4OKSA

Crystal structure of hepatitis c virus ns3 helicase inhibitor co-complex with compound 19 [[6-(3,5-diaminophenyl)-1-(2-methoxy-5-nitrobenzyl)-1h-indol-3-yl]acetic acid]
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
447
structure length
440
Chain Sequence
FTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTNGDVVVVSTDALGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated strategies for identifying leads that target the NS3 helicase of the hepatitis C virus.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease NS3
total genus 147
structure length 440
sequence length 447
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4oksA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oksA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oksA01
4HB2A 1KYIA 1EFCA 1KIMA 1KDPA 2P5TB 1KO4A 2D3WA 2PEYA 2C04A 2NO7A 3B1WA 2ZRPA 4LGMA 4PPFA 4Q1BA 4Z8YA 2F9LA 4QGHA 3BJIC 5C4MA 3BOSA 3I61A 4RY2A 2HT6A 4CEHA 2B92A 1PJRA 5FTLA 4JVMA 5AJZA 2QENA 3NH6A 1N0VC 3T1TA 2AXPA 3AVXA 3CZQA 2I3BA 1IM2A 5BWMA 3TVDA 5J4LA 4V0MA 5EUMA 4WZ6A 2VP4A 5FTKA 4S35A 4X8MA 1T9HA 2Q9CA 3GJ4A 3B1XA 5KDDA 1R0XA 4V0KA 1Z06A 3L2OB 4DCTA 4FMCF 3HPRA 1U0LA 4NONA 3EZFA 3U7EB 1US8B 4D4MA 1BKDR 1KY2A 4CEIA 2XSZA 1BMFA 1OIXA 3PQCA 4I1VA 1AN0A 3IIJA 2XGJA 4ZPXA 2H16A 2JA1A 3GLIE 3Q7PA 3THWB 8OHMA 1LS6A 1ZM2A 3CO5A 5KOYA 2J0SA 3OE7A 1KMHB 1G41A 2NTYC 4HEJA 4V03A 2IYUA 3AP2A 2JCSA 4EDHA 2GZHA 1JXMA 1OB5A 3OAAD 4ESHA 2NGRA 1KK1A 3CRQA 2ZETA 4CVNA 3C16C 1J2JA 2QAGC 1XTRA 3A58B 4L15A 3TK1A 1KMHA 1X8LA 2HXYA 2W0MA 3IILA 2ONJA 2ANBA 1QHGA 3DHWC 4YDHB 3ZS9A 4US2R 3U44A 1M7BA 2RGAA 4HAVA 1NN0A 4CYMA 4KSBA 3IEVA 2V8OA 3PEVA 2CCGA 3VNVA 4W5JA 3HDTA 3SQXA 3DOFA 4DLRA 2QNRA 4PTLA 4Q00A 3PV0A 2JLZA 2IUSA 1AS3A 1XU4A 2BBOA 4UNNA 1W48A 3FYHA 4KFRA 1JR3D 4AK9A 1TTTA 1GNPA 3LXRA 4LUCA 5JECA 2EYUA 1ZCBA 2WJGA 3Q72A 4K46A 4R98A 5K8UA 4BFTA 3QVVA 1GILA 2YV5A 3AVPA 4PO1A 3DKVA 4DB4A 2WICA 1Q3HA 1JEEA 4KYIB 4R2HA 1FUKA 4MYHA 4C7OB 4LV8B 3EPKA 2UVQA 1E4VA 5JJLA 2J41A 4B74A 2H17A 3QBVA 4QRHA 3I72A 1I4DD 5IK2A 1X8JA 2WVJA 3W90A 3VFDA 5J4YA 1KK3A 2DFKB 1S3SA 4KFUA 3REFA 2O8EA 1R0ZA 2GXSA 1A7JA 4UXHA 5AWFC 1SVOA 2OCPA 2C9YA 4B3DA 2DWOA 1XXHE 4Z1MD 5DLQC 1W4CA 4JL6A 4UKDA 2CMKA 3KTAB 3MJRA 4CEJA 1LTQA 3TW4A 3LY5A 3A37A 3BORA 2Q3HA 1DAFA 1N0WA 5B57C 3HU3A 2ZRHA 2IHYA 3ADCA 2BWJA 2VHJA 4PC2A 1DG1G 5FBLB 4BEBA 5JFGA 4HAXA 3H4MA 4RD1A 1WBBA 1ZNWA 4KXFB 1G5TA 1N6HA 1MO5A 1SXJC 2ODNA 2GDJA 3QPWA 3W6NA 1G7SA 1NN1A 3M4YA 2CE2X 1VIAA 1XD2A 1W5SA 3THOA 1RIFA 4R7ZA 3QY0A 4L16A 3GMTA 1CJUC 4FIDA 5DIFA 5EXTA 2AX4A 2ZJAA 3IPYA 3K0AB 3ZVRA 3B13B 1OH7A 1VYUA 1KI4A 2C77A 2Z5FA 4I99A 3AQ4A 1TF7A 1JI0A 3K0EA 1GRNA 5FL3A 1C4OA 4OHZA 4YQFA 1G21E 2F3TA 3FVQA 2ZJZA 4MUBA 2RB4A 4I1OA 1J7KA 4JJZA 4AG5A 3EZ2A 2GWHA 3EXAA 2R9VA 2VEDA 2DR3A 2VH5R 4BGDA 5L8VA 1RRGA 2KBFA 2NZJA 1KI7A 1OXXK 5HKKA 2ZI6A 4QBIA 3SBEA 3X1XA 3AP1A 2IS2A 4FCTA 1QVRA 2IUTA 3HU2A 4DLTA 2VQSA 4NYIR 1Z0IA 4MRPA 1WRBA 1AZSC 3SZRA 2K5UA 1R6BX 5CIQA 3OE7D 4HB4A 2FFBA 1E2NA 3HP1A 2PT5A 3TJZA 5GVSA 4TL7A 3U6BA 4DDVA 1N5JA 1P3JA 3SBDA 1WB9A 5EXSA 2H18A 2EFGA 1P72A 3HYRA 2AK2A 2P6UA 4EJSB 3B2EA 1IXZA 5FPTA 2EFHB 5EXPA 2GBLA 4IW3B 1OFIA 3AB3A 2ZRIA 3W3AA 4WW0A 3CR7A 1RW4A 2QRNA 1KSHA 3IEUA 1TU4A 1XJQA 3EW9A 4EIWA 4AY2A 2DHRA 3GJXC 4EPWA 1FNMA 1XXHA 2GZAA 4BLQA 4P0TA 4MRVA 2IYZA 4XOIA 1XMJA 3F5FA 1AGRA 2QPOA 3BIFA 5AR1A 3OEHA 4FMDB 4MYCA 2YINC 2BMFA 4TLAA 1CTQA 3FKSD 3LWNA 1N3BA 4Q18A 3FKQA 1UFQA 2X1VA 2YC4C 3CF2A 1UEJA 2QI9C 2BBSA 4KYUA 4IKEA 1GOTA 2FSHA 1SVWA 1IY0A 1YRBA 1ZW6A 2UZIR 3IBGA 4LK2A 4BLSA 4ZI3A 3TGPA 2MSEB 3U60B 3HU1A 1L2TA 1CP2A 3FMFA 3LAWA 2NO6A 2HXSA 1NF3A 5KSYA 3U4QA 3KJIA 3CUEF 2PT7A 4H1VA 3A1VA 4ARZB 3O8BA 2O8CA 1VHTA 4WXPA 1P9NA 3O8CA 1KI6A 4MITA 5D3QA 4G5GA 3EG5A 2W2XA 2IK8A 1JXOA 1AS2A 4XVUA 4ASUA 1M2OB 2IYXA 2OILA 4HB3A 4FWIB 521PA 1YVDA 3KKMA 1J8MF 1P2VA 2HYDA 4BZXA 1E1QA 4JZKA 4URVR 3I8XA 2NZ8A 1E9FA 3K53A 4MGKR 1U8ZA 2WWYA 1WA5A 3U7FB 3LW8A 2WIAA 4R9UC 4HAWA 4Z54A 1ZINA 4M1YA 3T34A 5L3SB 3LD9A 3R9IA 2ZE7A 2WOJA 2WSMA 3B60A 1JPJA 3A1UA 3CX6A 1R8SA 3MD0A 4BRWA 4IDHA 4XTRA 4KU4A 5KYKA 2ZS8A 1Q12A 4LPKA 2J46A 4TMVA 3LBHA 1N2CE 1XWIA 4ITRC 2WWFA 3ETLA 3GFTA 2ZXUA 1OHHD 4OJQA 3ZGXA 1CRPA 3RSLA 5DI3A 5FTMA 2CBZA 2YKGA 3RS7A 2QM8A 1LV7A 3BC1A 2W2VA 3KFXA 1U90A 3CM0A 5F98A 1IXSB 1NY6A 4OK6A 4AWXA 2N1BA 3A1WA 4M1SA 2OLJA 3ZVLA 1DEKA 5EE1A 2IX3A 4OI2A 3RRMA 3TBKA 4DXAA 1VIYA 4LPSA 2QTVB 1AGPA 2AR7A 1IN7A 1E9CA 1Q21A 2D74A 2CL7X 4C0KA 4GMXA 1HV8A 3PXGA 2FWRA 4A4DA 4XD7A 2BCJQ 3NBZC 2W00A 1W4RA 4RD0A 5DHFA 1NBMD 2JIZA 3C4JA 2WIBA 3L82B 2P67A 3KUCA 2ZITA 2VF7A 1FP6A 2LWIA 4NYJQ 4PFSA 3SFZA 2HV8A 1E9DA 1CR1A 2JJ2A 3FHOA 4I4LA 1NIPA 4YMWA 5FOUA 5TDHA 1OKKD 4FCWA 2QBYA 2VBCA 5EP4A 1Z6TA 3GQBA 1KZGB 2WJHA 2P65A 1QRAA 2QQEA 2ZRBA 4ZV4A 4F38A 3BFXA 3OEED 1MOZA 4CEIB 3SHFA 4HDQB 2PX3A 2Q21A 3RRZA 4PSVA 4KV9A 2D7DA 2ZSEA 1JALA 4DLWA 2GILA 5DYGA 2FPMA 1KI6B 3WMEA 3BBPA 4UNPA 3KQKA 3NDBB 3MSXA 5L3VA 4HLUA 3E2IA 1NMYA 3W8RA 4PX9A 2HJVA 3KB1A 3RWMB 3R9XA 4OHWA 2F1JA 