVIA 4GMJB 1QZ6A 5AQGA 1TKDA 4NYNA 3KLIA 2NRVA 4GV6A 3OTOK 5GADP 1KFDA 2JWKA 4HUGA 2VG7A 3DRSA 5SZTA 3VN5A 3HOSA 3D2FA 1IKVA 4DV3K 1BOTO 3NBPA 3OYJA 4JI3K 3DAWA 5AQWA 3N4PA 1YJ9N 4FK0A 5K14A 3TAEA 4E1NA 3ULEB 4E1JA 2G8FA 2O8EB 3TU5A 3E66A 1X1PA 1VSDA 4NXNK 4ILHA 4KHWA 3DYAA 2NUBA 3QLHA 4FPBA 1HKBA 2F4VK 3PY8A 5JVHL 2YKNA 4CJLA 5CYMA 4YOWA 3ISNC 3U6FA 3A0IX 2F9TA 1XI1A 3SQ4A 4UY8O 1ZC6A 2GUIA 3MX5A 3CPEA 3O3HA 4EZ9A 5E26A 2QWLA 1DT9A 3ZX2A 2GX9A 1XWLA 3CI5A 3VEWA 5DK5A 3C6TA 1WSEA 1NGDA 3VTIA 4B1ZA 5I3UA 4DR5K 1U45A 1BQMA 2O8DA 4ELTA 1BWFO 4JKHA 4E0DA 4O0JA 4CFAA 3JXUA 3SQ1A 2HNYA 2FF3B 2QI2A 1NOZA 3O3GA 4DFJA 5DM6L 3C6HA 2F8SA 3UKUB 1IBKK 4BG9A 2E5LK 3H45C 4FJHA 3C7NA 1EX4A 1RCHA 4PA1A 3BF1A 3LDPA 1LWFA 2A6AA 2XY5A 3RMBA 4JI2K 3G4SN 4CJ3A 5HRNA 4DF8A 2P9LB 3THXB 4I7FA 4FCYA 4QCLA 1SL2A 2UUAK 3AAPA 2UXCK 4WE1A 1TKTA 3D2EB 2A1RA 2ITGA 3H3OB 2DFHA 5TKYA 3HZ6A 1D8YA 3LAKA 2IC3A 1KXPA 2BE2A 2IDOA 3AVJA 3GL1A 3O8MA 3SCXA 1YITN 2OPSA 4DR3K 3CF5L 3O9TA 3MECA 3SZ2A 4DQQA 1DGKN 4JRQA 1NMNA 3PSIA 5HP1A 2GELA 4MO4A 1HYVA 2QWQA 4GKJK 3PSFA 2O4GA 2H3GX 4FWKA 3IAYA 4CEFA 4DTNA 4N41A 2NRHA 3WXMB 4CEOA 3LDOA 3OYMA 1GOBA 3ID8A 3K9JA 3CCEN 4CZIA 4E7KA 1VRTA 3L4QA 4NCGA 2HHHK 1VSMA 4DR7K 1QQMA 1VQPN 1WNSA 4BRLA 4WFBL 4AHVA 3AVCA 1XHZA 2BTFA 1CZAN 2O8FB 2HNDA 3M3ZA 5AQVA 3NGIA 4CECA 1HQEA 2ZJQL 1TL3A 1IJJA 4MDAA 4E19A 2FLOA 4CHNA 2JGUA 2HF3A 3L3UA 1UOCA 1RTDA 2FSKA 3T7ZA 3DWLA 3EL2A 4KH4A 2QWOA 3A5LC 3CFOA 2XY7A 3SUPA 1EWQA 3MAQA 3SQ2A 4CFBA 3D7EO 4O8UA 1VSLA 1S9EA 4JI8K 1GLJO 2DTUA 4M3TA 2YV0X 3C0BA 3ENHA 4IEIA 1S3XA 4ZTJA 4FLXA 2P9KB 3B8AX 3SPYA 3PX4A 3KJVA 3A8YA 3ZSWA 2YJFA 2OTJN 1YIJN 3DXMA 4CK2A 1QZ5A 1HYZA 3WQTA 4OKKA 1YI2N 3KK3A 1HJRA 1SUQA 2FBYA 1KFSA 3VEYA 3FE1A 1UWBA 1MU2A 4CJ4A 1GLEG 4L8RB 2O4IA 3RRGA 4CCHA 3VEZA 3BZCA 1ZBUA 3K5MA 2P9UB 4AH9A 4JV5K 2A3ZA 3HRGA 3VQPA 4CEZA 3IFRA 4H0OA 3EZWA 5AQKA 1NK5A 4M3RA 1T44A 5IT9O 1ESVA 3QFPA 2ZE2A 2E2QA 5JLHA 2WC9A 4KTWA 1K9MO 3QEVA 3QBWA 4JKEA 1TUUA 1IBLK 1S9GA 1RTIA 4LH5A 3OYIA 2KLAA 4M42A 1RTHA 3V9SA 1VQ8N 3H1VX 3CG7A 5D3GA 2P9PA 3I8BA 4DLEA 3TANA 4JI4K 4H4OA 4MO5A 4NYFA 4EP4A 1BG3A 1D9FA 3K57A 3LDNA 3PUFA 3HVTA 4QOZB 3BGRA 1BUPA 5JICA 5GINA 3OYLA 1RDAA 2BGGA 3ZSXA 2UUBK 1D5AA 3PIPL 3L2QA 3JSMA 3TARA 1SV5A 1RT6A 4LF4K 3KZBA 4IXCA 3VQDA 4CF8A 1ATRA 1ZXOA 4E7LA 2EHGA 3OYNA 3VGMA 4KHSA 3TAPA 3FZHA 1JLAA 1IBMK 4NCBA 4DR6K 2AA4A 4F8RA 4YOVA 4KH6A 3GE1A 4CJVA 1IKWA 3K9KA 5AZIA 4FZZA 3T1HK 4E7HA 1QQOA 2BH1A 4WQ4A 2UXDK 2VYPA 4FJ7A 4BRQA 2KZZA 1GLBG 3V1OA 4CGJA 2NRTA 4AHCA 2I7NA 4I2PA 4CJWA 1LW2A 4NLCA 4O8KA 3T1AA 4AHTA 3LP2A 2GWJA 4FVUA 2NRRA 4IJNA 4EZ6A 4Z4IA 2HVHA 3AA5X 1D4XA 3VERA 3DXKA 1NM1A 3P31A 4WQ4C 4CJRA 1Z6RA 2X6NA 4W5RA 4FJXA 2Z1GA 3U3GA 3FLCO 3LDLA 4DB3A 5KQ8A 3OYAA 2J4RA 3OY9A 3RMAA 3ZEUB 3QNNA 1VSHA 5C10A 2UU9K 3SAFA 4CZEA 4H5TA 4LF9K 2B5JA 5HRSA 4JKBA 2V52B 2XHBA 1EWRA 4BR9A 1VHXA 4KBOA 4K43A 2EX3A 2Z1JA 2RKIA 4E89A 2VGMA 4H4MA 3NGYA 4BQLA 1TGOA 1VSIA 3RSEB 5BR9A 3L3VA 2OYQA 4YOTA 3HI0A 3CJ7A 1KVCA 1KTQA 4KKOA 3HPHA 3S9HA 3SQ0A 5M1QA 1O13A 2E6LA 1RBUA 4CESA 4FZXC 1S22A 1HNIA 1BO5O 1L3UA 3CHWA 3ULEA 1LV5A 3O9QA 5ADXH 3B6PA 2YHXA 4DTUA 1ZBFA 4ILJA 4DS5A 3FZLA 3OS1A 1X9WA 5B8HA 4RCHA 2OANA 4A5AA 3VF4A 2YX6A 3S3NA 2A42A 4DUYK 4JI6K 2D5RA 1T05A 1UA1A 2E1YA 5LY3A 4AHSA 3LDQA 3UE5A 3V9XA 3D6RA 5KI6A 4RW9A 3MXMA 1T7PA 3S3OA 4JKAA 1JCFA 3M8PA 4AHRA 5E41A 2OZMA 4BGAA 4DSJA 4IG3A 2W6KA 4BDYA 1QQNA 4CZLA 5M1FA 1YF5L 3TAFA 3QEWA 3C6AA 3SPZA 4BC3A 1JLGA 4CJEA 3MEDA 2FSJA 2X78A 4KO0A 4O5BA 1OKJA 3THWA 3L8BA 3DLKA 4Q5VA 3CCVN 2X74A 1NKBA 3V1RA 2B4JA 5AQHA 3CCUN 3CMEN 4KPYA 5AQRA 4CZMA 5MLCQ 1BA0A 3M8QA 3HL8A 3L6QA 1RBVA 1YJWN 3CM5A 3EYZA 3HBTA 1NGJA 1ATSA
chains in the Genus database with same CATH topology
1RILA 4J2AA 2P51A 3QLHA 4FZYA 4KI4A 4CGDA 1A5VA 4CHQA 3V9WA 3DI6A 3PY8A 3KD1E 4W5QA 1RBTA 4B9UA 4YNQA 3AVHA 2YKNA 4CJLA 5CYMA 3TI0A 1ZYQA 3DOLA 3ISNC 3U6FA 1N5YA 1WAJA 2HW3A 2DFEA 3O4NA 1XI1A 3SQ4A 4C8KA 1C0TA 1RBRA 5KGWA 2Z1HA 5JS1A 2GUIA 1KVAA 1IKYA 4FLYA 1Z26A 3O3HA 2G8KA 1FK9A 2G8VA 4EZ9A 3U3YA 5HRRA 3NHGA 3MXJA 1XWLA 1BIUA 3LAMA 3UIQA 3QO9A 2KW4A 4FVMA 3VQEA 5DK5A 3H08A 3ZSVA 2ZQBA 1NOYA 3C6TA 3LZJA 4FJJA 2D0BA 5FRMA 1HRHA 1WSEA 2BANA 3VQ8A 3QIPA 5I3UA 3OJSA 2G8HA 1HPZA 3RMCA 3T3FA 1U45A 3CYMA 4KHQA 4KB1A 3LP1A 4JS5A 1BQMA 2YNFA 4Z4EA 4KTQA 4BE2A 4ELTA 3RRHA 4FLTA 1L3SA 4E0DA 3SV3A 4O0JA 4C8MA 3OYFA 3RMDA 4CFAA 4FJIA 1Y97A 2FBVA 4B9LA 3SQ1A 2YHAA 2HNYA 2HHSA 1IO2A 1NOZA 4N47A 3ALYA 3VQ9A 3O3GA 4DFJA 1R0AA 3HK2A 4CK1A 2PYLA 2VWJA 4FK2A 3QEIA 4B08A 1NK9A 2F8SA 1RT4A 1TAQA 3ZSQA 4DU3A 2HNZA 3ZSRA 3LANA 3JYTA 3KK2A 4FJHA 4B9NA 3DLGA 4M3WA 2ZD1A 5FROA 1LW0A 4CHYA 1EX4A 4K8ZA 1B9FA 1RCHA 5J1EA 4PA1A 4FM2A 1J5OA 4PUOA 4OLBA 3TR8A 3SUNA 3BDPA 1VSKA 4KV8A 1BQNA 1QQCA 3SI6A 1BISA 3TABA 1LWFA 4F4KA 3LWMA 2XY5A 3HVRA 1JL1A 3E01A 1KSPA 3SYZA 3DM2A 3ITHA 4C8NA 1I3AA 3G10A 3RMBA 3DRPA 4KB0A 1JLFA 2I5JA 3ZCMA 4CJKA 4E7IA 4DQRA 3VQAA 4CJ3A 2GBZA 5HRNA 2XY6A 1CXUA 3HXMA 4DF8A 3K5LA 1TK0A 2W42A 4I7FA 4FCYA 4QCLA 1SL2A 3K5NA 2P5OA 4Q0BA 3DRRA 3KKSA 1SL1A 1FXXA 1WLJA 4WE1A 2KQ2A 2D0CA 3VA3A 1TKTA 3OYCA 3CQ8A 1C0MA 4C8LA 4FJ8A 2A1RA 1U49A 1ITGA 2ITGA 4PY5A 2DFHA 1BI4B 3VQCA 1VSEA 1D8YA 4KHYA 3LAKA 2IC3A 2F96A 1Q9XA 3NH2A 4OKJA 4M3UA 2BE2A 1DTTA 3AVFA 2IDOA 3AVJA 2JLEA 3KK1A 3PX6A 1B9DA 4MFBA 3IRXA 4CHPA 3SCXA 2OPSA 2G8WA 4TSXA 3NH1A 3MECA 3SZ2A 4DQQA 3SNNA 3L2WA 3LPTA 4JRQA 5HP1A 3KLGA 3QESA 4OLAA 1HYVA 2YNGA 1L3VA 2O4GA 5KRTA 1GOAA 3IAYA 3AVGA 1JKHA 4CEFA 4CIGA 4DTNA 4JLHA 4N41A 4CEOA 3OYGA 4J2EA 3OYMA 5KRSA 4OGEA 2IGIA 4ICLA 4FM0A 1GOBA 2VG5A 1RDBA 3OS2A 4E7KA 3AA2A 3KLEA 4CEBA 1VRTA 4CF0A 4NCGA 1LWEA 1VSMA 4KRFA 3OS0A 5CZ1A 4M3XA 1WNSA 4FW2A 3THVA 2D0AA 4DLGA 4LSLA 4AHVA 5HLFA 3AVCA 4OKEA 4GW6A 4CF9A 1TAUA 1XHZA 1U47A 2HNDA 4KFBA 3C6UA 3NGIA 3IG1A 4CECA 3AVLA 1HQEA 3DLEA 3B6OA 2IAJA 4ZTFA 4DTRA 4FJ9A 1TL3A 4DSEA 4HUEA 4DG1A 4E19A 4CHNA 1S6PA 4CGHA 5J2QA 2JGUA 3HO1A 3L3UA 2VG6A 4LD0A 3VQ4A 2B6AA 1UOCA 3VQ5A 1S1TA 3AA4A 1RTDA 3ZT3A 3QNOA 3K2PA 3CM6A 4IFVA 4DSIA 1JXEA 3CFOA 2XY7A 3SUPA 5SWMA 3MAQA 5DMRA 3SQ2A 4CFBA 1XHXA 2XO7A 3AVNA 4DSKA 1VSLA 1S9EA 1W9HA 4GVMA 4N5SA 3HP6A 2DTUA 3P5JA 3RR7A 2QKKA 4KHUA 3F73A 4M3TA 1YTUA 1WAFA 2YV0X 3NGZA 1NK7A 1EXQA 1JLCA 4O44A 4FLXA 3LWLA 4DSFA 4ZTJA 4K8XA 3SPYA 3PX4A 2YHBA 2YNIA 3AVKA 3OYHA 4F3TA 3KJVA 1RT2A 1S6QA 1CZ9A 5EU7A 3ZSWA 4E3SA 3K58A 4FJKA 4CK2A 3KD5E 3I0SA 1BCMA 1UA0A 1HYZA 4RW8A 4OKKA 4KAZA 2KFNA 3KKRA 1VSJA 4CF1A 4CFCA 1BCOA 4RG8A 5C25A 3M8SA 3KK3A 1HJRA 1SUQA 2FBYA 1KFSA 4Z4FA 4M41A 3D45A 4CJ4A 1UWBA 1MU2A 3ASMA 