4OKSA

Crystal structure of hepatitis c virus ns3 helicase inhibitor co-complex with compound 19 [[6-(3,5-diaminophenyl)-1-(2-methoxy-5-nitrobenzyl)-1h-indol-3-yl]acetic acid]
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
447
structure length
440
Chain Sequence
FTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTNGDVVVVSTDALGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated strategies for identifying leads that target the NS3 helicase of the hepatitis C virus.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease NS3
total genus 147
structure length 440
sequence length 447
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4oksA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oksA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oksA01
2LCFA 3LA6A 1KO7A 4AYXA 1SZPA 3ZJYA 3DPUA 1SXJD 3U3MA 4JL5A 1VG0B 2NQ2C 2ZRJA 5DNYB 1HURA 3GPLA 2AK2A 1E2PA 1MABB 2J3EA 3DZDA 3PEUA 4GMXA 2PMKA 5DE3A 1NBMA 2QENA 4CRWB 1GWNA 3ASYA 1OT3A 5IRCD 1KMHA 4ZCMA 1QHYA 2J87A 5CK5A 2FZ4A 1R10A 4TSFA 1E2KA 3RVBA 2A5YB 5HZKA 3FMFA 2AL7A 3PJRA 4RD3A 1R8QA 1IN8A 1DVRA 1R4AA 2IYUA 3JZAA 3CWQA 2F3TA 1SXJC 5CB8A 3IKJA 2IHBA 2OAP1 4P4SA 2WJJA 3SJCA 1E2GA 2HYDA 1QHXA 2WVJA 1XWIA 3EIEA 1VYUA 1LS6A 1G7TA 3IBYA 1ESMA 1XJ0A 2OXCA 1KO4A 5L3RA 4IOJA 4XTRA 4FMDF 4P3YA 1NLYA 3K1JA 1Z63A 5E3HA 2I3BA 2BIFA 4OQXA 3W5IA 1KSHA 1DO2A 3I1FA 2VP2A 4IOLA 2QNRA 1Z28A 4RCYA 4TYQA 3U4QA 3E1SA 4ZI2A 4LSGA 2G88A 4QM6A 1SHKA 3BC1A 4URXR 2W0MA 1KJWA 1NY6A 3CNNA 5JJLA 4OQMA 2WMNB 3A4LA 1OV4A 2WWIA 4M0LA 2ZI6A 5DYGA 2JEOA 1JR3D 3KJIA 1EX7A 3MWJA 4DDUA 1XZPA 1U9IA 1Q3HA 4YLGA 1GDDA 4ESVA 2FGJA 2ZU6A 1L2TA 3B1WA 2AD5A 2FGKA 621PA 3M1IA 2GEVA 2GAAA 3K70B 4B3XA 3KKMA 2YZ2A 2F9MA 4LYJA 3GEHA 1SVIA 3Q3JB 4HB4A 1YHNA 2JJ8A 4IDHA 4TYNA 4S35A 5FBVB 4IDQA 2W83A 5H68A 1XXHA 3V00A 2J9RA 2QRNA 2CNWD 4PQRA 3RRYA 4ZDWA 2F55A 4PXAA 4ZIRB 3GJ3A 4JT2A 3MMPA 1GZSA 4WIAA 4EPYA 4MITA 3FHTA 1GKYA 1GILA 4PPFA 1JXMA 1KI2A 5HE8A 3AV0B 4NE2A 3TRFA 3SQXA 3JVVA 2EVWX 5FPYA 4PSVA 4DCSA 3EXAA 4JS0A 1GM5A 1QHSA 1UKZA 3IQWA 3KL4A 4RSGA 1DO0A 4RD2A 1JBKA 4YMTA 2DWOA 2IW3A 2Q0HA 1W47A 1TQ4A 4KU4A 5EQTA 2YKGA 2W58A 4IOKA 4II7A 1II9A 4Q9JA 3W9YA 3AVTA 3JVUA 3PITA 1ZM2A 4OBEA 4YONB 2ONJA 2JLZA 2VQSA 1GL9B 3B1XA 2I4IA 1ZM3A 1G3RA 3GJ0A 1Q1EA 2X8AA 2DWQA 3W8RA 4Y0AA 2C03A 1R8SA 4EPXA 1AZSC 1YR8A 4F38A 1EFHA 2A5GA 2CCGA 4LHYA 1MV5A 4NP6A 4R2IA 3ZIAA 1VIAA 4JKIA 2JLVA 4XD7D 2GAOA 2ZJYA 2PJZA 3L8YA 3RC3A 3PIRA 4EUNA 1MRNA 4LHVA 1SXJB 1MR3F 2YINC 4O3MA 3EZ2A 2B7CA 4Q48A 3BFXA 3UATA 1XD2A 2CK3A 1D8TA 1TAGA 3SE0A 3CF6R 1E2LA 3BBPA 2YOFA 2QTHA 4CVNA 1RVDA 4OI0A 4RCZA 4OJQA 3LVQE 3BE4A 4DLTA 1XTIA 2A3RA 3LV8A 4M8NE 4PSAA 121PA 5AJVB 3VR6A 3VX3A 2O8CA 1GTVA 3X2SA 2WKRA 1ANKA 4LV6A 5BQ5A 5A4JA 4PX9A 2QE7D 2QG6A 3PCRB 2PEZA 3DL0A 1KTVA 3C4JA 3F5FA 4G5RA 5JRZA 1P9NA 3LRPA 1FW6A 2HF9A 4TLCA 3QY0A 3K09A 4KODA 4MUBA 4NCHA 2WWYA 1Z6GA 4Q47A 2RKOA 4ZCIA 5FL3A 2O8CB 2G77B 1JR6A 1AIPA 2WWGA 2HUPA 2JIZA 1E98A 1XXHE 2KI5A 2ORVA 2V54A 4XH9B 4Q7LA 2J5XA 1SVWA 3UMSA 2P2LA 3AVPA 3AVXA 1WXQA 1D6JA 4OKSA 1QVAA 2IEZA 1R0XA 4UKDA 2P0EA 2QP4A 1P2UA 3QQ5A 5J40A 5L3VA 1NIJA 4N0DA 1WE2A 2QPAA 4TLBA 3WYGA 3IUYA 1YZGA 1RRGA 1AM4D 1IAQA 1ZM7A 4Q21A 4QOSA 4URYR 2P65A 4MH0R 1CTQA 2QP9X 1AKEA 1ODFA 3LO5A 2HCJB 4KJZA 1NKSA 2OFWA 3CUEF 2VF8A 1GRNA 4HEJA 1AN0A 3PUYA 4QC2A 3IO3A 1D2NA 1HQCA 3EG5A 3LW7A 4C2TA 4TZ6A 1VCMA 3B1YA 1XCPA 3B6EA 3QXSA 1W5SA 4HAVA 2F1HA 1JEDA 1U2RA 5FPHA 3V4FA 1HT2E 1NVVQ 5CJ2A 1LNZA 5EE9A 4OK5A 5GJVC 4TQ9A 1PLJA 4C0QC 1NLFA 2R62A 1KI9A 3QXCA 3ZD7A 4C0KA 3A4NA 2BBWA 4GNKA 4DSUA 1XMJA 2AHOA 4BRWA 1EG7A 5EXSA 4FMDB 4KI0A 4BLPA 2JDIA 4V03A 1RIFA 3PXGA 5KNBA 3NKVA 5EXXA 4B2PA 4K8OA 1H8HA 1OIVA 2Z4SA 1GNPA 2WZQA 3OEEA 2V8OA 3QG5A 4TLDA 3AVYA 4QBHA 3TAUA 3U60B 2CCKA 3QBVA 3U5ZB 2YNMA 1W4BA 2XB4A 1LTQA 5IT5A 1H65A 4YDHB 5JBQA 1OB5A 2CL0X 3C5HA 2G1JA 1W4AA 2YWEA 3W3ZB 4B35A 5EXTA 4BLTA 1CF4A 5SZJA 2CLCX 1S0UA 2GJ9A 2NO7A 5E7IA 1Z0JA 4R71A 2RGCA 1QHGA 1UEIA 1D5CA 2ECKA 1E9DA 3GEIA 1ZC4A 4IKEA 3GQBA 2OBLA 5CDFE 1AS2A 2JCSA 3WYFA 2XZPA 4A8JC 5TMPA 1MOZA 3SYKA 4GP7A 1MKYA 2JIZD 3RS3A 3ZVLA 1OE0A 4EKDA 5B57C 3HWSA 1DS6A 3DDCA 2NPIA 1NLZA 1Z07A 2FF7A 5IK2D 4QRHA 3TAHA 4M21A 1NVWQ 3QPUA 3WMEA 5AJZA 1YKSA 3KB1A 1N0WA 1HT1E 2VO1A 3FHOA 3UG7A 1NBMD 5FOSA 1G19A 1TUIA 1YZQA 4HDQB 1E2MA 1LF5A 2ZYTX 1CLUA 4Z8XA 4P31A 2AKAB 5JLJA 2H8KA 2LWIA 2EFHB 2RGNA 5JI3E 2ZREA 3GCGA 2QQEA 1UBFA 4D0NA 5L8VA 1U81A 3ADDA 3BRWD 3TLXA 1OSNA 4HSEA 4D0LB 2HT1A 3NG1A 4OI1A 2BMDA 3Q7PA 2J0VA 2G83A 4QGFA 4MDEA 2BM0A 2CK3D 2WKQA 3BFVA 3N2IA 5K8TA 4C0LA 3I62A 3PEYA 2H17A 1CULC 3KJHA 1N6LA 1VHTA 2D62A 4JLAA 3ZQJA 1L8QA 1NVXQ 2ZSDA 2P3SA 4JLBA 3HYTA 3ZQ6A 5HKKD 2DFLA 3FMPB 3GLGB 3QKRA 3TSWA 2QM7A 5FUXA 1Z8FA 3AF1A 2VRWA 4MGYR 2IS4A 3NBYC 4ZKEA 3THYA 3GP8A 3CONA 3IIJA 4W7SA 1NKTA 2BWJA 1GL6A 5LPNA 1VHLA 1W5TA 2NOAA 4Z8YA 3RS2A 2PCJA 4B3FX 2R6CA 1WDTA 1Z2AA 3GLIE 4GOXA 4PC7A 3K09C 1JR3E 1TQ2A 3WNCA 2JGNA 4XSHA 1YZNA 5CK4A 2IC5A 5KSPA 2EFDB 2Z4RA 4FINA 3M0EA 2JLSA 2WPDA 3C41J 3NIBA 4DSNA 