1P60A 1E79D 1Y63A 3KFVA 2WZQA 5CYOA 4DLVA 5HPYB 2AL7A 4P33A 1TAGA 4UXIA 3HJNA 4DIDA 5UKDA 5D3MB 4XWOA 2ODEA 2PBRA 2GF9A 3JZMA 1W0KD 2WWIA 2ZJ8A 4M22A 1IY2A 1JAIA 2ASEA 3I4LA 3QENA 3LNCA 5AJWA 1MRNA 3MLEA 2PLFA 4NYJR 1M74A 2ERYA 4EFLA 4QC2A 4MRNA 1IAQA 2UZ3A 2J5XA 4GZLA 2JLRA 1G3MA 5J5CA 3QKSA 5C1BA 4C0SA 1E69A 1VTKA 4ZO4A 4LYHA 3QXCA 1GZSA 4YMVA 3KQUA 4R71A 2IXEA 3LH5A 5JLJA 1P5ZB 3KXKA 2BJWA 4GSYA 5DO9A 2QAGB 5EZ5A 1G6HA 3PUZA 3CRMA 2D7CA 4G5RA 3R7WA 3TR0A 4BASA 1T91A 2YWGA 4UNRA 1AZTA 1ZMXA 3JVUA 1MR3F 2CLSA 2VSOA 3HPQA 2JJ2D 3X1YA 2ZSAA 2BMDA 1E1QD 4PC6A 1KNXA 1EXMA 1QF9A 2QPTA 1CBUA 3B85A 2WPDA 1V5WA 4R2IA 1FPMA 2BKUA 2ORIA 5KPJA 3NXSA 3U6KA 2PCJA 3B6EA 4PANA 3MWYW 4JT4A 4LBVA 4W5WA 4RFSA 3UPUA 1P9RA 1P61B 2OFOA 3VX4A 1NNEA 4KSCA 1CRQA 1KJYA 4IDPA 2O8BA 2W83A 1XEWX 3R20A 3PEUA 3GLGE 3FFBA 2F7SA 1N6KA 1RFLA 4QBGB 3DEFA 2ZU0C 2O0HA 3IKJA 2QORA 4OKSA 1FNNA 1ZIPA 2CNWD 4Q7JB 4HAYA 4LBYA 4WZBE 2KB0A 4KFSA 1OH6A 4LBWA 1F2UA 1NJFA 1G1MA 3TIFA 3TR5A 4NCKA 1P75A 4X8OA 3W8NA 2JAQA 2JLQA 5M04A 2WJVA 2FSGA 3SJCA 5KTYA 2GJSA 1UF9A 1KGDA 3FDIA 4FINA 2ZAMA 2ZJ2A 3RLFA 3X1DA 3AVOA 2V55B 4XD7D 1OXSC 2NQ2C 5AUQA 2REBA 3K0AA 4NE2A 4EFNA 2R62A 1G291 2KJQA 2OXRA 3M1IA 2Q3FA 1F5NA 1MKYA 4QHYA 2ZI9A 5JI3E 2Z0MA 2FFAA 2VO1A 1AIPA 1G4UR 3ZLJA 4Q7KA 1F6BA 5BYKA 3LRPA 2XNDA 4RJLA 2PH1A 4A15A 3CRVA 4XVRA 4M1WA 2P2LA 2VF8A 2Z4RA 4LJ9A 1IN8A 2IT1A 1JEDA 2YWHA 3DO6A 3QI2A 4EKDA 5JZVA 2W0SA 3KDSE 4Q66C 4NH0A 4LV6A 5TB5A 4EPYA 3DMNA 1N0UA 4HUQA 4Q01A 2NPIA 2GAAA 2QP9X 2WJIA 2C99A 4TQAA 1DAMA 4PHTA 4Q47A 4PAQA 4BLPA 2W6ID 2ODBA 1PLJA 4B32A 5BN3A 2FZLA 1BH2A 2ZUCA 3VQTA 2ZTSA 3GLHB 4NBSA 3GJ3A 3WY9A 2VSXA 1Z08A 1M6NA 4M1TA 2QMHA 3B78A 3R8CA 4F4JA 1UM8A 3VHLB 4B3GA 1YZKA 2FPKA 4CEHB 2IS6A 1E94E 4YLGA 1KZ7B 4D81A 1M7HA 5K8TA 3KJHA 2WOOA 4IDOA 1W0KA 2DFLA 2IEZA 4BLRA 4DHEA 2JGNA 4DDWA 4E5UA 2WSSA 3LLMA 2C78A 1WMSA 1K6MA 3C8UA 2XAUA 3SR0A 4P4TA 5TVKA 5HE8A 3OFND 4TT3D 1WP9A 2IF0A 421PA 2VTKA 3EIEA 3V4FA 5LB2A 1T0JB 1ZD9A 2IYWA 4DCUA 5JCZA 1H8EA 4BFWA 2GJAA 1OYWA 1TUEA 2EWVA 3DM9B 5BXQC 1E6CA 5SZIA 3TSWA 4KVGA 2BEKA 4RD4A 2OSBA 4DB2A 1II8A 3ZH9B 4ZIRA 1ZNZA 3A1SA 2XNDD 3MAAC 4JVNA 1KK0A 1PZNA 2J7KA 4CZ2A 3RNLA 2O8EB 2ZU6A 2QT0A 3SQWA 1Z3IX 4HLDA 2O8BB 3CPJB 2J0UB 1U0HC 2QA5A 5EE9A 2XJ9A 3QJYA 1OFHA 3IIKA 4AURA 1SVLA 2ZUBA 2I4IA 2PZGA 4C9BA 3EC1A 1F3OA 3KB2A 4A36A 1F2TA 1DPFA 4PZYA 1Z07A 4TMKA 3AKYA 4F4CA 3I1FA 1KO5A 1YR6A 3GEEA 2QU8A 3U5ZB 2FG5A 3IHWA 3FHTA 1F2TB 1VG1A 1E2EA 4TLEA 4XVQA 3RABA 2QPAA 1KMQA 4B44A 2VP0A 4H1UA 1OT3A 3BK7A 1P9WA 5BN4A 3DVLA 2R65A 1XPRA 1TQDA 1T6NA 4O2LA 2R6CA 4GI7A 3RS5A 3LVQE 1W36B 1F2UB 4BZPA 5AJXA 4D0LB 1R10A 2B8TA 4RCZA 4DJTA 2G88A 1E2KA 2XTMA 4A0HA 4BLOA 2A9KA 4D0NA 1W2GA 2QM7A 3PVSA 1LF5A 2J9RA 1SQ5A 4CEJB 4CDGA 1E0SA 1KI3A 1SKYE 2WWGA 3OZXA 2V1XA 4CRWB 1CJMA 2VP5A 4IOMA 3DKPA 5JBQA 5C2JB 1XTSA 1Z8FA 5FR2A 2ZJ5A 5TARA 3WYFA 1JECA 5JS8A 2ZAOA 4II7A 1ZCAA 3THYA 1X1RA 1YKSA 4MYUA 1T8TA 1EFHA 1R0YA 3DMDA 4YMTA 2R6AA 4G5SA 4MKHA 2BV3A 4ZCIA 2ZI7A 1K5GA 3QBTA 3M0EA 2WKPA 4LX0A 3AF0A 2OCAA 4A6XA 3MWKA 1GKYA 1ZC4A 3L0PA 5EE5B 4AIIA 1UAAA 3SU8A 4KLZA 1LVGA 4B76A 2FFHA 3GLFE 1FQJA 3K9NA 5IHPA 3EASA 3GJ6A 4AD8A 2QTHA 1CXZA 1UEIA 4FN5A 3MMPA 4LRWA 2WHXA 3A36A 2OFXA 1SZPA 2AHOA 2JEOA 5G3ZA 3OIUA 2B8WA 5G53C 4P32A 2ZE5A 1HT1E 4XJXA 1VDZA 4GOJA 2CNWA 2GXUA 3R7WB 5B30A 2G0NA 2RGDA 4MA4A 4V02A 3PENA 4OK3A 1AKEA 1DAKA 1OLOA 3I32A 2IXGA 4NL4H 1E2IA 3VKWA 1W4BA 3WRXC 1G8YA 3CF6R 3QSYA 1W36D 5JSZA 2GEVA 2QRZA 4HAUA 1NRJB 2BEJA 3QEJA 2BIFA 3LO5A 3RSOA 1R5OA 5KNDA 1TNDA 2OFWA 4LJ7A 1VCMA 2L0XA 1XB2A 5H70A 2WBLC 3AEZA 3QKRB 3WP0A 4TZ6A 4OQNA 4A8JB 1SHZA 2ZUDA 2BVNA 1E2MA 5CITA 5KDOA 2GJ9A 2FEOA 2GRJA 2KE5A 3AP3A 2NOAA 3WBJA 2QROA 4E09A 2KWIA 4HLQB 3NH9A 1XPOA 1Z28A 2C5LA 1SKQA 3NIBA 3QKRA 4FWTA 1ZD8A 3B1YA 2E1RA 3QKSB 2GESA 4K8OA 1MH1A 1NJGA 1OJLA 4JVSB 3RANA 4I1UA 4NMMA 2JJ8A 1P73A 1EFRD 1LFDB 2WMNB 1H8HA 3KKNA 4GRAA 5KU1A 3AV0B 2W6IA 5DGXA 3LVRE 1VKJA 1Z6YA 1T3SA 4GP6A 1HYQA 1KSJA 1YQTA 3K0FA 3D8BA 4GP7A 2HYIC 1JJ7A 4GDFA 5JJKA 2YWFA 4Y0VA 2EFDB 5FI0B 1R8QA 4QNRA 1JQJC 1CKEA 3QG1A 2QSZA 4Z51A 3GJ7A 1TQ2A 1RRPA 2ZREA 4QHSA 4JS0A 4I81A 3P4XA 121PA 4CIDA 2OUKA 1GFIA 3IQXA 5F3WB 3BS4A 2A5FA 4W9MC 2RHMA 4FI3C 3EPJA 1XNJA 2GK6A 4ZDKA 4US0R 2AK3A 2QMEA 3HR8A 3OEHD 5CDFE 5JHHB 2CE7A 3UMFA 2IW3A 2HCJB 2OXCA 2IA5A 3K8YA 1UJ2A 1OW3B 2N42A 3SYKA 1T0HB 4BFVA 2C95A 4D82A 3N2EA 1NBMA 3C14C 1UDXA 1VMAA 2GKSA 3W5JA 3VHXA 3B5JA 5FOWA 1G64A 4HUQB 1YR8A 2GA8A 3SJAA 2B7BA 3VNUA 1ZNXA 4D4KA 3T1VA 1BS1A 3AF2A 3Q5EA 5KSPA 2AFHE 3SJZA 2JLXA 2QQ0A 3MG9A 1US8A 3EZ9A 1P2TA 2P0EA 1E9EA 3ZZUA 4JBXA 4P3YA 2Q9BA 3CBQA 4O0MA 4X8HA 3TQFA 3Q5DA 1WF3A 1EFRA 1E3MA 1II9A 1T5IA 4IVQA 1KKLA 3C41J 2OO7A 1OXTA 5SZJA 3NC0C 3Q85A 1EFTA 1QVAA 4TL9A 2ZS9A 3TSOA 1Q22A 4AKHA 1KSFX 3EIQA 4IEIA 3OESA 3U3MA 4MDEA 4DCVA 1PUJA 3CW2A 4LJAA 5FPSA 3HWSA 2YNMA 1QG2A 2EWWA 2FF7A 2QZ4A 3NEYA 3ZD7A 2X8AA 3M6AA 4BQSA 4A2PA 4D2IA 5A0FA 821PA 4MUAA 1J90A 3EAQA 5GJVC 4ZKEA 4U02A 5G3YA 3RHFA 3U3JA 5DISB 3BFVA 1DE0A 3VKHA 1E9AA 1X1SA 1GDDA 