4OKMA

Selinadiene synthase apo and in complex with diphosphate
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
346
structure length
346
Chain Sequence
ELTVPPLFSPIRQAIHPKHADIDVQTAAWAETFRIGSEELRGKLVTQDIGTFSARILPEGREEVVSLLADFILWLFGVDDGHCEEGELGHRPGDLAGLLHRLIRVAQNPEAPMMQDDPLAAGLRDLRMRVDRFGTAGQTARWVDALREYFFSVVWEAAHRRAGTVPDLNDYTLMRLYDGATSVVLPMLEMGHGYELQPYERDRTAVRAVAEMASFIITWDNDIFSYHKERRGSGYYLNALRVLEQERGLTPAQALDAAISQRDRVMCLFTTVSEQLAEQGSPQLRQYLHSLRCFIRGAQDWGISSVRYTTPDDPANMPSVFTDVPTDDSTEPLDIPAVSWWWDLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Terpene synthase metal-binding domain-containing protein
publication title Induced-fit mechanism in class i terpene cyclases.
pubmed doi rcsb
source organism Streptomyces pristinaespiralis
molecule tags Transferase
total genus 136
structure length 346
sequence length 346
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.181: Selina-4(15),7(11)-diene synthase.
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4okmA00
3KB9A 3QQVA 4KVDA 2Q80A 5HN7A 3M0GA 4LPHF 1YQ7A 4JZBA 1YYTA 4LOBA 3KRFA 1N23A 3N3LF 3P5PA 3DYFA 4XQRF 1VG2A 3VJ9A 1WL2A 2Z7IA 3TFNA 4NKEA 3DYHA 2OPMA 5JA0F 2F94F 3IBAA 4QXSF 3KRFB 5ILDA 5EATA 4EA1A 4JYXA 2E95A 3MAVA 3RBMA 1V4IA 4WK5A 4LA5A 1DGPA 3LLWA 4DXJA 2E8VA 2Q9ZA 1WMWA 2F8ZF 3WEKA 4N1ZF 2E8UA 3KRAA 5DIQF 5HN8A 3ACXA 5IKAA 4KWDA 5B00A 4DEMF 2Z78A 1EZFA 3BNXA 4MC3A 4JZXA 1RTRA 5JV1F 2AEKA 3LGZB 3ZCDA 3KRAB 4OMGA 3CP6A 2Z4YA 1VG4A 4NFKF 5IM1A 3KBKA 3NF2A 5AYPA 3EFQA 3LZ9A 3VJEA 5B01A 4E9ZA 4PVYF 3AQBB 3WEGA 4ZQ8A 5E8HA 4FP4A 5DHKA 4E1EA 2PS6A 4RXCA 3Q30A 1YHKA 4RNQA 3PKOA 1N1BA 3V66A 1N22A 1YYSA 5B0IA 1WL3A 3WCHA 2PS4A 1V4HA 4LA6A 2AETA 4OKMA 3APZA 4LLTA 3VJCA 5I1UA 5E8LA 3WEIA 2E8XA 3N49F 4RXAA 5IK6A 5HNAA 1HM4A 3WEJA 3WCIA 4LZCA 5JUZF 3V1XA 3VJDA 2E8WA 1YHLA 3WEHA 1FPSA 3EGTA 1RQJA 3N5HF 4QPFA 3ZMBA 3KRPB 3LGKA 3N1WF 3N6KF 5B03A 3UCAA 4DI5A 4LTVA 3Q1OA 3IPIA 2AZKA 2ZEUA 4LZ3A 4GP1A 5ILJA 2F7MF 3Q2ZA 3MZVA 4LFVF 3S9VA 5ILKA 2Q9YA 3WEFA 1WKZA 1UBYA 3PDEA 4PVXF 3N46F 4KVIA 2OPNA 1UBXA 1JFGA 3G4DA 3P5RA 2Z4ZA 2Z50A 3TFPA 5IK9A 4LZ0A 2Z52A 2OA6A 3LVSA 3ZOUA 1V4JA 3ADZA 3LJIA 1VG6A 4LFEA 2F8CF 4RXDA 4LTZA 3WCGA 3CC9A 2AELA 3WCDA 4HD1A 5AHUB 5AELA 2ZY1A 3SAEA 3WCEA 1N20A 3S4JA 2PS5A 3N0GA 4GAXA 4NUAA 2F9KF 4EA2A 1UBWA 2EWGA 4LIXA 3G4FA 3NRIA 4JVJF 4OKZA 3SDRA 3TC1A 3LEEA 1YYUA 4H5CF 5HN9A 5DZ2A 4K10A 3RYWA 3ZMCA 3PYAA 4DHDA 2PS7A 5B0MA 2E92A 3OYRA 1V4KA 4XQSF 5B02A 3WJOA 2Q58A 3M9UA 4NG6A 3LK5A 5H9DA 5ILIA 4DWBA 3ICNA 2ONGA 2RAHA 3WCBA 4NKFA 3ICMA 4LXWA 4RYPA 4KPJA 3WCMA 1N24A 1YV5A 2F92F 1HXCA 2P1CA 2ZCSA 4LLSA 4P0XA 5IMPA 2Z4WA 2VF6A 5ER8A 3WSAA 3RMGA 3SDQA 2Z7HA 2E4OA 5IL3A 3EZ3A 1KIZA 3LDWA 2J5CA 3LSNA 5AFXA 3OACA 5DHIA 3P8LA 2ZEVA 1WL0A 3M02A 3KRCA 1UBVA 3WCFA 3KRPA 4XQTF 5A0IA 5JV0F 4MC0A 3M01A 3OACB 4OMHA 5DJPF 1VG7A 5A0KA 3KRCB 5IK0A 1KIYA 4JXYA 