2ORIA 3GD7A 2OFOA 2J0UB 4A2QA 4QM7A 2XX3A 1NBME 1CU1A 2RHMA 4IXNA 2FDCA 4I1SA 2J7KA 4PAQA 1OH8A 4L15A 1RW4A 1KZ7B 2ZVPX 1CJMA 3D31A 3NH6A 3OEHA 4BFYA 4C0SA 3FKSD 3EARA 4Q66C 3TR5A 2O8BA 1AJEA 1N5JA 2VTKA 2A78A 4IVQA 5AJWA 1SVLA 1K8RA 3X1YA 1WF3A 1SVOA 2H57A 2X2EA 4KLZA 3TNFA 1OXTA 2WJVA 1XTRA 4HAYA 1FMLA 4FWIB 3G5UA 1QHHB 2GWHA 1L7VC 4TYYA 3OE7A 2NIPA 1KAGA 4OHWA 5EP1A 5EUMA 1CEEA 3HR7A 3T1OA 4D4LA 1BS1A 3C14C 3KKOA 2VHTA 3W6NA 3IEUA 1QG4A 2UZIR 2GBLA 5FR1A 5F2EA 1IJEA 2JLRA 3AB3A 3SNHA 1RE0A 4POAA 3TH5A 4E5UA 1WB9A 4KV9A 5FTLA 3R8CA 1ZVQA 3TIFA 5D3QA 1G3IA 5FUYA 5JRJA 4KCGA 3HJNA 4D80A 3QPVA 2W0SA 4TZ0A 2AN9A 1JB1A 2C99A 3NHBA 4P4SB 1G5PA 1E9CA 2IBMA 3H2YA 3VFDA 4NPHA 5FTMA 2GZAA 1JQJC 1P2TA 2EU8A 3PUVA 4XIGS 3R7WB 4JJKA 3W6PA 4PHFA 2BEJA 4B71A 2ZI9A 3GLGA 5B30A 4DDWA 2OAQ1 4LBWA 1AGRA 5J4HA 1UEJA 4Q9KA 4NDZA 1KAOA 1TL7C 5CM9C 1XPOA 2IHYA 1SVSA 2X1VA 4GMDA 4M22A 4TMZA 4A15A 3KJGA 4JMPA 2GNOA 2RH5A 2ZSAA 2ZI7A 3BH7A 1J8YF 2DY1A 3P4XA 2GESA 2ZETA 1Q21A 1T4GA 5M04A 1RRCA 1TEXA 5E95A 1NMXA 4NCKA 2ZVQX 1IBRA 1F2UB 8OHMA 2ZI3A 1CR0A 4WVFA 3GLHA 4U02A 4F93B 4BFSA 4U00A 3GLHE 4LBYA 4Q7MB 4DB2A 2REOA 1DAEA 3QVUA 4AKHA 4MRRA 3U61B 4CEJA 1GIAA 1EESA 1BO6A 1SXJA 4JYBA 4PPNA 3AM1A 5JI2E 1JJVA 1L4YA 2C5LA 2R2AA 2CHQA 3MFYA 1I4LD 1N2CE 1WQ1R 4I1UA 2RHDA 2OO7A 3LBNA 2J41A 3KTAA 4UXIA 3VMFA 1ZD9A 1KSFX 1J99A 3FKQA 3GLHB 3KJEA 3CWZA 3ZD6A 3C16C 1AK2A 3U7FB 4U7DA 4JSYA 3NDPA 4DLXA 3SHWA 2Y8EA 1KI6B 1E96A 4XD7A 2OESA 3FE2A 3W3AA 4Q1CA 1XP8A 1TU4A 4Q19A 1TMKA 1WP9A 1SHZA 1BYUA 2ZE6A 1M7BA 2J7PA 3EIQA 3L0PA 4BLOA 5L3QB 1CR1A 1RPZA 1G291 1YRAA 2NO1A 2GRJA 2JAQA 2IXEA 3CH4B 3NXSA 4EPVA 2XOKD 4A2WA 4IXMA 1U8AA 4AYWA 1KDPA 5HCIA 1QZXA 5EXPA 3QENA 3BK7A 3UMRA 4DC9A 4PHTA 1LFDB 3SI7A 1RJ9A 5B2ZA 2CVFA 2NO9A 3CIOA 2OZEA 1P2VA 2EW1A 2PLRA 3K9NA 4ESHA 5FL7A 4XSGA 5ELXA 5HE9A 1VCNA 4XWOA 3ETLA 3ZVMA 4LYHA 4OK3A 3AKCA 4LC0A 5EE0A 4PZLA 1G18A 2XNDD 4URVR 5JWHA 4JLKA 4V0MA 4GZLA 2FFBA 1YU9A 4F7WA 3U6KA 3QKTA 4RD4A 3RDPA 3VR2A 2AK3A 4DB4A 2IUTA 1II8B 4M1YA 2YWFA 1AQYA 2XSZA 4MGZR 2IYWA 4DLVA 2CL6X 3MD0A 1E69A 4C9BA 3BGWA 1JEEA 1NI3A 1NRJB 1ZRHA 3THWA 3A4MA 4PSKA 4LJ4A 2QAGA 4OQFA 4B44A 2AWOA 2D4HA 1N6NA 4I99A 1NF3A 2BC9A 1FQKA 3H0KA 2O8FB 4CEIB 2ZS7A 2RGXA 3KQUA 1FTNA 2ZE8A 4X8HA 3ICEA 1XEWY 1KSGA 1JR3A 2VSFA 1HUQA 1IN6A 1WCV1 1XTQA 3BWDD 1UADA 2Q3MA 4D25A 1F48A 4FW9A 1NY5A 1KK2A 4HAXA 4LDJA 3TGPA 1KZGB 4WZAE 4NCIA 1P60A 3B5JA 2PT7A 4HUQB 4NYIR 3CX7A 1IXZA 3U3JA 4JLJA 4D6PA 3KTAB 3S1AA 1HA3A 2PLFA 2W6ID 2JJ1D 2QM8A 5FH9A 4HI0E 4TMWA 2P6RA 1W49A 1X1SA 3KFXA 4HB3A 2GETA 4RFSB 1A1VA 1WA5A 4PC6A 2CCJA 1F6BA 3TQCA 1JQLB 1FX0A 2D7CA 2Q21A 4YXWD 1T3LA 2VHQA 3UK6A 4TMKA 4DSTA 3N70A 5KTYA 2AX4A 2R6GA 4G1UC 3RRZA 3CZQA 2C98A 1NIPA 4IDNA 4A92A 3HU1A 5BWMA 2ONKA 4HLQB 4LBZA 2XGJA 3UXMA 2GCPA 5FR2A 5KO2A 1KO1A 4GRAA 1P4SA 3P20A 4MDFA 1G6OA 1M6NA 3LVRE 3ONWA 2IXFA 2IYRA 4QG7A 5LBIA 1E2IA 1YR7A 1ZW6A 1LF0A 1T9HA 2FH5B 2QE7A 1DAHA 2D2EA 4M1OA 1ZBDA 5KSOA 4DBLC 2RGNC 4NU0A 1E2DA 3QKSB 4QGHA 2W6JA 4Q1AA 2ODEA 1OH5A 2YOGA 1GG2A 4QJ3A 2IA5A 2O5VA 4XJXA 2XTMA 3NVAA 2OBMA 2QT1A 4Q4LA 1HTWA 5A5GA 3SYNA 2F1RA 4I1VA 4LGMA 4IFEA 1X3SA 4O25A 2MMCA 4UNQA 2CE2X 3IHWA 5KHOC 2BMEA 1E2JA 3UPUA 1H8EA 3QKSA 1MO5A 3BD9A 2NO0A 4TTPA 4Y0VA 1QF9A 4DT1B 4EIWA 5BN4A 3LFUA 1TF5A 1J90A 1K6MA 4G01B 2QBYB 1LS1A 3ZLJA 1BMFA 3U44B 2WKPA 4UQOA 2DFNA 3QXXA 3THYB 4EPRA 5FOVA 4NCNA 1DEKA 2QORA 3MJHA 4CT4B 1XPRA 1WBDA 1JAIA 2GILA 1H8HD 3HPQA 4BASA 3FYHA 1Z6TA 2IYLD 2O8BB 1W1WA 3ND8A 4W5WA 5CB6A 2ZSFA 1KI4A 1XTJA 2NGRA 5FTNA 1DBSA 2ERXA 2WOJA 2A5DA 1XMVA 3C8UA 2ZU0C 3IQXA 3RS0A 4NKRA 1GRRA 4LX0A 3K70D 5SZHB 5CIWA 3CPJB 4RKFA 3RANA 3RHFA 3TQFA 2WJHA 4QXAA 1R0YA 1KO8A 1Q3TA 4LHWA 4RD6A 1OXXK 2HF8A 1CJKC 1OH7A 3X1WA 1E9BA 2VP4A 3M4YA 3SU8A 4QGGA 1FMJA 4NYMQ 4UNPA 1U8ZA 3TUZC 3I73A 1M8PA 2X2FA 2ZE5A 4UNSA 4H1VA 4PANA 1ZC3A 3AF2A 1N5LA 3BS4A 4D2IA 2FNAA 3DKPA 1KHTA 5B64A 1YQTA 1VKJA 4Z54A 1D9ZA 3WP1B 2O8DB 3TSZA 1TQ6A 2G6BA 4KAXA 4WXRA 3A36A 3DEFA 4EPTA 1GKIA 2C96A 2TMKA 3QKRB 4KVGA 5C4GB 3R9WA 1TNDA 4ZPXA 4MRNA 2V1UA 2HCBA 4IHQA 4Z1MA 1YZUA 3AKDA 3REFA 4PFSA 2JLYA 4TL8A 3P1JA 3GLFB 2QEQA 4KYIB 4BPBA 3RSLA 2ATXA 2VSOA 2ZRHA 4Q9LA 4PPGA 4UNNA 2PZFA 1R5BA 3HU3A 2QROA 3EASA 1O87A 2BM1A 2R8RA 1DARA 4LZZA 1WRBA 4HLUC 4OHVA 3AVOA 1VMAA 3Q5DA 5DIFA 2ZR0A 3EW9A 5D3MB 4CW7A 1P62B 2IF0A 2KWIA 2RGEA 4B73A 2ZS8A 2ZPTX 3EZ9A 1GOTA 2OEPA 4TSFD 1T8TA 4ZV4A 5GVRA 3KXLA 1S3SA 4FCVA 1GNRA 4IDPA 4FN5A 2X19A 1S9DA 4O0MA 3VHLB 5K8IA 3BB1A 4HB0A 1OLOA 1KDRA 4N1AA 4JL6A 4R98A 4ZCLA 2RGAA 3CRW1 4JLDA 3P4YA 5IF9A 4TL6A 4A0HA 2QPTA 3LBHA 1YE8A 4JL8A 4B76A 3T1TA 1T91A 4TTQA 2ZAOA 1SXJE 1CJTC 4R7ZA 4BRUA 4CT5A 2BJVA 4HUTA 2XTNA 4BEBA 2FOLA 3TJZA 4JLPA 1Q0UA 1V5WA 1LB1B 3L0OA 4MKIA 4HAWA 1G7RA 2R6AA 5FFMA 4PC1A 2QUZA 1E1QD 4TT3A 3EA5A 4P32A 2JATA 4GT1A 2XJ9A 3DM5A 4JBWA 5GADl 1UKYA 2G3YA 2PX0A 2H1LA 1R6BX 4BFVA 3TUJC 1X8JA 1KI8A 1G21E 2ORWA 2WHXA 3EA0A 1SULA 1E3MA 1G41A 3CF0A 3T06B 3CRQA 4TLAA 4CZ2A 1GSIA 1VIYA 4H1UA 1GITA 2GCNA 4CYMA 2E1RA 4MKFA 3T15A 1G20E 1P73A 5F3WB 