4BWMA 4CF2A 4FM1A 4L8RB 1TL1A 2O4IA 2KTQA 3RRGA 3ZT4A 4CCHA 1QTMA 1L5UA 2ETJA 1ZBUA 4CERA 3K5MA 4AH9A 1I39A 1S1VA 4Z4CA 3K5OA 4Z4HA 3VQPA 4CEZA 2P5GA 4DU4A 4DTXA 4CJ5A 4IBNA 3KLHA 1K6YA 5C42A 2VWKA 1CZBA 3AO2A 2IS3A 4M3RA 1NK5A 3AV9A 3DLHA 3WNEA 4UQGA 1QHTA 4OGCA 3I0RA 1REVA 3V81A 1T03A 2ZE2A 1CLQA 3NF9A 2G8UA 1HMVA 2HHQA 4OJRA 3ULDA 3SUQA 1RTJA 4KTWA 1NK0A 3QEVA 3PO4A 1G15A 1KLMA 1W0HA 1S9GA 1RTIA 4G1QA 5HRPA 4LH5A 1NKCA 3OYIA 4E7JA 4Y1DA 3LZIA 2OZSA 3LALA 4DFKA 3HPOA 3O3FA 4M42A 1A5XA 4N76A 1J53A 1RTHA 1VK0A 3V9SA 3CFPA 2QXFA 1X9MA 4ELUA 1KCFA 1Z25A 4B9VA 3OYDA 1B92A 3MXIA 2HHUA 3TWHA 3D0PA 3CG7A 3L2VA 3NF7A 5CZ2A 1NJYA 3F9KA 1ASWA 4FJNA 1ASVA 5D3GA 1TV6A 4RW7A 4J2DA 2WOMA 3AVBA 4RW4A 2G8IA 3HT3A 4DLEA 3TANA 4LY7A 4MQ3A 1HNVA 4H4OA 4W5TA 3ZSOA 4FLVA 2KZMA 4NYFA 4EP4A 3A2FA 2E4LA 4CHOA 1D9FA 2X6SA 3HM9A 3VQBA 3K57A 5J2PA 4B3OA 2HVIA 5C24A 4YFUA 3PUFA 3M8RA 3HVTA 4QOZB 1NKEA 1WSGA 3BGRA 4IFYA 4O55A 4DTOA 1NK4A 4CJTA 4JRPA 3OYLA 1TK8A 3DLRA 4NCAA 1ZBHA 1RDAA 4B9SA 1BI4A 4QAGA 4FJ5A 3ZSXA 2BGGA 4CJUA 3ZSZA 1D5AA 5HROA 4CGIA 3EY1A 3V9ZA 2P1JA 3MEGA 3L2QA 3JSMA 3G0ZA 1C1AA 1SV5A 3TARA 2Q3SA 3V4IA 1RT6A 4FYDA 2QKBA 3TAGA 1SKSA 1JXBA 1RT5A 4DF4A 3TAMA 1C6VA 3OYEA 3VQDA 3NDKA 4FW1A 1J9AA 4CF8A 4O0IA 3NCIA 3NH0A 3LP0A 3RR8A 4RW6A 4CK3A 4C8OA 4DTJA 1WSIA 1XC9A 1IG9A 1NJWA 1QS4A 4E7LA 1C0UA 2EHGA 3OYNA 2QK9A 4KHSA 5J2MA 1SKWA 3TAPA 4R5PA 4EP5A 1JLAA 1RT1A 3L2RA 4M45A 2PZSA 4KREA 4NCBA 3NE6A 5JS2A 1WN7A 3O4QA 3RTVA 4B9TA 4F8RA 4ID1A 1LWCA 5HBMA 4FLWA 1L3TA 2Z1IA 4CJVA 1IKWA 4DWIA 4LSNA 2A1SA 4O4GA 1EETA 1GOCA 4FJLA 1KRPA 4FZZA 3ZT2A 1U04A 4E7HA 2WONA 1JLBA 1KVBA 4DU1A 4ELVA 2RF2A 4HCCA 4FJ7A 1TVRA 2KZZA 3OYBA 3V1OA 3DLBA 1RDDA 3T19A 5KGXA 4FXDA 1C1BA 4J2BA 2OPPA 4CGJA 3V1QA 2HB5A 3PX0A 1EKEA 1QE1A 3DOKA 4Y1CA 3ZSYA 4AHCA 3S3MA 2OA8A 2YNHA 1VRUA 4N56A 4I2PA 1SKRA 1LW2A 1A5WA 1ASUA 3T1AA 4CJWA 4OPJA 2DY4A 1JLEA 4AHTA 4CGFA 1SL0A 2XRIA 4CEEA 4W5OA 1QSYA 3LP2A 3QERA 5CY4A 4KTZA 1NK8A 4F2RA 4EZ6A 1C1CA 1O1WA 4Z4IA 1NJXA 2HMIA 3VQ7A 1HYSA 3HYFA 4F2SA 4DQIA 2E6MA 2RPIA 2HVHA 2RN2A 4CEDA 3AA5X 3SUOA 1QSLA 2HHTA 2F8TA 4HCBA 4ID5A 4CJRA 4DFPA 2X6NA 4H8KA 3VA0A 4W5RA 4FJMA 3QEPA 3OYKA 1RBSA 4FJXA 1S1UA 2Z1GA 3U3GA 3AVAA 1DLOA 4PWDA 3OYAA 3OY9A 4PQUA 5KTQA 5FRNA 3RMAA 3QNNA 4I9QA 1VSHA 4DTPA 3V9UA 4FLUA 5J2NA 2HHWA 4M3ZA 3QINA 1NJZA 2B5JA 5HRSA 2FC0A 2XHBA 1VSFA 3I8DA 1F21A 1TKXA 4CHZA 2BDPA 3FFIA 4IG0A 3LDSA 3CFRA 4BDZA 2EX3A 2Z1JA 3HSTB 1FKOA 2RKIA 4E89A 1RT3A 1S1XA 2AJQA 4E1MA 4H4MA 1IKXA 1T8EA 3NGYA 1RNHA 1JL2A 1WSJA 2Y1JA 4DSLA 1JLQA 1TGOA 1VSIA 3DMJA 4CEAA 3VQQA 2HHVA 4BE1A 4DTMA 5I42A 4CJSA 1QSSA 3L3VA 4I9LA 2OYQA 3HPGA 2YKMA 4BWJA 1KVCA 5CYQA 2R7YA 1KTQA 4KKOA 3NFAA 3HPHA 1WSHA 3WNFA 3P83D 4CGGA 3S9HA 1D9DA 1CXQA 3AA3A 1X9SA 3KLFA 3EZ5A 3SQ0A 4Z4GA 3WNHA 3HJFA 2E6LA 1J54A 1RBUA 1YT3A 4LH4A 3OJUA 3NF6A 2ATQA 3PV8A 4CESA 4CFDA 3TAQA 4KI6A 1BL3A 2HHXA 3OVNA 4FZXC 4CIFA 1YTAA 4OPKA 4W5NA 1HNIA 2OPQA 4B9MA 3MEEA 1L3UA 3PO5A 3C95A 1LV5A 3LPUA 2Y1IA 4CJFA 3B6PA 4DTUA 1RT7A 3KIOA 1ZBFA 1FKPA 3NF8A 3WNGA 4JS4A 3OS1A 4DS5A 4BDPA 2FBTA 3QIOA 2FBXA 3L2UA 1ZBLA 1U4BA 1U48A 1X9WA 4F3OA 4CIEA 1WSFA 1Q8IA 1TKZA 3HP9A 3S3NA 2PYJA 4I2QA 1DTQA 3KTQA 4KHNA 2GV9A 3ZT0A 2PY5A 2D5RA 4CJPA 1UA1A 1T05A 3C94A 4AHSA 1EP4A 1S5JA 1NK6A 4M3YA 4HVJA 3V9XA 4BACA 3K59A 5KI6A 4AILC 4RW9A 3VQ6A 3NAEA 3AO1A 4DFMA 1LAVA 3MXMA 1T7PA 3S3OA 1UAXA 4IDKA 4FJGA 4DQPA 4DMNA 3M8PA 4AHRA 5E41A 4BE0A 4DTSA 2OZMA 4FK4A 3LP3A 4CEQA 4HTUA 4DSJA 2OPRA 4AHUA 3AVMA 4IG3A 4DS4A 3V6DA 1LAWA 4B8AB 4HHTA 4BDYA 3AO5A 5T7BA 1Q9YA 4IKFA 3SJJA 4Z0UA 2DFFA 3AVIA 4GMJB 4HUFA 3AO3A 1TKDA 3TAFA 4NYNA 3QEWA 2IOCA 3AO4A 4ZHRA 3KLIA 3SPZA 1IH7A 3IS9A 1JLGA 3SV4A 1ZBIA 4CJEA 1KFDA 4HUGA 3MEDA 2X78A 1BHLA 4KO0A 4O5BA 2VG7A 3DRSA 1YVUA 4XIUA 1TK5A 5SZTA 3L8BA 2XY8A 3VN5A 3DLKA 1N6QA 4Q5VA 3RWUA 1IKVA 4CE9A 3QEXA 2KFZA 1KLNA 3NBPA 3OYJA 2X74A 1BGXT 1NKBA 3V1RA 1BIZA 2B4JA 4B8CA 4KPYA 1HQUA 4OVLA 4FK0A 4DQSA 5K14A 3TAEA 4E1NA 2LSNA 1RDCA 3M8QA 3P1GA 3QETA 3HL8A 2G8FA 4CJQA 1RBVA 1VSDA 1X1PA 3ZT1A 3CM5A 4KHWA 5FDLA 3DYAA 3EYZA 2NUBA 1S1WA 4FLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIL A;  4J2A A;  2P51 A;  3QLH A;  4FZY A;  4KI4 A;  4CGD A;  1A5V A;  4CHQ A;  3V9W A;  3DI6 A;  3PY8 A;  3KD1 E;  4W5Q A;  1RBT A;  4B9U A;  4YNQ A;  3AVH A;  2YKN A;  4CJL A;  5CYM A;  3TI0 A;  1ZYQ A;  3DOL A;  3ISN C;  3U6F A;  1N5Y A;  1WAJ A;  2HW3 A;  2DFE A;  3O4N A;  1XI1 A;  3SQ4 A;  4C8K A;  1C0T A;  1RBR A;  5KGW A;  2Z1H A;  5JS1 A;  2GUI A;  1KVA A;  1IKY A;  4FLY A;  1Z26 A;  3O3H A;  2G8K A;  1FK9 A;  2G8V A;  4EZ9 A;  3U3Y A;  5HRR A;  3NHG A;  3MXJ A;  1XWL A;  1BIU A;  3LAM A;  3UIQ A;  3QO9 A;  2KW4 A;  4FVM A;  3VQE A;  5DK5 A;  3H08 A;  3ZSV A;  2ZQB A;  1NOY A;  3C6T A;  3LZJ A;  4FJJ A;  2D0B A;  5FRM A;  1HRH A;  1WSE A;  2BAN A;  3VQ8 A;  3QIP A;  5I3U A;  3OJS A;  2G8H A;  1HPZ A;  3RMC A;  3T3F A;  1U45 A;  3CYM A;  4KHQ A;  4KB1 A;  3LP1 A;  4JS5 A;  1BQM A;  2YNF A;  4Z4E A;  4KTQ A;  4BE2 A;  4ELT A;  3RRH A;  4FLT A;  1L3S A;  4E0D A;  3SV3 A;  4O0J A;  4C8M A;  3OYF A;  3RMD A;  4CFA A;  4FJI A;  1Y97 A;  2FBV A;  4B9L A;  3SQ1 A;  2YHA A;  2HNY A;  2HHS A;  1IO2 A;  1NOZ A;  4N47 A;  3ALY A;  3VQ9 A;  3O3G A;  4DFJ A;  1R0A A;  3HK2 A;  4CK1 A;  2PYL A;  2VWJ A;  4FK2 A;  3QEI A;  4B08 A;  1NK9 A;  2F8S A;  1RT4 A;  1TAQ A;  3ZSQ A;  4DU3 A;  2HNZ A;  3ZSR A;  3LAN A;  3JYT A;  3KK2 A;  4FJH A;  4B9N A;  3DLG A;  4M3W A;  2ZD1 A;  5FRO A;  1LW0 A;  4CHY A;  1EX4 A;  4K8Z A;  1B9F A;  1RCH A;  5J1E A;  4PA1 A;  4FM2 A;  1J5O A;  4PUO A;  4OLB A;  3TR8 A;  3SUN A;  3BDP A;  1VSK A;  4KV8 A;  1BQN A;  1QQC A;  3SI6 A;  1BIS A;  3TAB A;  1LWF A;  4F4K A;  3LWM A;  2XY5 A;  3HVR A;  1JL1 A;  3E01 A;  1KSP A;  3SYZ A;  3DM2 A;  3ITH A;  4C8N A;  1I3A A;  3G10 A;  3RMB A;  3DRP A;  4KB0 A;  1JLF A;  2I5J A;  3ZCM A;  4CJK A;  4E7I A;  4DQR A;  3VQA A;  4CJ3 A;  2GBZ A;  5HRN A;  2XY6 A;  1CXU A;  3HXM A;  4DF8 A;  3K5L A;  1TK0 A;  2W42 A;  4I7F A;  4FCY A;  4QCL A;  1SL2 A;  3K5N A;  2P5O A;  4Q0B A;  3DRR A;  3KKS A;  1SL1 A;  1FXX A;  1WLJ A;  4WE1 A;  2KQ2 A;  2D0C A;  3VA3 A;  1TKT A;  3OYC A;  3CQ8 A;  1C0M A;  4C8L A;  4FJ8 A;  2A1R A;  1U49 A;  1ITG A;  2ITG A;  4PY5 A;  2DFH A;  1BI4 B;  3VQC A;  1VSE A;  1D8Y A;  4KHY A;  3LAK A;  2IC3 A;  2F96 A;  1Q9X A;  3NH2 A;  4OKJ A;  4M3U A;  2BE2 A;  1DTT A;  3AVF A;  2IDO A;  3AVJ A;  2JLE A;  3KK1 A;  3PX6 A;  1B9D A;  4MFB A;  3IRX A;  4CHP A;  3SCX A;  2OPS A;  2G8W A;  4TSX A;  3NH1 