5DGSF 4NFJF 2O1OA 3RYEA 1JFAA 5IMNA 5IL8A 2ZCQA 2ZCRA 3VJAA 4GA3A 4P0VA 5EASA 2E91A 4LUUA 3VJBA 1WL1A 5IMIA 3DYGA 2H8OA 3OABB 3LG5A 5IKHA 3ASXA 5IN8A 5EROA 4H5DF 2J1OA 3AQ0A 4N9UA 1HXAA 3Q2QA 5EAUA 4JXNA 5KSXF 3WJKA 2E8TA 1N21A 1ZW5A 5JV2F 4E9UA 1VG3A 1RQIA 1DI1A 3ZL6A 3ACYA 4NFIF 5DW7A 4KKMA 3SDUA 5ERNA 3CKEA 5ILYA 2PS8A 1WY0A 2F89F 4RXEA 2ONHA 3VJ8A 3TFVA 2AZLA 2Z4VA 3ICZA 2E90A 2OGDA 5C05A 1YHMA 3M00A 3N1VF 3WCCA 3WJNA 2J1PA 3ID0A 2QISA 4H5EF 3V1VA 5ILZA 1YJ4A 3WSBA 1HM7A 4Q23A 3SDVA 1PS1A 3LMDA 5B0KA 4KK2A 4UMJA 2FTZA 4LPGF 3WC9A 1HXGA 5E8KA 3TS7A 2ZCOA 4EA0A 4P0WA 3NPRA 3WCAA 5DJVF 5ERMA 1N1ZA 4KQUA 5CG6A 5DGMF 3SDTA 2Z4XA 5IVGA 4DWGA 3KROA 5B0JA 3W7FA 5DGNF 4DZWA 1YYQA 4F6VA 3N3DA 3ACWA 5A0JA 3KROB 4F6XA 4LFGA 3LOMA 3WE9A 3N0FA 3AQCB 4KVYA 4F62A 3ICKA 4FJQA 4MC8A 4KQ5A 2E94A 3PYBA 4KFAA 2E93A 3NPKA 3AE0A 1YYRA 4OGUA 3B7LA 3OABA 3PH7A 5B0LA 3QKCA 4KQSA 3P41A 2DH4A 3N45F 3BNYA 2AZJA 5ILHA 3WCLA 4KVWA 2FORA 3P8RA 3WCJA 4GP2A 2I19A 5DJRF 5CG5A 4L2XF 1HX9A 4KPDA 4KUXA 3N5JF 1V4EA
chains in the Genus database with same CATH superfamily
3KB9A 3QQVA 4KVDA 2Q80A 5HN7A 3M0GA 4LPHF 1YQ7A 4JZBA 1YYTA 4LOBA 3KRFA 1N23A 3N3LF 3P5PA 3DYFA 4XQRF 1VG2A 3VJ9A 1WL2A 2Z7IA 3TFNA 4NKEA 3DYHA 2OPMA 5JA0F 2F94F 3IBAA 4QXSF 3KRFB 5ILDA 5EATA 4EA1A 4JYXA 2E95A 3MAVA 3RBMA 1V4IA 4WK5A 4LA5A 1DGPA 3LLWA 4DXJA 2E8VA 2Q9ZA 1WMWA 2F8ZF 3WEKA 4N1ZF 2E8UA 3KRAA 5DIQF 5HN8A 3ACXA 5IKAA 4KWDA 5B00A 4DEMF 2Z78A 1EZFA 3BNXA 4MC3A 4JZXA 1RTRA 5JV1F 2AEKA 3LGZB 3ZCDA 3KRAB 4OMGA 3CP6A 2Z4YA 1VG4A 4NFKF 5IM1A 3KBKA 3NF2A 5AYPA 3EFQA 3LZ9A 3VJEA 5B01A 4E9ZA 4PVYF 3AQBB 3WEGA 4ZQ8A 5E8HA 4FP4A 5DHKA 4E1EA 2PS6A 4RXCA 3Q30A 1YHKA 4RNQA 3PKOA 1N1BA 3V66A 1N22A 1YYSA 5B0IA 1WL3A 3WCHA 2PS4A 1V4HA 4LA6A 2AETA 4OKMA 3APZA 4LLTA 3VJCA 5I1UA 5E8LA 3WEIA 2E8XA 3N49F 4RXAA 5IK6A 5HNAA 1HM4A 3WEJA 3WCIA 4LZCA 5JUZF 3V1XA 3VJDA 2E8WA 1YHLA 3WEHA 1FPSA 3EGTA 1RQJA 3N5HF 4QPFA 3ZMBA 3KRPB 3LGKA 3N1WF 3N6KF 5B03A 3UCAA 4DI5A 4LTVA 3Q1OA 3IPIA 2AZKA 2ZEUA 4LZ3A 4GP1A 5ILJA 2F7MF 3Q2ZA 3MZVA 4LFVF 3S9VA 5ILKA 2Q9YA 3WEFA 1WKZA 1UBYA 3PDEA 4PVXF 3N46F 4KVIA 2OPNA 1UBXA 1JFGA 3G4DA 3P5RA 2Z4ZA 2Z50A 3TFPA 5IK9A 4LZ0A 2Z52A 2OA6A 3LVSA 3ZOUA 1V4JA 3ADZA 3LJIA 1VG6A 4LFEA 2F8CF 4RXDA 4LTZA 3WCGA 3CC9A 2AELA 3WCDA 4HD1A 5AHUB 5AELA 2ZY1A 3SAEA 3WCEA 1N20A 3S4JA 2PS5A 3N0GA 4GAXA 4NUAA 2F9KF 4EA2A 1UBWA 2EWGA 4LIXA 3G4FA 3NRIA 4JVJF 4OKZA 3SDRA 3TC1A 3LEEA 1YYUA 4H5CF 5HN9A 5DZ2A 4K10A 3RYWA 3ZMCA 3PYAA 4DHDA 2PS7A 5B0MA 2E92A 3OYRA 1V4KA 4XQSF 5B02A 3WJOA 2Q58A 3M9UA 4NG6A 3LK5A 5H9DA 5ILIA 4DWBA 3ICNA 2ONGA 2RAHA 3WCBA 4NKFA 3ICMA 4LXWA 4RYPA 4KPJA 3WCMA 1N24A 1YV5A 2F92F 1HXCA 2P1CA 2ZCSA 4LLSA 4P0XA 5IMPA 2Z4WA 2VF6A 5ER8A 3WSAA 3RMGA 3SDQA 2Z7HA 2E4OA 5IL3A 3EZ3A 1KIZA 3LDWA 2J5CA 3LSNA 5AFXA 3OACA 5DHIA 3P8LA 2ZEVA 1WL0A 3M02A 3KRCA 1UBVA 3WCFA 3KRPA 4XQTF 5A0IA 5JV0F 