2E9SA 2GHIA 3RC8A 4HAZA 5CDFA 4J0QA 2QL6A 3SBDA 3O8DA 3LDAA 4Q4JA 1CS4C 5DI3A 1HY3A 2J1LA 2HJGA 3IIKA 4LJ6A 2ZRDA 4MYUA 4CF7A 2O8EA 2IF2A 1HEIA 1DAKA 2JDID 3QE0A 3W34A 2DFTA 1OXUA 3OE7D 3A37A 3GJ7A 2V7QA 3KQNA 3FPAA 4KFUA 1KY2A 1FP6A 3GJXC 3WP0A 4TWZA 2C2HA 3TBKA 2RGBA 1LV7A 4BFXA 4Q1FA 3GJ8A 4QFMA 2ZXUA 1XPUA 1J70A 2K5UA 1HQYE 1DE0A 2OT3B 3EZ6A 3KFVA 3H84A 3LBIA 1P2SA 2UKDA 1P9WA 3OEHD 5DO9A 2H5EA 2ZJBA 5FI0B 4GOKA 1V43A 2CDNA 2XNDA 5AJXA 5TY0A 4TQAA 2JLWA 1G8YA 3IDQA 4ILEA 5CYPA 2V7QD 1OYYA 1XXHB 1G16A 2BKUA 3MUFA 1A7JA 1AS3A 2Z83A 1RZ3A 2IYZA 1DAIA 2EWVA 4Q1DA 4ZIRA 2FE4A 3PEVA 1N6PA 4FMCF 2GF0A 1U9IC 1E1QA 2QZ4A 3DO6A 4Q03A 3TVTA 1ZCAA 1UDWA 1LVGA 2GZDA 3OFND 4V0OA 2F1IA 1OXVA 3OHMA 5FBWB 3CX8A 1PVOA 3LY5A 3AVWA 3KX2A 4N3NA 4A0GA 2CVHA 4L9WA 2FWRA 4W5JA 3RLFA 3QIAA 1KI3A 4UJ5A 2FN4A 1FUKA 1OKKD 2XITA 3K0AA 4NYMR 1XJCA 4UXJA 2NG1A 1G7CA 1XX6A 5DHFA 4MRSA 2NZJA 1C9KA 1DAGA 2VHJA 4TT3D 4DVGA 2LKCA 3T35A 1H8ED 5FUWA 2B92A 1OXSC 5EP3A 4LI0A 4MGIR 1F3OA 2F43A 5DH9A 4EQ6A 2WJYA 2IXGA 2NZ8A 1D2EA 2ZIAA 3H4MA 1Q1QA 4M1TA 1ZNYA 2QMEA 3EWAA 2IYTA 4PC3A 3MGCA 1S2MA 1CRQA 2VPPA 4Q7KA 2QP3A 2SHKA 4O2RA 1XNJA 3KDSE 4LV5B 1QVRA 2FX3A 2XEXA 2YOHA 2ZUCA 4KLNA 3NEYA 4LJ8A 1NL3A 2BCGY 3UANA 1PLLA 3CX6A 1X8LA 5AK0A 2ZRCA 4TL9A 3NC0C 5GJCA 1ZIOA 1KKLA 5BYKA 1CP2A 2GKSA 1UFQA 4OL0A 4TYPA 3T12A 3B9PA 3GLFA 2D7DA 3EWSA 3OAAD 4P0TA 1Q1ZA 4MKHA 3RRMA 1HE8B 2QQ0A 4LK2A 4WBSA 2Q3FA 5DGXA 3VU9B 4DUGD 5JMTA 1N5IA 5J4LA 1YVDA 2GZHA 4OHZA 1PJRA 1E6CA 3LD9A 3ADBA 2QBYA 2IUSA 3CPEA 4RFVA 1RC8A 2JLQA 2FSIA 4OHXA 4Q7JB 4JLVA 1N6OA 2IYQA 2OCPA 3P27A 1GVNB 2A5JA 1UBCA 2QTVB 3B1VA 4LPKA 1R5NA 4DIDA 1B0UA 2CMKA 2WOOA 1KI6A 5JECA 4LJ9A 5EUQB 3RABA 1GFIA 1E2NA 4RY2A 4DZZA 1Z47A 1ETUA 4N0EA 2CJWA 1G3QA 1XEXA 1KNXA 3HP1A 4HZUA 5BN3A 2VL7A 1N6RA 2VHUA 1ZNXA 3KB2A 2VP5A 2OXRA 5G3YA 1OH6A 3RSOA 2ZR9A 3RRNA 2PBRA 1J8MF 3I61A 3U7HB 4YMVA 2ZROA 2AXNA 4BFTA 1SVMA 1IQPA 1NVUQ 1XRJA 5HCNA 3PG5A 2OUKA 3HYRA 1CXZA 3U3RA 1QBKC 2CJWB 4V0ME 3PEWA 1CRPA 4DCUA 1E4YA 1ZUIA 4NONA 5AJYA 4JVSB 2QAGC 2FFQA 1N3BA 3BH6A 1TADA 1RFLA 3I32A 4B2IA 4E07A 5EJEA 4Q18A 1Y3AA 2EQBA 1P61B 3UWKA 4U5XA 5J5CA 2GA8A 2WAXA 3OIWA 4AY2A 4JKYA 1FZQA 2BMFA 4OI2A 3ZS8A 4IJMA 2W2XA 5GVSA 4Q00A 2WTUA 5JS8A 3TW4A 2PX3A 3OESA 2VF7A 4Q1EA 4ASUD 4AD8A 3A1WA 4B75A 4GZMA 3LLMA 4DDVA 3BIFA 4B74A 2ZRNA 4B33A 2C8VA 2IT1A 4ITRC 5J4YA 3MG9A 3ZS9A 3X1ZA 3Q85A 4G5GA 4ERNA 1YR6A 1W0KD 3IBGA 1OW3B 4B47A 1W2GA 3VQTA 4AURA 1CKEA 3B82A 3FGNA 4PO8A 2HLDA 1FNMA 3CM0A 2QSZA 1U0JA 5HTKA 2VBCA 3Q8XB 1YRBA 3A1SA 3B1ZA 2ZYVX 2YJTD 1JNYA 1EWRA 1GAJA 2XTZA 3EZFA 5FTKA 4GI7A 3UWOA 2RB4A 1NVVR 2AD1A 4KVAA 5KSZA 1XTKA 1ONBA 3S1AB 4YDSA 4LHXA 1W36D 2ZRAA 2QMUA 1N6HA 5EE1A 2XZLA 4DCNA 4DUGA 3TKLA 3ICQB 4G0NA 1QHHA 2ZUDA 4P4TA 5G53C 4H9GA 5FPSA 4HZIA 5AWFC 4DLZA 1W46A 4JLMA 4HYYA 1E0SA 1FX0B 4EJSB 4IDOA 4Q4AA 4AG5A 1E79D 4E03A 1II0A 1R7RA 5C46F 1A4RA 3I8SA 4P33A 4UXHA 1T8UA 5K8UA 1NMYA 1K5GA 4RD1A 4QL3A 4WZBE 1W36C 2ZAMA 3MWKA 4FMCB 1JXOA 2P67A 4V0NA 2OLJA 3DMDA 1IN4A 1FTSA 5CLQA 2WWXA 4FIDA 4IRUB 4M9ZA 3CNLA 3D7MA 2I1QA 5BXQC 1EFRD 3LQRA 1S9HA 4KFTA 3BAFA 4MYTA 2NPFA 4B3GA 5FUVA 4F4CA 1R2QA 3K9LA 2G0TA 4B34A 1O3YA 3B9QA 4V02A 2V6JA 3AF0A 4YMSA 1US8B 3CR8A 3LLUA 2FPLA 3K70C 821PA 1WBBA 1DTSA 1MO3A 3CRMA 4JZKA 2ZJZA 5H70A 4PQYA 5KDDA 3KKNA 1KMHB 3ZDQA 1VYVA 3SDZA 3SN6A 1RKBA 1UBGA 5AUOB 3L2OB 2DYKA 4PPQA 2IS1A 1Z22A 3CW2A 3ADKA 3SFZA 1XD2B 3QVVA 1XEWX 2Q3HA 2AFIE 3L82B 4OK6A 1FUUA 4PR0A 2F1JA 1Q44A 3K8YA 4G5OA 4F4IA 2EFCB 1DG1G 2VP6A 2D2FA 1ZNWA 1E1RD 4KO8A 1UJ2A 2ZRIA 1MH1A 2VEDA 3OF5A 1TEVA 1FFHA 3EPHA 1XBTA 4CDGA 4JVNA 3CNOA 3CKLA 2J59A 1NG1A 1II8A 2F3RA 1I4DD 4HZUB 4RJLA 4DLRA 4LBVA 1T0JB 1YJ5A 5E4FA 1S1MA 1BKDR 5KDLA 3EC2A 2O52A 1ZMXA 3PUXA 5TB5A 2FU5C 1UAAA 2B21A 4XVQA 1F2TA 1N6KA 1VG1A 2CNWA 2O0HA 4GPTA 4PZZA 4E09A 2ZANA 721PA 4RZUA 2XXAB 4JSTA 4LJYA 1IY0A 1SKQA 1G8PA 1ZJ6A 2GJAA 2JJ2D 3ASZA 1S1CA 5G41A 4C0BA 1ZNZA 4DLYA 4HB2A 4KSCA 1G5TA 1NJFA 5JHGB 1VDZA 4EJSA 1KDOA 1GNQA 1XEXB 3W8NA 1XCGB 4R2HA 5J4KA 1G1MA 5DLQC 2V3CC 1KGDA 4OQLA 2XOKA 1ZD8A 1TUEA 2ZYWX 4M1KA 4C7OA 3GJ5A 2W2VA 3VR3A 3VKWA 4A0RA 4RZXA 4DEXA 4JBXA 3D6TB 2OLKA 4IW3B 4HATA 2YWGA 1J2JA 4DLUA 4DHEA 4S2EA 5TARA 1IN5A 2NO6A 1W36B 1Y63A 5L3QA 1P3JA 3I3SR 2ZTSA 3CRVA 3THOA 1IHUA 4F92B 1QG2A 2QU8A 4O2LA 1COWD 3QSYA 2V4ZA 1DOAA 1N5KA 4JLOA 4QHSA 5L3SB 3IO5A 4LPSA 4BQSA 5JEDA 1C4OA 4A6XA 4PQFA 1KK0A 4XVRA 3X1XA 1VCIA 2GK7A 2J46A 3I5YA 3LAWA 2W6JD 2J7PD 3MWYW 1CJUC 1XMSA 2QA5A 3AEZA 5TDHA 3WBJA 1E9FA 1OFUX 5HKKA 4RD0A 1P6XA 4BWYA 4EFNA 2ZE7A 1OPXA 4BLRA 1A2KC 4MUAA 4HDCA 4LC1A 2REXB 4DKXA 3UMFA 1GP2A 1CIPA 1E9SA 1AZTA 1P9RA 3B60A 4LJ7A 5F98A 3BFKA 5JJKA 1EFCA 3WYAA 1G8HA 3KXIA 1G8GA 1F5NA 1E0JA 2RMKA 4MRVA 3BB3A 4LUCA 3WRXC 3NBZC 4DLWA 1X1RA 2Z6VA 3IPYA 4TL7A 1YZTA 3G82C 1KKMA 3MLEA 3CF2A 3Q5EA 4NTZA 1Z08A 1AGPA 3Q9LA 5DN6A 4GDFA 3B78A 3KQKA 1KIMA 1KMQA 2VYFA 1XF9A 4A82A 3G0HA 3A6PC 2OCBA 2GCOA 2GTPA 5SZKB 2JASA 4Z1MD 3VKGA 3QEJA 3SYLA 4W9MC 5FOXA 5JSZB 3SR0A 3CB4A 2Z43A 2XJ4A 3FMOB 4QHTA 3X1DA 421PA 1E32A 