A;  3MEC A;  3SZ2 A;  4DQQ A;  3SNN A;  3L2W A;  3LPT A;  4JRQ A;  5HP1 A;  3KLG A;  3QES A;  4OLA A;  1HYV A;  2YNG A;  1L3V A;  2O4G A;  5KRT A;  1GOA A;  3IAY A;  3AVG A;  1JKH A;  4CEF A;  4CIG A;  4DTN A;  4JLH A;  4N41 A;  4CEO A;  3OYG A;  4J2E A;  3OYM A;  5KRS A;  4OGE A;  2IGI A;  4ICL A;  4FM0 A;  1GOB A;  2VG5 A;  1RDB A;  3OS2 A;  4E7K A;  3AA2 A;  3KLE A;  4CEB A;  1VRT A;  4CF0 A;  4NCG A;  1LWE A;  1VSM A;  4KRF A;  3OS0 A;  5CZ1 A;  4M3X A;  1WNS A;  4FW2 A;  3THV A;  2D0A A;  4DLG A;  4LSL A;  4AHV A;  5HLF A;  3AVC A;  4OKE A;  4GW6 A;  4CF9 A;  1TAU A;  1XHZ A;  1U47 A;  2HND A;  4KFB A;  3C6U A;  3NGI A;  3IG1 A;  4CEC A;  3AVL A;  1HQE A;  3DLE A;  3B6O A;  2IAJ A;  4ZTF A;  4DTR A;  4FJ9 A;  1TL3 A;  4DSE A;  4HUE A;  4DG1 A;  4E19 A;  4CHN A;  1S6P A;  4CGH A;  5J2Q A;  2JGU A;  3HO1 A;  3L3U A;  2VG6 A;  4LD0 A;  3VQ4 A;  2B6A A;  1UOC A;  3VQ5 A;  1S1T A;  3AA4 A;  1RTD A;  3ZT3 A;  3QNO A;  3K2P A;  3CM6 A;  4IFV A;  4DSI A;  1JXE A;  3CFO A;  2XY7 A;  3SUP A;  5SWM A;  3MAQ A;  5DMR A;  3SQ2 A;  4CFB A;  1XHX A;  2XO7 A;  3AVN A;  4DSK A;  1VSL A;  1S9E A;  1W9H A;  4GVM A;  4N5S A;  3HP6 A;  2DTU A;  3P5J A;  3RR7 A;  2QKK A;  4KHU A;  3F73 A;  4M3T A;  1YTU A;  1WAF A;  2YV0 X;  3NGZ A;  1NK7 A;  1EXQ A;  1JLC A;  4O44 A;  4FLX A;  3LWL A;  4DSF A;  4ZTJ A;  4K8X A;  3SPY A;  3PX4 A;  2YHB A;  2YNI A;  3AVK A;  3OYH A;  4F3T A;  3KJV A;  1RT2 A;  1S6Q A;  1CZ9 A;  5EU7 A;  3ZSW A;  4E3S A;  3K58 A;  4FJK A;  4CK2 A;  3KD5 E;  3I0S A;  1BCM A;  1UA0 A;  1HYZ A;  4RW8 A;  4OKK A;  4KAZ A;  2KFN A;  3KKR A;  1VSJ A;  4CF1 A;  4CFC A;  1BCO A;  4RG8 A;  5C25 A;  3M8S A;  3KK3 A;  1HJR A;  1SUQ A;  2FBY A;  1KFS A;  4Z4F A;  4M41 A;  3D45 A;  4CJ4 A;  1UWB A;  1MU2 A;  3ASM A;  4BWM A;  4CF2 A;  4FM1 A;  4L8R B;  1TL1 A;  2O4I A;  2KTQ A;  3RRG A;  3ZT4 A;  4CCH A;  1QTM A;  1L5U A;  2ETJ A;  1ZBU A;  4CER A;  3K5M A;  4AH9 A;  1I39 A;  1S1V A;  4Z4C A;  3K5O A;  4Z4H A;  3VQP A;  4CEZ A;  2P5G A;  4DU4 A;  4DTX A;  4CJ5 A;  4IBN A;  3KLH A;  1K6Y A;  5C42 A;  2VWK A;  1CZB A;  3AO2 A;  2IS3 A;  4M3R A;  1NK5 A;  3AV9 A;  3DLH A;  3WNE A;  4UQG A;  1QHT A;  4OGC A;  3I0R A;  1REV A;  3V81 A;  1T03 A;  2ZE2 A;  1CLQ A;  3NF9 A;  2G8U A;  1HMV A;  2HHQ A;  4OJR A;  3ULD A;  3SUQ A;  1RTJ A;  4KTW A;  1NK0 A;  3QEV A;  3PO4 A;  1G15 A;  1KLM A;  1W0H A;  1S9G A;  1RTI A;  4G1Q A;  5HRP A;  4LH5 A;  1NKC A;  3OYI A;  4E7J A;  4Y1D A;  3LZI A;  2OZS A;  3LAL A;  4DFK A;  3HPO A;  3O3F A;  4M42 A;  1A5X A;  4N76 A;  1J53 A;  1RTH A;  1VK0 A;  3V9S A;  3CFP A;  2QXF A;  1X9M A;  4ELU A;  1KCF A;  1Z25 A;  4B9V A;  3OYD A;  1B92 A;  3MXI A;  2HHU A;  3TWH A;  3D0P A;  3CG7 A;  3L2V A;  3NF7 A;  5CZ2 A;  1NJY A;  3F9K A;  1ASW A;  4FJN A;  1ASV A;  5D3G A;  1TV6 A;  4RW7 A;  4J2D A;  2WOM A;  3AVB A;  4RW4 A;  2G8I A;  3HT3 A;  4DLE A;  3TAN A;  4LY7 A;  4MQ3 A;  1HNV A;  4H4O A;  4W5T A;  3ZSO A;  4FLV A;  2KZM A;  4NYF A;  4EP4 A;  3A2F A;  2E4L A;  4CHO A;  1D9F A;  2X6S A;  3HM9 A;  3VQB A;  3K57 A;  5J2P A;  4B3O A;  2HVI A;  5C24 A;  4YFU A;  3PUF A;  3M8R A;  3HVT A;  4QOZ B;  1NKE A;  1WSG A;  3BGR A;  4IFY A;  4O55 A;  4DTO A;  1NK4 A;  4CJT A;  4JRP A;  3OYL A;  1TK8 A;  3DLR A;  4NCA A;  1ZBH A;  1RDA A;  4B9S A;  1BI4 A;  4QAG A;  4FJ5 A;  3ZSX A;  2BGG A;  4CJU A;  3ZSZ A;  1D5A A;  5HRO A;  4CGI A;  3EY1 A;  3V9Z A;  2P1J A;  3MEG A;  3L2Q A;  3JSM A;  3G0Z A;  1C1A A;  1SV5 A;  3TAR A;  2Q3S A;  3V4I A;  1RT6 A;  4FYD A;  2QKB A;  3TAG A;  1SKS A;  1JXB A;  1RT5 A;  4DF4 A;  3TAM A;  1C6V A;  3OYE A;  3VQD A;  3NDK A;  4FW1 A;  1J9A A;  4CF8 A;  4O0I A;  3NCI A;  3NH0 A;  3LP0 A;  3RR8 A;  4RW6 A;  4CK3 A;  4C8O A;  4DTJ A;  1WSI A;  1XC9 A;  1IG9 A;  1NJW A;  1QS4 A;  4E7L A;  1C0U A;  2EHG A;  3OYN A;  2QK9 A;  4KHS A;  5J2M A;  1SKW A;  3TAP A;  4R5P A;  4EP5 A;  1JLA A;  1RT1 A;  3L2R A;  4M45 A;  2PZS A;  4KRE A;  4NCB A;  3NE6 A;  5JS2 A;  1WN7 A;  3O4Q A;  3RTV A;  4B9T A;  4F8R A;  4ID1 A;  1LWC A;  5HBM A;  4FLW A;  1L3T A;  2Z1I A;  4CJV A;  1IKW A;  4DWI A;  4LSN A;  2A1S A;  4O4G A;  1EET A;  1GOC A;  4FJL A;  1KRP A;  4FZZ A;  3ZT2 A;  1U04 A;  4E7H A;  2WON A;  1JLB A;  1KVB A;  4DU1 A;  4ELV A;  2RF2 A;  4HCC A;  4FJ7 A;  1TVR A;  2KZZ A;  3OYB A;  3V1O A;  3DLB A;  1RDD A;  3T19 A;  5KGX A;  4FXD A;  1C1B A;  4J2B A;  2OPP A;  4CGJ A;  3V1Q A;  2HB5 A;  3PX0 A;  1EKE A;  1QE1 A;  3DOK A;  4Y1C A;  3ZSY A;  4AHC A;  3S3M A;  2OA8 A;  2YNH A;  1VRU A;  4N56 A;  4I2P A;  1SKR A;  1LW2 A;  1A5W A;  1ASU A;  3T1A A;  4CJW A;  4OPJ A;  2DY4 A;  1JLE A;  4AHT A;  4CGF A;  1SL0 A;  2XRI A;  4CEE A;  4W5O A;  1QSY A;  3LP2 A;  3QER A;  5CY4 A;  4KTZ A;  1NK8 A;  4F2R A;  4EZ6 A;  1C1C A;  1O1W A;  4Z4I A;  1NJX A;  2HMI A;  3VQ7 A;  1HYS A;  3HYF A;  4F2S A;  4DQI A;  2E6M A;  2RPI A;  2HVH A;  2RN2 A;  4CED A;  3AA5 X;  3SUO A;  1QSL A;  2HHT A;  2F8T A;  4HCB A;  4ID5 A;  4CJR A;  4DFP A;  2X6N A;  4H8K A;  3VA0 A;  4W5R A;  4FJM A;  3QEP A;  3OYK A;  1RBS A;  4FJX A;  1S1U A;  2Z1G A;  3U3G A;  3AVA A;  1DLO A;  4PWD A;  3OYA A;  3OY9 A;  4PQU A;  5KTQ A;  5FRN A;  3RMA A;  3QNN A;  4I9Q A;  1VSH A;  4DTP A;  3V9U A;  4FLU A;  5J2N A;  2HHW A;  4M3Z A;  3QIN A;  1NJZ A;  2B5J A;  5HRS A;  2FC0 A;  2XHB A;  1VSF A;  3I8D A;  1F21 A;  1TKX A;  4CHZ A;  2BDP A;  3FFI A;  4IG0 A;  3LDS A;  3CFR A;  4BDZ A;  2EX3 A;  2Z1J A;  3HST B;  1FKO A;  2RKI A;  4E89 A;  1RT3 A;  1S1X A;  2AJQ A;  4E1M A;  4H4M A;  1IKX A;  1T8E A;  3NGY A;  1RNH A;  1JL2 A;  1WSJ A;  2Y1J A;  4DSL A;  1JLQ A;  1TGO A;  1VSI A;  3DMJ A;  4CEA A;  3VQQ A;  2HHV A;  4BE1 A;  4DTM A;  5I42 A;  4CJS A;  1QSS A;  3L3V A;  4I9L A;  2OYQ A;  3HPG A;  2YKM A;  4BWJ A;  1KVC A;  5CYQ A;  2R7Y A;  1KTQ A;  4KKO A;  3NFA A;  3HPH A;  1WSH A;  3WNF A;  3P83 D;  4CGG A;  3S9H A;  1D9D A;  1CXQ A;  3AA3 A;  1X9S A;  3KLF A;  3EZ5 A;  3SQ0 A;  4Z4G A;  3WNH A;  3HJF A;  2E6L A;  1J54 A;  1RBU A;  1YT3 A;  4LH4 A;  3OJU A;  3NF6 A;  2ATQ A;  3PV8 A;  4CES A;  4CFD A;  3TAQ A;  4KI6 A;  1BL3 A;  2HHX A;  3OVN A;  4FZX C;  4CIF A;  1YTA A;  4OPK A;  4W5N A;  1HNI A;  2OPQ A;  4B9M A;  3MEE A;  1L3U A;  3PO5 A;  3C95 A;  1LV5 A;  3LPU A;  2Y1I A;  4CJF A;  3B6P A;  4DTU A;  1RT7 A;  3KIO A;  1ZBF A;  1FKP A;  3NF8 A;  3WNG A;  4JS4 A;  3OS1 A;  4DS5 A;  4BDP A;  2FBT A;  3QIO A;  2FBX A;  3L2U A;  1ZBL A;  1U4B A;  1U48 A;  1X9W A;  4F3O A;  4CIE A;  1WSF A;  1Q8I A;  1TKZ A;  3HP9 