4MC0A 3M01A 3OACB 4OMHA 5DJPF 1VG7A 5A0KA 3KRCB 5IK0A 1KIYA 4JXYA 5DGSF 4NFJF 2O1OA 3RYEA 1JFAA 5IMNA 5IL8A 2ZCQA 2ZCRA 3VJAA 4GA3A 4P0VA 5EASA 2E91A 4LUUA 3VJBA 1WL1A 5IMIA 3DYGA 2H8OA 3OABB 3LG5A 5IKHA 3ASXA 5IN8A 5EROA 4H5DF 2J1OA 3AQ0A 4N9UA 1HXAA 3Q2QA 5EAUA 4JXNA 5KSXF 3WJKA 2E8TA 1N21A 1ZW5A 5JV2F 4E9UA 1VG3A 1RQIA 1DI1A 3ZL6A 3ACYA 4NFIF 5DW7A 4KKMA 3SDUA 5ERNA 3CKEA 5ILYA 2PS8A 1WY0A 2F89F 4RXEA 2ONHA 3VJ8A 3TFVA 2AZLA 2Z4VA 3ICZA 2E90A 2OGDA 5C05A 1YHMA 3M00A 3N1VF 3WCCA 3WJNA 2J1PA 3ID0A 2QISA 4H5EF 3V1VA 5ILZA 1YJ4A 3WSBA 1HM7A 4Q23A 3SDVA 1PS1A 3LMDA 5B0KA 4KK2A 4UMJA 2FTZA 4LPGF 3WC9A 1HXGA 5E8KA 3TS7A 2ZCOA 4EA0A 4P0WA 3NPRA 3WCAA 5DJVF 5ERMA 1N1ZA 4KQUA 5CG6A 5DGMF 3SDTA 2Z4XA 5IVGA 4DWGA 3KROA 5B0JA 3W7FA 5DGNF 4DZWA 1YYQA 4F6VA 3N3DA 3ACWA 5A0JA 3KROB 4F6XA 4LFGA 3LOMA 3WE9A 3N0FA 3AQCB 4KVYA 4F62A 3ICKA 4FJQA 4MC8A 4KQ5A 2E94A 3PYBA 4KFAA 2E93A 3NPKA 3AE0A 1YYRA 4OGUA 3B7LA 3OABA 3PH7A 5B0LA 3QKCA 4KQSA 3P41A 2DH4A 3N45F 3BNYA 2AZJA 5ILHA 3WCLA 4KVWA 2FORA 3P8RA 3WCJA 4GP2A 2I19A 5DJRF 5CG5A 4L2XF 1HX9A 4KPDA 4KUXA 3N5JF 1V4EA
chains in the Genus database with same CATH topology
3KB9A 3QQVA 4KVDA 2Q80A 5HN7A 3M0GA 4LPHF 1YQ7A 4JZBA 1YYTA 4LOBA 3KRFA 1N23A 3N3LF 3P5PA 3DYFA 4XQRF 1VG2A 3VJ9A 1WL2A 2Z7IA 3TFNA 4NKEA 3DYHA 2OPMA 5JA0F 2F94F 3IBAA 4QXSF 3KRFB 5ILDA 5EATA 4EA1A 4JYXA 2E95A 3MAVA 3RBMA 1V4IA 4WK5A 4LA5A 1DGPA 3LLWA 4DXJA 2E8VA 2Q9ZA 1WMWA 2F8ZF 3WEKA 4N1ZF 2E8UA 3KRAA 5DIQF 5HN8A 3ACXA 5IKAA 4KWDA 5B00A 4DEMF 2Z78A 1EZFA 3BNXA 4MC3A 4JZXA 1RTRA 5JV1F 2AEKA 3LGZB 3ZCDA 3KRAB 4OMGA 3CP6A 2Z4YA 1VG4A 4NFKF 5IM1A 3KBKA 3NF2A 5AYPA 3EFQA 3LZ9A 3VJEA 5B01A 4E9ZA 4PVYF 3AQBB 3WEGA 4ZQ8A 5E8HA 4FP4A 5DHKA 4E1EA 2PS6A 4RXCA 3Q30A 1YHKA 4RNQA 3PKOA 1N1BA 3V66A 1N22A 1YYSA 5B0IA 1WL3A 3WCHA 2PS4A 1V4HA 4LA6A 2AETA 4OKMA 3APZA 4LLTA 3VJCA 5I1UA 5E8LA 3WEIA 2E8XA 3N49F 4RXAA 5IK6A 5HNAA 1HM4A 3WEJA 3WCIA 4LZCA 5JUZF 3V1XA 3VJDA 2E8WA 1YHLA 3WEHA 1FPSA 3EGTA 1RQJA 3N5HF 4QPFA 3ZMBA 3KRPB 3LGKA 3N1WF 3N6KF 5B03A 3UCAA 4DI5A 4LTVA 3Q1OA 3IPIA 2AZKA 2ZEUA 4LZ3A 4GP1A 5ILJA 2F7MF 3Q2ZA 3MZVA 4LFVF 3S9VA 5ILKA 2Q9YA 3WEFA 1WKZA 1UBYA 3PDEA 4PVXF 3N46F 4KVIA 2OPNA 1UBXA 1JFGA 3G4DA 3P5RA 2Z4ZA 2Z50A 3TFPA 5IK9A 4LZ0A 2Z52A 2OA6A 3LVSA 3ZOUA 1V4JA 3ADZA 3LJIA 1VG6A 4LFEA 2F8CF 4RXDA 4LTZA 3WCGA 3CC9A 2AELA 3WCDA 4HD1A 5AHUB 5AELA 2ZY1A 3SAEA 3WCEA 1N20A 3S4JA 2PS5A 3N0GA 4GAXA 4NUAA 2F9KF 4EA2A 1UBWA 2EWGA 4LIXA 3G4FA 3NRIA 4JVJF 4OKZA 3SDRA 3TC1A 3LEEA 1YYUA 4H5CF 5HN9A 5DZ2A 4K10A 3RYWA 3ZMCA 3PYAA 4DHDA 2PS7A 5B0MA 2E92A 3OYRA 1V4KA 4XQSF 5B02A 3WJOA 2Q58A 3M9UA 4NG6A 3LK5A 5H9DA 5ILIA 4DWBA 3ICNA 2ONGA 2RAHA 3WCBA 4NKFA 3ICMA 4LXWA 4RYPA 4KPJA 3WCMA 1N24A 1YV5A 2F92F 1HXCA 2P1CA 2ZCSA 4LLSA 4P0XA 5IMPA 2Z4WA 2VF6A 5ER8A 3WSAA 3RMGA 3SDQA 2Z7HA 2E4OA 5IL3A 3EZ3A 1KIZA 3LDWA 2J5CA 3LSNA 5AFXA 3OACA 5DHIA 3P8LA 