2QGNA 4ZKDA 221PA 3NBFA 3NWJA 4EPWA 4A6PA 5FBLB 1QRAA 1E2HA 3A1UA 2H18A 4C7OB 4HLCA 1U8YA 3SQWA 3PFIA 3RS4A 2H7VA 4CEJB 1I2MA 1IY1A 3B8HA 2GCOB 2V6IA 3KUDA 3ZGXA 3RWMB 1EGAA 3NTUA 3K0AB 3K53A 3QXJA 3U7EB 2HT6A 3L0IB 5FOTA 2WSSD 3QF4B 2ODWA 2G1KA 3O8BA 2ZJAA 3FMIA 4QJ5A 2CHGA 4QNMA 3CR7A 1RJ9B 3DZ8A 4QBFA 4ASUA 1OB2A 1YZLA 5UKDA 4X8LA 2PZGA 2ZRLA 1EFTA 2J0QA 3BORA 5DI3B 1VCOA 3QBTA 4TMVA 2J45A 2DHRA 2IEYA 4TMTA 3W90A 1LW7A 3I92A 3EX7C 1UBEA 4KYUA 2ZRGA 4KBGA 2VHCA 4AKIA 2DFKB 1KK3A 3RAPR 2G9NA 2CE7A 2XAUA 5JZVA 1KK1A 1XD8A 3QXHA 2VP9A 5KPDA 1W4CA 2IUUA 2KSQA 3U44A 3KKPA 2HJVA 3I8XA 3KUCA 5C1BA 3MRSA 3KXKA 3LWNA 4NL4H 5LB2A 4D81A 5C4MA 5K8LA 3O8RA 1P5ZB 3LX8A 1VTKA 4CIDA 4BE7B 3D8BA 4WXPA 1T6NA 2ZRMA 3EZ7A 3V9PA 1BIFA 4WOPA 5CLLA 3WY9A 4YQFA 2OSBA 3AGPA 2QAGB 4MYCA 1QHIA 4MGKR 1AA9A 1NN0A 1KI1A 1E2FA 3ND9A 1N6IA 3K0SA 4I1OA 1RYHA 1S4QA 1IXRC 3T61A 4BZXA 3EPJA 1BYIA 1NN5A 2ZM5A 4M1SA 5C18A 2GDJA 5FOUA 3GLIB 1SQ5A 1W0JA 2QTFA 4OJKA 3VHXA 1KI7A 5CYOA 1ZM4A 3E5HA 3BERA 1Z0IA 4UJ3A 2OBNA 2ATVA 4NCJA 4RZ3A 1NSTA 4DJTA 3AF3A 4LRWA 3U3KA 1MO6A 3HU2A 3SS8A 2Z5FA 2E87A 3B7GA 3C5CA 3DOFA 2IS2A 1J7KA 5H1YA 1W4RA 1KOFA 3SOPA 4US2R 5JCPA 2C78A 4NBSA 2R9VA 4TLEA 4NHOA 4FI3C 1EXMA 3SBEA 4TMXA 1G3UA 1MABA 2WIAA 4G3XA 4DEYA 1K5DA 2IYYA 2FSGA 2HXSA 5IHPA 2AXPA 2PMDA 2G0NA 2OCAA 3SHFA 1RRPA 4L5BA 2QPOA 1A2BA 2BBSA 3QF7A 2XNSA 3TR0A 4B3DA 1E4VA 4NYJQ 1M1YE 5JWRA 2YVUA 3IILA 3FOZA 4URWR 5FPKA 2P5TB 1TU3A 4HLDA 2XZOA 4ZDKA 1E2QA 2QRZA 3SC3A 3CO5A 2BJWA 3VR4A 4LV8B 4QBIA 2WJGA 4Q4HA 2A9KA 4YMWA 3WMGA 2ZI5A 5KUTA 4URZR 4MYHA 1ZIPA 5IK2A 3AVUA 1OKKA 2D06A 2W6IA 4Q9IA 3GLFE 1NG9A 2GVDC 1W48A 1FNNA 3AP3A 4JIMA 3ECCA 1M74A 1VYTA 1XEFA 4Q01A 4BLQA 2PCLA 5GJWC 4B3CA 4IOMA 4M1MA 2V1XA 2WWWA 1G17A 1KJZA 3QPWA 3Q7QA 2WSMA 3T1VA 5FPTA 2N46A 3UKDA 1EX6A 2DB3A 3OIUA 5DSZA 2YYZA 5JSZA 2Q9BA 3F3YA 1JAHA 4TYWA 1Z2CA 3B2EA 3PV0A 2JLXA 3WRYC 1N0VC 2ASEA 3BOSA 4Q5IA 3TE6A 4DLSA 1T5IA 2GBLC 3DOEA 2FSFA 4C3ZA 4CEHA 4FCWA 3WHLA 4RKEA 3VX4A 3GFTA 3MWLA 3N5CA 3AGQA 5FTJA 2WM9B 1NSFA 5KOYA 2CHVA 2WBLC 3OEED 4Q4AB 4M9XA 5FBQB 3K0CA 1G64A 1VPLA 2ZRFA 3T5GA 1W44A 2YHSA 5EP2A 2J0SA 4ZDIA 5DI9A 3KKQA 3WHKA 2WWFA 3AUYA 2WSSA 3QKUA 4HAUA 5DHAA 1AS0A 5TV2A 3KQHA 1F2TB 4XTCS 1XFAA 3LNCA 1OJLA 1KNQA 5LD2B 3MAAC 5CIQA 4GL2A 2BBOA 1HV8A 4BEJA 1R0WA 3I5XA 4FMBB 3TSOA 3F8TA 4BLSA 1NN1A 1UM8A 4C30A 4V0LA 5EE5B 3SEAA 1XCMA 1XMIA 2ZJ8A 2XB2A 1G4UR 2ZSEA 2GJKA 2UZ3A 3B13B 4GSYA 3VR5A 4BZPA 1RRFA 2ZS9A 2BHRA 2FEOA 3U6BA 1A82A 5KNDA 3T34A 5GJBA 2PZEA 1BMFD 2VA8A 2GXAA 4WW0A 2O0KA 2PT5A 3EAQA 3N2EA 3ZVRA 2C9CA 3AVQA 3DMNA 4EQ6B 2ZJ5A 1DG3A 3FDIA 5JWOA 3Q72A 1F60A 2WAYA 2ERYA 3A58B 3WNDA 4DXAA 4LYFA 2WV9A 4Q4HB 3MSXA 4M53A 2AKYA 3R20A 3C7KA 3H86A 1XU4A 1Q20A 3RNLA 3P26A 3KZ1E 2J0UA 2P6UA 3QNUA 2Q9CA 1JECA 2RAPA 4JT4A 2RGGA 1QDEA 3AKYA 1Q22A 2CBZA 2PL3A 4A36A 1L4UA 2B8TA 3ZZ0A 4HLUA 2BMJA 1W0JD 1ZU4A 2IS6A 4DSOA 5F9HA 1B23P 3REGA 1ELOA 1XD9A 1I2DA 3FVQA 3ZZTA 4MKGA 3LX5A 1IXSB 5EZ5A 5KNCA 4C0JA 1M7HA 3MJRA 4NH0A 1TF2A 4OHYA 2P5SA 3NHAA 4I81A 2ZITA 4JVLA 4QKQA 3THXB 4M2LA 3O8CA 4JLNA 4RZ2A 2CLSA 4PHHA 2C9OA 1X86B 2OE2A 1Z06A 3FTQA 4ON9A 3P32A 3AUXA 3GLIA 4M9QA 1HYQA 1Z29A 3T1QA 2QY9A 5A0FA 2QGZA 5BYJA 4NYJR 4D0GA 4LHZA 3NC1C 1R5OA 5G3ZA 2HLDD 4IVPA 4XWAA 3ZIAD 2FA9A 3IGFA 4OYHA 5H8WA 1IM2A 3CZPA 1Z6YA 1Q1BA 2JJ1A 3PR1A 4C4PA 1W0KA 2VH5R 2HYIC 2BVNA 3O47A 3IPXA 1FQJA 4Q9HA 4D26A 4DCVA 1FL9A 1P7CA 1EK0A 2R65A 3TK1A 4G5SA 2JLUA 2EWWA 4PHGA 1RYFA 2GEUA 2ZRKA 3QG1A 3TW8B 1Z0KA 4ZO4A 1OFTA 2FG5A 1W2HA 2R6FA 1ZINA 5TXGA 4DIEA 2UVQA 2QAJA 4R9UC 4FWTA 2HXYA 3M6AA 4B3BA 1GUAA 1G6HA 3HDTA 1JALA 2FPMA 4A8JB 3NH9A 1SKYB 1OIWA 2EYUA 2GVZC 2Q9AA 3A1VA 3QOFA 1T5LA 1PUJA 2IYSA 2BV3A 2BEKA 3EIHA 2WICA 2R44A 1MO4A 3CRRA 4BFZA 3AVVA 1CBUA 3PVSA 1BH2A 1TX4B 3DVLA 1NMZA 3GJ4A 1SVKA 3FKSA 4KFRA 1LY1A 3L0SA 4OQNA 1BOFA 4QNRA 3ZH9B 1ZU5A 4M1WA 1PUIA 1UPTA 3ADCA 4C0AC 1T3HA 4FD2A 3GLGE 4AG6A 1DPFA 1OFIA 4D82A 1VG9B 2FPKA 1G4AE 4AIIA 2CL7X 4MRPA 1ZAKA 2WPDD 1E1RA 2FFHA 1PZNA 3K9GA 4URUR 4XVUA 5HZHA 2CEAA 1VG8A 3CPHA 2B7BA 1JI0A 1E9RA 1UDXA 5AUQA 3AP2A 1KSJA 4IFBA 4D4JA 3AQ4A 1UF9A 2OHFA 2V55B 3E2IA 2IYXA 3PQCA 1S96A 1ZP6A 4FCTA 3SJAA 4ACBA 1E2EA 4PTLA 1T3SA 2ANBA 4PAMA 2IWHA 2ZQ5A 4AK9A 4DWJA 3AF4A 4B48A 4A0FA 3K0EA 4KITB 2MSCB 5FOWA 2QN6A 3TMKA 1ZYUA 4JYCA 1M34E 4KBFA 4WAUA 5DN6D 3AH8A 1MT0A 4ARZB 1Z83A 1JPJA 1KY3A 4A1FA 1M7GA 2NTYC 1GRQA 5E7MA 4QJ4A 4IEIA 1XTSA 1IOZA 1C1YA 1XJQA 2RCNA 3WNBA 1Q12A 3B85A 1Z0AA 3H1TA 3RYTC 3IIMA 3U7GA 5P21A 1SKYE 4AWXA 4BGDA 3QF4A 2VP0A 1IONA 2W00A 2Z0MA 3EC1A 3RS5A 6Q21A 1TTTA 3SFVA 3GFPA 4NMMA 3LW8A 1Z3IX 2KE5A 4ARZA 1G8FA 4L9SA 3FB4A 4YXWA 1E79A 1M2OB 1US8A 5CITA 1N0UA 1NNEA 2GJ8A 4Z51A 1ZUHA 2KB0A 3DM9B 1G3MA 3VR1A 1U98A 2BCJQ 5DISB 3MCAA 1U99A 4B6EA 2AWNA 2KJQA 1G5RA 4GOJA 4A8JA 1T0HB 3THWB 1KO5A 3GFOA 4TN1A 3HPRA 4A4DA 3FHCB 2YWHA 3OIYA 4EJSC 4PC2A 3CBQA 5EP4A 1E9AA 4BZQA 2L0XA 2QT0A 4Q4JB 2ZUBA 5EZ6B 4EAQA 4L4UA 3OFNA 4NYIQ 1IJFA 2R6DA 3QEOA 4K81B 3TVDA 2QI9C 4Q02A 2ZSBA 5AUNB 5JJIA 5KDOA 3C15C 5JCZA 1A5TA 