1X86B 2A2ZA 2ECKA 2OESA 2CLCX 3ZQ6A 4DSTA 4DT1B 2REOA 3CH4B 621PA 1R0WA 4JSTA 1U99A 3LX8A 5F2EA 2WJYA 2J45A 5FL7A 3QKUA 2ZRNA 4GNKA 5IT5A 3EPHA 4JLPA 3ASZA 3EWSA 5AUPB 1Q1ZA 2H5EA 1G3IA 3SN6A 3TUIC 3QNUA 4QHTA 3AGPA 4KAXA 5B64A 1RRCA 1OYYA 1CJVC 1TADA 4C0QC 2VYFA 2OLKA 3FFAA 1C9KA 1TF2A 2IYTA 1XFAA 4OQXA 1XXHB 1E2DA 1OPXA 3H2YA 1K8RA 1SVMA 4YMUA 3TRFA 3ICEA 2GVZC 3WBKA 3HYTA 4WAUA 5JMTA 1NLYA 5HCNA 2JDID 1GP2A 3UWOA 5K8LA 4F91B 2G0TA 3C5CA 3WRYC 3NBYC 3KJGA 4AG6A 3EA0A 4XSHA 2FA9A 5EQTA 5LDDC 1XJCA 3AVVA 1ZUIA 4D6PA 2OAQ1 1UDWA 5JRZA 3IO5A 5FUYA 3HR7A 2JLSA 4MKIA 3U3RA 1LNZA 5JWRA 1BMFD 2V1UA 3UATA 4IRUB 3RVBA 2PCLA 5KDLA 1D8TA 2I1VB 4EQ6A 3OIVA 1U8AA 4Q9KA 1NN3A 3D7MA 3NTUA 4TTRA 4IOJA 1NVVR 1BIFA 4DUGA 3S1AA 1XD9A 3L0SA 4C4PA 2N46A 3OAAA 4Q9HA 1GTVA 3CWZA 4LWZA 1XD8A 1YRAA 1Z0FA 4PHHA 3SI7A 1I4LD 4HYYA 4N3NA 4PPGA 3H84A 4WA7A 1GITA 2FOLA 4QM7A 5C18A 5C4GB 4FMCB 3VTKA 3I73A 5CK5A 4DLXA 5TMPA 2IC5A 2DCUA 1N6NA 3CPHA 4ESVA 4D25A 4L8GA 4M2LA 1NMZA 1ZYUA 2JLYA 2Z4SA 2YC2C 4LJ4A 2RGNC 3ZYCA 4HUTA 5JCPA 3V4RA 1COWA 1KY3A 1MT0A 1I2MA 3KKPA 4JJKA 2F55A 1G17A 1PUIA 1G16A 3FE2A 4Q19A 3WXMA 4EQ6B 1XF9A 5EJEA 1AQUA 1YHNA 1Q57A 3CF0A 4LDJA 3RRYA 3AVTA 1KHTA 4N1AA 5EP3A 4B2IA 2A3RA 1EGAA 1JR3E 1HH4A 1D2EA 2FX3A 2J7PD 1XBTA 2ZVPX 3L0OA 1QHNA 3NVAA 1EK0A 4NCIA 2F43B 3GLFB 4QJ5A 2H7VA 5JRJA 2WWXA 1N5IA 2OEPA 1W36C 2VP6A 3V9PA 1D2MA 1E2QA 5JI2E 1XD2B 4CT5A 4LV5B 1OB2A 4Z8XA 4UJ3A 2XX3A 3Q7QA 1P62B 1XZQA 4TSFD 1MO4A 4YXWD 4MGIR 1G5RA 4A82A 3SYLA 5AUOB 4TLDA 2RMKA 3ZQJA 3UG7A 1NKTA 2F1RA 3SFVA 5KO2A 4TL8A 4PR0A 4O3MA 3UMRA 1DARA 4QBFA 2E9SA 2WWHA 2P6RA 3NKVA 1GWNA 2KBEA 1UBCA 3PFIA 3UWKA 3G0HA 2FE4A 4B3XA 4TYYA 2F1HA 2QY9A 1QG4A 3T1QA 5BQ5A 1U98A 4Q4AA 2MMGA 2WSSD 5CLLA 2XZOA 3QPVA 3TMKA 2BM0A 2G1KA 1HURA 2QGZA 2ZVQX 4OYHA 1W0JD 4UQOA 5H1YA 4ZIRB 4MKGA 1ZVQA 1EFUA 2OT3B 3K09C 4Q5IA 4Q4AB 2FPLA 1HQYE 1KK2A 1VYTA 3AVWA 4QGAA 1FFHA 4NP6A 1E0KA 1E2FA 4AYXA 1OV4A 1OIVA 4B71A 2MMCA 2OAP1 1ODFA 5BN5A 5CYPA 1KSGA 1OFUX 2ZANA 2ZR0A 5KNCA 1RC8A 1GG2A 3ZZTA 3IUYA 2CK3D 2OBLA 3UKDA 1GSIA 2GEUA 3MJHA 4PHGA 5A5GA 3G82C 1HT2E 2PMDA 1IJFA 4IDQA 2EVWX 4ZCMA 1WBDA 3DL0A 5GJBA 2ZRLA 4Q4HA 3AVYA 2E87A 2QMUA 4FMDF 1DADA 2ZSFA 4F92B 2AKYA 1N6PA 4GL2A 5FBQB 1BYUA 4YDSA 4M9ZA 5CM9C 3ZD6A 1YZUA 3GLGA 1NL3A 2VHUA 1ZD1A 3PEWA 4TMWA 3FTQA 1Z6AA 1G8PA 1Z6GA 1GIAA 4DDTA 1W7AA 2GJKA 1N5LA 4KBFA 4YXWA 3MGCA 3B1VA 1WE2A 1Q1QA 1TQ4A 2IL1A 3F3YA 5EE0A 1DS6A 3R9WA 1FQKA 4U5XA 2FJUA 2D62A 3AF1A 3ECCA 3U7GA 1OE0A 2RGXA 1SGWA 5G41A 1RZ3A 1OHHA 1ZM9A 5JJIA 5SZHB 1E2GA 3KL4A 4ERNA 1ELOA 1U94A 1Z2AA 5DNYB 3MRSA 3OF5A 2WM9B 1DAGA 1JR6A 1GL7A 2EU8A 1O3YA 5J4HA 2YZ2A 5J4KA 4YC7A 1QHIA 2ZYWX 3FKSA 3THYB 1PLLA 1XP8A 4XWKA 2QE7A 3H0KA 3VMFA 1MO3A 3EWAA 3RS4A 3BH0A 2QP4A 4RZUA 4ZDJA 2ZJOA 4C2TA 3UIEA 4HZIA 1G5PA 1Z0DA 4AKEA 3T35A 6Q21A 1GVNB 1ESNA 4EPVA 3UG6A 2OZEA 1LW7A 4MRRA 3KKOA 2CL0X 2P6NA 5FTNA 3TUZC 3SHWA 4M9XA 2QEQA 3WYGA 3WNBA 4W7SA 2NPFA 2VIIA 1JQLB 2ZRAA 4MGYR 5AJVB 5HCIA 4RVCA 2WKQA 1CR0A 1NIJA 4IDNA 1MABB 2AXNA 3GEHA 3GJ5A 4PSAA 1UBEA 4Q1CA 4NZYA 1RRFA 4DKXA 4DWJA 1XRJA 2WAYA 4JVLA 3CB4A 5EUQB 2XXAB 1M34E 4URUR 3K70D 2AN9A 2H92A 4LYFA 1XMVA 3U44B 4LBZA 2C96A 5JEEA 1GRQA 2NMVA 1SULA 3O8RA 1SXJD 2BMJA 3KZ1E 1FP7A 4A8JA 1RJ9B 3T1OA 2B7CA 1AM4D 4Q1FA 4ABYA 4EAQA 4EPXA 2BHRA 1QBKC 1OH5A 4M9QA 3MUFA 3RC8A 1W0JA 1GUAA 1E79A 2QN6A 2A5DA 1W1WA 2NIPA 3TLXA 4Q1EA 4AYWA 1E2LA 4LHVA 5CLQA 3LQQA 1JAHA 4B33A 1TF5A 5J40A 2EFCB 1T3LA 5E4FA 2RGCA 3BD9A 1CU1A 4QKQA 3QQ5A 4BFUA 2XTNA 1Z63A 5A4JA 3I62A 1AA9A 2QAGA 2ZRGA 4BRUA 4ZKDA 5CJPA 3IIMA 3NHBA 3GLIA 3GLGB 1KDOA 3BH6A 1A5TA 1ZRHA 5FUVA 4XH9B 4B75A 2X77A 5ELXA 3CNOA 1NVUQ 3AKCA 3VR5A 3E1SA 2J7PA 5E95A 4ZDIA 3P4YA 5LD2C 1PLKA 4B6FA 2ZS7A 3K9HA 4MYTA 3IHLA 1D6JA 2ZE6A 2ANCA 2FSFA 1DOAA 2BCGY 2XSZD 2ZRFA 3B7GA 3BAFA 3LA6A 3GPLA 2BM1A 1E2PA 3LFUA 3NBFA 4EPRA 3THXA 4LJ5A 3QXJA 4JL5A 4C30A 3BB4A 2WPDD 1R5NA 1ONBA 5D3MA 4V0NA 1LS1A 1VCNA 3GJ0A 4Q1DA 4TMZA 2KI5A 3TW8B 3GD7A 4TYNA 2O8FB 1SVIA 2IF2A 2LCFA 4BEJA 5K8IA 1DBSA 1S4QA 2R2AA 3SJBA 3PG5A 4AKGA 2OCYC 2XEXA 4BZQA 3CX8A 3QEOA 1E98A 1II8B 2IEYA 1L8QA 2GCOB 4TTQA 1AJEA 1KI1A 3C7KA 1J8YF 4JLKA 1D2NA 721PA 5HTKA 1DAHA 1BO6A 3B1ZA 2QBYB 3TQCA 1E1RA 1OFTA 3AUXA 1SKYB 4A8JC 3PCRB 1E0AA 1RE0A 4F7WA 1G8HA 3LLUA 2NO0A 2ODWA 2PZEA 2IBMA 4LHYA 1FX0A 3E5HA 2R8RA 5FH9A 1G6OA 2XOKD 3A8TA 4I1SA 4MDFA 5EP1A 1A4RA 4V0OA 5KHOC 1CIPA 1YZTA 1TPZA 2FEMA 4KODA 4TYWA 3X1WA 2XB2A 2X19A 4FXPA 2ZI3A 1N5KA 1Z2CA 4OQFA 1DO0A 4Q21A 3K0SA 3MFYA 3K9GA 3EC2A 2G77B 3QXHA 3F0TA 3UK6A 2WTUA 1S1CA 2B21A 1E32A 2VHCA 2GCOA 2WKRA 1L4UA 3BXZA 5IK2D 1E9RA 1OXUA 3TH5A 2ZYVX 4M0LA 2FNAA 4OI1A 1Z0AA 1YR7A 3EZ7A 5J47A 2ZM5A 3DDCA 5FOSA 1XTIA 1D9XA 1W4AA 3ADKA 1T5LA 2O5VA 3L43A 4L4UA 5GJCA 1NVWQ 1WQ1R 4Z1MA 2WJJA 4HB0A 5FBRB 4LZZA 4OK5A 3CLVA 4HLUC 4EJSA 1T4GA 1VCOA 2HEIA 3FWYA 3LDAA 1NBME 2YVUA 2ZRJA 3GCGA 2CLDX 3QF4A 5AUNB 4C0BA 1KDRA 2KSQA 2QAJA 3VX3A 1HY3A 4JLOA 1N6RA 2ZI5A 3CRW1 2IYLD 4A0FA 1X6VA 1E9SA 2O0JA 4KI0A 4PZZA 2YOHA 4O25A 1VPLA 4NCNA 1G3RA 1HQCA 1ZNYA 3THXB 