2ZEVA 1WL0A 3M02A 3KRCA 1UBVA 3WCFA 3KRPA 4XQTF 5A0IA 5JV0F 4MC0A 3M01A 3OACB 4OMHA 5DJPF 1VG7A 5A0KA 3KRCB 5IK0A 1KIYA 4JXYA 5DGSF 4NFJF 2O1OA 3RYEA 1JFAA 5IMNA 5IL8A 2ZCQA 2ZCRA 3VJAA 4GA3A 4P0VA 5EASA 2E91A 4LUUA 3VJBA 1WL1A 5IMIA 3DYGA 2H8OA 3OABB 3LG5A 5IKHA 3ASXA 5IN8A 5EROA 4H5DF 2J1OA 3AQ0A 4N9UA 1HXAA 3Q2QA 5EAUA 4JXNA 5KSXF 3WJKA 2E8TA 1N21A 1ZW5A 5JV2F 4E9UA 1VG3A 1RQIA 1DI1A 3ZL6A 3ACYA 4NFIF 5DW7A 4KKMA 3SDUA 5ERNA 3CKEA 5ILYA 2PS8A 1WY0A 2F89F 4RXEA 2ONHA 3VJ8A 3TFVA 2AZLA 2Z4VA 3ICZA 2E90A 2OGDA 5C05A 1YHMA 3M00A 3N1VF 3WCCA 3WJNA 2J1PA 3ID0A 2QISA 4H5EF 3V1VA 5ILZA 1YJ4A 3WSBA 1HM7A 4Q23A 3SDVA 1PS1A 3LMDA 5B0KA 4KK2A 4UMJA 2FTZA 4LPGF 3WC9A 1HXGA 5E8KA 3TS7A 2ZCOA 4EA0A 4P0WA 3NPRA 3WCAA 5DJVF 5ERMA 1N1ZA 4KQUA 5CG6A 5DGMF 3SDTA 2Z4XA 5IVGA 4DWGA 3KROA 5B0JA 3W7FA 5DGNF 4DZWA 1YYQA 4F6VA 3N3DA 3ACWA 5A0JA 3KROB 4F6XA 4LFGA 3LOMA 3WE9A 3N0FA 3AQCB 4KVYA 4F62A 3ICKA 4FJQA 4MC8A 4KQ5A 2E94A 3PYBA 4KFAA 2E93A 3NPKA 3AE0A 1YYRA 4OGUA 3B7LA 3OABA 3PH7A 5B0LA 3QKCA 4KQSA 3P41A 2DH4A 3N45F 3BNYA 2AZJA 5ILHA 3WCLA 4KVWA 2FORA 3P8RA 3WCJA 4GP2A 2I19A 5DJRF 5CG5A 4L2XF 1HX9A 4KPDA 4KUXA 3N5JF 1V4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KB9 A;  3QQV A;  4KVD A;  2Q80 A;  5HN7 A;  3M0G A;  4LPH F;  1YQ7 A;  4JZB A;  1YYT A;  4LOB A;  3KRF A;  1N23 A;  3N3L F;  3P5P A;  3DYF A;  4XQR F;  1VG2 A;  3VJ9 A;  1WL2 A;  2Z7I A;  3TFN A;  4NKE A;  3DYH A;  2OPM A;  5JA0 F;  2F94 F;  3IBA A;  4QXS F;  3KRF B;  5ILD A;  5EAT A;  4EA1 A;  4JYX A;  2E95 A;  3MAV A;  3RBM A;  1V4I A;  4WK5 A;  4LA5 A;  1DGP A;  3LLW A;  4DXJ A;  2E8V A;  2Q9Z A;  1WMW A;  2F8Z F;  3WEK A;  4N1Z F;  2E8U A;  3KRA A;  5DIQ F;  5HN8 A;  3ACX A;  5IKA A;  4KWD A;  5B00 A;  4DEM F;  2Z78 A;  1EZF A;  3BNX A;  4MC3 A;  4JZX A;  1RTR A;  5JV1 F;  2AEK A;  3LGZ B;  3ZCD A;  3KRA B;  4OMG A;  3CP6 A;  2Z4Y A;  1VG4 A;  4NFK F;  5IM1 A;  3KBK A;  3NF2 A;  5AYP A;  3EFQ A;  3LZ9 A;  3VJE A;  5B01 A;  4E9Z A;  4PVY F;  3AQB B;  3WEG A;  4ZQ8 A;  5E8H A;  4FP4 A;  5DHK A;  4E1E A;  2PS6 A;  4RXC A;  3Q30 A;  1YHK A;  4RNQ A;  3PKO A;  1N1B A;  3V66 A;  1N22 A;  1YYS A;  5B0I A;  1WL3 A;  3WCH A;  2PS4 A;  1V4H A;  4LA6 A;  2AET A;  4OKM A;  3APZ A;  4LLT A;  3VJC A;  5I1U A;  5E8L A;  3WEI A;  2E8X A;  3N49 F;  4RXA A;  5IK6 A;  5HNA A;  1HM4 A;  3WEJ A;  3WCI A;  4LZC A;  5JUZ F;  3V1X A;  3VJD A;  2E8W A;  1YHL A;  3WEH A;  1FPS A;  3EGT A;  1RQJ A;  3N5H F;  4QPF A;  3ZMB A;  3KRP B;  3LGK A;  3N1W F;  3N6K F;  5B03 A;  3UCA A;  4DI5 A;  4LTV A;  3Q1O A;  3IPI A;  2AZK A;  2ZEU A;  4LZ3 A;  4GP1 A;  5ILJ A;  2F7M F;  3Q2Z A;  3MZV A;  4LFV F;  3S9V A;  5ILK A;  2Q9Y A;  3WEF A;  1WKZ A;  1UBY A;  3PDE A;  4PVX F;  3N46 F;  4KVI A;  2OPN A;  1UBX A;  1JFG A;  3G4D A;  3P5R A;  2Z4Z A;  2Z50 A;  3TFP A;  5IK9 A;  4LZ0 A;  2Z52 A;  2OA6 A;  