A;  3S3N A;  2PYJ A;  4I2Q A;  1DTQ A;  3KTQ A;  4KHN A;  2GV9 A;  3ZT0 A;  2PY5 A;  2D5R A;  4CJP A;  1UA1 A;  1T05 A;  3C94 A;  4AHS A;  1EP4 A;  1S5J A;  1NK6 A;  4M3Y A;  4HVJ A;  3V9X A;  4BAC A;  3K59 A;  5KI6 A;  4AIL C;  4RW9 A;  3VQ6 A;  3NAE A;  3AO1 A;  4DFM A;  1LAV A;  3MXM A;  1T7P A;  3S3O A;  1UAX A;  4IDK A;  4FJG A;  4DQP A;  4DMN A;  3M8P A;  4AHR A;  5E41 A;  4BE0 A;  4DTS A;  2OZM A;  4FK4 A;  3LP3 A;  4CEQ A;  4HTU A;  4DSJ A;  2OPR A;  4AHU A;  3AVM A;  4IG3 A;  4DS4 A;  3V6D A;  1LAW A;  4B8A B;  4HHT A;  4BDY A;  3AO5 A;  5T7B A;  1Q9Y A;  4IKF A;  3SJJ A;  4Z0U A;  2DFF A;  3AVI A;  4GMJ B;  4HUF A;  3AO3 A;  1TKD A;  3TAF A;  4NYN A;  3QEW A;  2IOC A;  3AO4 A;  4ZHR A;  3KLI A;  3SPZ A;  1IH7 A;  3IS9 A;  1JLG A;  3SV4 A;  1ZBI A;  4CJE A;  1KFD A;  4HUG A;  3MED A;  2X78 A;  1BHL A;  4KO0 A;  4O5B A;  2VG7 A;  3DRS A;  1YVU A;  4XIU A;  1TK5 A;  5SZT A;  3L8B A;  2XY8 A;  3VN5 A;  3DLK A;  1N6Q A;  4Q5V A;  3RWU A;  1IKV A;  4CE9 A;  3QEX A;  2KFZ A;  1KLN A;  3NBP A;  3OYJ A;  2X74 A;  1BGX T;  1NKB A;  3V1R A;  1BIZ A;  2B4J A;  4B8C A;  4KPY A;  1HQU A;  4OVL A;  4FK0 A;  4DQS A;  5K14 A;  3TAE A;  4E1N A;  2LSN A;  1RDC A;  3M8Q A;  3P1G A;  3QET A;  3HL8 A;  2G8F A;  4CJQ A;  1RBV A;  1VSD A;  1X1P A;  3ZT1 A;  3CM5 A;  4KHW A;  5FDL A;  3DYA A;  3EYZ A;  2NUB A;  1S1W A;  4FLZ A; 
#chains in the Genus database with same CATH topology
 1RIL A;  2P51 A;  2ITM A;  1KD1 O;  4KI4 A;  3TSU A;  5BR8 K;  5AFU A;  3KD1 E;  4W5Q A;  1RBT A;  2Q36 A;  2HW3 A;  4BRP A;  3N4Q A;  4BG8 A;  4C8K A;  1Q81 O;  1KVA A;  1IKY A;  4FWO A;  1Z26 A;  1KQS M;  2PBD A;  2G8V A;  4LF6 K;  3U3Y A;  5ADX A;  5F2R A;  1K73 O;  3NHG A;  3MXJ A;  3T69 A;  3PLA A;  1BIU A;  3LAM A;  3QO9 A;  3VEN A;  1HJO A;  4FJJ A;  3ZSV A;  1NOY A;  3AGK A;  3VQ8 A;  1NGH A;  3ZET A;  3JS6 A;  4BRH A;  4JS5 A;  2YNF A;  3RRH A;  4FLT A;  1L3S A;  1RFQ A;  2O8B A;  4C8M A;  4JKG A;  3RMD A;  4FJI A;  3O1B A;  4BR0 A;  2FBV A;  2ZWH A;  4DCH A;  1HNZ K;  3ALY A;  2PYL A;  2VWJ A;  3QEI A;  1NK9 A;  4A5B A;  3ZSQ A;  5AQQ A;  3EO3 A;  1J6Z A;  4B9N A;  3DLG A;  4M3W A;  2ZD1 A;  1LW0 A;  4K8Z A;  4B1W B;  1P8Z A;  3W0L A;  3SUN A;  3BDP A;  1VSK A;  1QQC A;  3SI6 A;  1BIS A;  2Q97 A;  3M6G A;  3HVR A;  4H0T B;  1KSP A;  5E84 A;  4BR4 A;  4C8N A;  3G10 A;  1SAZ A;  4DQR A;  2I5J A;  4E7I A;  2E2N A;  1FJG K;  3VEO A;  4Q0B A;  3UKU A;  4A2A A;  1SL1 A;  4JHD A;  1WLJ A;  2KQ2 A;  2ASO A;  3OYC A;  4PY5 A;  1ITG A;  2IVP A;  4KHY A;  1VQK N;  3NH2 A;  1VQ4 N;  4OKJ A;  1DTT A;  3KK1 A;  4MFB A;  3SMS A;  2G8W A;  1NNE A;  4BRI A;  3SNN A;  4LC9 B;  5C0Y A;  4CZG A;  3QES A;  3KVG A;  5KRT A;  1GOA A;  3CCS N;  3AVG A;  1JKH A;  4CIG A;  1VQ9 N;  2FSN A;  4JLH A;  3OYG A;  4J2E A;  4NO7 A;  4OGE A;  2IGI A;  4FM0 A;  5FPD A;  1RDB A;  4LFA K;  3KLE A;  3TPQ A;  5AQJ A;  5CZ1 A;  4M3X A;  4IOA L;  4CBU A;  4CF9 A;  5BPL A;  1TAU A;  4YY3 K;  3WT0 A;  3IG1 A;  3AVL A;  3DLE A;  4CD1 A;  3B6O A;  4GVE A;  2IAJ A;  3WXI A;  4DG1 A;  1S6P A;  3HO1 A;  2VG6 A;  2NNW A;  3VQ5 A;  1LCU A;  3AA4 A;  4JD2 A;  2AP1 A;  2ZJP L;  3CM6 A;  4IFV A;  4WQ5 C;  4DSI A;  5SWM A;  5DMR A;  4DSK A;  1HLU A;  4N5S A;  4YOU A;  4IOX A;  5LMU K;  3KWI A;  4DKW A;  3NGZ A;  4DV7 K;  4FOI A;  4O44 A;  4G9Z A;  3H6E A;  2YNI A;  4A2B A;  4GV9 A;  3MK6 A;  4FJK A;  4E3S A;  3I0S A;  1UA0 A;  4RW8 A;  2KFN A;  3IKM A;  1VQ7 N;  2CGL A;  1NJI O;  5C25 A;  2CGJ A;  1WBB A;  3UKR A;  3L4I A;  4BWM A;  3P39 A;  2KTQ A;  3LM2 A;  1L5U A;  1KC8 O;  4BRM A;  5BPN A;  3OA9 A;  3K5O A;  3I33 A;  2P5G A;  2DPN A;  4CJ5 A;  5C12 A;  3AO2 A;  2IS3 A;  1NLV A;  1QHT A;  4OGC A;  3I0R A;  1REV A;  4CW7 B;  3NF9 A;  1HMV A;  4B9Q A;  4OJR A;  4X65 K;  2P9S B;  1E4G T;  1KLM A;  4U67 L;  4G1Q A;  4H0X B;  5HRP A;  2OZS A;  1NKC A;  4FJN A;  3LAL A;  4DFK A;  2UUC K;  3CJB A;  1VK0 A;  1X9M A;  4ELU A;  4B9V A;  3OYD A;  4M63 C;  2D0O A;  5GAE P;  4X64 K;  3VOV A;  3NF7 A;  5CZ2 A;  3F9K A;  3CCJ N;  4C1N I;  5A2Q O;  3SJH A;  4BR5 A;  2G8I A;  4BC5 A;  4LY7 A;  4MQ3 A;  1JCE A;  4CZH A;  4DV0 K;  3MN7 A;  3ZSO A;  2E8A A;  3HTV A;  4HWI A;  4U7B A;  2X6S A;  3MN9 A;  3SBT A;  3VEX A;  3HM9 A;  5C24 A;  4FWP A;  4O55 A;  4DR2 K;  1TK8 A;  4DV6 K;  2HF4 A;  3EY1 A;  3G0Z A;  1C1A A;  2Q3S A;  2QKB A;  3DXK B;  1SKS A;  1C6V A;  3NDK A;  3NH0 A;  3R1X A;  1RGI A;  4IWV A;  4DV4 K;  4EHU A;  1WSI A;  3ZEU A;  1QS4 A;  1C0U A;  2QK9 A;  1SQK A;  4EP5 A;  4KRE A;  3EE9 A;  4X66 K;  4FLW A;  4DWI A;  1GOC A;  1KRP A;  4LF5 K;  1KVB A;  4JI5 K;  1VQN N;  3VTH A;  4EIA A;  3T19 A;  3U9D A;  3PIO L;  4L3Q A;  2OPP A;  3F9M A;  3PX0 A;  1EKE A;  3DOK A;  4Y1C A;  3CMA N;  1EO1 A;  1TYQ A;  1SKR A;  1A5W A;  2V7Y A;  2DY4 A;  3MWP A;  1JLE A;  3F5T A;  4W5O A;  3DJC A;  4F2R A;  3VET A;  2HMI A;  5AQL A;  1HYS A;  2NZT A;  3RVC A;  2E6M A;  3CC7 N;  2RN2 A;  2QWP A;  4QS7 A;  3ZX3 A;  1QSL A;  2HHT A;  3DXM B;  2NRZ A;  5LMN K;  4LFB K;  2FXU A;  1MDU B;  2O8F A;  4DTP A;  5J2N A;  3AAR A;  5BRH A;  4M3Z A;  3QIN A;  1X9J A;  1XNR K;  1QVG M;  2ZGZ A;  3FFI A;  3CFR A;  3VEV A;  1FKO A;  3OBY A;  2AJQ A;  4E1M A;  4GNI A;  4H5N A;  4ISE A;  1T8E A;  2Y1J A;  1WSJ A;  1XMO K;  1JLQ A;  1N34 K;  2WUS A;  5I42 A;  4CJS A;  4BRK A;  3MN5 A;  4H5W A;  2Q1N A;  2YKM A;  2W40 A;  1WSH A;  3WNF A;  4PKH A;  3IMX A;  2P9U A;  1CXQ A;  3KLF A;  3SLC A;  3HJF A;  2FF6 A;  3I55 N;  1YT3 A;  3O5B A;  3OJU A;  3PV8 A;  4CFD A;  3TAQ A;  1BL3 A;  4CIF A;  4W5N A;  3LL3 A;  2OPQ A;  4B9M A;  3O9S A;  3UKR B;  2OTL N;  3LPU A;  2Y1I A;  4JS4 A;  1S72 N;  2FBT A;  3QIO A;  1H1V A;  2FBX A;  4F3O A;  1Q8I A;  1TKZ A;  3HP9 A;  5BN8 A;  2PYJ A;  3KTQ A;  4V19 S;  3ZT0 A;  2PY5 A;  1GLC G;  3U8X A;  3C94 A;  1EP4 A;  1FW6 A;  4HVJ A;  3K59 A;  2QM1 A;  4H5V A;  4DFM A;  1UAX A;  4BRG A;  4FK4 A;  4DV2 K;  4OX9 K;  1Q18 A;  4JD2 B;  3V6D A;  4B8A B;  3AO5 A;  4IKF A;  2DFF A;  4HUF A;  4O5F A;  5H1S Q;  4JYA K;  5C15 A;  3GG4 A;  3QBX A;  2YHY A;  2IOC A;  3AO4 A;  3QML A;  4BRD A;  4HTL A;  1IH7 A;  3L0Q A;  3IS9 A;  1ZBI A;  5AQY A;  1BHL A;  4K25 A;  1N6Q A;  2HOE A;  3RWU A;  3QEX A;  2KFZ A;  1KLN A;  2QEX N;  4QS9 A;  1ZBS A;  4B8C A;  1HQU A;  4DQS A;  1RDC A;  1C0F A;  3P1G A;  4CJQ A;  5AQS A;  1HX1 A;  3ZT1 A;  2WBN A;  3H1Q A;  1S1W A;  4AQY K;  2A40 A;  4H0Y B;  4J2A A;  4FZY A;  2HMP A;  4CGD A;  2A5X A;  4CHQ A;  3V9W A;  3DI6 A;  1OH6 A;  5EX5 A;  