1FUUA 2ZIAA 1TL7C 2YWEA 3I3SR 4LYJA 5FPKA 3GLIB 3KQLA 1MO6A 1U0JA 3WYAA 4TWZA 4TMTA 3DZDA 4B2LA 1R4AA 2Z83A 3KX2A 4F93B 1M1YE 2DWQA 3PEYA 1ZU4A 4N0DA 3CNLA 3RS2A 3DZ8A 4BPBA 2IS4A 3WMGA 4HAZA 3ICQB 1OXVA 1OSNA 4JLNA 5FPHA 2IUUA 1DG3A 2FSIA 1G4AE 1SHKA 5FTJA 4TTPA 4B3BA 4BWYA 1HUQA 3G5UA 3REGA 3WP1B 5IRCD 1XJ0A 2DYKA 5EP2A 3UXMA 2QTFA 3VR2A 4J0QA 2ZQ5A 4Q1AA 2QMOA 3CH5A 4PPNA 1EG7A 5FBWB 1IBRA 1NN5A 4BFXA 4JLJA 4NTZA 4Q9JA 5DE3A 2ZEJA 1YR9A 2YOGA 4URWR 4U00A 2YHSA 2MSDB 1VECA 1CULC 4K81B 4DRZA 4KHZA 1CF4A 1XMIA 5F9FA 1XCPA 1P6XA 2F9MA 4NU0A 3UANA 1GRRA 3RYTC 4OBEA 4DUGD 2GJ8A 4DSNA 5CJ2A 3P27A 2CCKA 1YZLA 2VL7A 1G7RA 3S1AB 1GL9B 1XTKA 3T06B 4D0GA 4CF7A 5JWHA 3QIAA 4C7OA 3NEJA 4IHQA 2J0UA 4KBGA 5L3RA 1E4YA 3K0FB 3RS3A 3SS8A 4URXR 4M21A 4NCJA 3IDQA 1GKUB 1FTNA 5CDFA 4POAA 5FFMA 3AGQA 5BYJA 3D31A 4B35A 4H9GA 3LV8A 1D5CA 4Q4JA 3K0CA 3CRRA 2XOKA 4Q7LA 4D80A 4QL3A 1Q0UA 4M9SA 4MQBA 1COWD 1WXQA 3FMIA 4PSKA 4CT4B 4DSOA 4TQUS 4AYTA 2W58A 2HLDA 4YONB 2XITA 4QFMA 1TQ6A 2W2TA 4B2PA 2IYQA 4QM6A 1YU9A 2LKDA 1KI8A 3LW7A 5DSZA 1UKYA 4M1OA 1A82A 5KNBA 1WDTA 3O47A 2JLVA 3GP8A 4OL0A 4B34A 1HEIA 2W6JA 5LB4A 5JEDA 3ZVMA 1HE8B 1DAEA 1TMKA 1O87A 2O52A 2OE2A 4JLVA 3P26A 1W5TA 4LC0A 1KJWA 4LSGA 1G3UA 1NLZA 2DWPA 3QXSA 4LCBA 1GKIA 2AD1A 2Z6VA 1LF0A 4B48A 1N6LA 3K0CC 4PC1A 5JHGB 5LBIA 5P21A 3U3OA 3U61B 2OBNA 4QBHA 4D26A 4XIGS 1W49A 1FMLA 4LYAA 1Z83A 4OQMA 1IJEA 2OM2A 4V0ME 3H1TA 3KQNA 1SVKA 4D4LA 1IXRC 1NI3A 2ORVA 3W6OA 4CGZA 2RCNA 2ZPTX 2QL6A 4Q9LA 2NG1A 4JBWA 3LBNA 5AK0A 2V3CC 3FMPB 5E7IA 1G20E 4DLYA 2JLUA 2QUZA 3ZS8A 2Q3MA 3AVQA 1Y3AA 2GCNA 2IS1A 2D4HA 1LB1B 2O8DB 1S9HA 1TEVA 1AQYA 3VKGA 3DPUA 3PUVA 4DIEA 3FOZA 2ZSDA 3I92A 4RFVA 1ZUNB 3R8FA 1QHHA 2VSFA 4IXNA 1XPUA 4QNMA 5CB8A 2AFIE 2F43A 4RZXA 2WMOB 5C46F 2QSYA 3K70B 1XEFA 2IHBA 1XEXA 4DVGA 1IY1A 1Z29A 4ZI2A 3IPXA 3AM1A 1CJTC 2VLIA 3I8SA 2YJTD 2J1LA 4NCHA 4A2QA 4LJYA 4E03A 3THWA 4OQLA 3ZJYA 4BFZA 3K09A 1T8UA 2IYVA 1CEEA 1GAJA 4PC3A 2FH5B 5CM8B 4B3CA 1NP6A 2EFEB 1ANKA 1KI2A 2CDNA 2CVFA 3QUSA 2V7QA 3CZPA 3A6PC 4QGFA 3EZ6A 5F9HA 2GF0A 3PITA 3AF4A 1TU3A 2FGJA 1KO1A 2G6BA 2GETA 2GBLC 3IO3A 4PC7A 5HR5A 3TVTA 3LQRA 4ASUD 3VR3A 3TE6A 3W6PA 1SXJE 4QJ3A 3RWOA 3U2QA 3DM5A 5J4VA 1Z0JA 4XSGA 4QGGA 4TYPA 4N0EA 3OEEA 2VA8A 1F60A 1NVVQ 2OV2A 1P4SA 2GNOA 4G5QA 4GMDA 4XTCS 5JSZB 1CLUA 4KVAA 4JMPA 2FV8A 1FZQA 2XNSA 5FPYA 5FOXA 4HATA 4Q02A 4A9AA 4NYMR 1L4YA 4Q4HB 3ADBA 4U7DA 2ZSBA 2IWHA 1J99A 1EX6A 1W44A 2Z43A 4GBMA 2A7QA 2HCBA 5BW8A 1L7VC 1XTQA 4NHOA 1HA3A 2D2EA 2IYYA 1UKEA 4JIMA 4TZ0A 4US1R 2RGEA 3SYNA 5TV2A 3SC3A 3VU9B 4JLBA 3X2SA 1WCV1 3GLFA 2PL3A 2WWWA 3BE4A 2FN4A 1E99A 1XDBA 3K1JA 4BLTA 2ZRDA 3EA5A 2GZDA 1G9XA 1E0JA 3VU9A 4HZUB 3B82A 4F4IA 1RPZA 1EESA 2QP3A 2HLDD 3O8DA 2V6IA 1U8YA 2VPPA 4HDOB 3TSZA 4HSEA 4Q9IA 2XB4A 3NWJA 2QE7D 3NDPA 4DZZA 3RDPA 2C03A 2RGNA 3BRWD 1DO2A 1PVOA 1N25A 3N5CA 4DC9A 2ZR7A 2MSCB 1JNYA 3J81k 3KUDA 2GXQA 1XZPA 3K70C 4DLUA 1NMXA 5EZ6B 3WMFA 1KI9A 4Q4JB 4IFEA 4BE7B 3L8ZA 4JYCA 3W34A 1KKMA 2AD5A 3OIWA 4DCNA 1JJVA 3Q3JB 1AK2A 2R6DA 2R44A 2IYRA 4TLCA 3RS0A 2CK3A 2G3YA 2VP9A 4NPHA 1F48A 1OKKA 1S9DA 1SVSA 4M8NE 2PX0A 2CL6X 4PQRA 3BB1A 221PA 3ONWA 2RHDA 4QOSA 2EW1A 1Z47A 3P20A 4KJZA 1Z5ZA 2X2FA 2HJGA 4M53A 1NG9A 3X1ZA 3QOFA 4PQYA 4GPTA 3SE0A 1GNQA 5CIWA 3WNDA 2ZRKA 4IOKA 4QXAA 2EQBA 3ZVNA 4EFMA 4RSGA 4M1MA 3TUJC 2F6RA 2DFTA 4M4SA 1QZXA 3L0IB 5FBVB 2PJRA 4OI0A 1IOZA 1XEXB 3C5HA 1Q1BA 4PXAA 3TKLA 3N2IA 4KFTA 4HLCA 3KXIA 4TLBA 5FUWA 3KQHA 3NG1A 3SNHA 4ACAA 2SHKA 1ZIOA 4GOXA 2C8VA 3GLHE 3FPAA 4ILEA 2P5SA 1KDTA 2CEAA 2IXFA 5FI1B 1CR4A 4BECA 2YYZA 3B9PA 1M7GA 3LBIA 4OJKA 1ZM3A 1GNRA 2GCPA 5DN6A 1BOFA 2ZJYA 4JLMA 1UKVY 4MRSA 2RKOA 2VP2A 3EARA 1HE1C 4LOAA 4A6PA 1H65A 2ORWA 3OHMA 4B43A 4GT1A 4IEEA 4TYQA 3GJ8A 5FR1A 2H8KA 3TAHA 2JLWA 1A2BA 2V7QD 3ND8A 2F3RA 3BWDD 4P31A 4QJ4A 1E96A 2ZYUX 4Q03A 5JS7A 1FTSA 1G8FA 3PUXA 2W6JD 1K5DA 5KPDA 2UKDA 4RD2A 1S3GA 2ZRMA 3OIYA 4NKRA 1RYFA 1G18A 3NBXX 3PR1A 3F8TA 2A5JA 3B8HA 3T61A 4D4JA 5EXXA 3U3KA 2O8FA 2JDIA 1S96A 4DEYA 2DBYA 2PZFA 3V00A 3PIRA 2XZLA 5DI9A 1YJ5A 2GTPA 2LKCA 1IN5A 1Z0KA 3QPUA 2VRWA 4JSYA 3RC3A 3UMSA 4C0JA 3I5XA 4E22A 4A0GA 2A5YB 4HZUA 1FMJA 4JYBA 4DT1A 4QG7A 1XX6A 2FU5C 4DSUA 5DYIA 4KITB 1DVRA 2OBMA 2AWNA 4RD6A 4YMSA 2RH5A 4RFSB 5B2ZA 1KNQA 3IGFA 4NYMQ 1IN4A 2PJZA 1E1RD 2PLRA 1VG0B 2HT1A 3MWJA 3B9QA 2YOFA 2H57A 2V6JA 1EWRA 1UBGA 2XZPA 1ZM4A 1VG8A 4LC1A 1G3QA 1LY1A 4XWAA 4B47A 3TAUA 4UXJA 4G3XA 1E2HA 4PAMA 3ZDQA 3BGWA 2AWOA 5DN6D 1G19A 4G0NA 3QF7A 4FMBB 1V43A 3T5GA 5HE9A 5DI3B 1Q20A 1W2HA 4UNSA 3GLHA 4WIAA 1UBFA 1H8ED 4G01B 4EJSC 1GL6A 5CB6A 3RRNA 1XCGB 2RGGA 3EX7C 3CIOA 2FFQA 1A1VA 2D06A 1GM5A 1R7RA 4GOKA 4LY6A 1QDEA 1XEWY 1Q1EA 1U81A 3SDZA 4B6EA 4OI4A 3BFKA 1EX7A 1T3HA 2WAXA 3VAAA 1E2JA 4RZ2A 3ZZ0A 4A0RA 1G7TA 3QXXA 1DELA 1SXJB 2C9CA 4CW7A 3TNFA 1Q44A 2Y8EA 3LX5A 4LJ6A 2CJWB 4Y0AA 1VCIA 4JBYA 4L5BA 3QF4B 5CK4A 1BYIA 3NHAA 4G1UC 3H86A 3AH8A 1FX0B 2CJWA 3K9LA 3T15A 1S0UA 3ZIAD 1U9IA 4TMXA 4PHFA 4OHVA 1Z22A 2A30A 1S8FA 4TSFA 4GFDA 5JWOA 3U4QB 2FZ4A 5G40A 2VHTA 1U2RA 4NYIQ 4Q4LA 