4LWZA 5AR1A 5AUPB 2JJ2A 2OFXA 4LYAA 2N1BA 3LXRA 4A2PA 2IYVA 4CEHB 5LB4A 2H16A 3R7WA 2XXAA 2REBA 2ZEJA 5B58C 2GJSA 4AI6A 4CEIA 3QUSA 3K0CC 4L16A 5BN5A 1HH4A 2FJUA 4WZ6A 4UNRA 4I4LA 3HR8A 2PH1A 2FEMA 2A7QA 1DAMA 4D4KA 1U0HC 2RGDA 2GF9A 3SZRA 3ZYCA 2WJIA 2ZRBA 4DCTA 5BW8A 1U94A 2IX3A 1Z5ZA 2YC4C 4XOIA 3R9XA 3VU9A 2ZR7A 2OILA 1E0KA 3TUIC 4V0KA 2CLDX 4PO1A 2KBFA 3T5DA 2X77A 3VTKA 5FL7D 2F6RA 2QSYA 5SZIA 2XSZD 4ABYA 1JPNA 3WMFA 1KJYA 2GK6A 1ZUNB 2A2ZA 2MSEB 4NZYA 4RFSA 4ACAA 3FFBA 2V9PA 1Z6XA 5J4VA 5LDDC 1WMSA 3L43A 4TTRA 2W2TA 3A1TA 3A8TA 2WWHA 2DWPA 3SJBA 2OV2A 3NBXX 3ZZUA 3I4LA 3J81k 1S8FA 1E9EA 2OCYC 2EFGA 4MA4A 4DDTA 4GP6A 3RS7A 3GMTA 3VAAA 2ZI4A 5JFGA 1OFHA 2HEIA 3AKEA 4G5QA 4AKEA 1W7AA 3VNVA 2F43B 3GJ6A 2A5FA 4M4SA 5HPYB 3U2QA 1MRSA 1VECA 4YC7A 2D74A 3PUWA 2BDTA 5JHHB 1OHHA 1GKUB 2GXUA 4AKGA 2DR3A 1EFRA 2O8DA 4US1R 1D2MA 2VIIA 2D3WA 1AKYA 2C95A 4EFLA 2C9YA 5IDVA 1E0AA 4L8GA 4X8MA 3CH5A 4DRZA 1DELA 2I1VB 4B32A 5FI1B 1XZQA 4IVRA 3BH0A 5TVKA 5HR5A 2KBEA 1FPMA 2N42A 3CLVA 1R0ZA 3AP1A 1NJGA 2BKEA 2LKDA 4JVMA 1ZM9A 4KFSA 2AFHE 5E7JA 4EDHA 2PEYA 5G40A 1PLKA 2C04A 2GXSA 1AQUA 2OG2A 4Q1BA 1DAFA 1SGWA 4M9SA 2O8EB 3PUZA 1S3GA 4D4MA 4PO9A 3W6OA 4EFMA 1OYWA 3UG6A 4BECA 5F9FA 1ZCBA 5KSYA 2EFEB 3LH5A 5FBRB 3U3OA 2IL1A 1COWA 1TQDA 1OHHD 3EPLA 4HUQA 1N25A 3IHLA 1OIXA 2F7SA 1EWQA 3BJIC 1P75A 5ANRB 2QMOA 4QGAA 1CJVC 2EYQA 4B2LA 4LOAA 2MSDB 2P6NA 3NEJA 2IK8A 4QHYA 5L3SA 2PJRA 4PAOA 3WXMA 1OF1A 3I72A 2ZRPA 3K0FA 4B6FA 1CR4A 3UIEA 3DKVA 4LY6A 1P72A 4W5HA 4F4JA 3THXA 3R8FA 3NDBB 1KYIA 2WMOB 4X8OA 1FOEB 5C2JB 1ESNA 3PENA 2AR7A 2DPXA 2C77A 4GFDA 5JEEA 5KU1A 3EPKA 1X6VA 1UKEA 4LJ5A 1PV4A 1I4TD 2FFAA 4K46A 4QBGB 2ZJ2A 3RWOA 2YC2C 2ANCA 1HE1C 1D9XA 2FMXA 3K0FB 4RVCA 4BFUA 1YR9A 4BUJA 3BXZA 4AC9A 4US0R 3LXXA 1KDTA 2HV8A 5KYKA 1EFUA 5CJPA 3IEVA 2B6HA 2BOVA 2ZYUX 3BB4A 2Q6TA 3KQLA 1Q57A 4P4UA 2CXXA 4C2UA 3E70C 2IWRA 4ZDJA 4F91B 3GEEA 4CGZA 1Z0DA 2FSHA 5DYIA 4OI4A 2ODBA 4WA7A 4PZYA 2H92A 3DHWC 4JBYA 1G9XA 1NN3A 2GEDA 3FWYA 4XWKA 521PA 3V4RA 3OIVA 4KHZA 1IY2A 4GBMA 4ZI3A 1Z6AA 4JJZA 3QJYA 4AYTA 4KSBA 1YZKA 3K9HA 4KXFB 2FZLA 1U90A 5J47A 2WIBA 2B8WA 2YV5A 2A30A 3U4QB 4IEEA 3WBKA 2MMGA 1QHNA 1DADA 1ZD1A 3SJZA 4DT1A 3QI2A 4E22A 2ODNA 2DCUA 2O0JA 4LCBA 3D3QA 3JZMA 2ZJOA 1E99A 1FP7A 4FXPA 1JJ7A 2JA1A 3F0TA 5KPJA 2O8FA 5JS7A 1E94E 4BFWA 4MQBA 1TF7A 1XB2A 2GXQA 4LJAA 4C0HA 3OZXA 2NMVA 3ZVNA 5D3MA 1NP6A 3VNUA 1GL7A 3L8ZA 4YMUA 5EE3A 1CR2A 1XDBA 1U0LA 4B43A 3OAAA 4TQUS 2FV8A 1UKVY 4A9AA 1X8KA 2VLIA 4HDOB 3FFAA 2DBYA 2QMHA 1G7SA 1F2UA 5CM8B 2OM2A 3W5JA 5LD2C 2BBTA 3VKHA 3R9IA 2VSXA 2F9LA 3LQQA 1Z0FA 1IN7A 2HDNB 1TPZA
chains in the Genus database with same CATH superfamily
4F84A 2LCFA 2Z9DA 3NP9A 4Y9RA 1I7QB 2ABWA 1N77A 3PICA 1R37A 3HRHA 1DRJA 3ZJYA 4DV4B 4MV6A 3RVDA 5ELLA 2UXBB 2W6NA 2ZRQA 3HDYA 4A27A 2H54A 3UXHA 1RXSA 2ZRJA 2O20A 4ZYXA 2WF5A 3GPLA 3ISTA 5AKYA 1FDRA 3PEUA 4GMXA 1JKFA 5DNDA 5I51A 3RSSA 5DT9A 1GWNA 4GH5A 4BU1A 1KMHA 4JK3A 1TGYA 5LKAA 4LOIA 1SCUB 3KU4A 1JSCA 1GCGA 1P45A 2FZ4A 5CK5A 4OVKA 5LA6A 1ZH0A 3EUEA 4E46A 3RVBA 4MEAA 3ZV3A 3PJRA 2AL7A 2DPYA 2I7CA 1Y1SA 4RD3A 1IN8A 1CDOA 1R4AA 1ORDA 3OZEA 3ZHQA 2VNKA 5AESA 1Z7BA 1F5SA 1T36A 4BVAA 3IAAA 5B3KA 5DPMA 1KR5A 1V8FA 6NULA 2WJJA 4KDRA 3SJCA 4YJHA 1O96B 4MP3A 4NDNE 4TXMA 3K72B 3WJ1A 4WY5A 1XWIA 4L5IA 1VYUA 5PGMA 4DN6A 4KR0A 1CD5A 1DOHA 2QHXA 4MVJE 1XJ0A 3GCZA 2PGJA 3IIIA 5KB3A 2XRZA 2OXCA 1K08A 2D59A 4FHCA 1V35A 5EJ9A 5ADWA 3OQJA 4P3YA 1NVTA 3K1JA 5A7GA 3R76A 5E3HA 4O08A 4OQXA 1HYHA 1JSXA 1DO2A 3QVTA 3PKZA 3GVIA 2OORC 3G2LA 1M8GA 3DE3X 1Z28A 1L4NA 1YOVB 4RCYA 4TYQA 3UAVA 2RH8A 1IYZA 4LSGA 2G88A 3G0OA 1SHKA 1NRWA 3HA2A 4O1IA 4X7PA 4JI4B 1KMMA 5AW3A 4O1MA 1JQDA 2R11A 4R01A 2WWIA 6ABPA 1E58A 4LGCA 4Y9UA 3KJIA 4DDUA 1DRWA 2CV1A 1MA0A 3OQVA 4JXKA 4AS3A 4ENTA 1GDDA 2IJGX 2AJBA 3KSUA 5IULC 4CLDA 1L2TA 4MWBA 4NCXA 2XWBF 1IATA 1YWGO 1NYQA 2HU2A 3M1IA 5GIPE 5IBCA 3K70B 1EGQA 1NUTA 3ZHUA 4AJOA 3ZE0B 4GLJA 1YHNA 2JJ8A 3CW9A 5J63A 3DLCA 3V34A 1EFAA 1DQZA 2AN1A 3DHNA 2NP7A 1GG8A 1B8OA 1V5FA 1XXHA 3OOHA 2QRNA 1BE0A 4WCFC 5GGYA 2CNWD 1PG2A 2A7XA 2VUUA 4PQRA 1IK6A 2VAWA 4CCYB 1X74A 4PXAA 2C31A 1NVBA 4MRAA 1GTRA 4MAAA 4QPCA 4PNZA 4EPYA 4KXWA 4UU1A 4L0CA 4P34A 3KWMA 1U0BB 3CPSA 5KYXA 4P53A 1JXMA 5K9ZA 1TFRA 4LW8A 2I6QA 4BO9A 1RKXA 3WWEA 3L8DA 2SKDA 3P5BA 3MRXA 3T38A 4FYIA 3D8HA 3J7TA 3TB4A 3WXBA 5MGBA 5K0SA 3GUHA 4HGZA 4XSVA 2YWBA 4RVGA 4BVHA 2E7ZA 4MUNA 3Q8WA 4CCYA 4NRDA 1UKZA 5BYBA 4KPEC 4U7TB 2QG4A 4RD2A 3L7YA 1JBKA 4YMTA 1VJ5A 3JQFC 3QV1A 4I6EA 4UPEA 3KO8A 1W47A 1TQ4A 1Q74A 2GLXA 4KU4A 4H7HA 2NUTA 4Q9JA 3JYOA 1U02A 1KXZA 1F8XA 4II7A 3TQQA 4F3KA 3PITA 3STXA 2JFPA 2A9RA 3QVGA 7YASA 1K7CA 3UB2A 3KVRA 5HRAA 4F06A 2VQSA 1F8YA 1GL9B 5C1IA 5AM1A 5ITWA 5KTRA 1ZM3A 3GJ0A 2X8AA 1L5FA 4WQMA 2DWQA 3W8RA 5GM2A 2CXOA 1OLSA 4Y0AA 2C03A 1WW2A 2CLHB 5E2IA 5J3JA 5JW6A 3GT4A 1YR8A 3KZCA 4RDXA 2A58A 2QDXA 1RDFA 4NP6A 2XEDA 3H65A 5A2QA 4TRRA 1Y6JA 4ZALA 3ZIAA 2VJNA 5BSFA 2WTMA 2ZJYA 4PIPA 2HD4A 3MTEA 3PIRA 4QLAA 3FOAA 3IMKA 4BO6A 1HC7A 1G0OA 2AMLA 1TCVA 3E9MA 2DR2A 1ABFA 