3LVS A;  3ZOU A;  1V4J A;  3ADZ A;  3LJI A;  1VG6 A;  4LFE A;  2F8C F;  4RXD A;  4LTZ A;  3WCG A;  3CC9 A;  2AEL A;  3WCD A;  4HD1 A;  5AHU B;  5AEL A;  2ZY1 A;  3SAE A;  3WCE A;  1N20 A;  3S4J A;  2PS5 A;  3N0G A;  4GAX A;  4NUA A;  2F9K F;  4EA2 A;  1UBW A;  2EWG A;  4LIX A;  3G4F A;  3NRI A;  4JVJ F;  4OKZ A;  3SDR A;  3TC1 A;  3LEE A;  1YYU A;  4H5C F;  5HN9 A;  5DZ2 A;  4K10 A;  3RYW A;  3ZMC A;  3PYA A;  4DHD A;  2PS7 A;  5B0M A;  2E92 A;  3OYR A;  1V4K A;  4XQS F;  5B02 A;  3WJO A;  2Q58 A;  3M9U A;  4NG6 A;  3LK5 A;  5H9D A;  5ILI A;  4DWB A;  3ICN A;  2ONG A;  2RAH A;  3WCB A;  4NKF A;  3ICM A;  4LXW A;  4RYP A;  4KPJ A;  3WCM A;  1N24 A;  1YV5 A;  2F92 F;  1HXC A;  2P1C A;  2ZCS A;  4LLS A;  4P0X A;  5IMP A;  2Z4W A;  2VF6 A;  5ER8 A;  3WSA A;  3RMG A;  3SDQ A;  2Z7H A;  2E4O A;  5IL3 A;  3EZ3 A;  1KIZ A;  3LDW A;  2J5C A;  3LSN A;  5AFX A;  3OAC A;  5DHI A;  3P8L A;  2ZEV A;  1WL0 A;  3M02 A;  3KRC A;  1UBV A;  3WCF A;  3KRP A;  4XQT F;  5A0I A;  5JV0 F;  4MC0 A;  3M01 A;  3OAC B;  4OMH A;  5DJP F;  1VG7 A;  5A0K A;  3KRC B;  5IK0 A;  1KIY A;  4JXY A;  5DGS F;  4NFJ F;  2O1O A;  3RYE A;  1JFA A;  5IMN A;  5IL8 A;  2ZCQ A;  2ZCR A;  3VJA A;  4GA3 A;  4P0V A;  5EAS A;  2E91 A;  4LUU A;  3VJB A;  1WL1 A;  5IMI A;  3DYG A;  2H8O A;  3OAB B;  3LG5 A;  5IKH A;  3ASX A;  5IN8 A;  5ERO A;  4H5D F;  2J1O A;  3AQ0 A;  4N9U A;  1HXA A;  3Q2Q A;  5EAU A;  4JXN A;  5KSX F;  3WJK A;  2E8T A;  1N21 A;  1ZW5 A;  5JV2 F;  4E9U A;  1VG3 A;  1RQI A;  1DI1 A;  3ZL6 A;  3ACY A;  4NFI F;  5DW7 A;  4KKM A;  3SDU A;  5ERN A;  3CKE A;  5ILY A;  2PS8 A;  1WY0 A;  2F89 F;  4RXE A;  2ONH A;  3VJ8 A;  3TFV A;  2AZL A;  2Z4V A;  3ICZ A;  2E90 A;  2OGD A;  5C05 A;  1YHM A;  3M00 A;  3N1V F;  3WCC A;  3WJN A;  2J1P A;  3ID0 A;  2QIS A;  4H5E F;  3V1V A;  5ILZ A;  1YJ4 A;  3WSB A;  1HM7 A;  4Q23 A;  3SDV A;  1PS1 A;  3LMD A;  5B0K A;  4KK2 A;  4UMJ A;  2FTZ A;  4LPG F;  3WC9 A;  1HXG A;  5E8K A;  3TS7 A;  2ZCO A;  4EA0 A;  4P0W A;  3NPR A;  3WCA A;  5DJV F;  5ERM A;  1N1Z A;  4KQU A;  5CG6 A;  5DGM F;  3SDT A;  2Z4X A;  5IVG A;  4DWG A;  3KRO A;  5B0J A;  3W7F A;  5DGN F;  4DZW A;  1YYQ A;  4F6V A;  3N3D A;  3ACW A;  5A0J A;  3KRO B;  4F6X A;  4LFG A;  3LOM A;  3WE9 A;  3N0F A;  3AQC B;  4KVY A;  4F62 A;  3ICK A;  4FJQ A;  4MC8 A;  4KQ5 A;  2E94 A;  3PYB A;  4KFA A;  2E93 A;  3NPK A;  3AE0 A;  1YYR A;  4OGU A;  3B7L A;  3OAB A;  3PH7 A;  5B0L A;  3QKC A;  4KQS A;  3P41 A;  2DH4 A;  3N45 F;  3BNY A;  2AZJ A;  5ILH A;  3WCL A;  4KVW A;  2FOR A;  3P8R A;  3WCJ A;  4GP2 A;  2I19 A;  5DJR F;  5CG5 A;  4L2X F;  1HX9 A;  4KPD A;  4KUX A;  3N5J F;  1V4E A; 
#chains in the Genus database with same CATH topology