2O8DA 3PJRA 2Q9AA 4AKIA 1KO7A 3GEIA 2FGKA 3IBYA 4DBLC 2V54A 1QHHB 3AUYA 5IF9A 2ATXA 3ND9A 4WOPA 1RKBA 1N6IA 4FW9A 1MRSA 2IYSA 5GVRA 4V0LA 4IFBA 2J3EA 2ERXA 4TN1A 2ATVA 2JASA 1S2MA 1JBKA 5DHAA 1ZUHA 2I1QA 5B58C 2F1IA 4PQFA 3FHCB 1ZP6A 2CHGA 2RGBA 4WVFA 3CNNA 3KXLA 1RVDA 3GFPA 1A2KC 1G7CA 4DEXA 3QVUA 1YZGA 1YZNA 2TMKA 1QHYA 3BH7A 2Q6TA 2G1JA 2OCBA 3A4MA 1NY5A 2C2HA 2BC9A 1TEXA 2J0QA 5L3QA 3VR1A 1CR2A 4FCVA 5GJWC 1YE8A 1NLFA 1PV4A 1UPTA 1UADA 1EWQA 2DFNA 4KLNA 2JJ1D 5KSZA 2BDTA 5L3QB 2C9OA 4ARZA 4UJ5A 2Q0HA 1XMSA 1FW6A 4Q48A 1NSTA 3WHKA 3NC1C 5EE3A 4HDCA 3RAPR 1M8PA 4LHZA 4P4UA 3A1TA 1ZU5A 3CONA 1IN6A 1VYVA 2IWRA 3A4LA 4IVPA 4BFYA 4C3ZA 3JVVA 2DY1A 1P2UA 3AKDA 4JL8A 3AVUA 3PUWA 3Q8XB 1N6OA 1ETUA 2NO1A 3CWQA 1CJKC 5FOTA 5LD2B 1ZM7A 4EPTA 1RYHA 2V4ZA 4G5OA 3P1JA 2BKEA 1TUIA 2HF9A 1KOFA 4PO8A 2CXXA 3L8YA 4Q7MB 4X8LA 1C1YA 3KTAA 4WBSA 1KAOA 1P7CA 2BBTA 3GFOA 1FL9A 4JLAA 4NDZA 4RKFA 3ASYA 4LJ8A 3KJEA 1IONA 4TL6A 1MV5A 2P3SA 3P32A 2GK7A 3E70C 4L9WA 1TX4B 2BBWA 3JZAA 2HDNB 2ZE8A 4C2UA 2ONKA 2PEZA 2WV9A 3KKQA 2J59A 1X3SA 1VG9B 1YZQA 1KO8A 1KTVA 4A1FA 4IVRA 3W3ZB 4OHYA 1NG1A 1JB1A 1W47A 2HF8A 4PO9A 2DB3A 2QG6A 2GVDC 3A4NA 1KJZA 4HI0E 1OIWA 1P2SA 5E7JA 4P4SB 3CX7A 4MGZR 2GHIA 4DLSA 4A2WA 3CR8A 4GZMA 4JLDA 4RCYA 1Q3TA 2ZYTX 5H8WA 3W5IA 5KUTA 2JIZD 4P4SA 1MABA 1S1MA 5AJYA 1H8HD 1R2QA 2PMKA 4RZ3A 2DPXA 4ZCLA 2AKAB 4KO8A 2NO9A 1AKYA 3DOEA 1J70A 3MCAA 4KCGA 3ZIAA 3U7HB 4M1KA 3AF3A 2XXAA 2RAPA 1AS0A 1W46A 4DCSA 2B6HA 3T5DA 5TXGA 4B3FX 4C0AC 1ZC3A 2GAOA 1JPNA 2OHFA 4FD2A 3VR4A 4JKYA 4PZLA 1X8KA 2CCJA 5HZKA 1XTJA 4LI0A 1ZAKA 4IXMA 1I4TD 1RJ9A 4WXRA 1ZJ6A 1NKSA 2QT1A 4URZR 2XTZA 5ANRB 4A92A 3CKLA 2ZJBA 4RD3A 2HUPA 4L9SA 4TQ9A 4EUNA 2J0VA 4UNQA 4C0LA 4PAOA 3PUYA 3VR6A 1NVXQ 4JT2A 2H1LA 2QGNA 1VHLA 5IDVA 5DH9A 2JATA 1DTSA 1Z6XA 4MKFA 2XJ4A 5FL7D 3SEAA 5GADl 2REXB 4LHWA 3MWLA 4MH0R 4BFSA 3FGNA 4IOLA 1IQPA 4DDUA 1I2DA 3BB3A 3WNCA 2O0KA 1B0UA 2BJVA 3WHLA 2O8CB 2VHQA 2GXAA 1B23P 2ZRCA 1II0A 1JR3A 3N70A 1R5BA 3W9YA 5H68A 2JJ1A 1QHSA 3QE0A 5SZKB 2X2EA 1XCMA 1E9BA 2ZR9A 4O2RA 3QKTA 5FOVA 5HKKD 1CS4C 4OHXA 4ON9A 4AC9A 1QHXA 2R6GA 4BUJA 4LHXA 4W5HA 5TY0A 1D9ZA 4ZDWA 4DLZA 1DAIA 1IHUA 3FB4A 1U9IC 3D3QA 4S2EA 3IQWA 2EYQA 2ZI4A 3EIHA 1G8GA 5E3HA 3BERA 4PPQA 2A78A 2BOVA 3AKEA 5KSOA 4JKIA 5FUXA 4B73A 2OG2A 3Q9LA 2FDCA 5LPNA 2A5GA 2J87A 4E07A 1HTWA 2FMXA 1OF1A 2R6FA 1OH8A 5L3SA 2CVHA 2CHVA 2G83A 4IJMA 5E7MA 3EPLA 1NSFA 3C15C 1FOEB 2CHQA 4URYR 1ZBDA 3SOPA 1SXJA 2ZROA 4RKEA 3FMOB 3CPEA 4AI6A 2GEDA 1UKZA 2BMEA 2G9NA 5HZHA 2C98A 4WZAE 1ESMA 4ACBA 4C0HA 1KAGA 3D6TB 3T12A 3I5YA 3ADDA 3OFNA 2V9PA 4TT3A 3QG5A 3LXXA 2D2FA
chains in the Genus database with same CATH superfamily
3SS9X 1ZL0A 1KIMA 1KDPA 1O6GA 1B1AA 1PWYE 4MI9A 1KO4A 2A0UA 2H9AA 1FDVA 4Z8YA 2NO7A 1PNVA 1JAXA 2WIKA 2CMFA 2DH5A 4M99A 4Y9SA 3TTTA 3GFRA 6NULA 5BVGB 5HM8A 3UJHA 3GIDA 4OMFG 3U48A 1T2EA 1T3TA 4S24A 2VNJA 1RYMA 4C43A 4C6RA 4YUWA 2RE8A 1PJRA 1EDOA 4JVMA 2DG2A 3W77A 4ARVA 2QSUA 1CDZA 3IP7A 2I3BA 4BKOA 1IM2A 4F4FA 5J4LA 5LR6A 5EUMA 3A3OA 1J24A 2NACA 3D3WA 5FTKA 2OYRA 4X8MA 1UJBA 4QLOA 5ELLA 3UFBA 1Z35A 4BUZA 3TMYA 3GJ4A 4LRTB 3WGVA 3UKJA 4V0KA 1BJKA 1EVLA 3HPRA 1GEGA 4BAZA 3L79A 3BE6A 1BKDR 1KY2A 1W76A 4L1KA 1DJPA 2XSZA 1OIXA 1VI6A 1Y9JA 1ZUWA 1AUXA 2JA1A 3IEKA 3FNIA 5A4MS 8OHMA 5AKGA 2ZAIA 5EHNA 1LS6A 5KOYA 2YW2A 2PAAA 3JQAA 3PPWA 1NYLA 4OH1A 4CKEB 4AQYB 2PMWB 1DOZA 1UXGA 3K1ZA 5F2KA 4D8YA 2O1EA 3VHXB 4D56A 1CJSA 1EM8A 2NTYC 3FTDA 3JSAA 4HEJA 4U0KA 3WGQA 3L7CA 4EDHA 2GZHA 1TVKA 1ZWKA 2Q45A 5IF3A 3IHKA 1YUMA 1H5QA 1KK1A 4XPIB 1ZK3A 3HDQA 4UZFA 4X93A 5EEHA 3C16C 2QAGC 2FN9A 5JD6A 1X8LA 5JBIA 1CY2A 3FCAA 1SBNE 4US2R 2R1VA 2VRCD 4IP0A 3U44A 1J42A 3M83A 1L4MA 2WNSA 3DZFA 4KUEA 1BQEA 4WOKA 4ZOBA 3TTXA 2V8OA 3PEVA 3L84A 1NTOA 2ZYSA 4RANA 1OAKA 3ESAA 2FR8C 3NHYA 1M6HA 3C7AA 3DOFA 3TX6A 5BRNA 3SQXA 3TTSA 3MRXA 1AGNA 2MSKA 1I51A 4PTLA 4Q00A 4E08A 4J0CA 2JLZA 2P4SA 1CQPA 3Q40A 4PZ9A 5CPBA 5DTQA 5KPDA 2W90A 1AS3A 5D01A 1XU4A 2BBOA 2C2XA 4Y2RA 1W48A 1GN8A 4FDMA 1KWGA 4L8LA 4OL9A 1FFCA 1QTNA 1HDCA 2QQFA 2QXYA 1TTTA 5HG0A 4FCCA 5ECYA 4LUCA 1OTHA 1B43A 2XI4A 2PO5A 3PEFA 4PNEA 1NPTO 5K05A 1QTQA 4BFTA 4B3HA 1GILA 3HN6A 1ENYA 2BMVA 4PO1A 1O94D 3B3JA 2YZKA 1D7AA 2GLTA 1OVGA 3ZNNA 2CZCA 4MYHA 4KYTA 4LV8B 3EPKA 1BD4A 4E4YA 1E4VA 3DUFB 2Q4DA 2VWPA 3JD3A 3W90A 4GR4A 3SXUB 1EVQA 2FPUA 3BHNA 2NVOA 3H9EO 3FB1A 4WESA 1U1CA 4KFUA 1WXWA 5DCUA 3REFA 4AUNA 2BTQB 2GXSA 1O03A 1SVOA 3ANXA 4U0JA 3ZWWA 2O57A 9ATCA 1X94A 2CGEA 2QTWB 3QPAA 4ZRMA 4YQZA 1W4CA 4YI3A 4EBBA 4JL6A 1U1DA 5C8YB 1DHRA 4CEJA 2FHSA 1ECGA 1N0WA 4JQYA 4ND4A 5CX1A 1GPNA 2GGSA 2ZRHA 3AUSA 3PEEA 5B57C 1C1XB 1FVFA 1S89A 4PC2A 5FBLB 2JIOA 2H1WA 5JFGA 4HAXA 3H4MA 4RD1A 1X2EA 4KDFA 4Z0HO 4KXFB 4TLLB 3VSEA 3EEOA 2YHAA 1G5TA 3MJEA 1N6HA 1QP8A 1L8LA 1SXJC 2ODNA 2P9HA 3QPWA 5AKLA 3L49A 3RARA 4MYDA 4BNMA 1G7SA 1UBOS 1JDJA 1L7QA 1J0BA 4LF7B 1JA1A 1HMPA 1Y37A 5EGNA 4D3DA 4UVEA 5KYYA 4QPJC 3QY0A 2VXYA 2YMLA 2YVAA 1WDMA 4L16A 1SQ0A 3SSNA 3GMTA 1YGPA 2OHIA 2P9CA 1OWNA 3HUDA 3LFHA 3QTLA 4FIDA 5AJUA 4W63A 3SYNA 2E3JA 