1GUDA 5I9BA 4D57A 1E2LA 3ENNA 1W93A 3NS7A 5LXTA 1VXRA 1D03A 1LBHA 1RXEA 1YUNA 4UARA 1YJQA 4CVNA 4EKEA 1RVDA 4OI0A 4LY9A 4DADA 1T43A 2Y92A 2FN7A 4B6GA 4J1TA 1P8AA 2H06A 1B1CA 3C8MA 1SN7A 2A3RA 1MG0A 4UM7A 3VR6A 5A0VA 3VX3A 1ST2A 1LU9A 4EZIA 3U7QA 1B73A 1BA3A 1Y7TA 3K7EA 1NRXA 1I4EB 4WZBB 1OBOA 1LC0A 1GU0A 2D1FA 3LZCA 3Q9UA 4H7JA 4PX9A 4PXSA 5JT1A 3PCRB 1H2YA 3I2IA 5L9AA 4R0MA 1L4FA 1E3QA 3QMPA 3NCTA 2YZ7A 3LRPA 1S5PA 1RRVA 1UBSB 3PUHA 5C5DA 4YQYA 1T3ZA 1OUMA 2DPHA 3UB3A 1TW3A 1IEXA 1OZ0A 3QV2A 1KWKA 3ABIA 3OZWA 4EG1A 1E59A 1NW8A 2VCEA 3BQMB 3ITEA 1RHUA 4L7VA 2RKOA 1JR6A 2G77B 1H66A 2HUPA 3AETA 3CLRC 1CB0A 1X9HA 1MPXA 2B94A 2J0EA 3N87A 4B3HA 3B7WA 2V54A 3IT0A 3N07A 3DWGA 4XH9B 4IDGA 2P2LA 1OGYA 3D1JA 1TZCA 4ZOLB 4OX9B 4OKSA 1QVAA 2G80A 2VOJA 4UKDA 1B2RA 4EW3A 1RI3A 3D3WA 4GSLA 4QELA 4ML3A 4M83A 1NIJA 4X92A 3WYGA 2V59A 1JFTA 5AW1A 1IZZA 1AM4D 1IAQA 2DGDA 3LL7A 1E3WA 3ID6C 4K9LA 2FRVA 1Z5UA 4QOSA 1KJ8A 1CTQA 2QP9X 2WSIA 1ODFA 1UPCA 3LO5A 1GTSA 2OFWA 3DNMA 4BLWA 4F1JA 2VF8A 1GRNA 2VZ8A 4HEJA 1YD7A 2F1KA 4C2TA 1KJIA 1VCMA 5AICA 3QXSA 4HAVA 4QXPA 5FPHA 2FWJA 2F1HA 2PTGA 3FDZB 3D4LA 3K0KA 4A1OA 2JA2A 4UU7A 1YNSA 4OK5A 2QX8A 3EVNA 4NFLA 5B4VA 4C0QC 1NLFA 2R62A 1FP1D 3T3GA 1KI9A 3QXGA 3RI3A 3HR4A 5DYWA 1RHQA 4NAUA 1RADA 4W8HA 1SEVA 4WI1A 3TVYA 3A4NA 4AP9A 4C0KA 1UDBA 2PL1A 3CLUD 3GMIA 4GIBA 5C34B 3OJLA 4GNKA 3FVRA 4F6CA 4MW0A 4NX2A 4IHJF 1XMXA 5BUQA 1I1HA 4KI0A 2EQ5A 1YB2A 3R5FA 1RIFA 1REQB 5JD6A 3HI6A 5ITZB 3PWKA 3PXGA 5KNBA 1UZAA 4QUDA 3F7NA 2I54A 2JGEA 1DX4A 1H8HA 1OIVA 2QYSA 3BXHA 3OD1A 5LJLA 1HLFA 2R4QA 1JXQA 3S8YA 1MUUA 1YS6A 1YVRA 3QG5A 2G4VA 4QBHA 1XLVA 4ZHSA 4LRTB 2EKLA 3L4BC 1W4BA 3GA7A 1TT7A 3I9OA 4FLMA 5FA5A 5IC5A 2X40A 3SX0A 1XRRA 2EL9A 1OB5A 3WK9A 1W4AA 4B35A 3CXUA 4NICA 2FSPA 5EXTA 4BLTA 4UOZA 2ZKIA 2C0QA 1S0UA 2JH9A 4N49A 1V6AA 4G0ZA 3SXPA 4QDZA 1MEOA 1D5CA 1UEIA 2AJ8A 5CT9A 1E9DA 1T24A 3GEIA 3NYRA 4NHEA 4TWIA 1M2FA 3I09A 2WZCA 1JG1A 3B6IA 4FOOA 4PYIA 5CDFE 2J8ZA 5EL0A 2XZPA 1T2FA 4Z4HA 1MOZA 4MR9B 3PQ2A 4R05A 4ZEWA 2BR4A 4GP7A 3E7XA 4HN9A 3UTDA 5JMWA 4FE4A 1YBVA 3ZVLA 3OX4A 1IZ7A 4X62B 3O7MA 4YWJA 1AHIA 1NVEA 4DMGA 4Q4CA 1EH5A 3HWSA 2PXAA 1DS6A 1LPBB 1VLQA 3A4TA 3DDCA 2W42A 2SBTA 2QX4A 4MQ6A 2H1OA 2M1ZA 2VAXA 3CY6A 4EATA 3CUWA 1U28A 2QYHA 2M6LA 3NEAA 1WQ3A 1UKBA 3JRWA 1YZQA 4Y9SA 3RB8A 1P9OA 1V1JA 2ZTHA 1R9MA 2QRVA 4J07A 4M37A 4BIMA 2LWIA 4CM7A 1TYAE 1Z8DA 4PZEA 3CLSC 3HJBA 1IK4A 1EVZA 1TVMA 3GCGA 4BMNA 4NJEA 1DXHA 2CYAA 1J0CA 2QTCA 1R6TA 3VH1A 5L8VA 2VJPA 2J4CA 4HSEA 3L7IA 3HSKA 4D0LB 4E32A 2HT1A 3NG1A 1H0HA 4OI1A 3Q7PA 3GF4A 4AU1A 1WSAA 2P2CA 2ZKLA 2H31A 2CWWA 2ZOSA 3E81A 2ZT7A 4MDEA 1VKNA 4KFCA 1XQWA 1E7YA 3ZXYA 1RCTE 1RYYA 3S44A 3W2TA 1JSLA 4GO1A 1ISJA 2FXVA 1E6WA 5HM8A 4BNYA 4UATA 1ECFA 2ZSDA 4TKUB 2C54A 2P3SA 3ZQJA 5BR7A 3HYTA 4WV3A 3ZQ6A 3GLGB 3ESZA 3D2AA 4Z0NA 1R9JA 1DRKA 2QM7A 3CUUA 4TROA 4Q39A 1Z8FA 5DP1A 5FUXA 5JCJA 5F23A 3EGIA 3NBYC 4M0PA 2A0WA 3E7WA 1ODKA 3CONA 4ZRNA 1G66A 3LT0A 3I52A 5LPNA 3IPCA 4RV4A 4K87A 1VHLA 1W5TA 4Z8YA 2AJDA 1RJEA 2IHKA 3KB6A 4GRDA 4RIEA 2OZLA 5CCDA 2PCJA 4KR6A 4FQ5A 3N7TA 2AG5A 4YRDA 2QTWB 1WDTA 2B3DA 4ARAA 3GLIE 1D4ZA 1PBNA 4R3WA 1XQ9A 4M0CA 1VA4A 3BL8A 1W5BA 4M8IA 5FFNA 1QJCA 3QKWA 3D1LA 4ZQEA 1U5AA 3X43A 3HNOA 3WNCA 1YZNA 4QWMA 1OX6A 1OWNA 3TRIA 3LKDA 2EKQA 3C41J 3PFGA 4MEBA 3UQYS 1CU1A 3ONVA 1GUBA 3S2FA 1MB0A 3B3FA 1QKIA 2XXJA 2J7KA 2Q62A 1SOAA 3K05A 4PAQA 1OH8A 4L15A 1EFVB 1RW4A 2JAUA 3D31A 3LIPA 2X8BA 4C0SA 2Q2NA 4LYYA 1JR2A 2Y71A 3G5TA 4N0PA 2ETVA 4U2KA 3VM6A 2OSVA 4WK6A 5C32A 1QIHA 1DKLA 3R3ZA 4ZOAA 1OA1A 2VTKA 4IVQA 1C0PA 1USVA 1S4MA 1ZBQA 3H75A 5AJWA 3U49A 3MYYA 1K8RA 4EA7A 3DR5A 2FFRA 2X2EA 2H57A 2VYQA 3ZHZA 1PEKE 3D8UA 4FWIB 3UENA 4OSEA 4TM7A 4B7UA 3BIXA 3ZD6A 3OE7A 1SBTA 4DIMA 1SCNE 1UXHA 1WAMA 3GT7A 5DB4A 2YV2A 4OATA 3WWCA 2FPRA 2QN3A 4J6EA 3WQBA 1KBZA 5CH3A 2PHZA 4D4LA 4J75A 2BMWA 3OETA 1UPFA 3KKOA 1ZN2A 2VHTA 7GPBA 2DY0A 1FLNA 3QJGA 2AX3A 2R1VB 3O26A 4AF7A 5F2EA 1L8AA 3A0UA 4OSOA 5TQ0A 4UQLA 1DRUA 1EVYA 2LP4Y 1UBRS 2ZWAA 3P2YA 3K9WA 3JQCA 4POAA 1GGVA 3H5RA 4LXIA 1MNQA 3GLRA 4ZYLA 4KV9A 4WCFA 1ZVQA 3OTGA 3TIFA 5E2BA 4DAEA 3RC7A 4BYMA 3L6DA 4H3VA 2OHGA 2IXAA 5JRJA 3ZH2A 2YZMA 5CA1B 2A4KA 5EZYF 3QPVA 4D80A 5H3LA 4TZ0A 1A97A 5AMXA 1YS1X 5ALIA 1ZI9A 1TJ4A 2JBHA 2AN9A 1JB1A 1KGSA 1CUAA 1P3Y1 4BP9A 1XAIA 3HFJA 3QVXA 1DJMA 3NU1A 4NPHA 5FTMA 2GZAA 2NTEA 4H7KA 3PUVA 4RZIA 2C7VA 4XIGS 2GM4A 1AMOA 3Q6NA 3RROA 4A7PA 2XUPA 1L7OA 1WZEA 2BEJA 2ZI9A 3DBOB 3FBTA 3FRHA 4UAGA 3ZDXB 1CY6A 2OAQ1 1AGRA 3IPLA 4Q9KA 2OTCA 4E31A 2IU3A 1C8KA 1KAOA 4BE9A 1TL7C 1CUEA 5JSFA 2W2KA 1FNDA 2ERCA 1SVSA 3H5TA 4FBLA 4GMDA 4B82A 4F9GA 5HYVA 4EHBA 5DCWA 4O4IA 4ER6A 2VPTA 4ILKA 4MVYA 2RH5A 2ZSAA 4RTNA 5IAOA 2R5WA 1JSRA 1NBWB 4XRGA 2G8NA 4X63A 5HJEA 5L6LB 1L5ZA 5F7XA 4G07A 2ZETA 4AUNA 1Q21A 1BHJA 4K6KA 2Y1OA 4GC9A 1RRCA 2G36A 1NRIA 1JFFB 3KTFA 1ISHA 1HFJA 3O3CA 5LP6A 8OHMA 4I08A 3GLHA 2HBZA 2RHJA 4BFSA 4MR8B 4WUVA 1WPXA 3GVHA 1P1CA 3E1GA 4QYWA 5HJ7A 1UFVA 1CB7A 4DB2A 2DWUA 2D1SA 1LDGA 3C1TA 1A9XA 3WB9A 1MC1A 4RXMA 2Q3DA 4UDNA 