 3KB9 A;  3QQV A;  4KVD A;  2Q80 A;  5HN7 A;  3M0G A;  4LPH F;  1YQ7 A;  4JZB A;  1YYT A;  4LOB A;  3KRF A;  1N23 A;  3N3L F;  3P5P A;  3DYF A;  4XQR F;  1VG2 A;  3VJ9 A;  1WL2 A;  2Z7I A;  3TFN A;  4NKE A;  3DYH A;  2OPM A;  5JA0 F;  2F94 F;  3IBA A;  4QXS F;  3KRF B;  5ILD A;  5EAT A;  4EA1 A;  4JYX A;  2E95 A;  3MAV A;  3RBM A;  1V4I A;  4WK5 A;  4LA5 A;  1DGP A;  3LLW A;  4DXJ A;  2E8V A;  2Q9Z A;  1WMW A;  2F8Z F;  3WEK A;  4N1Z F;  2E8U A;  3KRA A;  5DIQ F;  5HN8 A;  3ACX A;  5IKA A;  4KWD A;  5B00 A;  4DEM F;  2Z78 A;  1EZF A;  3BNX A;  4MC3 A;  4JZX A;  1RTR A;  5JV1 F;  2AEK A;  3LGZ B;  3ZCD A;  3KRA B;  4OMG A;  3CP6 A;  2Z4Y A;  1VG4 A;  4NFK F;  5IM1 A;  3KBK A;  3NF2 A;  5AYP A;  3EFQ A;  3LZ9 A;  3VJE A;  5B01 A;  4E9Z A;  4PVY F;  3AQB B;  3WEG A;  4ZQ8 A;  5E8H A;  4FP4 A;  5DHK A;  4E1E A;  2PS6 A;  4RXC A;  3Q30 A;  1YHK A;  4RNQ A;  3PKO A;  1N1B A;  3V66 A;  1N22 A;  1YYS A;  5B0I A;  1WL3 A;  3WCH A;  2PS4 A;  1V4H A;  4LA6 A;  2AET A;  4OKM A;  3APZ A;  4LLT A;  3VJC A;  5I1U A;  5E8L A;  3WEI A;  2E8X A;  3N49 F;  4RXA A;  5IK6 A;  5HNA A;  1HM4 A;  3WEJ A;  3WCI A;  4LZC A;  5JUZ F;  3V1X A;  3VJD A;  2E8W A;  1YHL A;  3WEH A;  1FPS A;  3EGT A;  1RQJ A;  3N5H F;  4QPF A;  3ZMB A;  3KRP B;  3LGK A;  3N1W F;  3N6K F;  5B03 A;  3UCA A;  4DI5 A;  4LTV A;  3Q1O A;  3IPI A;  2AZK A;  2ZEU A;  4LZ3 A;  4GP1 A;  5ILJ A;  2F7M F;  3Q2Z A;  3MZV A;  4LFV F;  3S9V A;  5ILK A;  2Q9Y A;  3WEF A;  1WKZ A;  1UBY A;  3PDE A;  4PVX F;  3N46 F;  4KVI A;  2OPN A;  1UBX A;  1JFG A;  3G4D A;  3P5R A;  2Z4Z A;  2Z50 A;  3TFP A;  5IK9 A;  4LZ0 A;  2Z52 A;  2OA6 A;  3LVS A;  3ZOU A;  1V4J A;  3ADZ A;  3LJI A;  1VG6 A;  4LFE A;  2F8C F;  4RXD A;  4LTZ A;  3WCG A;  3CC9 A;  2AEL A;  3WCD A;  4HD1 A;  5AHU B;  5AEL A;  2ZY1 A;  3SAE A;  3WCE A;  1N20 A;  3S4J A;  2PS5 A;  3N0G A;  4GAX A;  4NUA A;  2F9K F;  4EA2 A;  1UBW A;  2EWG A;  4LIX A;  3G4F A;  3NRI A;  4JVJ F;  4OKZ A;  3SDR A;  3TC1 A;  3LEE A;  1YYU A;  4H5C F;  5HN9 A;  5DZ2 A;  4K10 A;  3RYW A;  3ZMC A;  3PYA A;  4DHD A;  2PS7 A;  5B0M A;  2E92 A;  3OYR A;  1V4K A;  4XQS F;  5B02 A;  3WJO A;  2Q58 A;  3M9U A;  4NG6 A;  3LK5 A;  5H9D A;  5ILI A;  4DWB A;  3ICN A;  2ONG A;  2RAH A;  3WCB A;  4NKF A;  3ICM A;  4LXW A;  4RYP A;  4KPJ A;  3WCM A;  1N24 A;  1YV5 A;  2F92 F;  1HXC A;  2P1C A;  2ZCS A;  4LLS A;  4P0X A;  5IMP A;  2Z4W A;  2VF6 A;  5ER8 A;  3WSA A;  3RMG A;  3SDQ A;  2Z7H A;  2E4O A;  5IL3 A;  3EZ3 A;  1KIZ A;  3LDW A;  2J5C A;  3LSN A;  5AFX A;  3OAC A;  5DHI A;  3P8L A;  2ZEV A;  1WL0 A;  3M02 A;  3KRC A;  1UBV A;  3WCF A;  3KRP A;  4XQT F;  5A0I A;  5JV0 F;  4MC0 A;  3M01 A;  3OAC B;  4OMH A;  5DJP F;  1VG7 A;  5A0K A;  3KRC B;  5IK0 A;  1KIY A;  4JXY A;  5DGS F;  4NFJ F;  2O1O A;  3RYE A;  1JFA A;  5IMN A;  5IL8 A;  2ZCQ A;  2ZCR A;  3VJA A;  4GA3 A;  4P0V A;  5EAS A;  2E91 A;  4LUU A;  3VJB A;  1WL1 A;  5IMI A;  3DYG A;  2H8O A;  3OAB B;  3LG5 A;  5IKH A;  3ASX A;  5IN8 A;  5ERO A;  