4OKVB

Crystal structure of anopheline anti-platelet protein with fab antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLTLSVTIGQPASIACKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heavy chain of 8H7 mAb
publication title The crystal structure of anopheles anti-platelet protein, a powerful anti-coagulant, in complex with an antibody
rcsb
source organism Anopheles stephensi
molecule tags Blood clotting
total genus 53
structure length 218
sequence length 218
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4okvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4okvB01
4NP4H 5M95B 4MS8C 3LKPA 2CR3A 1NC2A 1PDKA 2EYTA 1OGTA 3D1MC 1S7RA 3EOBB 3QUZC 4MCYA 4QRPD 3VH8A 1EFXB 5FYKD 4XMLL 5T3XH 5D1ZD 3F58L 4JKWA 3SQOL 4BH7A 2YMXL 2EIBA 2X4SA 5ICZA 4KRPD 4L8BA 1HXMA 3QWRD 4MDJB 3RDTC 3B9EA 1CE6A 1MQKH 2DQGL 1CGSL 1CICB 3DBXB 1CTNA 4EI5D 3QFJE 1A6VH 2EDHA 1FO0B 1UB6A 2R1XA 1DUZA 2E7LA 2DWDA 1TQBC 2C7UA 1OTSD 3K8KA 2BVQB 3P4NB 5J1TC 3F62A 5MENA 1G1YA 3DVFA 4HK0B 4QRTB 1U8OB 3S37X 3OX8B 1RZJL 5INDA 5IESH 5A2IH 1MEXL 4H25A 3DIFB 5DMYA 4WEUD 2JJTC 3DHJA 4XNQB 4DVBB 2Z0BA 3SCMA 5IMKA 3NPSC 5I1LB 2VLLB 3VFWA 3ZHLA 3I84A 4NNXA 5GS0D 3ROLA 3EYVA 4XWGL 2J12B 1ZVHA 3BWUC 5JUEL 2HRLA 3UJJL 1J05A 7FABL 1AD9A 1KIRA 2P48B 3BIAX 4MB5A 4QXTA 1KTLA 2JJVA 4JFDE 3VXTA 2JIXB 2P45B 3HI5L 3C60D 3TIEA 5C86A 2Z35A 4M9PA 4NQCE 4HAGA 3SE4A 3VWKA 3RVXD 4OFKA 4WW1B 4UNVA 2B2XH 3PWNA 4LCYA 4HWEH 4HULB 1WC7A 4KKCD 1M71A 1BEYH 3FQXB 2CIIA 1K8IA 5JQ6L 4N5UA 4OUUB 4P2OC 1BBJB 2F5BL 4CUCA 5DJAB 3KYKH 4WUKH 2DQEH 5F8RC 2UUDK 3T8XB 1S7WB 3S36L 4PJ5A 1EBAA 2YD9A 2DWEA 3RX8A 5I1IL 4D0DA 3LAFA 4XMPL 5E8PB 2ZCLH 3QCTH 3SPVA 5F72S 4UIMA 3EZ8A 4RBPH 2VZTA 4FQLH 3UTOA 4HWNA 1MVFA 5H94A 3QXVA 5DSCA 3BPCB 4PB0L 3NMEA 2PF6A 4Y4HA 5TQ2H 1SJXA 3MOBL 1OARL 3Q5OA 4NO2B 1BFOA 4FQQB 1KIQA 1F42A 3MBEA 4KJPC 4KKLC 4U6HA 3TIDA 4AH2B 3LN4B 1FGNL 3MCKB 3EYFA 2CDFB 2FBJH 3MMEB 4NJAH 3VRLF 2XFXA 2YPVH 3I6GB 4ZTPL 5JTWA 2QEJA 4LSQH 4ZUVA 5K33A 1URLA 4RMRA 4R0LC 1IBGL 3EUUA 4G6AD 5CWSA 4ELMB 3WD5L 4QHNB 1UCTA 4YHNB 4JFHD 1CT8B 1HINH 5C08D 5E2TH 1S7UA 3EGSA 4OZFA 4ZUWA 3A6BH 1PY4A 4D2NA 3ROOA 1EHNA 1MRDH 4DGVH 4F9PA 2Y07H 5C0GA 4YHOL 5HXMA 4ZFZA 5ADPH 1J86A 1JTTA 1KLFA 3TVMD 3U36A 1QLRB 1PX4A 3QUZB 2DQTL 1DSFH 3MLXL 4JN1H 4CJ0A 1RZ7H 2FLRT 2EXYC 2X1OA 5FOBB 4WO4C 4EN3D 1FFQA 2EIZA 1VFUA 3K4DA 1U8JA 1FYTE 3LSOB 5F96H 5GS2D 4JEGB 4X7TB 1M6OA 4WFHE 1OP5H 5HYSB 4TSCH 4M4PA 4D9QD 3ARZA 5TJWK 1NFIB 3BISA 3EO0B 1FP5A 4YQXL 3SKMA 1ZT7A 5IBLD 2VDMH 4KVNL 5I8CA 2NNAA 1QBMH 3I50L 4E41A 4HWBH 5I9QC 2VUYA 1FORL 2V2WA 1VFBA 4RMVA 2P7TB 2FJGA 5C7XL 32C2A 5CEYB 5JHDE 5B3JE 4PRDB 4PIRF 1MHPH 4PV8A 1FFNB 3QPXL 5DJXB 3QFDB 3CFCH 4NHUA 2V9TA 4WV1C 4PRHB 3W5MA 5A2FA 1HWHB 3UYRH 3GMPA 1CLOL 4CN6A 3ULVD 4OCXL 1KCVL 3NAAH 1A0QH 2GITB 5F9OH 3MV7E 2Z4QB 3WBDA 1A64A 1MLCA 2MKLC 3BZ4A 3O8XC 3VFNA 3BGFC 4XI5D 4CVXB 1GPOL 1ROWA 4ZQKA 3TO4C 1EHXA 2P5EB 4Q0XH 1VB9A 3WCYA 3PQYA 2JTDA 3PHQA 5HY9A 1CGXA 2ZUSA 5CBAB 3ELAT 5IF0A 2CLRB 4R2GC 4Q9QH 4ORGB 1SBBA 1KXQE 2RGSA 5CMAB 3TH2T 4IBLT 1W72H 5IBTL 4ZSOE 4MJIE 5HI3D 4YXLH 4PGJA 3X3GL 5D7LB 5HHOE 3VJ6A 3NTCH 3WEXA 5ENWB 4KGLA 4Z95H 3OB0H 3CX2A 1P4BH 4J3OC 3E3QC 1DR9A 1OSPL 2ZJSL 4PGEA 1CVSC 3FAWA 4QOKD 2XTJD 3T65B 1IZJA 1EAPA 5HGHA 3W2DL 5EWIL 4HCRA 5D7IF 1KN2H 3NIFE 3STLB 3RVTD 4X98B 2AJVL 4LLDB 1MCQA 4BH8B 5I30H 4QF1A 4YHPB 4JKLA 3UP1A 4HGWA 1N3NB 2HN7A 1K3IA 2V5RA 1JWSA 5E2VH 5GISH 5D7IB 2VE6B 1HH6B 4D9LH 3BPOC 3TYFA 5GGRY 2FD6L 3LQZB 3E0GA 2Y7QB 1YN6A 1R3HA 5HVFB 3PL6C 4NHCL 3V5KA 3MA9L 4ZTOH 3GSVA 3RZCD 4QCIB 2Y6SD 1MF2L 5FHBH 2RR3A 1QBLH 3NFPA 1P7KA 1B6UA 4G43A 1NC4A 4KPHH 1FC2D 1HHIB 1LO3L 1U2HA 3RPKA 4JY6B 5H37H 4M6AA 2BVUA 3QI9B 4FXGA 1WWCA 3MREA 1UJ3C 3X13A 2CKBL 3EDFA 2E9WA 2D03L 1KT2B 3VXUB 4Y2DB 2N7BA 3ET9F 1CDIA 5CILH 5F6HJ 3O2VL 4ZXBB 4MSWB 5EU6D 5GHWL 3SDDB 3HNSL 4I2XB 1CQKA 1EO8L 1XCTB 4JFYB 4ODVL 5CJBA 3QXAA 3JZ7A 4GG6F 1Z9MA 3EHBC 4G7YL 3HNVL 2IGFH 4F7TB 3CPLB 3REVB 4K9EC 2VABA 1DVFD 4X4ZA 4JHWL 3MGTA 2H9GA 4Z6AT 2ARJA 2VO5A 4MNQD 5F9WC 4GG6B 4Y1AA 1ES0B 1A9BB 4JFXA 5EU7C 4X9BA 5I1JH 4LP4A 1EEZA 1OTSC 2ARWA 1K8DA 3UBXA 1U58B 3L5WB 1J0ZA 1DJSA 1TCMA 3KPRD 1R3LB 3O3BB 5KVGH 