5JDIA 1AX9A 2OHHA 1U0EA 5DIFA 4OX9B 2AX4A 2FVXA 2WD8A 3B13B 3BA1A 3PGLA 4Z7QB 4KN8A 3B52X 4MUHA 2CMGA 2Z5FA 4I99A 2YXPX 3AQ4A 1TF7A 3I3OA 3P71T 5FL3A 3MINB 2VJBA 5KCZA 3VYTB 4AUKA 1J6UA 2V7PA 2CV2A 4JFRA 1LX7A 1DV2A 5EXEA 3PTAA 3CURA 1VQ1A 4RHYA 3LKBA 4JJZA 5AM3A 3VVMA 2FPSA 3EXAA 5HQ3B 2R9VA 2VEDA 1TM2A 2W2MA 5K45A 2VH5R 2FPPB 4MJ3A 2KBFA 1KI7A 2BHSA 4DW8A 5JBNA 2ZI6A 4ITUA 4QBIA 3X1XA 1KVTA 3JQ6A 1N2XA 2C7RA 3P96A 1QVRA 3F4KA 2JEZA 5D1NA 4ZAYA 4DLTA 1O54A 4HFJA 3G0CA 1Z0IA 3MWFA 1FVXA 2E21A 4J3FA 3C85A 2Q46A 3SZRA 3AR3A 1KBOA 3OE7D 5CIQA 3N39C 3WGHA 3HP1A 1E2NA 5DCLA 3S2IA 2K2QB 5KQGA 4TL7A 4AJ1A 4HXEB 4FYWA 3A6JA 2HIMA 4H4DA 4JP5A 4NATA 3SWWA 3IDAA 4DDVA 1P3JA 3DWEX 1F4LA 3SBDA 3M1LA 1SUEA 1T8PA 2H7XA 1U2ZA 3DJYA 5EXSA 4LF5B 2EFGA 5EJ5A 5L4LA 1TYZA 4RE5A 1P72A 5BR1A 2ZIXA 3HYRA 2QVLA 3UA3A 2DBQA 2R4QA 3HDHA 3FZQA 3H4VA 3M4XA 4B6SA 2AJCA 3HKEB 1DKPA 4KN9S 4QXRA 4DILA 5A0TA 3AB3A 3A2NA 3HVIA 3W3AA 4K9RA 1J06A 2QRNA 4NMXB 1TU4A 1BX3A 2XY4A 3EW9A 3F2IA 3WK5A 4EIWA 4EYKA 3GJXC 3PJDA 3DDZX 3RHTA 3UWDA 2YXEA 1LTHR 2GZAA 4I4IA 3UYLA 4CKWB 2UXCB 4P0TA 1N9GB 1ND5A 4HPWA 2YY5A 4MRVA 3RC7A 2ZZMA 3F5FA 4Y1GA 1AGRA 4EF4A 3QJ5A 4ND7A 3AI1A 3E1KA 1AUQA 2V8BA 1BZYA 3FKQA 1UFQA 5SY4A 3CNHA 4QTUB 3I9MA 4R8RA 3C5WP 1UEJA 2QI9C 2BBSA 3L1VA 4QU0A 5ALYA 2B5VA 4IKEA 3TLYA 5A5VA 2HK9A 4FYVA 4YT8A 1RWXA 2AOTA 3I09A 2CY0A 3NT5A 3I83A 4K6FA 1IY8A 3NS7A 5AOAA 5AVYA 3TGPA 1ZUD1 3ROKA 1GZVA 3V6MA 4CM9A 2ARKA 1LPMA 2OR3A 3FMFA 5B6JA 3VZCA 1NBIA 5HW0A 5A62A 2QRHA 5IH3A 4UATA 4DR3B 3U4QA 2DQYA 3JQRA 1Z15A 1IOLA 2PT7A 4H1VA 4CLOA 1Y33E 1XCLA 3NR2A 3V55A 3VOAA 3ILXA 4R81A 1VHTA 2LXNA 3P97A 1LK0A 4MITA 1KMMA 3N6VA 5D3QA 5GV8A 3BCUA 1D3AA 4MIKA 4OXIA 4DNOA 5CMLA 2IK8A 3D9QX 3FWNA 3O8QA 3IE0A 1AHHA 1AS2A 1V1RB 2AOVA 4KQ2A 2HZBA 3UOAB 1F8UA 2PSFA 2FDRA 4ASUA 4ESEA 3L1JA 2FQQA 4HB3A 1HNZB 3LHIA 4BQIA 1P2VA 1R9MA 1TZMA 5AHWA 4CETA 4IHJA 3THRA 2WI8A 4AJLA 3M81A 3I9V6 3A6GA 2QK4A 4ZAFA 3QE3A 2X9GA 4LEIA 1D04A 3EFBA 3GZTB 1KYVA 2FK7A 4DQUA 4TXNA 2WSMA 2BKVA 4Y6OA 1JPJA 3A1UA 3EODA 5G4KA 1R8SA 2H8GA 5HZMA 1LPPA 1V26A 2DLDA 1VBMA 3H87A 1P44A 4IDHA 4KSYA 4WKGA 5BNFA 2JFGA 3KT0A 5E3IA 4OYYA 3KAKA 3F9IA 3GRKA 1FTWA 3TEJA 1JG2A 2AI3A 1N2CE 2ZRQA 4ITRC 1I4OA 2DFVA 2EIHA 1OHHD 4CI0B 4OJQA 3MA0A 3BMNB 3GPDG 5C8XA 4HQLA 3RS7A 3BC1A 1YKFA 5U1PA 1P29A 4MIYA 3HFSA 5A2GA 4RA9A 3BF7A 1U2SA 2CFCA 5DKFA 3VPDA 1U90A 2NXCA 1IXSB 1NY6A 4OK6A 3HDVA 3OFSA 3NETA 3G2QA 3Q6IA 5F64A 3GFBA 4AWXA 2OLJA 2Z9BA 1V16A 4RH1A 5AVQA 2GM5A 1DEKA 4MQMA 3EC7A 3FCEA 1EMDA 2G40A 4N9WA 3WIVA 1QGED 3YASA 3AUJB 5DM70 4HD8A 4LPSA 1AGPA 3ZE7A 3LQ4A 4I55B 5GQSA 2DUUA 1EHCA 5FPQA 1YH3A 2J6BA 4RIFA 3O95A 1U28A 2W2OA 4XD7A 3A9TA 4EA7A 4ZT4A 2ODQA 2X0FA 3PDJA 3C3DA 2OLEA 1QCYA 1W4RA 1GCGA 1X7XA 2KW5A 1NT2A 2FUEA 1V11A 5AW9A 4BP9A 2YASA 5JATA 4D43A 2CLKB 1JIJA 4HPXB 4YBRA 1P1IA 1Y3HA 3ZXUB 3EXIA 1ENPA 3FHOA 4PVCA 1FE8A 1NIPA 3DE6X 4YMWA 4U6NA 2AJLI 3WZ2A 1W85B 1V71A 3H2BA 3KQQA 4RHCA 4F56A 2AG5A 3BTSA 5A6SB 3FROA 4PEVA 4QBKA 5EP4A 4ZU3A 4ZK2A 5FX2A 1PRYA 2RDMA 2AB0A 2QQEA 2WJHA 4W9RA 4Z4HA 1U8CB 2GN6A 1A96A 1PZFA 2GLUA 2ZRBA 1EXNA 3UMJA 4BJ1A 3BSWA 3OEED 5T6BA 3RFUA 4RIEA 3QX3A 1EJ0A 3FI9A 4CEIB 4DF3A 2PX3A 2Q21A 4EQZA 1RP1A 5JAPA 1E3WA 3K9BA 1EBBA 4J16A 3DOUA 2BFBB 4C20A 2P9YA 4FZRA 5AJHA 5SV2A 3HZRA 3BBPA 4G1CA 2OHJA 4RWZA 4WERA 1L7BA 1O94C 3HXQA 2G71A 2O1XA 1VCHA 1NXQA 2R25B 2F1JA 5H83A 2J09A 3KFVA 4KBYA 5FF9A 1Q6YA 3GJRA 4P33A 4JB2A 4ZP1A 2W37A 3EEFA 1P4JA 1I4WA 3MCUA 4UXIA 4BDSA 2VHYA 2YIMA 1PV1A 4YRGA 1LC0A 4RM2A 1VMIA 2GF9A 4J7AA 1W0KD 4PIVA 3SJUA 2Y4OA 2I2DA 2BONA 2EKBA 3A1NA 3MZ0A 4DLPA 4IV0A 4PF1A 5AJWA 5AOVA 3OM0A 3UBTA 3LXMA 1M74A 3BE5A 4DMLA 1RBMA 1JZQA 3DXXA 4J1SA 1M75A 1QG0A 1IAQA 2AYZA 2IY9A 2MR5A 2P62A 1ESDA 2C61A 2HHCA 2F00A 2I3DA 2UZ3A 3A6DA 3N76A 2QTTA 3IT0A 1PQUA 4HOYA 5K6TA 2JB9A 2JLRA 2YHIB 2GUWA 3MCWA 3QKSA 4ZO4A 3T54A 4LYHA 3KQUA 1NOIA 4G25A 3LH5A 4WVLA 3TZCA 3KXKA 1RI2A 2C7OA 3ZHQA 1JSLA 3BAZA 1AKTA 2ZTMA 3PQ2A 5F23A 2YV4A 4NBVA 4PZDA 2ZPUA 4P3PA 4TX1A 3F96A 2F8LA 3G17A 1MTZA 4RTPA 1JPVA 2QRVB 3HPQA 2I22A 2BMDA 1E1QD 1VJDA 2VK2A 4G1EB 4XYBA 2EG9A 4JGGA 3ZU2A 4C01A 1EXDA 2WPDA 1V5WA 3EF0A 3Q8KA 4TRJA 1QGZA 4J8PA 4BNKA 4XGNA 5TLSA 1FPMA 2XHEA 2AZTA 4M1ZA 2GF2A 4R1MA 1J20A 4WE3A 2HSZA 3X2EA 4DXDA 1IULA 2HJHA 2BZGA 2E5FA 4P35A 1IBLB 2VXOA 4LKRA 4CCSA 5E7QA 3WGLA 4E5NA 2OFOA 3AHJA 3NAQA 3MB5A 1WBJB 4K05A 3HXTA 1JFLA 1UFVA 3EXHA 1CRQA 4KSCA 1KGSA 1U3DA 4HL6A 2W83A 3WI7A 2H08A 3FFBA 2F7SA 1RFLA 4Q12A 4ZU1X 3DEFA 3IKJA 5CD1A 3K6SA 2CNWD 4LBYA 2Z4TA 5ALOA 2JD0A 3LY8A 4KO1S 2JIPA 2HMWA 4E94A 1DLIA 1G38A 2ZUUA 5ERXA 3FFWA 3VH4A 5HJEA 1F2UA 4J3NA 2ID4A 3TR5A 1ESZA 1EUDB 3FBGA 1N1EA 3AX6A 4H3HB 5F1OA 2FSGA 2I67A 3SJCA 2PZAA 1ZSVA 2GJSA 3AERB 3AYZB 1KGDA 2AI2A 3FDIA 2J31A 3GB9A 2ZAMA 3MYYA 4X6UA 3WGNA 3FBWA 5CGZA 3X1DA 4H3VA 3H05A 3H9BA 1ORVA 3I1IA 3CKKA 3KSBC 1VA5A 4J43A 3VPBA 4BU0A 1FDWA 2REBA 2IV2X 3SSMA 1JT2A 4EFNA 3GGJA 3UMCA 5K3EA 1DAPA 2R62A 3M1IA 4KK3A 1F5NA 1EVYA 4KXLA 1T4BA 1SG9A 5AI0A 1E5DA 2Z0MA 2VO1A 4YRDA 3OG9A 