4H5D F;  2J1O A;  3AQ0 A;  4N9U A;  1HXA A;  3Q2Q A;  5EAU A;  4JXN A;  5KSX F;  3WJK A;  2E8T A;  1N21 A;  1ZW5 A;  5JV2 F;  4E9U A;  1VG3 A;  1RQI A;  1DI1 A;  3ZL6 A;  3ACY A;  4NFI F;  5DW7 A;  4KKM A;  3SDU A;  5ERN A;  3CKE A;  5ILY A;  2PS8 A;  1WY0 A;  2F89 F;  4RXE A;  2ONH A;  3VJ8 A;  3TFV A;  2AZL A;  2Z4V A;  3ICZ A;  2E90 A;  2OGD A;  5C05 A;  1YHM A;  3M00 A;  3N1V F;  3WCC A;  3WJN A;  2J1P A;  3ID0 A;  2QIS A;  4H5E F;  3V1V A;  5ILZ A;  1YJ4 A;  3WSB A;  1HM7 A;  4Q23 A;  3SDV A;  1PS1 A;  3LMD A;  5B0K A;  4KK2 A;  4UMJ A;  2FTZ A;  4LPG F;  3WC9 A;  1HXG A;  5E8K A;  3TS7 A;  2ZCO A;  4EA0 A;  4P0W A;  3NPR A;  3WCA A;  5DJV F;  5ERM A;  1N1Z A;  4KQU A;  5CG6 A;  5DGM F;  3SDT A;  2Z4X A;  5IVG A;  4DWG A;  3KRO A;  5B0J A;  3W7F A;  5DGN F;  4DZW A;  1YYQ A;  4F6V A;  3N3D A;  3ACW A;  5A0J A;  3KRO B;  4F6X A;  4LFG A;  3LOM A;  3WE9 A;  3N0F A;  3AQC B;  4KVY A;  4F62 A;  3ICK A;  4FJQ A;  4MC8 A;  4KQ5 A;  2E94 A;  3PYB A;  4KFA A;  2E93 A;  3NPK A;  3AE0 A;  1YYR A;  4OGU A;  3B7L A;  3OAB A;  3PH7 A;  5B0L A;  3QKC A;  4KQS A;  3P41 A;  2DH4 A;  3N45 F;  3BNY A;  2AZJ A;  5ILH A;  3WCL A;  4KVW A;  2FOR A;  3P8R A;  3WCJ A;  4GP2 A;  2I19 A;  5DJR F;  5CG5 A;  4L2X F;  1HX9 A;  4KPD A;  4KUX A;  3N5J F;  1V4E A; 
#chains in the Genus database with same CATH homology
 3KB9 A;  3QQV A;  4KVD A;  2Q80 A;  5HN7 A;  3M0G A;  4LPH F;  1YQ7 A;  4JZB A;  1YYT A;  4LOB A;  3KRF A;  1N23 A;  3N3L F;  3P5P A;  3DYF A;  4XQR F;  1VG2 A;  3VJ9 A;  1WL2 A;  2Z7I A;  3TFN A;  4NKE A;  3DYH A;  2OPM A;  5JA0 F;  2F94 F;  3IBA A;  4QXS F;  3KRF B;  5ILD A;  5EAT A;  4EA1 A;  4JYX A;  2E95 A;  3MAV A;  3RBM A;  1V4I A;  4WK5 A;  4LA5 A;  1DGP A;  3LLW A;  4DXJ A;  2E8V A;  2Q9Z A;  1WMW A;  2F8Z F;  3WEK A;  4N1Z F;  2E8U A;  3KRA A;  5DIQ F;  5HN8 A;  3ACX A;  5IKA A;  4KWD A;  5B00 A;  4DEM F;  2Z78 A;  1EZF A;  3BNX A;  4MC3 A;  4JZX A;  1RTR A;  5JV1 F;  2AEK A;  3LGZ B;  3ZCD A;  3KRA B;  4OMG A;  3CP6 A;  2Z4Y A;  1VG4 A;  4NFK F;  5IM1 A;  3KBK A;  3NF2 A;  5AYP A;  3EFQ A;  3LZ9 A;  3VJE A;  5B01 A;  4E9Z A;  4PVY F;  3AQB B;  3WEG A;  4ZQ8 A;  5E8H A;  4FP4 A;  5DHK A;  4E1E A;  2PS6 A;  4RXC A;  3Q30 A;  1YHK A;  4RNQ A;  3PKO A;  1N1B A;  3V66 A;  1N22 A;  1YYS A;  5B0I A;  1WL3 A;  3WCH A;  2PS4 A;  1V4H A;  4LA6 A;  2AET A;  4OKM A;  3APZ A;  4LLT A;  3VJC A;  5I1U A;  5E8L A;  3WEI A;  2E8X A;  3N49 F;  4RXA A;  5IK6 A;  5HNA A;  1HM4 A;  3WEJ A;  3WCI A;  4LZC A;  5JUZ F;  3V1X A;  3VJD A;  2E8W A;  1YHL A;  3WEH A;  1FPS A;  3EGT A;  1RQJ A;  3N5H F;  4QPF A;  3ZMB A;  3KRP B;  3LGK A;  3N1W F;  3N6K F;  5B03 A;  3UCA A;  4DI5 A;  4LTV A;  3Q1O A;  3IPI A;  2AZK A;  2ZEU A;  4LZ3 A;  4GP1 A;  5ILJ A;  2F7M F;  3Q2Z A;  3MZV A;  4LFV F;  3S9V A;  5ILK A;  2Q9Y A;  3WEF A;  1WKZ A;  1UBY A;  