4OLVL 1H0DA 4WV1B 3RWEA 3RNKB 2FO4B 4XNZC 2NY4D 1FYTA 5LGHH 1G7JB 5MERA 4M61A 4LHQB 2NY3C 4K7PX 3QCUH 5TFSL 5KS9F 1RFDL 4H1LB 3CNKA 5FV1L 1BX2B 2NCMA 2YD1A 2DDQL 4QRUA 4XNXL 5BXFA 1EHLH 3F8UB 4OCRL 1LK2B 4B50A 4FQJL 5KS9B 1JNLL 1CK0L 4S0TD 2EDYA 4O51B 2WWMC 1KJ2L 3MODL 3KPSD 2W59A 2X44D 3FQUB 1NL0H 2QJDA 5JHDA 5E6IC 3Q6FB 3QH3A 5DO2C 2PTTA 1ND0B 4P57A 2DL2A 3AXLB 1T21B 5HI4D 5DFVD 2MWCA 4J1UB 3FO2B 1RUPH 1RZ8A 5DI8A 1U3JA 2Z31B 1G7HA 2XIDA 3QDJB 3MFFA 4AMKL 2OI9C 1IFHL 2VDQL 4RFEA 4Q9RH 3BYYA 2CMRH 1J8KA 4QHKI 5I71C 3WUWB 3W9DA 4LRIC 1KF9B 5D72L 2XQYK 5ALCL 2I26N 3N0PB 1KPUA 3BVNA 4ZFOL 1L7TL 1R5VB 3FZUC 1MI5B 3HRPA 2VNCA 5E8EB 4NO3B 4JVPA 4U3XA 2PYED 4UINH 3OR6B 4MJIA 4GQ9H 4ZSOA 2WUBL 4X6CE 5EBWA 2EEBA 1RUQH 2NZ9C 5CP3A 3EFDL 3GNMH 3LEYH 4G9DB 4BSJA 5KAQG 4ZNCD 3WE6A 1VACA 4DEPC 4JDVB 2E27H 1ZLSL 2VERN 1YEKL 4I0CC 1OAQL 5EBGA 2YXMA 4GRLD 4R4BA 2OSLA 2R0KH 3QISA 1WZMA 4E9LA 1B0GA 5I76B 3TWCL 3DMMB 3V4VL 3QQ4A 5H35A 3HZMA 1FZKA 4OCSL 4PJBE 3LS4H 5T33H 2F58H 4D3CH 4Z7QE 1IQDA 2OL3L 4DTGH 4PJDF 5HI5C 2EEAA 4MAYB 3MRQA 2CRYA 2OXHA 3CK0L 1AP2B 4M62H 4PJGE 4U33A 3H7BB 4G6JH 5HHVL 5ICYB 5K59F 1WZ1L 1QO3A 2VXSL 5E94A 4QRPB 4PJDB 1OLZA 3MPCA 2Q7NA 2ICES 3QDME 5D1ZB 1UCBH 3PF2A 2VZSA 5HYJE 1IC5L 5J56B 2B4CL 1BQHB 4KRPB 3SDYL 1CS6A 1SEBA 3IGAA 1A7NH 2V7NB 3AY4A 4QWWD 5I1AB 3EAKA 3GMOB 4DK3A 5KW9H 2YA1A 3NN8B 3JWOC 4DAGH 4PS4L 1YDPB 5DQDH 3MCG1 3O41A 4UV4H 1KENH 4EI5B 2FSEB 3QUXD 5EO1B 1EXUA 2F15A 3L3KA 2YRPA 5BS0A 3TZVD 3JTTB 5D6CA 2W9DH 1X4ZA 5J6GB 4XNZB 5C70A 1T1WA 1R3KB 2V17H 3Q0HA 5C8JB 1A1OA 3UROR 2FL5B 2LFGA 1T1XA 5FYJU 3GK8L 1GXEA 5D6DC 1TZGL 2AV1B 3O9WD 1SYVB 4HUKB 1N8ZA 3QG6B 4MNGB 3PGDA 4PJ9A 1NAMB 3ULVC 2AW2A 3WNLA 4X0KA 2Y1VA 4F7EA 4XGZB 3C6LC 2CIKB 2ZPKL 3GSRB 3MOAL 1RQ5A 2YA2A 2WUCH 4KVCH 5EZIL 1XF5B 3PDDA 1MCKA 1BAFH 1QFHA 2VLKE 4JRXD 2B5IB 5DVNA 5T3XL 1F2XK 2X4QB 4NFCA 3C60B 3KGRA 1FNSL 2R0WL 4BKLA 2OR9H 4ZOBA 4LLWA 5CJOH 4I18C 3KYOA 5LCVH 1QPXA 1MAMH 1IEAA 4KRMB 4JRWA 5DT1H 4ZS7L 1S7SA 3SDXF 1Z5LA 3SOBL 3E6FB 5ICXA 3NCCB 2AEPH 2ICEB 3TBYA 5A16B 1A9EB 4YDJA 3BUTA 3U30C 1TQCC 1YEDB 1U93A 3SDXB 4HF5H 1KLGB 1X5KA 3RZWA 5K9OA 1P6AB 2P1YA 3MBXH 4O02H 5IESL 2F8XC 3ZTJG 2ICWA 3MRNA 2MQCA 15C8H 3IJHA 4TYUA 2FHCA 4UB0L 5I66B 1P5VA 4HV8B 5H8DA 4C57C 1AD0A 3V6OC 3DGCR 3WIIH 2GCYB 4XH2B 1HQ4B 3RVTC 3C09B 4L8CB 3NIDE 3FL7A 3JVGA 4R3SB 2AK4D 3TBWB 4CADB 4P99A 3IDNB 4KZDH 2QL1A 4QNPE 2QADC 1JF1A 3LZFH 3TBSB 1V05A 1CBVL 4Y5XC 5BZWA 1H15B 2XKUA 4U0QB 1FAKT 5FO8A 2FB4H 3CX5J 3IDYC 4JRYD 4WFFE 3ULSB 4O58L 3VXOB 1QNZL 2XWTA 4HWEL 1GGBL 4XP9H 3BP7B 5GS1C 3G5YA 1X7QB 1QBAA 2HTLC 4LASH 4MJ6B 4UU9B 5I74B 5B21A 5IROC 3T1FB 5GRJH 4M7KL 2DQIL 2DKMA 3NFSL 4TOYL 5KJRH 4K9EH 4OGYH 4WUKL 4UOW1 3JV6A 2DQEL 1QLEH 4N90E 1KJVA 2P24B 3PIQB 5DFWH 5E4EC 4DOHB 4OCMC 2X4NB 5JW5A 3IKCB 2WIIB 2APTA 4JCMA 3H6JA 3TVMB 1I7UB 4M7JH 4ZMAT 3MRRA 1XAUA 1NEZB 4P3WA 3V7AG 1JRHI 2R69H 4RGNE 1M7IA 1JRHH 2VXUH 2ZCLL 1O5DT 2ED9A 2EO9A 1IGYB 3D25A 2XWJA 4Z0XB 4FQXD 1H3XA 4EN3B 1MCOH 1PLGL 4PJHE 3MXVH 1FLRH 4IDJH 5ESQA 4XVJL 5D70H 3U1SL 1I85C 5HGAA 3QIUC 2KQNA 3D9AH 5D2LF 3ZTNH 3FN3A 5KSAD 3L3HA 3Q5YA 4OJFH 1MRCH 5BRZE 1RAMA 3F12B 1B4JH 2IPKA 4PJBA 3PWUA 2FBJL 5C6TH 2ZG3A 4Z7OF 2YPVL 2B1AL 1Y18B 4K8RH 4LSQL 1S9YB 5D2LB 1ZA3A 1HIML 4ZG1A 2IPUG 2X89A 2HLAB 3M17A 4HUUA 4R26H 2FX8L 3QDGE 4ZUTB 5FDWA 4PJGA 3SEPA 5C07E 3PHOA 5TH2B 4OLXH 3SKOA 2W07A 1MWAL 3ULVF 4H5SB 2EYRB 4W6WB 3FQRB 3OGCA 3BKYL 1P69B 5JXEC 4EOWH 3CFJA 3O2DH 3K0WA 2Z8SA 3QDMA 2UZXB 2G2RB 4H8WH 4X6BA 5HYJA 3FRUB 1JZ4A 5DHYB 1M05B 3GSNB 5FUOH 5ADPL 5JOEA 2H45A 4ESKA 2XKSA 4FHBD 5IB3A 3GI9H 3MLSH 1PJ9A 2K3TA 1T3FB 1RZ7L 2VXTH 1FIGL 4XP4L 3X12B 2EC9T 3ARBD 3PDOB 5GRZA 5KN5B 1AR2A 1T80A 2L7JA 3H9SD 3WIHA 4CJ1A 1JZ3A 1BGXL 5H2BA 5K9JL 4BFGA 1OAUH 1JF6A 1GGIH 3IXAA 1Q0XH 5DLML 3VDCA 4URTB 2B39A 4HJGB 1HQRB 4HWBL 3LKNA 3VXRD 4RFOH 3H3PL 4LCUA 2WK2A 4QOKB 2XTJB 4LGRB 2JELH 2VLKA 2VKWA 3KYNB 5GGTL 1V7ML 3CFCL 3MJ9H 5F7EH 3HZVA 1JGEB 1RZFL 3D2UA 4X5WB 3R8BB 5I16A 4XPTH 3TNNB 4JJ5B 3KLDA 3NAAL 3OKOA 3RVWC 2AXFA 1F3RB 3FOMA 3U2SA 5KSBF 1YC7A 1F4AA 4UNTA 1WFTA 3RHWF 3TNMB 4PJ8D 4ZFFB 2N7AA 4WFGD 1G7PB 5T1DL 3D0LB 3AREA 4ZAKD 2GUOA 4LCCC 2R39A 5KSBB 4UT6H 