1G4UR 1ZGCA 3AM4A 5DB4A 5BYKA 1RABA 3ZLJA 4DRYA 3LRPA 1RAEA 1K6XA 3QWFA 4YJHA 5C32A 4XYGA 1QFYA 1UP4A 2OKCA 2C00A 1ZD2P 3CRVA 4QOHA 1NONA 3CZCA 2VF8A 2Z4RA 1IN8A 2RKWA 2MWMA 1YDFA 1SHUX 1XDUA 3GJZA 3WWOA 3KDSE 3UJ7A 4Q66C 1Z26A 4NH0A 4X92A 5CLIA 4YCJA 1O9GA 3JQAB 5FBVB 3S7ZA 3WX0A 4NZPA 1BSVA 3LM8A 4KX5A 1P1RA 3MT0A 4W1PA 1TJNA 3SF0A 3FTEA 4D9FA 1G2IA 1KH2A 1L6IA 1NM5C 2QNIA 4Q47A 2IELA 2SKDA 2VYND 3D8NA 5JARA 4CCYB 2ODBA 3LCVB 4B32A 3NVKI 2EF1A 1OLXB 2QPLA 3CEPB 5CUQA 1WB5A 3C6XA 2K7ZA 1QIMA 3TZ6A 1PCXA 4UM7A 4X44A 4RHTA 1NZDA 1KP3A 2VSXA 3GI1A 4PY2A 1M6NA 3TLGB 4B4UA 3BWBA 4MUXA 4LG1A 4DV7B 1XLWA 3R8CA 4Y6SA 2QD4A 2ZG6A 4WBNA 5BNWA 5JSQA 1NR5A 3L7YA 4B3GA 2OD7A 3GMSA 5AW3A 4M86A 5FO0A 2WT8A 4PQEA 4TLMB 2ZKLA 3EMBA 1GYQA 4ZEMA 2QF7A 4KAFA 3KTOA 5IBPA 3ZJUA 1BWQA 4IDOA 3MVEA 2DFLA 3A70A 4IDEA 4DJTA 4QBTA 5JDCC 4NENA 2MCFA 1U1EA 2ZYIA 4Q9NA 2IOFA 5AM5A 3FZGA 4DLAA 4DHEA 2AGVA 5DASA 1GGHA 2GZSA 2JGNA 4AULA 3ZNQA 1P5HA 2CFSA 3Q1KA 2ACEA 3LLMA 2C78A 3HCBA 3NBAA 5K3FB 3PFHA 1K6MA 2VJNA 3U16A 2P1DA 3FYCA 1ECLA 1MJNA 3SR0A 2LP4Y 3DCYA 4CKCB 3PDWA 1TVEA 2PS0A 3EIEA 3V4FA 1VKRA 3W1WA 1HDGO 1HLDA 1SKUA 1TYCA 2IYWA 3K72B 3WB9A 5HKAA 5JCZA 1QQTA 1RT9A 2XCRB 4JI8B 4B85A 1P1CA 2E2WA 1TCAA 2II6A 2N3ZA 1H2AS 4OB7A 3E5MA 3UH1A 1TUEA 3DM9B 4MWDA 3KVRA 3OD1A 3WE7A 4BRSA 5BXQC 4OX9Y 2J9YB 5FA6A 4B6GA 4UCFA 2OSBA 2PE5A 1XZJA 3ZH9B 4F9GA 1U9YA 3KU4A 4CZ2A 5IJWA 3BREA 4MPJA 5DBHX 3G2PA 3KTDA 2QT0A 5KTTA 1PEAA 1Z3IX 4HLDA 4PGHA 3Q8MA 2O8BB 5AYVA 4CLDA 4AURA 1SVLA 4HWKA 2PZGA 5DWVA 3EC1A 1F3OA 5BN5B 2HKIA 1DPFA 1IB6A 2RHJA 3NOQA 4TMKA 3NGLA 4W9NA 3WKEA 4DA4A 5LZ4A 1RSZA 1Y1SA 1N5RA 2QU8A 1MVNA 2FG5A 3FHTA 1P8JA 2FP3A 2R4UA 1V8ZA 2CVPA 1GSHA 2IPOA 3DHNA 1JFFB 1ITZA 3RJ9A 1OFUA 4B44A 5JXGA 1MQSA 2K6GA 3BK7A 2YV2A 1RQ7A 2PNJA 3TBFA 4ABTA 4OHPA 4LXGA 2JI9A 2GEJA 2YJ5A 3B1KA 4B3MB 2PUWA 4QSHA 2AFIB 1CUBA 3ROTA 5HVNA 5AJXA 4UUAA 1R10A 3PUKA 1H6AA 1LGYA 3EOBI 3I6QA 4GH5A 1HQDA 2G88A 1E2KA 4JN6B 4M8IA 4MV1A 4AICA 1KYTA 1JFSA 4BLOA 4N5LA 3HO8A 5JMPA 3I58A 4D0NA 1ODSA 1LF5A 1SU4A 2GUGA 4XWGA 1SQ5A 5KVAA 4J1TC 4M9RA 1EWKA 2AFHB 1CJMA 2V7BA 1ZGBA 5TNXA 3ABRB 2O0MA 1B0AA 2HWYA 2SCUB 4X85A 1RZUA 4GX5A 4C4XA 3EFOA 4I5IA 1Z8FA 2NTNA 4D4GA 2BH9A 3S27A 2ZJ5A 3OTOB 4XIYA 2AFVA 2VJMA 3FAKA 2OO3A 3WYFA 5MFPA 2VTVA 3GFGA 3V4VB 4RTNA 1Q19A 1Y5IA 2P2SA 3GELA 4JBHA 1E59A 1Y8RA 3C98A 1YZYA 1U6JA 3KDPA 4HTFB 1C3EA 3K5PA 4AX4A 1AG9A 3FD8A 1ABFA 1K2WA 3DMDA 5CA1A 1NXOA 1R18A 2PGAA 4G5SA 3O75A 4FT4A 1I6MA 2VTBB 3FJOA 3QBTA 6PFKA 3M0EA 2X1HA 3Q0TA 1SA0A 1PGJA 2D1RA 4QAJA 4LX0A 5D7NA 2OCAA 1EK2A 1A9QA 2FKNA 3MWKA 4KNWA 2BPOA 1E3SA 5C80A 3PFWO 4HZGA 1O5TA 3L0PA 2FFJA 3WL6A 2WD7A 4J0KA 1AHIA 4AIIA 4CKCA 3IPLA 1UAAA 3HB5X 4KLZA 3WGZA 3A1EA 3KUKA 3QFSA 4CMGA 4YY3B 1Q84A 2FFHA 4WMLA 4C08A 1JB9A 4I9GA 3K9NA 1FSSA 2IOYA 5DT2A 5FFFA 4GEGA 4URHA 5AW2A 5IG2A 3BKXA 2MINB 3QPDA 4P9NA 3BMQA 3O7MA 4FN5A 3MMPA 2PA3A 4H15A 4O4LF 2BGJA 4W5RA 1YDGA 1LJ8A 2GI4A 3KWFA 4DV1B 3MJTA 3V4OA 3PRJA 2P1ZA 3KV3O 1R16A 3ANLA 3BDAA 4MLCA 4V0SA 3CH7A 3OIUA 3PSAA 2Z3VA 4P32A 4XJXA 1VDZA 4IH9A 2GXUA 2ILVA 5JISA 9GPBA 4U6QA 1C4KA 3DCIA 4BV8A 4B4WA 1LPSA 3VPCA 1N3IA 2ADOA 3I32A 2B6NA 2EL7A 4HN2A 5HDBB 5EJ6A 5ITWA 1QO0A 4JR2A 4N82A 2IU0A 5LOVA 2FKAA 4PSUA 3D0RA 5EUCA 1W4BA 1G8YA 1LLCA 5IM5A 4DV2B 5ILOA 3C6ZA 3KYCA 4QDXA 2O5RA 5KNDA 1GAWA 1UJCA 3QKWA 1CE8B 3PFFA 4JCCA 4JJ7A 2R5FA 3GXBA 4B84A 1M73E 3QKRB 1SK8A 4A8JB 4CCWA 2P6MA 3DVQX 3R23A 1QAOA 4YAKA 1CD5A 1ZCFA 1O7JA 2BVNA 2XMRA 3DDNA 4GE0A 3C3MA 4HMQA 1T5BA 3AP3A 2KE5A 3UJBA 3V2GA 4GP9A 4R3NA 5K0FA 1MJHA 1G42A 3DMRA 4MQ4A 4HLQB 3NH9A 1USUA 1WTAA 2W70A 5J2TB 2C5LA 5D51S 4EW1A 5C7OO 4FWTA 1U7PA 3B1YA 4ZAGA 3SPXA 3CO0S 3WKDA 4X90A 1MH1A 2W8BA 2O9JA 3A1DA 2IBTA 1NATA 1I0ZA 1NLUA 3WL5A 3F8SA 3COVA 1P4AA 1VC2A 3I9FA 4MR8A 2ATEA 2R60A 2WIJA 3I6BA 3R5FA 4KP7A 1DHTA 2E49A 2QIPA 2VAXA 4GPBA 4MIOA 5HF9A 1H8HA 4GOLD 3AV0B 5LL6P 3HWX1 4QDTA 1G63A 1MX9A 2BFOA 2RIRA 5DGXA 2XPCA 2M9MA 3CH6A 5D8DA 1T3SA 4JQCA 4KGZA 4ZJYA 4D42A 4YCLA 1ZRNA 4QZVA 3HXMA 4RK4A 3UT6A 2IHKA 4OFBA 3AHFA 1NX9A 3MXOA 2V6MA 4GDFA 2DE0X 3QVWA 5FO1A 4G5XA 2M6RA 1FXUA 4CLRA 3L0ZA 3ZX5A 4WTOA 1R4NB 3T94A 2A86A 3GCWA 4TUYA 2GPYA 1U7HA 2QX4A 1IPEA 1ZH6A 6REQA 5KOJB 3B38A 3QG1A 4JWKA 5FT9A 4Z51A 3I2GA 5KAMA 3U4CA 2ZIUB 1BWPA 1RRPA 2X7HA 4QHSA 3P4XA 121PA 3W2HA 1DL5A 2FJ0A 2P9QA 2J5BA 3P4UA 1YI1A 3F3KA 4RNCA 3VJMA 4EJ2A 5DX1A 5F3WB 1JXAA 5K0GA 4W9MC 4EG8A 2P4EA 3CLRD 4FI3C 1YVPA 3DZJA 3GMDA 4RF4A 2DQZA 3CTPA 4WASA 4Z3OA 5AM1A 3GMIA 3HR8A 3OO1A 1QR6A 5F5NA 3BF8A 1TMOA 3G1UA 5EMLA 1UJ2A 1T6ZA 4KXNA 1T0HB 2BDEA 4OUDB 3GBPA 4Y2UA 4D82A 5H9VA 2V7XA 3TRHA 2D2IA 4P22A 1VSVA 1UDXA 2GKSA 3LLSA 5IBQA 3W5JA 1T5OA 7ABPA 3NJRA 4HUQB 1UT6A 1YR8A 2O2XA 4OGFA 2WR8A 4TTSA 3T1VA 4Q9DA 5EJ2A 4BCDA 3HN2A 4IR7A 2Q6OA 3SR3A 2QQ0A 3MG9A 2IYNA 13PKA 4NHEA 2P0EA 1OFVA 3ZZUA 4XDHA 5A71A 4P3YA 4HNTA 2OGTA 4KQ1A 3ZE1B 1EFRA 3FPJA 1G55A 1UKCA 2CL5A 2GM3A 1II9A 2FZEA 4FHGA 4KNVA 4WY5A 4ENWA 5LQDA 1T15A 3DMFA 3VC2A 3L4SO 1NVFA 3C41J 3LT1A 4DSAA 1V2GA 5SZJA 1L5OA 2L18A 2J4FA 