4B9U A;  4YNQ A;  1ZYQ A;  3TI0 A;  3A5N C;  1HKC A;  3AY9 A;  4Z94 A;  1N5Y A;  3O4N A;  1E4F T;  1X3N A;  2HBL A;  3CD6 N;  1YHQ N;  2Z1H A;  3MN6 A;  4IFE A;  4BVP A;  1FK9 A;  1YXQ A;  4JHD B;  2QWR A;  1J5E K;  4RTF D;  1WOQ A;  5EOY A;  1K8K A;  3VQE A;  5FRM A;  2ZQB A;  3LZJ A;  2D0B A;  1HRH A;  2D4W A;  3QIP A;  1YAG A;  3OJS A;  2G8H A;  3RMC A;  4KHQ A;  3T3F A;  3CYM A;  4KB1 A;  3LP1 A;  4Z4E A;  3Q7C A;  3CCR N;  4KTQ A;  4IZ9 A;  4FL9 A;  3SV3 A;  4DQ8 A;  3W3D A;  2VGN A;  3FFK B;  1Y97 A;  5FPN A;  4WCE L;  5BRE A;  2YHA A;  1MWK A;  2HHS A;  4CK1 A;  2VCP A;  4B08 A;  3O6W A;  1RT4 A;  4DU3 A;  3HSC A;  2HNZ A;  3ZSR A;  3JYT A;  2D0P A;  5HOO A;  2P9I B;  3CJC A;  3TTD A;  5FRO A;  1B9F A;  3E9L A;  4FM2 A;  4OLB A;  3TR8 A;  3R9P A;  4B1V A;  1BQN A;  2ZF5 O;  3TAB A;  2P9S A;  1JL1 A;  3E01 A;  2JWL A;  2NRW A;  1Y64 A;  3VF2 A;  1I3A A;  1WBD A;  3CCQ N;  2VQE K;  4KB0 A;  3ZCM A;  4CJK A;  1CXU A;  3HXM A;  3K5L A;  1TK0 A;  1EQY A;  4BC4 A;  1W7A A;  2P5O A;  1FXX A;  4IDH A;  2D0C A;  3VA3 A;  3GBT A;  3CQ8 A;  4FJ8 A;  1U49 A;  2GWK A;  1IV0 A;  1BI4 B;  4B1U B;  3VQC A;  4JN4 A;  1Q9X A;  4KH5 A;  5BN9 A;  4JI0 K;  5LJV A;  3HOT A;  3CQY A;  3AVF A;  3BF3 A;  4H5R A;  2JLE A;  3PX6 A;  3L2W A;  5AR0 A;  4IO8 A;  1E3M A;  2YNG A;  1L3V A;  3GDQ A;  2ZJR L;  3MMV A;  3G25 A;  5KRS A;  1G99 A;  4ICL A;  4YDU C;  3ATU A;  3OS2 A;  1NBW A;  4CEB A;  1KAZ A;  4KRF A;  1VAZ A;  4FW2 A;  2D0A A;  5HLF A;  4OKE A;  1DKG D;  1W2B M;  4GW6 A;  5KPT A;  1U47 A;  3J80 O;  4KFB A;  1OVY A;  4I6M B;  4FJ9 A;  3DLL L;  4HUE A;  2IVN A;  2QA4 N;  3VQ4 A;  4LD0 A;  4WYB A;  3FZF A;  1MA9 B;  3ZT3 A;  5GIP A;  3LM9 A;  1XHX A;  3AVN A;  3AGR A;  1YUW A;  3HP6 A;  4XH5 A;  5JMV A;  3MX2 A;  2QKK A;  1BDG A;  3RR7 A;  3F73 A;  1YTU A;  1WAF A;  1EXQ A;  1JLC A;  4DSF A;  3LWL A;  3NMU A;  3D2F B;  1RT2 A;  1S6Q A;  3K58 A;  1XQS C;  3O1W A;  3FGU A;  4KAZ A;  3KKR A;  1VSJ A;  4CF1 A;  1BCO A;  2GUP A;  4Z4F A;  4JI1 K;  4BVO A;  3SAG A;  2YJE A;  3BUZ B;  4YOX A;  3ZT4 A;  4QS8 A;  1QTM A;  1NGA A;  1S1V A;  4Z4C A;  5FPE A;  4DTX A;  1NMD A;  3KLH A;  1K6Y A;  5C42 A;  1CZB A;  3R6M A;  3AV9 A;  4UQG A;  1T03 A;  1CLQ A;  3ULD A;  3SUQ A;  1NK0 A;  3PO4 A;  5FLX O;  1G15 A;  4CZF A;  4OPA A;  3O80 A;  1W0H A;  4H0V B;  4E7J A;  4Y1D A;  3LZI A;  3CJ9 A;  3HPO A;  1A5X A;  4N76 A;  3SAH A;  1J53 A;  3CFP A;  1KCF A;  1Z25 A;  4BRE A;  1B92 A;  5I9E B;  3BEX A;  1OVQ A;  2IIR A;  3L2V A;  1ASW A;  1R59 O;  3QDK A;  3CJA A;  4RW7 A;  3S41 A;  3Q7B A;  1HNV A;  2GTD A;  1HPM A;  3J8A A;  4H0P A;  3VGL A;  4DR1 K;  4W5T A;  4ISG A;  5KPR A;  3VQB A;  5J2P A;  3M8R A;  4X62 K;  3MWT A;  1NKE A;  4B3T K;  1WSG A;  4WFN L;  4DTO A;  1U6Z A;  3M1F A;  4CJT A;  4JRP A;  1NK4 A;  3DLR A;  3VGK A;  4B9S A;  1BI4 A;  4CJU A;  5HRO A;  3V9Z A;  5AZI B;  3IUC A;  3CCL N;  4FYD A;  3TAG A;  4CZK A;  4DF4 A;  4Y0W A;  2QWN A;  3OYE A;  2ZM6 K;  1J9A A;  4RW6 A;  4H03 B;  2P9N B;  1XC9 A;  1GLL O;  1IG9 A;  1NJW A;  3J7Y P;  3ATV A;  4CJ7 A;  3M5R A;  4BR7 A;  1SKW A;  2WFB A;  4M45 A;  2PZS A;  3NE6 A;  3RTV A;  4ID1 A;  1LWC A;  3VF6 A;  2KHO A;  2Z1I A;  4IOC L;  4LSN A;  4O4G A;  1EET A;  3I56 N;  1U04 A;  2WON A;  4JK8 A;  4DU1 A;  4A62 A;  3VMF B;  2HBK A;  3G71 N;  1TVR A;  3OYB A;  3FZK A;  1RDD A;  1YVN A;  4M7Y A;  3GOI A;  4J2B A;  3S3M A;  4R79 A;  4WQ5 A;  3WQU A;  4OPJ A;  1ASU A;  4MDB A;  2Q0U A;  1SL0 A;  2XRI A;  5CY4 A;  4KTZ A;  5AQX A;  1NK8 A;  1C0G A;  1O1W A;  1W97 L;  3VQ7 A;  4DQI A;  2RPI A;  3G6E N;  4CED A;  4B3R K;  1K8K B;  4ID5 A;  1XC3 A;  4PL8 A;  2Q31 A;  3EN9 A;  4H8K A;  3OYK A;  1RBS A;  1U2V A;  1TYQ B;  2E88 A;  1DLO A;  3AVA A;  3CJ1 A;  5M1O A;  4PWD A;  3JAM O;  3E1Y A;  2IVO A;  5KTQ A;  5FRN A;  2VQF K;  4I9Q A;  1NGC A;  3V9U A;  4F9O A;  2E2O A;  4FLU A;  1NG9 A;  1RDU A;  2HHW A;  1NJZ A;  3D2E A;  1HNW K;  1F21 A;  3BZK A;  1TKX A;  4JKG B;  4IG0 A;  3HST B;  1RT3 A;  4LFC K;  1Q7Y O;  1LOT B;  1RNH A;  1JL2 A;  3EKS A;  4JEP A;  4CEA A;  3VQQ A;  4OO1 J;  3WXK A;  4FPA A;  1OH5 A;  3HPG A;  1KAY A;  1NGB A;  4BWJ A;  5CYQ A;  2R7Y A;  3WXL A;  3ID6 A;  1D9D A;  1X9S A;  3AA3 A;  3EZ5 A;  3SBG A;  1BA1 A;  4Z4G A;  4FWN A;  1J54 A;  3P4I A;  4LH4 A;  4KI6 A;  2ATQ A;  3OVN A;  1X3M A;  5GIO A;  4OPK A;  3R8E A;  1VQL N;  3C95 A;  4CJF A;  4XH4 A;  1RT7 A;  1FKP A;  3NF8 A;  3WNG A;  3VES A;  4BDP A;  2NLX A;  4CZJ A;  1U4B A;  1U48 A;  3OBW A;  1T3V A;  4MLH A;  1GLD G;  4KHN A;  1DTQ A;  3QB0 A;  3KWG A;  2GV9 A;  4CJP A;  4CVN E;  3H3N O;  1NK6 A;  3VQ6 A;  5EXW A;  1N32 K;  1N8R O;  4DQP A;  4DMN A;  4BE0 A;  3HM8 A;  2W6L A;  4FWS A;  1HNX K;  4DS4 A;  4DUZ K;  1LAW A;  5EVZ A;  1Q9Y A;  3SJJ A;  2CGK A;  4Z0U A;  3AO3 A;  3RSE A;  5AQI A;  4ZHR A;  4JKC A;  3SV4 A;  4EHT A;  3THY B;  1VQ6 N;  1TK5 A;  1YVU A;  4XIU A;  2XY8 A;  5FPM A;  2Q2R A;  4CE9 A;  1BGX T;  3ZLJ A;  1BIZ A;  4BC2 A;  1DEJ A;  4OVL A;  1N36 K;  3WXJ A;  2LSN A;  3QET A;  4J8F A;  3WEE B;  3R3L A;  5FDL A;  3CPW M;  3J7Z O;  5EY4 A;  5GAH P;  4FLZ A;  5KPZ A;  3TTF A;  3BY5 A;  3NVM A;  1A5V A;  3TSQ A;  3AVH A;  3NVK A;  2Q0R A;  3DOL A;  5C2D A;  1WAJ A;  2DFE A;  5AQF A;  5M1P A;  4BRA A;  2O8D B;  1C0T A;  5AFU H;  1RBR A;  5KGW A;  5JS1 A;  4K0K K;  5IWA K;  4FLY A;  2BUP A;  2G8K A;  2KKZ A;  3TTC A;  5HRR A;  3OW2 M;  1IG8 A;  4BQZ A;  3UIQ A;  2KW4 A;  4FVM A;  3THX A;  3FR0 A;  3H08 A;  5AQM A;  2BAN A;  2I7P A;  4PL7 A;  1HPZ A;  5JVG L;  4BR2 A;  5CHI A;  4BE2 A;  3THW B;  3U4L A;  3OYF A;  1SZ2 A;  4NLB A;  4B9L A;  3EE8 A;  1IO2 A;  4N47 A;  3IDH A;  3VQ9 A;  1R0A A;  3HK2 A;  3WEE A;  4DHY A;  4FK2 A;  4B3M K;  1TAQ A;  4GKK K;  3LAN A;  3KK2 A;  5LL6 Z;  3F2K A;  4M7X A;  1VQ5 N;  4CHY A;  5J1E A;  4PUO A;  1J5O A;  5ELZ A;  1JJ2 M;  4KV8 A;  5M1N A;  4F4K A;  3LWM A;  2O8E A;  4JI7 K;  4BRN A;  3SYZ A;  2UXB K;  3DM2 A;  3ITH A;  3DRP A;  1ILY A;  1JLF A;  3VQA A;  2GBZ A;  3EKU A;  2XY6 A;  2W42 A;  1WB9 A;  2V7Z A;  3K5N A;  1ATN A;  3DRR A;  3KKS A;  3O4W A;  2O8C B;  4C8L A;  1C0M A;  4GY2 B;  4WF9 L;  2E20 A;  1VSE A;  2F96 A;  3O9U A;  3UB5 A;  4ILG B;  3ZYY X;  3BP8 A;  4M3U A;  1T6C A;  1B9D A;  3IRX A;  4CHP A;  4C23 A;  4TSX A;  3NH1 A;  2YHW A;  4KHP K;  3LPT A;  3CCM N;  3KLG A;  4OLA A;  1RDW X;  4BRF A;  4LF8 K;  4FWL A;  2QTD A;  3SK3 A;  1QHA A;  4CBW A;  1Q82 O;  3AAQ A;  4PHT X;  2VG5 A;  4YOR A;  4MLE A;  3EEQ A;  3AA2 A;  