5AYQA 2PCPA 1YJDC 4YHZH 1B90A 2ZOLB 5KOVC 3TCLB 2XWBA 3D48R 4GW4B 3RZCB 3WFBH 2VLJD 4KKBC 2DLTA 3ZYJA 1JYXA 4YXLL 3DO3A 1XH3A 4NN7B 3SO3C 3NTCL 5ACMA 3JWOH 5T1MA 4Z95L 3KDMB 3KLHC 5C9JA 4FMFA 5HYSG 4JAMA 4Y5YC 5IQ7H 3RVVD 2EC9U 1HHGB 1LO4L 3MZTA 4L8SC 3BQUD 5T3ZH 1AXSB 1GSMA 2AEWA 5JA8B 3N1PC 3GGWA 5EU4A 2PR4L 3ALXA 3EYOB 3QXUA 4ALAH 1KN2L 5DEGA 1MLBB 3VGHA 1C08B 4NQSA 5EU6B 5J6HB 4Y4KD 3DV6A 4Y5VA 4BJLA 5I30L 1Q9KA 1ZANL 2H2PD 4ZO6A 1VFOA 3VG0L 1HDMA 1FPTH 3EYSH 4KQ3L 5E2VL 1YN7A 3GSUB 4BSWA 4PGZA 4JPWL 5I8OH 1DVFB 5IEKB 2XKNA 2WBJA 1R6VA 2E7HA 4OBSA 1EIBA 4MNQB 1KTKE 2D4DA 1LWRA 2NY6C 1I1AC 2P5WD 1QVOB 1T1YA 2IALA 4GG8B 5HDBF 2MCPH 5C9KA 4P4RB 2NR6D 3S3PA 3DRQB 1HYSC 3KPRB 3BRFA 1WBXB 1ZLWH 4G5ZH 2BMKA 1QBLL 3MRGA 2VISB 4FQ1H 4XBEH 3FT4B 2P4AB 3I3DA 3G5ZA 1NGPH 4PJHA 1PQZA 2NY4B 1ZGLA 3TA3C 1IM3A 5L2JA 3FQTB 5IFJB 1UKQA 4GBXC 5JW3H 2RAMA 1PZUB 1T04A 3MRLA 1J18A 5ESVB 3D3VD 2BVOB 1J1OH 4JREC 2R23B 3CMOH 4TQEH 5FB8A 3HI1B 4PGDB 2ID5A 1IZKA 1YEJH 2FZ3B 1J8HA 3WIFA 3PNWA 4D94A 4NZUH 3KPSB 4JR9L 5C07A 2IAMD 1J7VR 1PAMA 2E5EA 4P5TC 2IGFL 4MXVE 4I13B 1NMBH 2ATKB 5EORL 3FFDA 3GI8L 3CGTA 2GAZA 1JPGA 4MQ7A 5IB4B 1JV5A 2H1PL 4CVZA 2A74B 4TTDD 4OQ1A 4BQ9A 3HC4L 5SWQA 2IC2A 4LNRB 4NDMA 3HPJA 1FFPA 4M5YH 4IJ3B 4KUZL 5IVOA 1U95A 3S96A 5TF1H 4L4VD 4IMLB 4XPHL 1BQSA 1U8PB 3L3DB 3SDAD 2YSSA 2NXZC 3ZE1E 4OTXH 4IRJA 5CEZH 4KV5E 3UTSD 1A1NB 4NRZA 3P4MA 4PYGA 1A6UL 3QEUA 2BCKB 1T1ZA 4HXBL 4LPXA 4JO1L 2A0LD 4WRLA 3LN9A 1MHHB 4EUPA 4WFEE 2G5BB 1Z9OA 4DN4L 5LBSH 5DJCA 2YXFA 3QJHA 4LRNH 5HHXH 1AC0A 3SGKA 1S8DA 1MELA 2PYEB 1EA9C 4PJ7F 4EZMA 1KNOB 1K4CA 4H88H 4JFFE 3O11A 4DQOH 4XXDB 1RV6X 4MD5B 4OZGE 5LGJA 1MCIA 1NL0L 4PJ7B 1WBYA 2Z8RA 4LPTA 3MUY1 2J6EA 4GRLB 2LVCA 1AXTH 4FG6C 5DJDB 1QG3A 3PV6B 3CDCA 3OXSA 3IFOA 4MJ5B 1AR1D 4FABH 3DUSB 1CFSB 4AEHH 3HE6C 1QQDA 1P7QA 2X70A 5SV3A 3AU1A 1HI6B 3N85H 3NCFB 3V5HA 3C9NB 2VN4A 4LSPL 1GOFA 5DMKB 1BOGB 4TUOB 4YDLB 4U6XA 5GGUA 1CDUA 1V3KA 1ZT1A 1T03L 1NMAL 1QRNE 1P1ZB 2PNDA 2A6DB 2ADGA 3DXAD 3MLTB 4NKDA 3IFPA 4OLYL 1UZ6E 4YZFE 4C55A 4FQXC 4N0FB 3ARFD 1YMHA 1FIEA 4PJXF 4KI5E 4OKVB 4JPIB 1MPAH 5D8JH 4PRBB 1TZHA 3QA3B 1JN6A 4C83A 3FB8A 4R96A 5IWLC 3GSOB 2ERJC 3I3BA 1NLDL 4GO6B 4PJXB 4S2SA 2XPGB 1RUQL 4MQTB 5C0ND 3MNWB 3QUXB 2BJML 4LDOB 2E27L 3NGBB 1E4JA 5D1XA 5E70A 4H1LG 3TZVB 4RAUA 3PJSB 3PWPA 1OT1A 1QSED 1ITCA 4Y4FA 3NFNB 4LAQH 1A3LL 3PXHA 2BY0A 5CINH 2R0LH 1SY6H 4PLJC 1KEGH 1D5XA 2F58L 1QEWA 3O9WB 2D31B 4UOW0 1X5IA 3DVNB 4XNUL 3IFLH 3BT2H 1JP5A 4MHHI 3QIWC 1Q1JL 3UX9B 1RZKC 3SKUD 3ARGD 1U3ZA 4MD4B 1G0XA 4IOIB 1S9KC 2HLFC 4JRXB 2BHYA 1G9NC 4ODWB 4F3FA 1UCBL 3GMLA 5T5FH 4Z0BH 1A2YB 4NQVB 2WQRA 2Y5TB 3ILQD 4X6EB 1FDLL 3MR9B 1N5YL 1A7NL 1S7QA 3MUHL 4UV4L 3T3PE 1OD7A 3RTQA 1FFOB 1FZMB 5IMMA 2FJFA 3ZDZE 1B4RA 3ARPA 4WW2F 4MA8L 3U46A 3ZDYF 1ZEAL 3WO4C 1YJDH 2YRZA 4I3RH 1F3JB 3WNMA 3C8KB 3QXTA 3ARDC 4MYWB 2C4FT 3GJFK 3PGCA 1IC1A 2FH6A 4WDIA 2GSIB 1CDYA 1C16A 2A1WH 4WW2B 4BZ1H 1VADB 1CF8H 2C3VA 4PP2A 4HJ0D 4Q74A 4NKMA 3BDYH 1IC4L 2A6IB 2UY6A 1B3JA 4P23C 5BVPH 4FFWC 2AK4B 5HHPB 1BP3B 1S3KL 2UVEA 1FZOA 3ZTJH 1YQVH 5B8CC 4PREA 2J1KA 3BYTA 2GJJA 1J1XL 1BAFL 3KXFE 2E7MA 2H2SC 2HFFA 3HI6L 2XRAL 4KROD 3O4OC 3G6DL 4RGOH 4JRYB 4YUEH 5BOPA 3SY0A 4AT6A 1S5HA 2Q20A 3CUPA 1CXIA 3BH9B 1K4DB 4OZ4B 1GAFH 2FWOA 4OGAD 1TNNA 5GZOD 2OX5A 5FGCB 1I3UA 1DFBL 5B38A 2APFA 4NCDA 5FYLH 2DLFH 3ALPA 3RWHA 4KK5C 1TPXC 35C8H 4OQTH 4XMKH 5IFAL 2UUDH 4I0KA 5TGBA 4DCQA 3HS0A 3F6LA 2XZAH 5F7FA 1B2WL 2NXYD 4HF5L 1DDHB 1BQHG 2YUWA 5C0EA 4JKMA 3MBXL 2VDKH 4PGCA 1MFNA 1U8LB 2BDNL 2DTML 5F1NA 4LCWE 5IEHB 4JFFA 3B2VL 1JF5A 3BQUC 2O26U 4XPGL 3QIBD 2MFNA 3O6FD 4OZGA 3H0TA 4FQXB 3P9WB 5KG9A 3WIIL 4NN5B 2CJUL 3RY6C 2XXMB 1G7LA 5DGRA 2XYCA 1MJ7H 4GUPA 4BQ6A 3ARRA 4MXWH 4KZDL 5KSAB 4NM4H 5I0ZA 3RGVC 3LZFL 2I07A 4EDWH 1NUDA 4HLZH 4RWYH 3LQAC 4HBQA 4LLVB 4ONHB 4U1IA 4BK5A 2X05A 4OZHE 1OTUD 2EE9A 1OSZA 2VC2L 3FTGB 4PLOB 1H8SA 1UYWH 1MCDA 3KPLA 5HHNB 5EOTA 1RK0A 4JM4H 4P46C 3WS3A 4OFYA 3WN5B 1N59A 4LASL 1N6QL 1CXLA 1QRNA 5E9DE 3EW3B 4APQA 3I9GH 4ETQA 3RWGA 2J5LB 4JFZH 3S5LB 2UVFA 4DKFH 5BJTA 1QLFA 3A67L 2AS5M 2A6KA 2KPNA 1KPVA 4KXZH 5DJYB 1A4JB 4HUXB 4YBQC 3C5JB 2Z91B 3NZ8B 2CDEB 2CLZA 3SKNB 1ZHLA 4D0CB 