3PDE A;  4PVX F;  3N46 F;  4KVI A;  2OPN A;  1UBX A;  1JFG A;  3G4D A;  3P5R A;  2Z4Z A;  2Z50 A;  3TFP A;  5IK9 A;  4LZ0 A;  2Z52 A;  2OA6 A;  3LVS A;  3ZOU A;  1V4J A;  3ADZ A;  3LJI A;  1VG6 A;  4LFE A;  2F8C F;  4RXD A;  4LTZ A;  3WCG A;  3CC9 A;  2AEL A;  3WCD A;  4HD1 A;  5AHU B;  5AEL A;  2ZY1 A;  3SAE A;  3WCE A;  1N20 A;  3S4J A;  2PS5 A;  3N0G A;  4GAX A;  4NUA A;  2F9K F;  4EA2 A;  1UBW A;  2EWG A;  4LIX A;  3G4F A;  3NRI A;  4JVJ F;  4OKZ A;  3SDR A;  3TC1 A;  3LEE A;  1YYU A;  4H5C F;  5HN9 A;  5DZ2 A;  4K10 A;  3RYW A;  3ZMC A;  3PYA A;  4DHD A;  2PS7 A;  5B0M A;  2E92 A;  3OYR A;  1V4K A;  4XQS F;  5B02 A;  3WJO A;  2Q58 A;  3M9U A;  4NG6 A;  3LK5 A;  5H9D A;  5ILI A;  4DWB A;  3ICN A;  2ONG A;  2RAH A;  3WCB A;  4NKF A;  3ICM A;  4LXW A;  4RYP A;  4KPJ A;  3WCM A;  1N24 A;  1YV5 A;  2F92 F;  1HXC A;  2P1C A;  2ZCS A;  4LLS A;  4P0X A;  5IMP A;  2Z4W A;  2VF6 A;  5ER8 A;  3WSA A;  3RMG A;  3SDQ A;  2Z7H A;  2E4O A;  5IL3 A;  3EZ3 A;  1KIZ A;  3LDW A;  2J5C A;  3LSN A;  5AFX A;  3OAC A;  5DHI A;  3P8L A;  2ZEV A;  1WL0 A;  3M02 A;  3KRC A;  1UBV A;  3WCF A;  3KRP A;  4XQT F;  5A0I A;  5JV0 F;  4MC0 A;  3M01 A;  3OAC B;  4OMH A;  5DJP F;  1VG7 A;  5A0K A;  3KRC B;  5IK0 A;  1KIY A;  4JXY A;  5DGS F;  4NFJ F;  2O1O A;  3RYE A;  1JFA A;  5IMN A;  5IL8 A;  2ZCQ A;  2ZCR A;  3VJA A;  4GA3 A;  4P0V A;  5EAS A;  2E91 A;  4LUU A;  3VJB A;  1WL1 A;  5IMI A;  3DYG A;  2H8O A;  3OAB B;  3LG5 A;  5IKH A;  3ASX A;  5IN8 A;  5ERO A;  4H5D F;  2J1O A;  3AQ0 A;  4N9U A;  1HXA A;  3Q2Q A;  5EAU A;  4JXN A;  5KSX F;  3WJK A;  2E8T A;  1N21 A;  1ZW5 A;  5JV2 F;  4E9U A;  1VG3 A;  1RQI A;  1DI1 A;  3ZL6 A;  3ACY A;  4NFI F;  5DW7 A;  4KKM A;  3SDU A;  5ERN A;  3CKE A;  5ILY A;  2PS8 A;  1WY0 A;  2F89 F;  4RXE A;  2ONH A;  3VJ8 A;  3TFV A;  2AZL A;  2Z4V A;  3ICZ A;  2E90 A;  2OGD A;  5C05 A;  1YHM A;  3M00 A;  3N1V F;  3WCC A;  3WJN A;  2J1P A;  3ID0 A;  2QIS A;  4H5E F;  3V1V A;  5ILZ A;  1YJ4 A;  3WSB A;  1HM7 A;  4Q23 A;  3SDV A;  1PS1 A;  3LMD A;  5B0K A;  4KK2 A;  4UMJ A;  2FTZ A;  4LPG F;  3WC9 A;  1HXG A;  5E8K A;  3TS7 A;  2ZCO A;  4EA0 A;  4P0W A;  3NPR A;  3WCA A;  5DJV F;  5ERM A;  1N1Z A;  4KQU A;  5CG6 A;  5DGM F;  3SDT A;  2Z4X A;  5IVG A;  4DWG A;  3KRO A;  5B0J A;  3W7F A;  5DGN F;  4DZW A;  1YYQ A;  4F6V A;  3N3D A;  3ACW A;  5A0J A;  3KRO B;  4F6X A;  4LFG A;  3LOM A;  3WE9 A;  3N0F A;  3AQC B;  4KVY A;  4F62 A;  3ICK A;  4FJQ A;  4MC8 A;  4KQ5 A;  2E94 A;  3PYB A;  4KFA A;  2E93 A;  3NPK A;  3AE0 A;  1YYR A;  4OGU A;  3B7L A;  3OAB A;  3PH7 A;  5B0L A;  3QKC A;  4KQS A;  3P41 A;  2DH4 A;  3N45 F;  3BNY A;  2AZJ A;  5ILH A;  3WCL A;  4KVW A;  2FOR A;  3P8R A;  3WCJ A;  4GP2 A;  2I19 A;  5DJR F;  5CG5 A;  4L2X F;  1HX9 A;  4KPD A;  4KUX A;  3N5J F;  1V4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...