1CT9A 2ZIGA 1L4YA 1ATIA 3IESA 3ER9A 1BE8A 1G5HA 3OLZA 1GCIA 2CD9A 2FEAA 1TD1A 5B3LA 3MCWA 5GONB 4PLYA 3D4BA 4TRJA 2CNKA 3VMFA 5FNVA 3GLHB 4DYVA 4QAQA 1CUSA 2C5GA 3I2HA 3LUKA 4ME6A 4P8RA 3R9XB 1Q0ZA 1WB5A 4JSYA 3RYCB 3H9UA 3DOUA 4R9RA 3HWX1 4ARIA 3NDPA 3BWBA 4DLXA 2JGDA 3V2HA 1KQPA 1E96A 2X5OA 4Q1CA 3DZGA 5I9LA 3F74A 1KRHA 4IQFA 4P7GA 5FLEX 3LU1A 4CMAA 4E08A 4HTFA 4WKBA 2CF5A 1H0SA 1NNUA 1SG0A 4KRGA 3EDOA 5EIWA 1YGYA 2VBIA 3LUPA 3L0PA 1SXIA 1A04A 4GPBA 4LRUA 1RCFA 1KJ9A 4PWYA 2NO1A 4AUMA 4BCBA 3PNMA 4FGKA 4EPVA 5KWVA 4Q7EA 3GGCA 4LF7B 1V3TA 1ADFA 5HCIA 2BGUA 3ZZMA 3BK7A 4Q7QA 4FLEA 3U4GA 1ZH6A 1GQYA 1R0LA 2JFHA 2O3TA 3CLTD 4EO4A 4TTAA 2RD2A 5JY1A 1YFLA 4YJ2A 2OZEA 3TD2A 5FL7A 1ZEJA 4G1EB 1JKJA 1V3UA 1V1MB 2JFNA 5B37A 4JI6B 4LYHA 3LP8A 5IN4A 2H4YA 4OK3A 3AKCA 3CZ9A 3H11A 1Q2XA 4PZLA 2Q3EA 1G18A 3ICWA 4MIYA 1R8YA 2XNDD 1IZ8A 3GFRA 2PKQO 3WHIA 1NQWA 2W6QA 4JJ7A 2XRFA 2H65A 2R4TA 3AHCA 3U6KA 4D3SA 4RENA 5HJ5A 1ECLA 1WZNA 3A4IA 4RH3A 1SURA 5C35A 5DTQA 4N41A 4HEA1 4IJ5A 2AQ8A 1OVMA 1II8B 2IUTA 2Q45A 1KRWA 3SMVA 4TRNA 2XYQA 2GPNA 4TS4A 1KEUA 4WNYA 4AZ0B 5BP7A 2CJPA 1OBFO 2ODPA 4MGZR 2CL6X 4J8PA 3MD0A 1AO3A 1OT5A 2ZBVA 1YCDA 5CA0B 1MDBA 1ULZA 3RFCA 5JXGA 3NX4A 1KQOA 1NRJB 3G3EA 5A03A 1XDZA 3N0VA 3FYUC 5IYZA 4OFBA 2O2SA 4OQFA 4X7RA 2ZYSA 1R15A 4EJMA 1CNMA 3M3PA 4B44A 3KZNA 1NF3A 3EY4A 4LDNA 1FQKA 5PNTA 3ETGA 3FPEA 3OM8A 5K4HA 1JV2B 2RGXA 1A72A 2GVNA 2WT8A 1IVYA 1JR3A 1YNOA 3OCVA 3OPYI 5G0SA 4W5NA 1IN6A 4DR2B 1WCV1 1XTQA 3BWDD 3X44A 4H31A 2Q3MA 4HJRA 3OICA 1Y1PA 2HF7A 4FW9A 1GZ6A 4Y2QA 1KK2A 3OZRA 3PC8C 1Z33A 1ZGJA 4HAXA 3TGPA 1KZGB 4K6HA 5CXQA 1X92A 4WZAE 3S2EA 1GCUA 3COSA 3PYXA 2F3UA 4HQLA 2VPWA 5AI0A 2BFAA 4DDKA 4JLJA 2NTJA 5AOBA 4QX6A 3V7UA 4ZVSA 4M7RA 5JS6A 3IA7A 2PLFA 1KEEA 2JJ1D 3WOHA 2QM8A 1EWVA 2ZCUA 1SCIA 4OMCA 2G25A 4TMWA 1W49A 3AHFA 3RFVA 4F8JA 5EJMA 4DXDA 4YBZA 3W3AD 3EMBA 1XVLA 4PLHA 2XKKA 3VSAA 2PRKA 1TM4E 1FFEA 1WA5A 2CCJA 3D3EA 1TAQA 4NV1A 1ZSNA 5CVJA 1GSOA 3C8DA 1I5EA 1CUDA 3LPNA 3N70A 2BMAA 2AX4A 5KTYA 1QWOA 3BE8A 1LKZA 1P5HA 4IIJB 1JDTA 4BVEA 3NTOA 1H3EA 2PPLA 4IDNA 2YY6A 1ENPA 3HU1A 2NM0A 1KOGA 2EWMA 1V1RA 3TQSA 2XGJA 2C3MA 2P9YA 2DQKA 1KO1A 4EO7A 1P4SA 3NP7A 3P20A 4UTPA 3LCVB 4BB0A 4YHHB 2IYRA 3I5UA 5LBIA 3FROA 4FYPA 6ADHA 4K3VA 1M2EA 3GOQA 1A27A 4L3OA 5FA6A 4JUBA 3CCBA 1AOXA 1ZW6A 3U13A 4CUJA 1LF0A 1QB8A 1T9HA 2FH5B 3PDCA 3ZIUA 3OZCA 4CQLB 3W2GA 4BKMA 1J1UA 3Q0EA 4AUEA 2P2NA 3ONEA 1DBQA 2JAWA 3OQOA 5JDIA 1CY7A 1JDUA 1SZCA 4IQ4A 1E2DA 2F8TA 1KZ1A 4TKZA 2GR9A 4L73A 3V4ZA 4PZDA 1OH5A 4Z4FA 1GZ5A 2FG7C 3O9ZA 2YOGA 3HJUA 4MI6A 5LP6C 2IA5A 2XTMA 3GGGA 3ONDA 5C8YA 4YAKA 5KYYB 1X9GA 1JXAA 2XNJA 3PZRA 4EOGA 4Q4LA 3EMVA 4Q6WA 3SYNA 5KWIA 2CFSA 1SXQA 1X3SA 4EBFA 4BX9A 2CE2X 2J3IA 4G41A 1ITZA 3U39A 1HYBA 4DLAA 4DUPA 1KQGA 1H8EA 1EVIA 5JH7A 1EDOA 1JEQA 1FPQA 1F38A 1G5FA 1GKLA 3LA8A 2DVMA 3QKSA 2X9LA 4AF6A 1QCZA 3BD9A 3I6MA 3FSJX 4J16A 4Y0VA 1PZMA 3SLKA 5BSTA 4EIWA 4F45A 4O2BA 4BNJA 5JZSA 3VPDA 2QBYB 1U1EA 4KR7A 3UHPA 3LDGA 1BMFA 2BUCA 4IIFA 4R1NA 2WKPA 3PQ4A 2VDNB 4MEJA 4UQOA 5EKUA 3EWNA 3T9BA 1B74A 4R2LA 1WEKA 1FBTA 5FX2A 3IB6A 3Q88A 4DR1B 2CMDA 4AECA 2QL7A 4H4CA 1HLPA 4FPXA 3S5UA 2CWDA 3TGLA 4INJA 4WERA 4D8UA 2J33A 1L5YA 1NQOA 2HJRA 3LFTA 1F6WA 1BKYA 5GQSA 2R2GA 4YUAA 3O3MB 3V4SA 2EZ4A 2BGGA 1BXRB 4Q3EA 4B79A 4BNVA 2ZATA 5CB6A 3PHCA 2NGRA 3M9WA 4LTDA 2ERXA 1WKCA 1K86A 1XMVA 1XTVA 3L49A 1A8HA 3F8WA 4G97A 2C92A 4NBVA 5HQTA 4TVKA 2JIMA 1F12A 4AVYA 4DTCA 3PXAA 1BNCA 5HOQA 4TTIA 3CGWA 3TQFA 2O4UX 2OB1A 4F1WA 4P7FA 2H4HA 4PU0A 3ZW8A 1GGFA 1QMGA 1VZ3A 3KYDB 4LHWA 4OLJA 2DBZA 4R8KA 4RD6A 2FMTA 2HF8A 1JDBB 1SZJG 2Y1LA 4H6XA 3AUAA 1U8TA 1YUMA 4H27A 3MAGA 4QGGA 1U3GA 3IP6A 1FMJA 4UNPA 1U8ZA 2XUAA 1E6UA 2DKFA 2NPOA 3F71A 2FHPA 2EKDA 4YAFA 1IDN1 1KH3A 1N5LA 2YHUA 4S2UA 3EFHA 5B64A 3Q8KA 1MV8A 1YQTA 4I55F 4Z54A 2QLMA 1D9ZA 2V8BA 2YJGA 1JWBB 1PL0A 3GNLA 2YXEA 1DDGA 3QA9A 4R8LA 4TGLA 4YNBA 5ALJA 4MTCA 3QE9Y 1TQ6A 4E2YA 5IM5A 3QVWA 3J80A 2PS1A 3OT1B 3DAYA 5ALOA 4LXTA 1Y6ZA 1KZ9A 2Q50A 3EQ2A 2C96A 3EUFA 4BTLA 4EPTA 1FJXA 4QRDA 5C4GB 2GCEA 3R9WA 3D7LA 2RHHA 2V1UA 3LHKA 1PEYA 2IHNA 3IMGA 4Z1MA 3AKDA 4DA6A 3JARB 4PFSA 1YMUA 3GNQA 3L1IA 5FAXA 1LLDA 3I9V6 1N4AA 4M87A 2JLYA 5ETJA 3AEKB 5EC8A 3MEQA 4MHTA 5DBFA 3N8KA 1XT6A 3AILA 3MGKA 4GZ6A 2C7BA 1FLVA 1TLLA 4Q9LA 2ZB3A 1GR1A 4MOWA 4HT3B 2BFBB 3AEUB 3LC2O 2Q5IA 4ER7A 1WMDA 5EVJA 1GARA 2C7GA 3R7LA 1Q2UA 3EASA 3TEFA 4DBVO 1RBYA 3IXLA 4HLUC 4EI2A 3PVCA 5CDTA 3ZDDA 1MRZA 1CEXA 4D98A 1PP4A 4U7GA 3ZV6A 3VKVA 3DBIA 3NGXA 1PE0A 1WLSA 1WR8A 3VC7A 3PF9A 3P9SA 1GOTA 4YPVA 4LOHA 2OEPA 4W1RA 1N8KA 5CB4B 1S3SA 3LKZA 2JBAA 4IDPA 4QQFA 4ZVVA 3MF4A 3MJ4A 5TR9A 1S9DA 3M2TA 1QQTA 1R6XA 1HQKA 1CVIA 1WUJS 4HB0A 4R1LA 3RVRA 4CL0A 4N1AA 3EOBI 4BBAA 3T9AA 5IF9A 3IRUA 4W7HA 1M10A 2FPGA 2EIHA 1YE8A 2POQX 4N01A 3FHLA 4F5DA 2FW6A 4YYZA 1SXJE 1Z38A 4CT5A 2IH2A 5CHYA 2ROQA 2VN8A 4ENPA 4QU9A 1JQAA 2PG3A 5DBGA 5LLSA 3TNLA 1MLDA 4Z0PA 2QN2A 2VDWB 1H4SA 2XOXA 1T8RA 3HMKA 2JLAA 1J1IA 2R6AA 3U7IA 4PC1A 4LGYA 1FDIA 3OI7A 1VL0A 3OEWA 1HPLA 1QH8B 2OKGA 1E1QD 2I2FA 