2QV2A 3DLQR 3MV8D 4N5ED 1JRHL 1PBYA 2VXUL 1ITBB 4XVSH 4F2MB 4PLNC 1N2RB 1NBZA 4KWUA 1I7TB 2Y5EA 1XGUA 2BSED 5JO5A 2BP3A 1UQSA 4FFZL 4RA0C 1D6EA 1E28A 3ARBB 4G7VH 1XF4B 4QHUA 4G9FE 4UT9H 3WKMH 2EC8A 4L3CA 3ZTNL 4YGVA 3AC0A 4BUHA 4NFDA 5F1SA 4OJFL 4XNMB 3FB7B 4KJQD 3V4UL 1FV1B 1RMFH 4S1RH 2ZUVA 1B4JL 4ELKB 2C3XA 1RHFA 2G9HA 1T20A 5IT2H 2ICCA 1T5WB 1VGEH 5DC4B 3SE3A 3VXRB 3R4DA 1HOCA 2B1HH 4PJAE 3VW3H 1ZWIB 4OLXL 1TVHA 3WHXB 4K3GA 1KCKA 1NC2D 3JUZA 1ZXQA 4L9LB 2YC1A 3O2DL 3OAZH 5EN2A 4F80A 1J1PL 3NOIA 3AS1A 4WU7A 1VHPA 1QZ1A 4JZJC 3HUJA 1OTTD 5ID0A 1ZS8B 1HZHH 2A0LC 3V6ZA 2VITA 1SBSL 1RURL 4PY8I 3F7VA 2I25N 3GI9L 4Q2ZA 4P3CL 3MLSL 4N9GB 4PJ8B 1N4XH 3TYGH 5TE6H 1MUJA 5F8QC 5CGYD 5HYFA 2YOCA 1B9ZA 3CVHB 4ZAKB 2BSTB 4CKVX 4DW2L 5JIKA 4NZDA 1IM9D 3DGGB 2VZ1A 4QTHA 4AENB 3BXNB 4NQXB 1NEZG 2AJ3A 1WAAA 5L7XH 5FCUL 3UCRA 2ZUUA 1WWWX 4Q6YA 4HS6B 1F6AA 4GXUN 3OHXB 2VLJB 2EKSA 1GGIL 4NNPL 3TN0A 3UJIL 5CAYB 4PUBH 5IB2A 2YN3A 1MFDL 1UM5H 2AK1H 1NLBH 3OG4B 4RFOL 4QRRE 2DKUA 4GAFB 1GVIA 1QFUL 2ORBH 5C0DB 1S7TB 2EXWD 3SJVE 5DJZA 4YBHA 3BQUB 4JCLA 4QHLB 4JDTH 3KXFA 4EDXA 1T0PB 3KJ6L 3RKDD 4QYOA 5D1QA 2X4TA 3QUKA 4A6YB 4KHTH 2ADFH 3NPZB 3O45A 4M1CD 4XPTL 2R4RH 4Y4KB 3PWLB 1I4FA 3OJ2C 4CMMA 4F7MA 2FEEI 3CSYB 1BD2D 3VWJC 2DQUH 4M6NL 4XC1H 5EOQH 1FNEB 4JN2B 1FNFA 3MGAA 1VFAA 1WEJL 3K1KC 1CR9H 2Z92A 3CFKA 5DQ9B 2BNUA 1RZKH 1J0YA 1A7QH 3KWWB 3WXWH 5FK9A 2MOVA 1G9NH 1FVDA 1UADC 4LCWA 2P5WB 4KK6C 5F3BA 1F8TL 1NCDL 4JE4B 4I5BB 5JPNA 2OTUB 4LQ1A 1FNAA 4KTEH 2XN9D 3K81A 5CJQL 4OAWA 4WUUD 1F11B 3WJJC 3JWOL 5CJ5A 2AJXL 4X5XA 3ZO0A 3VG9B 1YY8A 1S7XB 1QPPA 3G04B 1ZSDB 4UBDC 2HP4A 4TN9A 4WI9A 5DTFA 1I3RB 1KJ3L 5T3ZL 2OTWA 3D3VB 3FB6A 5DJ8A 3HZKB 1L7IL 4OZHA 4ALAL 3PG2A 4YHYC 1BJ1J 3UYPA 4RIRB 3VXSD 5LKNA 1QFWH 3HZYA 1WLHA 1E6OH 4G8GD 1A4KB 2Y36H 5FYJD 4I9WD 5CSGA 4LLQB 4HGMA 3NH7H 1CG9B 2IAMB 2YA0A 4Z7UF 4HKJB 3ULVL 5E9DA 4AYFA 1LNUA 4U6VL 3MJ6A 1KEMH 5DVMA 3QEGH 4XCCH 1IGFL 3BOVA 3AMLA 4Z7UB 3W5NA 1QACA 3MRKB 3LB6C 5FIEA 3S97C 4EVNB 2EE2A 3ZL4L 2EYSA 3V8OA 4L4VB 2IPTH 4O5LH 1IGJA 4LVHC 4OUOA 2X4OB 5F6IC 3SDAB 1MAKA 3RWCB 2DMBA 3B9KD 1ZLUH 2QQNL 3NZHH 1S9XA 5EDXA 3VU2A 4FFVC 3ARYA 4F7CB 2E9IA 3UTSB 4M48L 1N0LA 4G9FA 1OPGH 3BUYA 4X99B 1UM6H 4N8CL 1ERNA 5IVXF 5HBBA 5L0QB 1AHWA 4I0PA 2EDQA 3EDDA 3T0EE 4TSBL 43C9B 4NNYB 1GZPB 1UA6L 5C09E 5JW3L 1ONQA 4GRWE 2EZ0D 3L6FA 3BSZL 4NM8L 1J1OL 3U9PH 4FZEL 1FSKB 2E3VA 3VGGA 4B41A 3CMOL 3NVQA 1GOHA 2DBLH 2CPCA 4N0UB 4Z5RA 5AD0B 1YEJL 2N4IA 1BVLA 2YWZA 4IRSA 5DD5H 1E4XI 5CEZE 2AQ1A 2O5ZL 3W11D 1AFVH 3MNZB 3BZFA 1IEBB 4YHKH 4HBCL 5IHUH 1R0AH 5I1DA 3TT3H 3GMQA 5GZOC 4PRIE 5AUMB 1CFNB 5I17A 4F37K 4X6FA 1EBPA 2YBRB 1DL7L 3LQAH 1CFQB 5E8DH 1ZTXL 4CL7A 3VI4F 5GRVL 4M5YL 4JY5L 2ITDB 5DUBB 5TF1L 3VFOA 1JWMA 1YPZF 3OKDA 3PWJB 2FBOJ 2PYFB 3JV4B 1JPST 5TDOA 4PP1C 3QFJD 5LQBH 1I3GH 3JTSB 4MA1C 3C5ZC 4Y19E 1YPZB 5ANMB 2MQ0A 3BKJH 1G6RH 1C12B 3QUML 4ZD3H 3ARFB 5T1LD 3ZKMC 2ICWJ 1CDHA 2ZCHH 4DKEL 3NIGF 5LBSL 2I9LA 5I1EL 1WQVT 5HHXL 2P8PA 2QKIB 3IYLW 4WEBL 1MH5B 3UZQA 1Y0LB 4NC0B 2AGJL 5J7CC 1BBDH 4DZ8A 5KTEL 3RQ3A 5IG7B 1NFDE 4JB9H 3ZZ1A 3UPRA 3EIFA 2VN7A 3MV9B 5FA3B 1XZ0A 2DF3A 1KACB 1HHHA 2C1OB 1Z0NA 3ARQA 2CKBA 2A73B 3SJVA 2A6JB 4R4NC 1CU4H 3R8QA 4GXVH 1HN1A 4JFDD 1QSEB 4HD9A 4FABL 4OM1H 4NQCD 5IR1A 1JUFA 3BDXA 3D0VA 1YMME 1A6TB 1ETZA 4L29A 3N85L 4YXKL 3T08A 3UTTB 3G08B 3S34H 2AJYH 2UWEF 4OB5H 3RIAK 4K94C 2W92A 1TETH 3QUYA 4OF6A 3HPLA 1M4KA 3LKOB 3DRTA 4HDIB 1K2DB 4GJTB 3ARGB 4HFWB 1CE1H 1P7HL 1K85A 1MCPH 2UWEB 1IAKB 3QNXA 2I5YH 4JZNA 1UH2A 4C56E 1Q0YL 3IDXH 5JIPA 4F57L 2GQHA 4MHHG 4NRXB 5I1HH 2COQA 1AH1A 4ZOEA 1YEIL 4K55A 5IK3A 4PG9A 2FX7H 2IWGA 4OLWH 4TULL 3VE0A 3FFCD 3P30H 2J8UF 1DTUA 4YPGB 4NJ9H 5E03A 2ADJB 4GQPH 4JFOA 5I1GL 3SHSA 4HC1H 1HXYB 1U8NA 4BUGA 4S1SL 3L7FB 3WHE0 1DQML 1NGYB 5IM7A 2W0FA 4ENEC 2J8UB 2HKFL 1LP9F 4ODHL 4WY7H 3K74B 4RAVB 3UTQA 1QA9A 4YR6A 5J89A 1Q72H 1OGAD 4GW1A 4LAQL 4XVUC 1I1YA 2D7MA 5CINL 2VQ1B 4XWOC 2HRPL 4X9FA 4Z78A 5SX5H 1KXTB 3PWVB 3EYQD 1LP9B 2FATH 3NABL 3W82A 4JGUA 4Y16D 3HNTH 3MROA 3IFLL 1XGQB 5DJ2B 4IEFB 3U83A 3LEVH 1DQTA 3UDWA 4POZC 5DUMH 5C0AD 4K2UL 1H5BA 3BRGC 4NZTH 1YEFH 1VCAA 1DBKL 3IT8D 3GBNH 3D18A 2F5AL 5FKAB 4KROB 3VMPA 