4CF0 A;  5BRF A;  1LWE A;  3OS0 A;  3THV A;  4DLG A;  4LSL A;  4BRC A;  4CBX A;  5BPM A;  3C7N B;  3C6U A;  4BY9 C;  4ZTF A;  4DTR A;  4DSE A;  2P9L A;  4CGH A;  5J2Q A;  1GLF O;  5TKW A;  1NWK A;  2B6A A;  1XUP O;  2HBJ A;  1S1T A;  3CIP A;  3E9P A;  4DV5 K;  4IO9 L;  3QNO A;  2W41 A;  3K2P A;  4FSV A;  1JXE A;  4EFH A;  3THY A;  5AQZ A;  2XO7 A;  3P38 A;  4JNE A;  4IJA A;  1W9H A;  4GVM A;  3P5J A;  1HUX A;  4KHU A;  4AM7 A;  3KHY A;  1NK7 A;  4K8X A;  2ZGY A;  2YHB A;  3E9O A;  3AVK A;  3OYH A;  4F3T A;  3OHR A;  4B3S K;  1CZ9 A;  5EU7 A;  3KD5 E;  1BCM A;  2NRX A;  4CFC A;  1M90 O;  4RG8 A;  3M8S A;  2P9P B;  4M41 A;  3KK7 A;  5LJW A;  3D45 A;  4CI6 A;  3ASM A;  4FM1 A;  3VPZ A;  4CF2 A;  1TL1 A;  3H46 O;  5JLF A;  4FWQ A;  2PFU A;  5AZJ B;  2ETJ A;  4I6M A;  4CER A;  1I39 A;  4IEE A;  4Z4H A;  2O8B B;  4DU4 A;  4IBN A;  4NB4 A;  2VWK A;  3DLH A;  1Q86 O;  1P90 A;  3WNE A;  3V81 A;  4A61 A;  3MCA B;  2G8U A;  2HHQ A;  3ENO A;  4JAX A;  1RTJ A;  2ASM A;  3J7A P;  1OH8 A;  4DV1 K;  2D1K A;  4BRO A;  5CE3 A;  2RE2 A;  4FO0 A;  1Z05 A;  5F0X A;  3WUH A;  4B1X B;  5HL7 L;  4LF7 K;  3O3F A;  3ZX0 A;  2UYT A;  4FOE A;  2QXF A;  1KAX A;  1V4T A;  4YDU A;  3MXI A;  2HHU A;  2CH6 A;  3TWH A;  3D0P A;  1NJY A;  2P9N A;  1ASV A;  3CQX A;  1OH7 A;  1TV6 A;  4J2D A;  2WOM A;  2A41 A;  3AVB A;  4RW4 A;  3HT3 A;  1QVF M;  5AQU A;  3CER A;  4FLV A;  2KZM A;  5AZJ A;  3CC2 N;  3A2F A;  2E4L A;  4CHO A;  4B3O A;  1NU0 A;  2QWM A;  2HVI A;  4YFU A;  4OPH A;  2F9W A;  4IFY A;  4NCA A;  1ZBH A;  3TSP A;  4QAG A;  4FJ5 A;  4B1Y B;  3ZSZ A;  4CGI A;  1WUA A;  2P1J A;  3MEG A;  3V4I A;  4K41 A;  1JXB A;  1RT5 A;  3TAM A;  4FW1 A;  4O0I A;  3NCI A;  3RR8 A;  3LP0 A;  4CK3 A;  4C8O A;  4DTJ A;  1K8A O;  1NGG A;  1MWM A;  3CC4 N;  4C1N K;  3QIC A;  5J2M A;  4R5P A;  1RT1 A;  3L2R A;  3A5M C;  5JS2 A;  1WN7 A;  3O4Q A;  1V4S A;  4B9T A;  2HST A;  5HBM A;  1N33 K;  1L3T A;  4K42 A;  3MCP A;  2A1S A;  4FJL A;  3ZT2 A;  4ELV A;  1JLB A;  2RF2 A;  4HCC A;  4BGB A;  4WFA L;  2VWB A;  3DLB A;  4FXD A;  5KGX A;  1C1B A;  2QW9 A;  3V1Q A;  2HB5 A;  2OA8 A;  1QE1 A;  3ZSY A;  2YNH A;  1VRU A;  4N56 A;  3CET A;  4FWR A;  1SS6 A;  4CGF A;  4CEE A;  1QSY A;  3QER A;  2RHK A;  1XNQ K;  1C1C A;  1NJX A;  3ZET B;  2CH5 A;  3HYF A;  4F2S A;  3O08 A;  4JKF A;  5BRD A;  2E1Z A;  3SUO A;  4FWM A;  2F8T A;  4YOY A;  2E2P A;  4JKD A;  4HCB A;  4DFP A;  3VA0 A;  4FJM A;  3QEP A;  4AF1 A;  3MDQ A;  1S1U A;  1T6D A;  2P9K A;  2WTU A;  4PQU A;  1BU6 O;  1YJN N;  1NGI A;  3CXC M;  5AJ3 K;  5KQD A;  4JK7 A;  2FC0 A;  4DR4 K;  1VSF A;  4PKG A;  3I8D A;  4CHZ A;  2BDP A;  4NXM K;  3LDS A;  4BDZ A;  3A5O C;  1S1X A;  2GEM A;  1IKX A;  5GAG P;  4DSL A;  4CD3 A;  2YCH A;  2PAV A;  3DMJ A;  2QXL A;  3U9Z A;  2HHV A;  4BE1 A;  4DTM A;  2P9I A;  4JK9 A;  1HR0 K;  1QSS A;  4I9L A;  4RWT A;  3K0S A;  3NFA A;  3QFU A;  4CGG A;  3P83 D;  5F1X A;  4A59 A;  3WNH A;  1NGF A;  3NF6 A;  5CR4 A;  2HHX A;  2O8C A;  5AQP A;  1GLA G;  2OCE A;  1NGE A;  1YTA A;  1M1K O;  3MEE A;  3PO5 A;  2ASP A;  2EWS A;  4XEI A;  3J81 O;  4PKI A;  1JCG A;  1U2V B;  4A57 A;  3KIO A;  4AM6 A;  2HBM A;  1ZBL A;  1XMQ K;  3L2U A;  1HKG A;  4CIE A;  1WSF A;  4I2Q A;  4GV3 A;  5DM7 L;  5AQT A;  1TUY A;  3ENB A;  4YHH K;  5AQO A;  3C65 A;  1S5J A;  4M3Y A;  4AIL C;  4BAC A;  5AQN A;  3NAE A;  3AO1 A;  1LAV A;  4IDK A;  4FJG A;  4DTS A;  2F7T A;  5M1K A;  3LP3 A;  4CEQ A;  4HTU A;  2V51 B;  1VQO N;  2OPR A;  3FZM A;  3AVM A;  4AHU A;  2YI1 A;  3O9R A;  4HHT A;  5T7B A;  4XH1 A;  3SMP A;  4EAH D;  1VQM N;  5C2F A;  1I94 K;  4ISF A;  3T1Y K;  3AVI A;  4GMJ B;  1QZ6 A;  5AQG A;  1TKD A;  4NYN A;  3KLI A;  2NRV A;  4GV6 A;  3OTO K;  5GAD P;  1KFD A;  2JWK A;  4HUG A;  2VG7 A;  3DRS A;  5SZT A;  3VN5 A;  3HOS A;  3D2F A;  1IKV A;  4DV3 K;  1BOT O;  3NBP A;  3OYJ A;  4JI3 K;  3DAW A;  5AQW A;  3N4P A;  1YJ9 N;  4FK0 A;  5K14 A;  3TAE A;  4E1N A;  3ULE B;  4E1J A;  2G8F A;  2O8E B;  3TU5 A;  3E66 A;  1X1P A;  1VSD A;  4NXN K;  4ILH A;  4KHW A;  3DYA A;  2NUB A;  3QLH A;  4FPB A;  1HKB A;  2F4V K;  3PY8 A;  5JVH L;  2YKN A;  4CJL A;  5CYM A;  4YOW A;  3ISN C;  3U6F A;  3A0I X;  2F9T A;  1XI1 A;  3SQ4 A;  4UY8 O;  1ZC6 A;  2GUI A;  3MX5 A;  3CPE A;  3O3H A;  4EZ9 A;  5E26 A;  2QWL A;  1DT9 A;  3ZX2 A;  2GX9 A;  1XWL A;  3CI5 A;  3VEW A;  5DK5 A;  3C6T A;  1WSE A;  1NGD A;  3VTI A;  4B1Z A;  5I3U A;  4DR5 K;  1U45 A;  1BQM A;  2O8D A;  4ELT A;  1BWF O;  4JKH A;  4E0D A;  4O0J A;  4CFA A;  3JXU A;  3SQ1 A;  2HNY A;  2FF3 B;  2QI2 A;  1NOZ A;  3O3G A;  4DFJ A;  5DM6 L;  3C6H A;  2F8S A;  3UKU B;  1IBK K;  4BG9 A;  2E5L K;  3H45 C;  4FJH A;  3C7N A;  1EX4 A;  1RCH A;  4PA1 A;  3BF1 A;  3LDP A;  1LWF A;  2A6A A;  2XY5 A;  3RMB A;  4JI2 K;  3G4S N;  4CJ3 A;  5HRN A;  4DF8 A;  2P9L B;  3THX B;  4I7F A;  4FCY A;  4QCL A;  1SL2 A;  2UUA K;  3AAP A;  2UXC K;  4WE1 A;  1TKT A;  3D2E B;  2A1R A;  2ITG A;  3H3O B;  2DFH A;  5TKY A;  3HZ6 A;  1D8Y A;  3LAK A;  2IC3 A;  1KXP A;  2BE2 A;  2IDO A;  3AVJ A;  3GL1 A;  3O8M A;  3SCX A;  1YIT N;  2OPS A;  4DR3 K;  3CF5 L;  3O9T A;  3MEC A;  3SZ2 A;  4DQQ A;  1DGK N;  4JRQ A;  1NMN A;  3PSI A;  5HP1 A;  2GEL A;  4MO4 A;  1HYV A;  2QWQ A;  4GKJ K;  3PSF A;  2O4G A;  2H3G X;  4FWK A;  3IAY A;  4CEF A;  4DTN A;  4N41 A;  2NRH A;  3WXM B;  4CEO A;  3LDO A;  3OYM A;  1GOB A;  3ID8 A;  3K9J A;  3CCE N;  4CZI A;  4E7K A;  1VRT A;  3L4Q A;  4NCG A;  2HHH K;  1VSM A;  4DR7 K;  1QQM A;  1VQP N;  1WNS A;  4BRL A;  4WFB L;  4AHV A;  3AVC A;  1XHZ A;  2BTF A;  1CZA N;  2O8F B;  2HND A;  3M3Z A;  5AQV A;  3NGI A;  4CEC A;  1HQE A;  2ZJQ L;  1TL3 A;  1IJJ A;  4MDA A;  4E19 A;  2FLO A;  4CHN A;  2JGU A;  2HF3 A;  3L3U A;  1UOC A;  1RTD A;  2FSK A;  3T7Z A;  3DWL A;  3EL2 A;  4KH4 A;  2QWO A;  3A5L C;  3CFO A;  2XY7 A;  3SUP A;  1EWQ A;  3MAQ A;  3SQ2 A;  4CFB A;  3D7E O;  4O8U A;  1VSL A;  1S9E A;  4JI8 K;  1GLJ O;  2DTU A;  4M3T A;  2YV0 X;  3C0B A;  3ENH A;  4IEI A;  1S3X A;  4ZTJ A;  4FLX A;  2P9K B;  3B8A X;  3SPY A;  3PX4 A;  3KJV A;  3A8Y A;  3ZSW A;  2YJF A;  2OTJ N;  1YIJ N;  3DXM A;  4CK2 A;  1QZ5 A;  1HYZ A;  3WQT A;  4OKK A;  1YI2 N;  3KK3 A;  1HJR A;  1SUQ A;  2FBY A;  1KFS A;  3VEY A;  3FE1 A;  1UWB A;  1MU2 A;  4CJ4 A;  1GLE G;  4L8R B;  2O4I A;  3RRG A;  4CCH A;  3VEZ A;  3BZC A;  1ZBU A;  3K5M A;  2P9U B;  4AH9 A;  4JV5 K;  2A3Z A;  3HRG A;  3VQP A;  4CEZ A;  3IFR A;  4H0O A;  3EZW A;  5AQK A;  1NK5 A;  4M3R A;  1T44 A;  5IT9 O;  1ESV A;  3QFP A;  