2LCIA 4MPRA 2MOKA 4HFMA 3DDWA 5EVCA 3VHRA 3BJRA 3JTMA 1Q50A 5GADl 1HI9A 6GPBA 2Q07A 1N8TA 5JANA 2Q1YA 3G5AA 5DP2A 4BFVA 3TUJC 4P3KA 2WHXA 3JQ8B 2B4YA 2ORWA 4Y7DA 3V46A 3LXUX 4LKOA 4TTSA 3N0XA 3EA0A 4C3OB 2R6JA 4UPDA 5IKEA 4W1PA 1E3MA 1PVDA 1LQ2A 4DSZA 2V0NA 1THTA 4MIOA 3AY0A 3CJQA 3T99A 5F77A 4MKFA 3T0GA 1JZSA 4HS9A 3LSYA 3E7FA 2G1UA 2QRGA 5EPEA 5CDFA 2XUGA 1F4VA 4A5OA 2Q7XA 1HY3A 4K40A 2AMJA 2DUUA 1Y42X 2HA7A 2PH3A 1NDUA 2ZRDA 4LJ6A 2IF2A 1HEIA 2VSYA 1K7EB 3QE0A 4QEDA 4B8WA 5B1EA 3O73A 1RM3A 3OE7D 3TKAA 4GI1A 2B1IA 4OKNA 5LOVF 3KFLA 1FP6A 1NSYA 2WUGA 3GJXC 4C14A 1MB2A 4UTOA 1BE6A 3B12A 3C1UA 3ZBUA 1HKHA 1LV7A 4GI5A 4LZJA 4XFKA 4BFXA 3V6LA 3E61A 1M2VB 5DBOA 5F7JA 3LTEA 4Z0HO 2SKEA 5E3IA 1DE0A 2QTVA 3Q10A 5U4XA 4CM8A 4E2XA 1P2SA 2AI1A 2UKDA 3R5TA 1P9WA 1GTG1 1T0UA 1MJFA 1ZCFA 4GOKA 1V43A 4F6RA 4WBNB 4XB6B 3PXXA 3R5SA 4OP2A 1DIRA 1Z82A 4TQAA 2GBCA 1VIDA 4IV8A 4CTOA 1OYYA 2I67A 2JZNA 3LHSA 2BKUA 4RVNA 4Y6RA 3M5PA 4XVCA 2Z83A 3IP1A 4EI9A 3W5AA 2EWVA 3MW8A 5KJEA 4FMCF 2YN4A 1XMQB 1U9IC 1V39A 3IMFA 2C5SA 4DIBA 1LVGA 1JHMA 1PT8A 4P0QB 2Q6IA 5MN6A 2QN7A 1OXVA 5FBWB 3OWOA 1PVOA 1GT6A 2QLBA 1HLGA 2ZYAA 3ESDA 3L7JA 3KX2A 3DOCA 2VEOA 4N3NA 3F3KA 3KSBC 3JQEA 4CU5A 3D4OA 4WINA 2A0KA 2ZIXB 4CPDA 2FWRA 2GHTA 2HWKA 3AUUA 4XWTA 4CG3A 1N2CA 3PZBA 4OL9A 2DLNA 4UFNA 3WB1A 1UK8A 2IUFA 5JCJD 1XJCA 1N32B 1B15A 1VL1A 1PFGA 3RLIA 1G7CA 5C51B 2NZJA 3EQ9A 4EHDA 5A5VA 2G70A 1LX7A 3KZOA 2O23A 4X6LA 3NDIA 5LMNB 2QX9A 3VPXA 3RFTA 1E6KA 4JYMA 2F43A 5KU7A 5BT9A 2WJYA 4L02A 2JH3A 2IXGA 3IHKA 4G1BA 2NZ8A 4KX5A 3WA7A 1QQBA 4I4TB 2QMEA 3KJFA 3VZDA 3GMDA 3GGPA 1CRQA 3JWJA 4Q7KA 3DDHA 2I1WA 2PLAA 4YQZA 2B4RO 4FS3A 4ZOLF 4JOCA 4LJ8A 1NL3A 1W85A 2NUPB 4KLCA 3UANA 5HTOA 3V2IA 3CX6A 1K88A 3VOAA 4I6GA 2ZRCA 2FFJA 3GYBA 1ZIOA 3S81A 5BYKA 1OU0A 2PY6A 1GA1A 5FNVF 3ANNA 4KO3S 1PV1A 1W4ZA 4OL0A 1EM8A 3GYGA 3FAKA 4FZVA 2QG9A 5EIFA 4DRXB 3B9PA 2J4FA 3GL9A 3O82A 4P0TA 3BWVA 4EJ6A 1OYOA 1Y98A 4GMKA 4WBSA 3VU9B 1QGYA 3U7JA 3ROFA 2D5LA 5EJ4A 4X6XA 1PJRA 4DBLE 3CPEA 4RFVA 1YB7A 2FSIA 2ZSUA 3ZW7A 3HKBB 1BKSB 2XD4A 2ZUFA 1N6OA 1QZUA 2IYQA 3O5AA 3A4VA 4JBGA 3M4NA 3P27A 3FG9A 3I01M 4WKOA 3E5MA 1CYDA 2CMKA 2ZP1A 3AQIA 3L40A 4LJ9A 3RABA 1GFIA 3RYIB 3HB9A 3HO1A 4EFDA 1E77A 3EZYA 1PGQA 4LF4B 3QNWA 3A4YA 3P2OA 2BEWA 5IJAA 4N0EA 4L2IA 4DJFC 1G3QA 3HCAA 3C2QA 5BQFA 4ZOEA 3PNKA 5LU8A 1XDDA 1EP1B 1NURA 4B6JA 3J7AC 3KB2A 4IQ0A 2X8LA 5HVNA 3C7DB 5F1PA 4ZMSA 5KS2A 4RH1A 3GP5A 1UBTS 1J8MF 1Y4DE 4HFNA 3VTZA 4BFTA 1SVMA 1T5BA 1RJGA 3Q6MA 4FB4A 3MLAA 1VSBA 1H6CA 4Z7NB 1QS0B 4R69A 5CVVA 2RK3A 3IAS1 1I30A 3HCFA 3H2GA 4LNHA 3FPSA 4N7BA 5AJUA 4KOEC 5I8PA 3HVRA 3ES9A 2HK7A 2WB2A 3NBMA 4Q3NA 3BH6A 3GV0A 3RWMB 1NYRA 4BPRA 2QZJA 1JBQA 1RFLA 1UDCA 3I32A 4PRZA 3INNA 3STVA 2EF1A 3PNPA 2X86A 3T94A 4Q18A 5BVGA 5KOJB 2DETA 2R7LA 3B52X 1TJ5A 4JD5A 1LVHA 1P1RA 2VDQB 2WAXA 4RF3A 3UWKA 4ZI7A 4QVKA 1UC8A 4AY2A 2BMFA 3DXXA 4OI2A 3GXBA 5GVSA 1L5QA 2YZGA 4KUHA 5ALHA 1ZVVA 4INPA 3A05A 3NORA 2RE8A 2VF7A 1ZGAA 3JQAA 4TXHA 1T1SA 3LCUA 3A1WA 3GNSA 3WBBA 2PO7A 4WESB 5CVEA 4FR5A 3JPYA 2FG6C 2HPAA 3TPZA 4B33A 3AL3A 3EYWA 1PRYA 2C8VA 2H1HA 4QUBA 3MG9A 2FTKE 4Y9DA 4X7BA 3SIPA 4ARUA 1DDOA 4G5GA 1YR6A 1RP1A 1W0KD 1Z6PA 3IBGA 3MS7A 5HA5A 2BELA 1J97A 4B47A 1W2GA 2AYYA 3S0JA 4FFMA 2JK1A 3VQTA 3G9UA 2PJUA 3FGNA 4PFQA 3R6LA 1WF6A 1GU7A 3CM0A 1BN7A 2OHOA 2C3YA 2X9GA 1QONA 3I04M 4BY9E 3DBRA 3Q8XB 4KMSA 1FSZA 2AEMA 4DV0B 3KAKA 5DHPA 2YJTD 1HNXB 3EZFA 2XTZA 4BVGA 3BKWA 4E5SA 2NSHA 4KQCA 1CUBA 3LUDA 3UWOA 1BC5A 4EP1A 3ZDBA 2PZAA 3LPDA 3SLGA 1ONBA 2H1RA 2I29A 3BD7A 3LCCA 4LHXA 2YR0A 4G1VA 4KJXA 4TZKA 1N6HA 5CCBA 3RE1A 5ITSA 4CQMB 5BN5B 3TFOA 2WVHA 4JUIA 5JSUA 1CVRA 1LWOA 4P4TA 3V1YA 5LZ5A 5EIHA 2D54A 3CSUA 1E0SA 4QFDA 1FX0B 3QW4B 2GH1A 4GRIA 1Q15A 2QIOA 3JYHA 4IDOA 4Q4AA 4WKCA 4AG5A 3OUUA 4BZZA 5B6IA 2ZWIA 2I7TA 4GU5A 1E79D 2YXPX 4E03A 1QRUA 2YJ3A 3GFFA 4WXHA 1R7RA 3KETA 4UXHA 4P33A 1L8OA 5K8UA 1NMYA 4RPJA 1MPTA 2O4CA 4WZBE 5HDQA 1WETA 1M76A 2ZAMA 1JXOA 2ZYDA 3KEFA 4MAMA 3OX3A 4ISCA 3DMDA 3ZG6A 1IN4A 4BO8A 4FIDA 4IRUB 4HQ6A 2YIMA 1JHQA 3LQRA 1S9HA 3IXQA 3ED5A 3RVQA 3V7WA 1L7NA 4W1SA 5TT0A 3ZGNA 5FUVA 4LF6B 2P4HX 3K9LA 3HBJA 4P7KA 4B34A 3B9QA 4V02A 5AW0A 5IFKA 1V6SA 2EBUA 2AIRA 2WLSA 1Z2EA 2FDRA 3BREA 4G5XA 5EJIA 5GZ6A 4QTYA 5IAAA 5C7LO 2FPLA 1PZEA 1W88B 3CRMA 4JZKA 3RUPA 2ZJZA 4ZHQA 3C1AA 3DTNA 3KKNA 1KMHB 3TR6A 1VPDA 1VYVA 1OJ7A 4TV8B 5BNFA 3T0FA 1PR0A 3RSFA 3SN6A 3UQZA 1ZUWA 3UA4A 3MWEB 4QEZA 2EV9A 4L8VA 1QF7A 2FK8A 3VO9A 2QJTA 3EVFA 3ADKA 2PAFA 1PJAA 3OLQA 1MENA 1XD2B 3U4HA 1YMVA 2Z8YM 2J3HA 4PZAA 4D96A 1Q6YA 4DG9A 1MVLA 4PR0A 5DCUA 1VGVA 3K8YA 3BN3A 4U4AA 1M6HA 2DTXA 3B48A 4G5OA 3VNBA 1KOLA 5BSKA 1QE5A 3B36A 2D2FA 2H7XA 2O5CA 2NXJA 2OBFA 1J00A 4H0CA 4KO8A 1TEVA 1FFHA 3AB7A 1E2BA 3K5IA 1EB8A 4XCXA 4CDGA 4EBBA 1P7WA 3NXKA 3ZV4A 1DJOA 3FPHA 2QUIA 4KR2A 1I4DD 4HZUB 1JYSA 4RA9A 4CDRA 3C6XA 1NTRA 1IUKA 4Z2YA 2BEUB 4K9OA 3V4PB 1DEAA 4JBIA 4EY3A 1RLUA 2VHEA 3NHLA 4JDPA 5KDLA 4OF4A 2CC2A 3WK7A 4D9NA 3IL2A 3RG2A 1UAAA 3M82A 3SIXA 2YTZA 4D5EA 4KP7A 5C9ZA 1VG1A 1LSUA 4GPTA 3ZBPA