2IG2H 3WV0A 4Z0BL 1J88A 2E7LC 1MHEA 2KDGA 1D5ZA 3RAJH 1ZOXA 3CJJA 1U92A 1KIPA 3DVGA 5DD6B 3DECA 4UNUA 4IS6A 4LIQH 3F7PC 3T0EA 4TPRH 4XBPA 5C09A 2JJSA 1HSBA 3LDBB 3SCMC 1Q9OB 2NXYB 3DYOA 5EZOL 2GK0B 2BHZA 5GRUH 2WINB 4I3RL 1O0VA 1U91A 3V0AC 3PP4L 4ISVB 1J12A 1H3PL 3LMJL 1AGFB 3WFHB 2VIRB 3BGMB 3SO5A 5DS8B 3CFBB 5DK2B 5FYLE 2A1WL 3QIBB 2OP4H 2X1PA 3O6FB 3TJHD 4PBXA 1SM3H 3VXME 5FYKH 4J3TA 4RBPK 1QSFE 3SE4C 1TJHL 3VWKC 5BVPL 4PRIA 5MEPA 1YEEH 1JK8A 4Z76B 5FECA 3RUGB 4JG1H 3MC0A 5DYOB 3AROA 2VZOA 5E4IA 3HG1A 1C7SA 1FG2A 3CC5A 3L3OB 1I1FB 3O6ML 3RWFB 2OL3A 1E4WL 4RGOL 3ILPA 5A2KH 4FQHB 3MV7D 1FVEB 4U6TA 3GUTA 3H7LA 1KB9J 3PV7A 2Q8BL 4OD1H 1BJ8A 2Q7YA 1AY1H 4Z77A 2DLFL 1XGYH 3IDGA 2JK5B 1KN4H 4Y19A 3FOLA 4L3EE 4OQTL 2BNRE 4AQOA 3V9FA 4YHLH 1H8NA 1OP3H 3F7YA 2QR0A 4ZYKB 3F5WB 4OIIL 2GTZA 1Z2KA 1FCGA 3QT2A 4MVBD 4J3UA 5L8KB 4Y4HC 4YAQB 1NAMH 2VYRE 2GSGA 3GSQA 4RGMC 4Y8DC 3PXJA 2NY2C 3OKMB 2X4RB 3MV8B 1YQ2A 4EXPX 4OCYL 2XV6B 4YHIA 1I9EA 1KSRA 5HHOD 1V7NH 4OSUH 3MBEC 4YBLB 4RMTA 3FQNA 1QR1A 2NYYC 1QR4A 2VDOH 1V3LA 2YPKB 2VQUA 5JOFB 1JJUA 1U9KA 4X7FC 5E8OA 4HX1A 5JPMA 3O3AA 4OD3L 5BW7A 4TUJB 3SGJA 3MJ7B 3RVUC 1OCWL 4NM4L 1S9WB 1M1SA 2ZUYA 4TVPE 4YIQB 4RWYL 1OP5K 1YMMA 3LOWA 4W6XB 5AZEL 4YDVA 2BVPA 1CGVA 2BC4A 3L5XH 1PKQE 3QQ9D 4XNYH 5E6ZA 3X14A 1RJLA 1A6WL 4X83A 2APVA 4U1MB 4F9PC 2JB5L 5ADOH 3VFMB 2PO6A 2JCCE 2GJ6D 4NN6B 3I6LE 3E1F1 1NDMB 4PJEE 1FN4A 5B3NA 5I1CH 4NQDE 5E2WH 3MCLH 1I7ZB 4YHML 3BZEB 4MD0B 2ZP0T 4C56A 4DKFL 2W65A 4UQ3B 1SJHA 5F9DC 3FB5B 2XZQH 1Z9LA 4GKZA 5DHVH 3L5IA 1X5LA 3BJLA 2VAAB 4JFQA 3LVEA 3WJLA 4YH6A 3K7UA 3FT2A 1D3CA 4M5ZH 3V4PH 4HPOH 2EH7L 3ULUD 3O3DB 1T7WA 4OZIF 3QCVL 5CIPH 4CN4A 1MJJA 3H9HB 1C5DA 2CRMA 1RZIB 3EZJB 1E27B 3T04D 1IM9B 5I6XB 1UXSB 3FO1B 3WXVL 3W11C 1EK3A 4OZIB 3T3MF 5E5RB 5AYUL 2L0DA 3JWDC 4S1RL 3HE7D 5GGSA 4NKOA 5D2NB 5IGXL 5IT2L 4R97B 4TNWK 2PW2B 5BZDA 3TCXA 3ARWA 4EKXA 1V3JA 1B0RA 4WJ5A 4NQUA 1G7IA 1I8LA 3T2PA 1G7QB 3OB0K 5IKCA 4PRNB 3CU1A 4P2RD 4ELME 4I3SH 5INCB 1EV2E 3VRLE 1L0QA 4OKDA 1GC1L 2BSSA 2IADB 2JLLA 1T4KA 2ZUQB 3LRSB 3FQWA 3BE1H 4CRPA 5GQBA 1NGWB 5DHXB 4YO0A 4P3DB 1BD2B 4PJCF 5FM8A 4K94H 3R1GH 4BZYA 2BOBB 4E0RA 4GAYB 4JKPL 4LVNC 4JFED 3ZKND 1N4XL 2XA8H 3S5LG 1KB5A 3CSPA 2Q87A 3TBVB 1CL7I 1DQQB 1WFNA 4FXKB 1CL7H 4PJCB 5F3HA 4KUCD 5HHME 3G5XA 4WWKD 4CVUA 5C0RH 3NA9H 4PJIF 2LABA 4C54A 4FZ8H 2H26A 1BVKB 5GXBB 3GMNB 1TVBB 3LKSA 2CGRL 4J4PD 3WUZA 2XNAB 2XN9B 1WTGT 3P73A 4JM2D 2MHAA 4NSKA 4F15B 4HXAH 4MX7B 4PJIB 4WUUB 1QSFA 3BKML 2F9BT 1UM5L 2AK1L 2BFVH 4HH8A 1RUKL 3QO1A 3MRCB 1MQ8A 2VDLH 1IQWL 3WMSA 1V5JA 4U1JA 4LHUD 4L3AA 1U6AH 4JDTL 1C5CH 1WZLA 2X40A 1IAII 4AEIH 3EOBA 4C4KT 1EFXA 1ZHBB 3VXSB 5I75C 4KHTL 2ADFL 3KYMB 1C1EL 4G8GB 3K2UL 4PRHE 5JDSB 2FEEL 2DQUL 3HA0A 4XC1L 2R1YB 5EOQL 3SBWA 4MDJA 4HS3B 1RZKL 5MHSE 4NC1C 1T7YA 1N0XL 5E1AB 4YC2C 2F53E 3UMTA 1CICA 1YEGH 3DBXA 1NBQA 4HKBB 3ROOB 4M3JA 1FO0A 2FEDC 1SEQH 2ZWLT 4U1HB 3L95A 4FOMA 3QHZH 4LBEB 2BVQA 2AP2A 1EAJA 2P5EE 2VOTA 2YKLH 3P4NA 2DJSA 1OQXA 3NCEB 3QWOB 4HK0A 1I1CA 1U8OA 4QRTA 3OX8A 1UKTA 1MJUL 3B9KB 3DIFA 2HT2D 4RQQB 3D85D 2K1MA 4Z8FL 4BQ8A 3L9RB 2A9NH 4XNQA 1U3HB 1WWBX 3H2WA 4DVBA 1R5WB 4W4OA 2OBGA 5I1LA 2VLLA 1NH6A 5EC1B 5D7LE 4CU8A 1EZVY 1X5HA 1SQ2N 3UZEA 4ZS6D 4XCNB 1BVZA 2FYYB 1QFWL 1U8IB 2JIXA 1J0KA 3WLWC 1E6OL 2Y36L 5FA4B 3GJEB 4MGXA 4XRCB 4H26B 4HIXH 4WW1A 4NRYB 2YR3A 1W2KT 3DX9B 3MLUH 5GGTA 3FQXA 3GO1L 1X9QA 1OL0A 2WSKA 5MI0C 1BIIB 4OUUA 1EEYB 2EDTA 2MPAL 5J3HC 2ITCB 4XP6H 1BBJA 3QDMD 3WDHA 5DJAA 5D7IE 4YJZL 4OGZA 4MCZB 3QQ3B 3V0WH 1EZVX 3IS0X 3T8XA 3CVHL 1S7WA 4UDUB 2QSCH 4GOSA 1ORSB 3U4AA 1I9RH 1VDGA 3NZHL 3QFJB 5E8PA 3HMXL 5T3XD 1XF3B 1MREH 1MFBH 4M7LH 3BO8B 2E8YA 3BPCA 3UTPE 5T1LB 3TT1H 4NZRH 5FUZL 2XQYG 4OM0L 3PP3H 5I73C 1Z0MA 4NO2A 4FQQA 4NYLB 4POUB 3UAJC 1F3DJ 3FO0L 4AH2A 3LN4A 1OM3L 5DD5L 3MCKA 4MMZC 3MMEA 1E4XL 4KQ4H 1H3WM 3I6GA 5CUSH 3LIZH 3GJFB 3V95A 4YHKL 2F54D 3KPMB 1R0AL 4I2XE 1OT2A 4ELMA 3E2HB 1RUML 4QHNA 4YHNA 1OY3B 3O2WL 4JFDB 1CT8A 1YNLL 4I77H 2KQMA 1OAZL 4NQCB 2VTFA 2I9TB 1CXKA 4IDLA 1IMHC 1PG7H 4OZFH 2HT4C 1TXKA 4QF1B 1FAIH 4G6KL 3HR5B 5D93C 2VJXA 4M1GH 1QLRA 5LQBL 3INUL 1N5AB 1A8JH 5C71A 1XGPB 7CGTA 5FOBA 5CP7B 4KJYB 5F70A 4QRQB 