3NC0C 3Q85A 1QVAA 4M37A 1V3TA 4C4ZA 1UXJA 3SQDA 1P5RA 1XTVA 4FHFA 2FN8A 2R1TB 3TSOA 4DN6A 1RBQA 3T4XA 1K68A 3AR5A 1X9HA 4AMBA 1C0LA 2PMBA 1YACA 3QLVA 5EIBD 2G8LA 3LUFA 4WCFA 4EY8A 2YNMA 1QONA 2PGDA 2QZ4A 4QDKA 1OU0A 4FNOA 4RF2A 4BQSA 4A2PA 4D2IA 3O93A 5A0FA 5BURA 4J0DA 3DAOA 1X7XB 1J90A 1T2NA 5GJVC 3AFMA 5I3CA 1FS5A 3O8NA 5DISB 3BFVA 3RHFA 1DE0A 1YVRA 3MRVA 1X1SA 4FHDA 1B76A 2OESA 2X6TA 2BE9A 3I12A 4MSUA 3O3MB 1E64A 1GFWA 1LLDA 4HUJA 4MB0A 1SOUA 1WZIA 3R5KA 1U99A 2JLAA 2XVXA 1IZ7A 2WJYA 5F2EA 4JI3B 5IFLA 3FMVA 4CMCA 5AUPB 3EXHC 1C14A 1CNMA 2OCGA 3G6KA 2Q2OA 3OETA 1G3IA 2VYQA 4N3BA 3TUIC 4QHTA 2OBXA 3AGPA 1TUBA 4Q3NA 4BQRA 3P0EA 2VYFA 4RK5A 2HNBA 1G8AA 4LRSB 4LZOA 1C9KA 4UBJA 2IYTA 2DJIA 3RWBA 3F47A 1UXHA 3U4AA 1OX5A 1TECE 4D7AA 1E2DA 1OPXA 1GUYA 1Z74A 1AKMA 3EXEA 3H2YA 3MC1A 2YNMC 3TRFA 5KKAA 1VPDA 4WCFC 4ZFNA 3WBKA 5JMTA 1IXKA 1T9GS 2OZVA 3JQ9A 4ETWA 1PWZA 3G7UA 1RAAA 1UINA 3MTAA 5HCNA 1GP2A 1N2JA 1NF2A 2ZDQA 4NNJA 4F5DA 1D07A 1GPMA 1C9JA 1I7LA 1FTGA 3NBYC 4MLDA 2EJVA 3KJGA 2FDXA 2QKYA 4XSHA 5EQTA 3V80A 3KM0A 4AG6A 5HOQA 4B3SB 3AVVA 2WWRA 1UPUA 2IZOA 4M7WA 2OAQ1 3D7SA 5DJ5A 5JRZA 3ACDA 3HR7A 2JLSA 5F1YA 4L74A 3U3RA 1UXOA 3DD5A 2HSJA 2QU7A 3UATA 4IRUB 5DBOA 1U7XA 5GOZA 2PCLA 1E8MA 1YRYE 4L51A 1SU7A 2ERCA 5KDLA 2EERA 3EEQA 3WB1A 3D7MA 1P7PA 3RAGA 3LHDA 1PK9A 1Y5RA 1C0IA 4G0MA 2XBMA 2N46A 2Q7XA 4YV1A 1E0DA 4KZPA 1UIMA 2OFPA 3IAS6 3HY6A 1Z0FA 1OREA 3C3BA 4PHHA 3RYFB 3WMWA 2Q2QA 3F67A 4BNWA 1XCJA 3H84A 3OCCA 3PNQA 4NR0A 4I1PA 5KVSA 4TKLA 3THYA 1A4UA 4PIMA 3TN7A 3HKBB 3OZVA 3O1IC 4DLXA 5TMPA 3H11B 4XGIA 5LYYA 3X3HA 4L95C 3TW6A 5JTUA 1N6NA 1X1QA 1WZNA 1C30B 2Z5GA 2HSGA 3FIUA 2I33A 4PYQA 3AXTA 4D25A 1ZYUA 2HDHA 3C70A 3O8OA 2BR3A 4X1OA 5CCDA 2YC2C 1MAWA 5B1DA 3HFRA 4NK5A 4UHBA 1COWA 3RUDA 3IEXA 1RPNA 1MT0A 3QU7A 2E37A 2F55A 2EBWA 4M46A 4MVJE 3E03A 1PL8A 3HACA 1FFDA 1MLDA 2C4UA 3FOWA 4JLUA 5BT8A 2AA3A 1IEWA 1KVUA 4GXTA 1Z2OX 4RGBA 5KYYB 5EJEA 1AQUA 2I62A 1CQJA 1FFXA 1Q57A 1QK5A 1QWSA 4RVUA 5J2UF 3DDOA 4MMYB 4N1AA 5JYBA 1M6YA 2A3RA 4RWEA 5LXTA 1S2NA 5EVCA 2YICA 2GD0A 3LK6A 2I66A 3SOZA 4EY3A 3NVAA 2B4RO 3I6ZA 3HB0A 2QL7A 3D8HA 4PVDA 3C0KA 4L2IB 4QTZA 1TFUA 1W36C 1UWCA 3NYRA 2D5CA 2QI9F 5I51A 1N0HA 3OFJA 3VBEA 1XD2B 4OJTA 1N7IA 2G6TA 2WJ6A 4IM7A 1PT5A 2PR7A 2H31A 4DDHA 1NGSA 1P2DA 4GWGA 5D6OA 4B3TB 3NNDA 4TSFD 2AS0A 4YXWD 2RARA 2D0IA 4A82A 3A7DA 3DDHA 4QU5A 3HLYA 4N0QA 4XFJA 3ZTYA 3ROQA 1JDPA 3GWGA 3ZQJA 1L7MA 3AC0A 3KR0A 2Q6LA 4I4TF 4IJVA 2F1RA 5JVDF 4KXXA 3HKDA 1S7CA 1UAGA 3UMRA 1P0QA 1SMKA 4BP8A 1M72A 5AD1A 4IBOA 1GWNA 4UAUA 2Y93A 4WGFA 5F4ZA 5FRDA 2RJ3A 4H7FA 2TMGA 1RS0A 2WHYA 2MMGA 5FLKA 1A8HA 4WSOA 5CLLA 5JQGF 5LQCA 2G1KA 1W0JD 4MKGA 5CRIA 2F3PA 4CDMA 1UUFA 1W9HA 5A7HA 3RTCA 2P2DA 1U0OC 4Q5IA 1DEOA 3N6XA 4Q4AB 2FJPA 2H4FA 1L1FA 3T3MB 4LFBB 5JTTA 1RKXA 5B3AA 2V59A 1Z62A 1WQ3A 1NJSA 1NXTA 1E0KA 1E2FA 2PPVA 2XVAA 5JZSA 1W0CA 2BDUA 3ZU3A 4Y6PA 4LJKA 3S2YA 4I9HA 4A03A 2WTAA 4OATA 1XVAA 1WETA 1Y7IA 1DWUA 2JGFA 3E8XA 4KK4A 5JNWA 4HN4B 2ADFA 3LTNC 1H9CA 1F2VA 2C0CA 4Y9DA 3S2ZA 1IMJA 3H0EA 1HDEA 1GCOA 4ER0A 2PMDA 3IBCA 4DYVA 1IJFA 1WBDA 2EVWX 2PGJA 3OOJA 1ZGHA 4JR0A 4KQGA 4LOKA 2XUPA 5HF8A 1PTJC 3ANMA 4Q4HA 4GMFA 3U26A 1HWYA 4K0RA 3ZQUA 1P17A 4ITVA 5K3OA 2EBUA 2QMUA 3I04A 3RUEA 4ZAXA 3EIXA 3O2JA 2QN8A 4GL2A 2JAXA 3VM6A 1YS2X 5FBQB 1W88A 3TZLA 4MW4A 2H00A 2O3RA 3D1VA 4I4TA 4LRUA 3ZD6A 1YZUA 3UPDA 3GLGA 4LE0A 5ER6A 1ZD1A 2HUNA 4KQIA 1YAJA 3ABIA 3HB7A 3SM3A 1Z6GA 4XIIA 4UBMA 1BCSA 1N5LA 1O95A 3MGCA 1DXOA 3B1VA 2BUBA 1Q1QA 2I2FA 2VT6A 2ZWIA 2QT9A 2DSTA 3B9RA 3FETA 3HJAA 1U4NA 3UNXA 5JXJA 4U2FA 3CSUA 1UPXA 3KYJB 3MTGA 1JHMA 3AY7A 3LRTA 3M6VA 4LZNA 4EY6A 1QLHA 1WR8A 2D62A 1HYEA 2O2EA 3D3EA 3P9XA 5GP1A 2RGXA 3U80A 3BGOS 4P54A 4NRDA 1ZM9A 2QX8A 3II6X 1XRLA 2VF4X 5SZHB 2FYTA 2HRBA 4HXFB 3SYRA 4D3XA 4ERNA 1L6RA 3ILSA 5EHQA 4EHAA 3KJNA 3M5DA 2WM9B 3OF5A 2ZWVA 2R7MA 3PQFA 5BVGA 1JSXA 2EU8A 2Y76A 2QYHA 3PFKA 5J4HA 3UAXA 4Z53A 1QHIA 1RXWA 1UZMA 1Y8RB 3FKSA 3THYB 3OLZA 1PLLA 3KQWA 1ZY2A 5LA6A 4OB8A 1GZUA 4CLXA 4MARA 2D0DA 3G7NA 3OPMA 5I7WA 4F97A 2QE7A 3UAWA 3H0KA 4AROA 4XR4A 3D3WB 3GLTA 4J91A 1MO3A 3V32A 3RS4A 1Q6ZA 3BH0A 1ULUA 3I2YX 3IQEA 1YVEI 5JR3A 2ZJOA 5CBKA 4C2TA 1NXVA 1NDQA 1TCBA 1WSAA 1QH1B 2XIQA 2ZUVA 5C8YF 1JKJA 1NXSA 1ESNA 1VLZA 3UG6A 5IC4A 5BOVA 3V5NA 5JASA 1LU9A 2OZEA 2QVCA 4Q15A 1LW7A 3ER6A 3KKOA 3OY2A 2A88A 4MRRA 2IHVA 1ZCZA 2BFDB 1IL0A 3EW7A 4HDMB 1PUXA 4LAFA 4LZJA 3WYGA 4OEHA 2H1IA 3Q8LA 3OCUA 1GAQA 2C8LA 4MGYR 4CMEA 5HCIA 4UVIA 1CR0A 2NVWA 4JU8A 3NJ4A 1NQXA 2AXNA 3GJ5A 4R8LA 1ABBA 4N7JA 4EJ0A 4CM8A 4NZYA 1RRFA 4DKXA 1XRJA 3CB4A 3BILA 1IRXA 1M34E 1NUPA 4URUR 2FWMX 2NLOA 3RSHA 5L4NA 1G59A 4KXVA 2A9RA 1RXYA 4DG9A 3ONVA 1XMVA 5LLDA 4AQ7A 5JUWA 1OAOC 3U44B 1VYHA 2BFCB 3PXAA 4FKBA 2R6HA 1K3TA 4M1EA 5PNTA 5JEEA 4BNJA 3H3JA 2NMVA 3O8RA 1FQOA 3Q9SA 4I8XA 5H3CA 2ISSD 1V48A 1K7FB 2GN0A 3KZ1E 4JBLA 1FP7A 4WCVA 1TW2A 4A8JA 3N2GA 2B7CA 4OJMX 1KJNA 3DJFA 4ABYA 4EAQA 2VDOB 2BHRA 1OH5A 3RC8A 2XA1A 4EHBA 5CU7A 1ZK4A 1CX9B 1E79A 2A57A 2H2WA 2JFXA 4JJ4A 4Q82A 4BE4A 4YPVA 3A6HA 5L7WA