2ZE2 A;  2E2Q A;  5JLH A;  2WC9 A;  4KTW A;  1K9M O;  3QEV A;  3QBW A;  4JKE A;  1TUU A;  1IBL K;  1S9G A;  1RTI A;  4LH5 A;  3OYI A;  2KLA A;  4M42 A;  1RTH A;  3V9S A;  1VQ8 N;  3H1V X;  3CG7 A;  5D3G A;  2P9P A;  3I8B A;  4DLE A;  3TAN A;  4JI4 K;  4H4O A;  4MO5 A;  4NYF A;  4EP4 A;  1BG3 A;  1D9F A;  3K57 A;  3LDN A;  3PUF A;  3HVT A;  4QOZ B;  3BGR A;  1BUP A;  5JIC A;  5GIN A;  3OYL A;  1RDA A;  2BGG A;  3ZSX A;  2UUB K;  1D5A A;  3PIP L;  3L2Q A;  3JSM A;  3TAR A;  1SV5 A;  1RT6 A;  4LF4 K;  3KZB A;  4IXC A;  3VQD A;  4CF8 A;  1ATR A;  1ZXO A;  4E7L A;  2EHG A;  3OYN A;  3VGM A;  4KHS A;  3TAP A;  3FZH A;  1JLA A;  1IBM K;  4NCB A;  4DR6 K;  2AA4 A;  4F8R A;  4YOV A;  4KH6 A;  3GE1 A;  4CJV A;  1IKW A;  3K9K A;  5AZI A;  4FZZ A;  3T1H K;  4E7H A;  1QQO A;  2BH1 A;  4WQ4 A;  2UXD K;  2VYP A;  4FJ7 A;  4BRQ A;  2KZZ A;  1GLB G;  3V1O A;  4CGJ A;  2NRT A;  4AHC A;  2I7N A;  4I2P A;  4CJW A;  1LW2 A;  4NLC A;  4O8K A;  3T1A A;  4AHT A;  3LP2 A;  2GWJ A;  4FVU A;  2NRR A;  4IJN A;  4EZ6 A;  4Z4I A;  2HVH A;  3AA5 X;  1D4X A;  3VER A;  3DXK A;  1NM1 A;  3P31 A;  4WQ4 C;  4CJR A;  1Z6R A;  2X6N A;  4W5R A;  4FJX A;  2Z1G A;  3U3G A;  3FLC O;  3LDL A;  4DB3 A;  5KQ8 A;  3OYA A;  2J4R A;  3OY9 A;  3RMA A;  3ZEU B;  3QNN A;  1VSH A;  5C10 A;  2UU9 K;  3SAF A;  4CZE A;  4H5T A;  4LF9 K;  2B5J A;  5HRS A;  4JKB A;  2V52 B;  2XHB A;  1EWR A;  4BR9 A;  1VHX A;  4KBO A;  4K43 A;  2EX3 A;  2Z1J A;  2RKI A;  4E89 A;  2VGM A;  4H4M A;  3NGY A;  4BQL A;  1TGO A;  1VSI A;  3RSE B;  5BR9 A;  3L3V A;  2OYQ A;  4YOT A;  3HI0 A;  3CJ7 A;  1KVC A;  1KTQ A;  4KKO A;  3HPH A;  3S9H A;  3SQ0 A;  5M1Q A;  1O13 A;  2E6L A;  1RBU A;  4CES A;  4FZX C;  1S22 A;  1HNI A;  1BO5 O;  1L3U A;  3CHW A;  3ULE A;  1LV5 A;  3O9Q A;  5ADX H;  3B6P A;  2YHX A;  4DTU A;  1ZBF A;  4ILJ A;  4DS5 A;  3FZL A;  3OS1 A;  1X9W A;  5B8H A;  4RCH A;  2OAN A;  4A5A A;  3VF4 A;  2YX6 A;  3S3N A;  2A42 A;  4DUY K;  4JI6 K;  2D5R A;  1T05 A;  1UA1 A;  2E1Y A;  5LY3 A;  4AHS A;  3LDQ A;  3UE5 A;  3V9X A;  3D6R A;  5KI6 A;  4RW9 A;  3MXM A;  1T7P A;  3S3O A;  4JKA A;  1JCF A;  3M8P A;  4AHR A;  5E41 A;  2OZM A;  4BGA A;  4DSJ A;  4IG3 A;  2W6K A;  4BDY A;  1QQN A;  4CZL A;  5M1F A;  1YF5 L;  3TAF A;  3QEW A;  3C6A A;  3SPZ A;  4BC3 A;  1JLG A;  4CJE A;  3MED A;  2FSJ A;  2X78 A;  4KO0 A;  4O5B A;  1OKJ A;  3THW A;  3L8B A;  3DLK A;  4Q5V A;  3CCV N;  2X74 A;  1NKB A;  3V1R A;  2B4J A;  5AQH A;  3CCU N;  3CME N;  4KPY A;  5AQR A;  4CZM A;  5MLC Q;  1BA0 A;  3M8Q A;  3HL8 A;  3L6Q A;  1RBV A;  1YJW N;  3CM5 A;  3EYZ A;  3HBT A;  1NGJ A;  1ATS A; 
#chains in the Genus database with same CATH homology
 1RIL A;  4J2A A;  2P51 A;  3QLH A;  4FZY A;  4KI4 A;  4CGD A;  1A5V A;  4CHQ A;  3V9W A;  3DI6 A;  3PY8 A;  3KD1 E;  4W5Q A;  1RBT A;  4B9U A;  4YNQ A;  3AVH A;  2YKN A;  4CJL A;  5CYM A;  3TI0 A;  1ZYQ A;  3DOL A;  3ISN C;  3U6F A;  1N5Y A;  1WAJ A;  2HW3 A;  2DFE A;  3O4N A;  1XI1 A;  3SQ4 A;  4C8K A;  1C0T A;  1RBR A;  5KGW A;  2Z1H A;  5JS1 A;  2GUI A;  1KVA A;  1IKY A;  4FLY A;  1Z26 A;  3O3H A;  2G8K A;  1FK9 A;  2G8V A;  4EZ9 A;  3U3Y A;  5HRR A;  3NHG A;  3MXJ A;  1XWL A;  1BIU A;  3LAM A;  3UIQ A;  3QO9 A;  2KW4 A;  4FVM A;  3VQE A;  5DK5 A;  3H08 A;  3ZSV A;  2ZQB A;  1NOY A;  3C6T A;  3LZJ A;  4FJJ A;  2D0B A;  5FRM A;  1HRH A;  1WSE A;  2BAN A;  3VQ8 A;  3QIP A;  5I3U A;  3OJS A;  2G8H A;  1HPZ A;  3RMC A;  3T3F A;  1U45 A;  3CYM A;  4KHQ A;  4KB1 A;  3LP1 A;  4JS5 A;  1BQM A;  2YNF A;  4Z4E A;  4KTQ A;  4BE2 A;  4ELT A;  3RRH A;  4FLT A;  1L3S A;  4E0D A;  3SV3 A;  4O0J A;  4C8M A;  3OYF A;  3RMD A;  4CFA A;  4FJI A;  1Y97 A;  2FBV A;  4B9L A;  3SQ1 A;  2YHA A;  2HNY A;  2HHS A;  1IO2 A;  1NOZ A;  4N47 A;  3ALY A;  3VQ9 A;  3O3G A;  4DFJ A;  1R0A A;  3HK2 A;  4CK1 A;  2PYL A;  2VWJ A;  4FK2 A;  3QEI A;  4B08 A;  1NK9 A;  2F8S A;  1RT4 A;  1TAQ A;  3ZSQ A;  4DU3 A;  2HNZ A;  3ZSR A;  3LAN A;  3JYT A;  3KK2 A;  4FJH A;  4B9N A;  3DLG A;  4M3W A;  2ZD1 A;  5FRO A;  1LW0 A;  4CHY A;  1EX4 A;  4K8Z A;  1B9F A;  1RCH A;  5J1E A;  4PA1 A;  4FM2 A;  1J5O A;  4PUO A;  4OLB A;  3TR8 A;  3SUN A;  3BDP A;  1VSK A;  4KV8 A;  1BQN A;  1QQC A;  3SI6 A;  1BIS A;  3TAB A;  1LWF A;  4F4K A;  3LWM A;  2XY5 A;  3HVR A;  1JL1 A;  3E01 A;  1KSP A;  3SYZ A;  3DM2 A;  3ITH A;  4C8N A;  1I3A A;  3G10 A;  3RMB A;  3DRP A;  4KB0 A;  1JLF A;  2I5J A;  3ZCM A;  4CJK A;  4E7I A;  4DQR A;  3VQA A;  4CJ3 A;  2GBZ A;  5HRN A;  2XY6 A;  1CXU A;  3HXM A;  4DF8 A;  3K5L A;  1TK0 A;  2W42 A;  4I7F A;  4FCY A;  4QCL A;  1SL2 A;  3K5N A;  2P5O A;  4Q0B A;  3DRR A;  3KKS A;  1SL1 A;  1FXX A;  1WLJ A;  4WE1 A;  2KQ2 A;  2D0C A;  3VA3 A;  1TKT A;  3OYC A;  3CQ8 A;  1C0M A;  4C8L A;  4FJ8 A;  2A1R A;  1U49 A;  1ITG A;  2ITG A;  4PY5 A;  2DFH A;  1BI4 B;  3VQC A;  1VSE A;  1D8Y A;  4KHY A;  3LAK A;  2IC3 A;  2F96 A;  1Q9X A;  3NH2 A;  4OKJ A;  4M3U A;  2BE2 A;  1DTT A;  3AVF A;  2IDO A;  3AVJ A;  2JLE A;  3KK1 A;  3PX6 A;  1B9D A;  4MFB A;  3IRX A;  4CHP A;  3SCX A;  2OPS A;  2G8W A;  4TSX A;  3NH1 A;  3MEC A;  3SZ2 A;  4DQQ A;  3SNN A;  3L2W A;  3LPT A;  4JRQ A;  5HP1 A;  3KLG A;  3QES A;  4OLA A;  1HYV A;  2YNG A;  1L3V A;  2O4G A;  5KRT A;  1GOA A;  3IAY A;  3AVG A;  1JKH A;  4CEF A;  4CIG A;  4DTN A;  4JLH A;  4N41 A;  4CEO A;  3OYG A;  4J2E A;  3OYM A;  5KRS A;  4OGE A;  2IGI A;  4ICL A;  4FM0 A;  1GOB A;  2VG5 A;  1RDB A;  3OS2 A;  4E7K A;  3AA2 A;  3KLE A;  4CEB A;  1VRT A;  4CF0 A;  4NCG A;  1LWE A;  1VSM A;  4KRF A;  3OS0 A;  5CZ1 A;  4M3X A;  1WNS A;  4FW2 A;  3THV A;  2D0A A;  4DLG A;  4LSL A;  4AHV A;  5HLF A;  3AVC A;  4OKE A;  4GW6 A;  4CF9 A;  1TAU A;  1XHZ A;  1U47 A;  2HND A;  4KFB A;  3C6U A;  3NGI A;  3IG1 A;  4CEC A;  3AVL A;  1HQE A;  3DLE A;  3B6O A;  2IAJ A;  4ZTF A;  4DTR A;  4FJ9 A;  1TL3 A;  4DSE A;  4HUE A;  4DG1 A;  4E19 A;  4CHN A;  1S6P A;  4CGH A;  5J2Q A;  2JGU A;  3HO1 A;  3L3U A;  2VG6 A;  4LD0 A;  3VQ4 A;  2B6A A;  1UOC A;  3VQ5 A;  1S1T A;  3AA4 A;  1RTD A;  3ZT3 A;  3QNO A;  3K2P A;  3CM6 A;  4IFV A;  4DSI A;  1JXE A;  3CFO A;  2XY7 A;  3SUP A;  5SWM A;  3MAQ A;  5DMR A;  3SQ2 A;  4CFB A;  1XHX A;  2XO7 A;  3AVN A;  4DSK A;  1VSL A;  1S9E A;  1W9H A;  4GVM A;  4N5S A;  3HP6 A;  2DTU A;  3P5J A;  3RR7 A;  2QKK A;  4KHU A;  3F73 A;  4M3T A;  1YTU A;  1WAF A;  2YV0 X;  3NGZ A;  1NK7 A;  1EXQ A;  1JLC A;  4O44 A;  4FLX A;  3LWL A;  4DSF A;  4ZTJ A;  4K8X A;  3SPY A;  3PX4 A;  2YHB A;  2YNI A;  3AVK A;  3OYH A;  4F3T A;  3KJV