4M6OH 4PJFE 4P9ML 4K3DL 2AQ3A 4X7TA 3V5KB 4U1SB 4RMSA 2Q3AA 5HYSA 5GGRB 1BBDL 1NGZB 3LHPL 1D9KD 4JB9L 1NFIA 3EO0A 2H6PB 1LDPH 2C9AA 3FFCB 4HK3J 2IF7A 1I8MB 2AXJA 5BQ7B 2CDGB 1GOGA 5J8OA 5C3TA 5KVFL 4OF0A 2HAZA 4EBQL 3L1OH 2R2HB 2O5XL 1AO7D 2OLDA 2FECI 1BQUA 1DQDL 5EH1A 2Q8AL 2NY1C 3QPQD 2P7TA 2X9YA 5CEYA 1QP1A 4PRDA 4OM1L 1FFNA 1P4LB 1OGAB 3JWDH 5DJXA 4WFFD 5BV7C 3QFDA 2OJZH 4PRHA 4ZOCA 2AABH 3ZDXE 3F7QA 1RIUL 2W9LA 3S34L 1D6VL 4OB5L 1UB5B 4Y16B 2GJZB 3Q5TA 4M8QB 1TETL 2NMSA 2DYPD 3MV11 3MRMB 3QDJE 2GITA 2Q76B 3K8LA 1J5OH 4OLUH 1X3DA 2VR4A 2Z4QA 3FT3B 5C0AB 3AY4C 3IJSB 4XPBH 1MCPL 5GJTH 4AG4H 5HVHB 1F6FB 2UZYB 1Q8MA 3L3IB 5D71H 4TUKL 5DRNB 2MCG1 4CVXA 2D9QB 5CBEB 4X7SL 3IDXL 2WAHA 2P5EA 4CU7A 4LOUD 3UBXB 5LGKA 1EMTH 5CBAA 2CLRA 1R3IH 3G9VA 1MI5E 1YECH 3CMGA 4ORGA 2V5TA 5CMAA 2EH8L 4XPFH 4OLWL 1W0YT 1W8NA 3RX7A 3MLWL 1KG0B 8FABB 4PTUB 4YXHH 4LF3B 5D7LA 5IB1B 5ENWA 4MZ3A 3EJJX 3OBAA 3OJDB 5BRZD 2AKRB 4PJ9C 3SE9H 2C1PB 1PYWB 2DQFB 1U42A 3T65A 3SGEH 4YE4L 4M7ZC 1ZHKB 2RCSL 4HJJH 3STLA 1W8OA 1DN0B 3QDGD 2FATL 3OGOE 4BELD 3V6FB 4X98A 1OVZA 4LLDA 3RI5K 4NWUL 3IDUA 4BH8A 4YHPA 4YLQT 5MEOB 4V1DE 1KELL 1N3NA 2CK2A 5D7IA 2P43B 1PSKL 2VE6A 1HH6A 3JV0A 1CFTB 4XPAH 3T0XA 3L3GB 4YEFA 4IRZH 3STBA 3LQZA 2Y7QA 5FDYA 5I0DA 1DUYB 2JJWA 4XCEB 2Y4SA 4QRPE 4NT6B 1J0HA 4PJDE 5FYKE 3MV7B 1VPOL 5J9PB 5JZ7C 4OI8A 4KMQA 5D7JA 3UO1L 4S1DC 3ZKXB 5J13C 1YY9D 4QCIA 4N0CD 1FRGL 3GZKA 3OKEB 4LIQL 1HEZB 3OZ9H 4TPRL 1HHIA 3LN5B 4NGHL 4JY6A 1I9IH 3QI9A 1JGUH 4M93C 5CGTA 5DVOA 3JVGC 4KKAD 1O7SA 5IMOB 1DQLL 1T0MB 2O5YL 1KT2A 1BWMA 3FN9A 1NJ9B 3VXUA 3GIZL 4B5EA 4Y2DA 4PD4J 5HHOB 3B2UC 3G6JB 5TE4L 1A22B 1BZQK 3UTZB 4XCFH 2R56H 4HIJB 4NWTH 3VD3A 3UPCA 4ZXBA 2OQJB 4MSWA 3NIFF 1BQLL 3QHTC 2CUIA 1UACH 3SDDA 1CD8A 4I2XA 1XCTA 4JFYA 2PXYA 4ONGH 4X7DC 3KVQA 1L9NA 1GGYA 2DL9A 4D8PB 3CPLA 5EZJB 3REVA 1T83A 5I15L 2Y25A 3LKQB 3EYUH 5DEFA 4Z9KB 1RJZB 3LS5H 1JZ5A 3HB3C 5JDJA 4GG6A 1XIWD 1ES0A 1A9BA 4HKXB 4OD1L 1PVHA 2GJ6B 2R9HC 1AY1L 4F58H 1U58A 3L5WA 2CUHA 1D5MB 1Z3GL 3UBXI 4QT5B 1R3LA 3O3BA 5FM5O 2N56A 5BV7B 4G3YH 2QQLL 3RNKA 4U7MA 2FO4A 5CEXB 1TZIB 3MXWH 4N8PA 1OD9A 2E6PA 3ULUF 1G7JA 4P4KB 3QEHB 3H42L 4XC3H 3UJTL 4QGTA 1HWGB 3SDXE 3V6BR 4H1LA 3CCHB 4MS8D 5HD8C 1X5YA 2M1KA 3B6SB 4NIKB 4OSUL 4ZS6C 5C2UB 2VDOL 1LK2A 5E2UH 2ENYA 5KS9A 4O51A 3ZE2E 4AM0B 2XOTA 4JDZB 3P9LB 3FQUA 4X7EC 1S78C 3Q6FA 1BIHA 3CH8A 1P84K 4PR5B 1FZJB 3AXLA 1T21A 2VQTA 3HE7B 4J1UA 3FO2A 3JUYA 2J2ZA 4CVWA 4XNYL 3QEQD 1QYGH 4KK8C 2Z31A 3V52H 3QDJA 4HQQH 2YD7A 1INDL 3S6CA 1WCBB 2O61B 5D7SH 3LKRB 3QQNA 4WWID 3WUWA 1M7XA 4P2RB 4DGYH 3N1GC 2LU4A 1UJTA 1NCAL 2J4WL 3TBTB 4FQCH 3LV3B 3P4OB 3SDCA 1MRFH 1KXVC 1F4YH 1KJ2B 1BWWA 3ZSTA 1R5VA 2GYSA 3BPLC 3RY4A 4ERSH 1MI5A 1YNKH 4YNYB 1CLYL 4M4RA 5E8EA 5GGVL 1RJYB 4M5ZL 4RISL 4HWZB 4KY1H 1Z5LB 2P44B 4NO3A 4Q58C 4JFEB 4DZBB 2HJLB 2HH0L 3OR6A 4JQXA 4KTDH 3IAPA 2OR8A 5J11B 1NANI 4I1NB 4N1CA 5J1AB 4JM2F 4R7NB 3M8OH 5KVDH 4G9DA 4HG4K 3O6KH 1F58L 4WWKB 5CP3H 4JDVA 4N9OB 1ZHNB 2D4FA 5HYQB 4X4XB 3KS0J 4P2QD 4P2OD 4R9HA 1YNTA 2PETA 4JM2B 3OAYH 2XY1A 4D9QE 5I76A 5LVEA 3DMMA 3BEWB 4XBGB 2EEDA 5AAWA 1D5BB 4JO4H 4ZFOB 3P3YA 5FGRA 1BJ1H 3FAXA 4KZEL 25C8H 5D2LE 5ALBL 3C08H 4MAYA 4LHUB 1JPFB 3L7EB 1AP2A 2VAJA 3H7BA 4X8JB 4F37F 2VDRH 3H8NA 1IKNA 3E8UH 4QRPA 2G75B 4PJDA 3AREC 5F7WC 5D1ZA 4ODTH 1BQHA 3R1GL 1CZ8L 2K7PA 2YUXA 4AL8L 4FQ2H 2V7NA 4R8WH 4IOFC 5I1AA 3GMOA 5JMRA 2IH3B 4WGVB 5TE7H 4KJPD 4KKLD 4P49A 5LG1A 2EDBA 1CL7L 2GY7B 3NN8A 4X6CF 5F1KC 3WFEL 1YDPA 2ZOKB 4EI5A 2FSEA 5EO1A 4DVRH 2YD3A 5L9DH 1GHFH 2IFGA 5EO0B 4FMKA 2LTQC 4RZCB 4FZ8L 1X6NA 3RKPA 1EUUA 4X6CB 3JTTA 3D85B 5J6GA 1R3KA 5C8JA 1ZLWK 3KJ4C 2FL5A 1KTRL 2AV1A 1SYVA 4GLRI 3QG6A 2VDLL 4Y5VC 4MNGA 1NAMA 1HHJB 5K93A 3U0WH 3C6SB 2YS4A 5C0FB 2BY3A 4XGZA 1J0IA 2CIKA 3GSRA 5F21B 3IJYB 3CFIC 2Z93B 4TRPH 4K23L 1XF5A 1IAIL 2WBJC 1FL5B 3D87B 2EXYD 4BFEA 4HMCA 2X4QA 3C60A 1BFSA 4MNHB 4WO4D 4HZLB 3RIAF 2HMIC 1RIVL 4RGNC 2DQDH 3VCLB 3IF1B 1EUTA 4JVUA 4IIQB 4WTWA 3E6FA 1J9CT 3OKNB 3QDMB 2ICEA 5A16A 1YEGL 2WQ8A 1A9EA 1LO2L 4KI5D 3QRGH 5GSVB 4YPJA 2NY5H 3DWTA 1YEDA 4XVTL 1BFVH 3SDXA 3CFEB 1KLGA 2APWA 4GAGH 5KSBE 1A6AB 5GRVK 2X9WA 4PPTA 3B8SA 2NTSP 1KPRB 5GGVY 4ZFGL 4HV8A 2HTKC 5A40E 3X11B 3PGFL 1QFWM 2GCYA 5HDQL 3E6HB 4XH2A 1HQ4A 4L8CA 3F6IA 4R3SA 3TBWA 4CADA 3IDNA 1WIOA 3MACH 3TBSA 2EDXA 1H15A 4LKCB 4Y0GA 3O8XD 1PG7W 4R4FL 3VFSB 3TO4D 1L0YA 5J4MA 3ULSA 4RX4D 1KV3A 5JW4N 1I3VA 4HIXL 1DCLA 3VXOA 2VL5B 5EU6E 5CKAA 1L0XA 2D2OA 2F54B 4LSTH 3BP7A 2CRZA 1X7QA 4R2GD 4MJ6A 4UU9A 5JR1H 3T1FA 1KGCE 1IGTB 4IRJC 1JHLL 5HPMB 2BRQA 1U2CA 5FUCE 4XAWL 4XP1H 4FP8H 2P24A 1LVEA 2AXFB 2QSCL 4MNQE 1ODAA 2H41A 2X4NA 5DJ0B 5L88H 1ZLVH 3IKCA 2VR9A 2WIIA 4YEEA 3TVMA 1I7UA 3FMGH 1NEZA 3N1MC 1P4IL 1AE6L 1WITA 1KCSH 3BP6B 2NY7L 3KPRE 1LDSA 1IGYA 1MREL 4EN3A 3LEXB 1CGTA 5DC0A 5B4MC 1FE8H 1MFCH 2DLGA 4LARL 4WGWB 2R2BB 1LK3H 1AJ7H 1XCQB 1D9KB 1T2QL 4RAHA 3F12A 2WNGA 2DAVA 3I6KB 4KQ4L 1Y18A 1S9YA 3LIZL 4NC2B 5D2LA 1AO7B 2HLAA 3PL6D 1F6LL 5E5MB 2IQ9H 4ZUTA 5FYJL 5TH2A 2NW3B 1X5FA 4H5SA 2A77H 2EYRA 2GEEA 4I77L 3FQRA 4Z18A 5D1QD 4OCNC 5D96B 1W0WB 5AZ2H 2G2RA 4LK4A 3FRUA 5F9JB 1PG7L 4LCIL 2KZWA 1PY9A 5DHYA 1M05A 4HT1L 1IGCL 3GSNA 3FKUS 4JG0H 1GGTA 2V2TB 1EVUA 2DYPB 4M1GL 4U1NB 1A5FL 1E6JL 2XKNB 1T3FA 2AXHA 2OK0H 1OAYH 3X12A 2NZIA 3VRJB 3PDOA 5FKPB 3X3FL 1IAMA 5KN5A 5D1XC 3LD8C 3EHBD 1MWAB 3B3IB 1IGIH 4A2MA 3WIHH 4Y4FC 1LEKB 4FN0A 3DSNA 2PYEE 4N0YL 3RRQA 4LSSH 5IIEB 4ODXB 5I1KL 4HJGA 3BKCH 4QRSB 1HQRA 2XQBL 1YYLH 5DURD 4HIIB 4JHZA 3QG7H 2FECL 5BRZB 1J87A 3AGVA 5D9SB 1JGVH 1UEMA 4PJ7E 5D4QA 4QOKA 2EE3A 5HJ3B 3PQYE 3KYNA 4POYA 1CN4A 4I48B 4U2YA 2AABL 3ECBB 1Q9WB 3GBMH 1I9JH 3QDGB 1JGEA 4JO3H 4X5WA 3OAUH 3TNNA 1CGYA 4JJ5A 1HNGA 43CAB 4CDHA 4JLRB 1INQB 2NY3D 4FTVD 1RJCA 1UWGH 4OLUL 1TDQA 3DTXB 3TNMA 3FONB 3O3UN 3VGAC 5ESAB 5GJTL 2I60L 4AG4L 4ZFFA 1X5JA 1UFUA 1ZA6B 3BESR 4Q6IB 1G7PA 4K8RD 3D0LA 4LDLB 2XZCH 5KSBA 3PDGA 4R7DB 2WWMD 3JBG7 3RTQC 3JXAA 5EZLB 4HPYL 2ZOLA 3AM8A 3TCLA 4QTIH 5E6ID 4RFNC 5DO2D 4GW4A 3RZCA 4XPFL 2DIJA 1NDGB 5JORB 3CXDL 4ZUSB 1TCRB 4WCYL 4UAOB 4PJXE 3EDEA 3KDMA 4K71B 1IJ9A 5DJ6B 5CSBA 1VESA 1WF5A 4FFYL 4X5LA 3SE9L 5JXAL 5LWYH 2R2EB 1D5IH 1HHGA 2H32B 1AXSA 3MNVB 3CIQA 3I75B 4HLJA 3GSWB 4PRPD 3ZYZA 3EYOA 5F71A 1AI1H 3VXNB 5C2BH 1MLBA 4TNWF 3EJZC 3HRZB 1C08A 1XGRB 4HCRL 5EU6A 5J6HA 1T66C 4WIQA 5DR5H 4NC1E 1SHMA 3FZUD 4F9LA 3P0YH 3OPZH 3CZFB 3TP4A 9CGTA 4G8IB 3HC3L 5I8KH 3GSUA 1CD9B 2NLJB 1W72B 1DVFA 5IEKA 5K9KB 1NMCB 2MTPA 4NO0D 2WW8A 4IRZL 1HSAB 4MNQA 2CO6B 1XIWB 2NZ9D 4UTAH 3CLFH 4JRXE 1JYNA 1QVOA 4GG8A 4P4RA 5F7YC 2FR4B 2AVGA 3DRQA 3KPRA 5JNYB 1WBXA 4I4WB 5ITFB 2VISA 3FT4A 3IFNH 3NCJH 5EUOF 3BW9B 3QSKB 1VEOA 1VEPA 3TV3H 3U0PB 1IT9L 1IGMH 1ACYL 3FQTA 3UBXG 3MLYL 2BNQD 3P11H 5CZVL 5IFJA 4XB8A 1CIUA 2PN5A 3RL2B 5EUOB 5HI5D 3STZB 3U4EB 2ENSA 4Y1AE 5ESVA 1YUHB 5TQ0H 1LO5B 2BVOA 4PGBB 4D0BB 2R23A 4OF3A 2Y06L 5CFHA 1MSPA 1WJ3A 1WT5A 3HI1A 4PGDA 4XCFL 2JJUA 2R56L 4NWTL 4QRRD 4IM8A 3DURB 5IW6B 5DD0H 3DROB 3QDAA 1UACL 1PG7X 3KPSA 5IBUB 3SJVD 4OLEA 4TSAH 1IAOB 3OWEA 5AEAA 1YYML 2ATKA 2AK4E 3DI2B 3EYUL 4J7RA 3T2NH 1WK0A 2D7NA 1X5ZA 4JKKA 5IB4A 4KC3B 3RDTB 4APQC 4HUMB 2A74A 3QEQB 4LSRL 4KI5C 2D0HA 4LNRA 2J88L 1TQBB 2DQJH 1T2JA 4IMLA 4K7PL 1EFQA 1U8PA 3L3DA 5T3ZD 5IJVB 2BVEA 3H3KA 4QGYA 3V0VB 1Q94B 3U7YL 1SMAA 2RFXB 3GHEL 12E8H 1AIFB 3ESUF 1A1NA 5GPRA 4ACPA 1DE4B 3OAZK 2BCKA 1RUAL 3NPSB 1MHHA 1UEYA 3CDFA 3LPFA 4OGXH 2R8SL 4EUPH 2E7CA 1EO7A 2PYEA 3BP4B 3C6LD 4MQXC 1KNOA 4OI7A 5AG9A 2B0SH 4XHJC 4XXDA 3B5HA 4MD5A 1JNNL 3RWIB 3Q6GH 1WIUA 1MFEH 3SE3C 4PJ7A 5IJKA 1K5NB 3BN9D 2EE6A 5DRXB 4GRLA 4U6YB 5DJDA 3PV6A 2J6EH 4P2QB 4P2OB 1N64H 1KYOJ 1DANU 5JW4R 4MJ5A 3DUSA 1CFSA 4L8DB 1A7OH 5SWZB 3IDIB 1QYGL 4YDIH 1HI6A 2AJSL 3T1WA 4ZPVB 3U48A 3C9NA 1FFRA 5DMKA 1BOGA 4KDWA 2I24N 3QWQB 4TUOA 4Q7DA 2ZNWA 3GRWL 3BRDA 1UM4L 5ETUB 2WWKT 4LP5A 2WM0A 3ZHKA 1P1ZA 1MY7A 1L4IA 2A6DA 3MLTA 4LU5L 4X7CC 5EO9B 1MRFL 3EOTH 4O2FB 4CW1B 3HAEH 5EC2B 4NBZB 3EO1B 4OKVA 3O4LD 4H20L 1YNKL 4JPIA 2W60B 4PRBA 1C5BL 4M9OA 3QA3A 4UV7H 4GT7A 3GSOA 4GH7B 2QADD 1TMCB 3TN0C 5GZNC 4PJXA 4WENB 2XPGA 4DCQB 5JW4Q 3WO3B 3MNWA 3O6KL 3QUXA 4MAUH 4OZGF 2QTEA 1DZBA 1FGVH 2VXVH 3TZVA 4R0LB 3PJSA 2HTLD 5CD3B 1TJGH 5CEZD 3EJYC 3NFNA 4K3EL 1NCCH 5D1QC 3FRPG 2QHRH 3AFLA 1CFVH 4JO4L 3THML 3RU8L 5FO9B 2AJZB 1IC7H 5F88B 1G7LB 2HG5B 3O9WA 2D31A 3DVNA 3IVKB 3WFCH 3C08L 4TNVK 1ZMYA 5CHNB 4CAGA 4QXUH 3RNQB 4KMTH 1F90H 