A;  1RT2 A;  1S6Q A;  1CZ9 A;  5EU7 A;  3ZSW A;  4E3S A;  3K58 A;  4FJK A;  4CK2 A;  3KD5 E;  3I0S A;  1BCM A;  1UA0 A;  1HYZ A;  4RW8 A;  4OKK A;  4KAZ A;  2KFN A;  3KKR A;  1VSJ A;  4CF1 A;  4CFC A;  1BCO A;  4RG8 A;  5C25 A;  3M8S A;  3KK3 A;  1HJR A;  1SUQ A;  2FBY A;  1KFS A;  4Z4F A;  4M41 A;  3D45 A;  4CJ4 A;  1UWB A;  1MU2 A;  3ASM A;  4BWM A;  4CF2 A;  4FM1 A;  4L8R B;  1TL1 A;  2O4I A;  2KTQ A;  3RRG A;  3ZT4 A;  4CCH A;  1QTM A;  1L5U A;  2ETJ A;  1ZBU A;  4CER A;  3K5M A;  4AH9 A;  1I39 A;  1S1V A;  4Z4C A;  3K5O A;  4Z4H A;  3VQP A;  4CEZ A;  2P5G A;  4DU4 A;  4DTX A;  4CJ5 A;  4IBN A;  3KLH A;  1K6Y A;  5C42 A;  2VWK A;  1CZB A;  3AO2 A;  2IS3 A;  4M3R A;  1NK5 A;  3AV9 A;  3DLH A;  3WNE A;  4UQG A;  1QHT A;  4OGC A;  3I0R A;  1REV A;  3V81 A;  1T03 A;  2ZE2 A;  1CLQ A;  3NF9 A;  2G8U A;  1HMV A;  2HHQ A;  4OJR A;  3ULD A;  3SUQ A;  1RTJ A;  4KTW A;  1NK0 A;  3QEV A;  3PO4 A;  1G15 A;  1KLM A;  1W0H A;  1S9G A;  1RTI A;  4G1Q A;  5HRP A;  4LH5 A;  1NKC A;  3OYI A;  4E7J A;  4Y1D A;  3LZI A;  2OZS A;  3LAL A;  4DFK A;  3HPO A;  3O3F A;  4M42 A;  1A5X A;  4N76 A;  1J53 A;  1RTH A;  1VK0 A;  3V9S A;  3CFP A;  2QXF A;  1X9M A;  4ELU A;  1KCF A;  1Z25 A;  4B9V A;  3OYD A;  1B92 A;  3MXI A;  2HHU A;  3TWH A;  3D0P A;  3CG7 A;  3L2V A;  3NF7 A;  5CZ2 A;  1NJY A;  3F9K A;  1ASW A;  4FJN A;  1ASV A;  5D3G A;  1TV6 A;  4RW7 A;  4J2D A;  2WOM A;  3AVB A;  4RW4 A;  2G8I A;  3HT3 A;  4DLE A;  3TAN A;  4LY7 A;  4MQ3 A;  1HNV A;  4H4O A;  4W5T A;  3ZSO A;  4FLV A;  2KZM A;  4NYF A;  4EP4 A;  3A2F A;  2E4L A;  4CHO A;  1D9F A;  2X6S A;  3HM9 A;  3VQB A;  3K57 A;  5J2P A;  4B3O A;  2HVI A;  5C24 A;  4YFU A;  3PUF A;  3M8R A;  3HVT A;  4QOZ B;  1NKE A;  1WSG A;  3BGR A;  4IFY A;  4O55 A;  4DTO A;  1NK4 A;  4CJT A;  4JRP A;  3OYL A;  1TK8 A;  3DLR A;  4NCA A;  1ZBH A;  1RDA A;  4B9S A;  1BI4 A;  4QAG A;  4FJ5 A;  3ZSX A;  2BGG A;  4CJU A;  3ZSZ A;  1D5A A;  5HRO A;  4CGI A;  3EY1 A;  3V9Z A;  2P1J A;  3MEG A;  3L2Q A;  3JSM A;  3G0Z A;  1C1A A;  1SV5 A;  3TAR A;  2Q3S A;  3V4I A;  1RT6 A;  4FYD A;  2QKB A;  3TAG A;  1SKS A;  1JXB A;  1RT5 A;  4DF4 A;  3TAM A;  1C6V A;  3OYE A;  3VQD A;  3NDK A;  4FW1 A;  1J9A A;  4CF8 A;  4O0I A;  3NCI A;  3NH0 A;  3LP0 A;  3RR8 A;  4RW6 A;  4CK3 A;  4C8O A;  4DTJ A;  1WSI A;  1XC9 A;  1IG9 A;  1NJW A;  1QS4 A;  4E7L A;  1C0U A;  2EHG A;  3OYN A;  2QK9 A;  4KHS A;  5J2M A;  1SKW A;  3TAP A;  4R5P A;  4EP5 A;  1JLA A;  1RT1 A;  3L2R A;  4M45 A;  2PZS A;  4KRE A;  4NCB A;  3NE6 A;  5JS2 A;  1WN7 A;  3O4Q A;  3RTV A;  4B9T A;  4F8R A;  4ID1 A;  1LWC A;  5HBM A;  4FLW A;  1L3T A;  2Z1I A;  4CJV A;  1IKW A;  4DWI A;  4LSN A;  2A1S A;  4O4G A;  1EET A;  1GOC A;  4FJL A;  1KRP A;  4FZZ A;  3ZT2 A;  1U04 A;  4E7H A;  2WON A;  1JLB A;  1KVB A;  4DU1 A;  4ELV A;  2RF2 A;  4HCC A;  4FJ7 A;  1TVR A;  2KZZ A;  3OYB A;  3V1O A;  3DLB A;  1RDD A;  3T19 A;  5KGX A;  4FXD A;  1C1B A;  4J2B A;  2OPP A;  4CGJ A;  3V1Q A;  2HB5 A;  3PX0 A;  1EKE A;  1QE1 A;  3DOK A;  4Y1C A;  3ZSY A;  4AHC A;  3S3M A;  2OA8 A;  2YNH A;  1VRU A;  4N56 A;  4I2P A;  1SKR A;  1LW2 A;  1A5W A;  1ASU A;  3T1A A;  4CJW A;  4OPJ A;  2DY4 A;  1JLE A;  4AHT A;  4CGF A;  1SL0 A;  2XRI A;  4CEE A;  4W5O A;  1QSY A;  3LP2 A;  3QER A;  5CY4 A;  4KTZ A;  1NK8 A;  4F2R A;  4EZ6 A;  1C1C A;  1O1W A;  4Z4I A;  1NJX A;  2HMI A;  3VQ7 A;  1HYS A;  3HYF A;  4F2S A;  4DQI A;  2E6M A;  2RPI A;  2HVH A;  2RN2 A;  4CED A;  3AA5 X;  3SUO A;  1QSL A;  2HHT A;  2F8T A;  4HCB A;  4ID5 A;  4CJR A;  4DFP A;  2X6N A;  4H8K A;  3VA0 A;  4W5R A;  4FJM A;  3QEP A;  3OYK A;  1RBS A;  4FJX A;  1S1U A;  2Z1G A;  3U3G A;  3AVA A;  1DLO A;  4PWD A;  3OYA A;  3OY9 A;  4PQU A;  5KTQ A;  5FRN A;  3RMA A;  3QNN A;  4I9Q A;  1VSH A;  4DTP A;  3V9U A;  4FLU A;  5J2N A;  2HHW A;  4M3Z A;  3QIN A;  1NJZ A;  2B5J A;  5HRS A;  2FC0 A;  2XHB A;  1VSF A;  3I8D A;  1F21 A;  1TKX A;  4CHZ A;  2BDP A;  3FFI A;  4IG0 A;  3LDS A;  3CFR A;  4BDZ A;  2EX3 A;  2Z1J A;  3HST B;  1FKO A;  2RKI A;  4E89 A;  1RT3 A;  1S1X A;  2AJQ A;  4E1M A;  4H4M A;  1IKX A;  1T8E A;  3NGY A;  1RNH A;  1JL2 A;  1WSJ A;  2Y1J A;  4DSL A;  1JLQ A;  1TGO A;  1VSI A;  3DMJ A;  4CEA A;  3VQQ A;  2HHV A;  4BE1 A;  4DTM A;  5I42 A;  4CJS A;  1QSS A;  3L3V A;  4I9L A;  2OYQ A;  3HPG A;  2YKM A;  4BWJ A;  1KVC A;  5CYQ A;  2R7Y A;  1KTQ A;  4KKO A;  3NFA A;  3HPH A;  1WSH A;  3WNF A;  3P83 D;  4CGG A;  3S9H A;  1D9D A;  1CXQ A;  3AA3 A;  1X9S A;  3KLF A;  3EZ5 A;  3SQ0 A;  4Z4G A;  3WNH A;  3HJF A;  2E6L A;  1J54 A;  1RBU A;  1YT3 A;  4LH4 A;  3OJU A;  3NF6 A;  2ATQ A;  3PV8 A;  4CES A;  4CFD A;  3TAQ A;  4KI6 A;  1BL3 A;  2HHX A;  3OVN A;  4FZX C;  4CIF A;  1YTA A;  4OPK A;  4W5N A;  1HNI A;  2OPQ A;  4B9M A;  3MEE A;  1L3U A;  3PO5 A;  3C95 A;  1LV5 A;  3LPU A;  2Y1I A;  4CJF A;  3B6P A;  4DTU A;  1RT7 A;  3KIO A;  1ZBF A;  1FKP A;  3NF8 A;  3WNG A;  4JS4 A;  3OS1 A;  4DS5 A;  4BDP A;  2FBT A;  3QIO A;  2FBX A;  3L2U A;  1ZBL A;  1U4B A;  1U48 A;  1X9W A;  4F3O A;  4CIE A;  1WSF A;  1Q8I A;  1TKZ A;  3HP9 A;  3S3N A;  2PYJ A;  4I2Q A;  1DTQ A;  3KTQ A;  4KHN A;  2GV9 A;  3ZT0 A;  2PY5 A;  2D5R A;  4CJP A;  1UA1 A;  1T05 A;  3C94 A;  4AHS A;  1EP4 A;  1S5J A;  1NK6 A;  4M3Y A;  4HVJ A;  3V9X A;  4BAC A;  3K59 A;  5KI6 A;  4AIL C;  4RW9 A;  3VQ6 A;  3NAE A;  3AO1 A;  4DFM A;  1LAV A;  3MXM A;  1T7P A;  3S3O A;  1UAX A;  4IDK A;  4FJG A;  4DQP A;  4DMN A;  3M8P A;  4AHR A;  5E41 A;  4BE0 A;  4DTS A;  2OZM A;  4FK4 A;  3LP3 A;  4CEQ A;  4HTU A;  4DSJ A;  2OPR A;  4AHU A;  3AVM A;  4IG3 A;  4DS4 A;  3V6D A;  1LAW A;  4B8A B;  4HHT A;  4BDY A;  3AO5 A;  5T7B A;  1Q9Y A;  4IKF A;  3SJJ A;  4Z0U A;  2DFF A;  3AVI A;  4GMJ B;  4HUF A;  3AO3 A;  1TKD A;  3TAF A;  4NYN A;  3QEW A;  2IOC A;  3AO4 A;  4ZHR A;  3KLI A;  3SPZ A;  1IH7 A;  3IS9 A;  1JLG A;  3SV4 A;  1ZBI A;  4CJE A;  1KFD A;  4HUG A;  3MED A;  2X78 A;  1BHL A;  4KO0 A;  4O5B A;  2VG7 A;  3DRS A;  1YVU A;  4XIU A;  1TK5 A;  5SZT A;  3L8B A;  2XY8 A;  3VN5 A;  3DLK A;  1N6Q A;  4Q5V A;  3RWU A;  1IKV A;  4CE9 A;  3QEX A;  2KFZ A;  1KLN A;  3NBP A;  3OYJ A;  2X74 A;  1BGX T;  1NKB A;  3V1R A;  1BIZ A;  2B4J A;  4B8C A;  4KPY A;  1HQU A;  4OVL A;  4FK0 A;  4DQS A;  5K14 A;  3TAE A;  4E1N A;  2LSN A;  1RDC A;  3M8Q A;  3P1G A;  3QET A;  3HL8 A;  2G8F A;  4CJQ A;  1RBV A;  1VSD A;  1X1P A;  3ZT1 A;  3CM5 A;  4KHW A;  5FDL A;  3DYA A;  3EYZ A;  2NUB A;  1S1W A;  4FLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...