4S1QH 2I07B 1Y6MR 3RBGA 3QHFL 4UILL 4MD4A 4WU5B 3L3JB 5BS0E 4IOIA 5BV7L 3HMWL 4JRXA 5E99L 4ODWA 3KPLB 4JANB 1UZ6F 4WO4B 3SKJH 1IE5A 1A2YA 4NQVA 5E7BA 5E7FA 4KI5F 1HKLH 2Y5TA 1FL3B 4X6EA 3MR9A 4JPVH 4FQ2L 3QIUD 5TE7L 1ZVYA 4UT7L 4K7PY 4UIKH 1UKSA 5F7KC 2ATPB 3B8YA 5CZKA 3ULUL 3EFFB 5E6YA 5ECJE 2Q1EA 5L9DL 5C0BD 1FFOA 1FZMA 1UGNA 4XHQA 5I9QB 2VZUA 1F3JA 1A7PH 4G80B 3C8KA 5F97E 3JSSA 3A0OA 1I8KB 5EU3B 5F1IB 1MCWW 1U0QA 1RIHH 2GSIA 5JXED 1XGUB 1X44A 1ZLUK 4WW2A 3CVIL 1IAIM 1WZKA 2VLJE 1VADA 1UWXH 1F3DH 2BVTA 2A6IA 4AZ8A 3A6CH 2X7LB 3EO9H 2AK4A 5HHPA 1OAXH 3W81A 4GMSH 1DEEB 2R29H 1DLFH 3CH1B 4G8EB 3BI9X 4RNRB 3QP3A 3MQIA 4YWGL 1TJIH 3O8XB 3IKKA 3BGFB 5C0CE 4NCC1 3TO4B 2BY1A 4JRYA 4K8RC 4ODUB 4DN3L 4X80H 1EGJH 2AV7B 3BH9A 4OZ4A 1K4DA 4LHUG 4HAFA 5IFHH 4R2GB 2HVJA 5SWSD 2QQKL 5GS3A 4AEFA 2R0ZL 5HYEA 1HCFX 3RIFK 4H8WC 2AI0H 4U49A 1OHQA 3IU3B 1AHWC 1BFVL 4I0PC 5DMGD 1DDHA 2FRGP 4GAGL 3IRZA 2Z8WC 5ITBH 2DD8H 1U8LA 2IH1B 2E9JA 2JB6B 1NCWH 4JPKL 4EIGB 5IEHA 1NCBL 3P0VH 3WL9B 1DBML 3F7RA 4M1DL 4IRSC 3VMNA 1JIBA 3OSKA 5DK0B 4U0RC 3RVWD 4KDTA 1I8IB 3AS3A 5KSAA 3WKNA 2M2DA 3BD4A 3PHSA 4ZNEA 2C3GA 4OD2B 4AIXA 2ESVD 3BPOB 3D3VE 4LLVA 4ONHA 1RZGB 5GRWA 1GZQB 3FTGA 5HHNA 2G60H 5E00B 3RI5F 3PL6B 4FNLL 5JHLH 4GAJH 3WN5A 5L8LB 3GHBL 2VLRB 4PY7B 1DBJL 2OZ4L 1EO5A 1SJEB 2DM2A 2J8OA 4L4JA 1HYRC 4KKBD 2EDOA 3S5LA 4XMLH 4ONOA 3AUVA 3F58H 2ZKHL 3SQOH 5DJYA 4QHKJ 1A4JA 4Z7UE 5L88L 3KLHD 4HUXA 3JWNC 4DUVA 3C5JA 2Z91A 3R06B 4YFLF 3NZ8A 5L2KD 2CDEA 3C87A 3SKNA 4D0CA 2WV3A 1UJ3B 1NGQL 2GFBB 2X6MA 4F2MA 2HVKB 4OI9A 3BZDA 1N2RA 1T22B 3KR3L 1N26A 1I7TA 2DQGH 1CGSH 2EDLA 1ADQA 2X4PB 3UTSE 3ARBA 1XF4A 1MNUL 4P0DA 1KJMB 2QSQA 5ISZD 3WLBB 1JYWA 3VFTB 1G9MC 2YZ8A 3P77B 1MEXH 5FYLD 4XNMA 3HKFA 1FQ9C 3FB7A 3VXMD 1FV1A 4O9HL 1A3QA 4ELKA 5C0IB 1QSFD 2AXGB 1T5WA 1DBAL 5F9WB 2H8PB 3U6RB 1C8PA 2NY6D 5DURB 3VXRA 4XWGH 1I1AD 1ZWIA 3QUYC 3WHXA 4N1EA 3UJJH 4CU6A 4DGIH 7FABH 1F4WL 3QAZC 1HYSD 4LSUL 4L9LA 1UWEL 5TDNB 1NKRA 4K07A 3HC0B 1MHCB 2APBA 5KBNC 3MRHB 3HI5H 4LQFL 5A43C 3TA3D 5SX4H 3BHBB 3RGHA 1K9TA 4HS8L 4JZOB 5SX5K 1ZS8A 3DYPA 4HEME 2NY3B 4FTVB 1T7VA 4DFIA 1BZ9A 4GBXD 4JO2L 4L3ED 5JQ6H 2BNRD 2X1QA 4PJ8A 4N9GA 2VSCA 4NP4L 2Q86B 4XB7A 5GIRB 1OAYL 2F5BH 3CX5K 4YK4C 3BWAB 1RD6A 2EDKA 3CVHA 4ZAKA 3VI4E 2BSTA 4RRPG 4XCYB 3DGGA 5KZCD 1K6QH 5ANME 4AENA 5D5MF 3BXNA 4NQXA 2VB5A 2X2YA 5E6IB 4P5TD 5CJ8A 3HMXA 3BN9C 2E9BA 3HCVB 4HS6A 1JL8A 3OHXA 2VLJA 4LAJH 1AQKH 3P9MB 4LKXA 4LSSL 2DM3A 5D5MB 1MQKL 1JNHB 3BKCL 1YYLL 3MV9E 4PB0H 1A6VL 1X4YA 4UZGA 2OI9B 4HZAA 2DM7A 5C0DA 4PJAF 2NTFB 1S7TA 1OARH 3UDWC 1SYSB 3BQUA 5I71B 2NXZD 5C0CA 1H5BC 4PRPB 1QSEE 1FGNH 1NBYB 2LAAA 4JO3L 3GEWB 4A6YA 1XEDA 4PJAB 2Q6WB 4Y4KA 3PWLA 3UTTE 3CSYA 4NQDD 1IBGH 3CSBA 1JGDB 4P59H 3G6AB 3WD5H 4K3JH 5TPWH 1FNEA 4JN2A 4HH9B 3BIKB 5DQ9A 4NO0B 5CD5C 3M1BB 2XZCL 2DKSA 2LE9A 2UWEE 4O2CB 3T0EC 3KWWA 3WNKA 4AJ0A 5J12C 2JJSC 4YHOH 4YFLI 1II4E 2P5WA 4DEPB 2B2XL 4I5BA 2OTUA 4FG6D 5FF6B 1BEYL 5EIIA 3QZWB 2DQTH 2QSVA 1MIMH 3MLXH 1DLHB 1F11A 3C2SA 3HE6D 5FM4A 5C08B 3KYKL 3CDGB 3V79C 3VFVB 1E4KA 1F45A 5DMIH 2BNQB 1S7XA 3G04A 1OP3K 1ZSDA 1VENA 1U8HB 3MYJB 1D5IL 1I3RA 3D3VA 3HZKA 2IEPA 4YQXH 1UH4A 2EKJA 4KVNH 4NQED 4TTGA 5C2BL 3TPUB 3QCTL 4QRRB 4RIRA 4A2LA 5FO7B 4FQLL 2CQVA 1A4KA 2MSPA 4LLQA 1FORH 1BF2A 1CG9A 2IAMA 1LP9E 4HKJA 4NKIH 5TQ2L 1MCBA 5C7XH 1MVUB 5C0JB 2YD5A 2YEZB 5CLWA 3BH8B 3QXDB 4Z7UA 3MRKA 1AGEB 1CVRA 4NJAL 2B4CC 2WBWB 4EVNA 1KCVH 1ZT4B 3OKLB 4L4VA 5GSRB 1JHTB 1J8HE 2X4OA 3SDAA 4YX2H 3LRGA 3RWCA 3AB0C 2HFEB 3ETBF 4F7CA 5HHMD 2R15A 1F13A 5F7UA 1GPOH 3UTSA 1HINL 5E2TL 4X99A 1KC5H 4PLJD 3A6BL 2Z8VC 1T5XB 1MRDL 1GZPA 4NNYA 3VFRB 43C9A 4DGVL 2AERT 4NPYB 2Y07L 3WFDH 2ZUWA 5BW7C 2OJEB 3DARA 3SGJC 3QIWD 3C6LB 4ZO8A 3I02B 4LVOC 5IBTH 4N0UA 5AD0A 3VDBA 2V2XB 2HLFD 1DSFL 4JN1L 2CSPA 3KS0H 5T5NF 2YUZA 3MNZA 5ID1B 2ED7A 2DMKA 1IEBA 1UZ8B 4I18B 5F96L 2PO6C 4OIAA 4ZOAA 3FO9B 4WTZG 3SN6N 5AUMA 1CFNA 3RUGE 3MGOB 4TSCL 2YBRA 3AAZA 1FCCA 3RX5A 2VDML 1IL1B 2GKIA 1CFQA 5FM5M 1UT9A 2RB8A 1QBML 1CD1B 3U30B 1TQCB 2AJVH 2CXKA 2ITDA 4R6UA 5DUBA 2HJFB 1XFPA 5DMGC 3PWJA 2PYFA 3WJLC 1RU9H 3JV4A 1HCVA 2F53D 3ARDD 5DEZA 1BMGA 2XACC 3D69B 3JTSA 4WHTB 1MHPL 3BP5B 2GT9B 1QKZH 1YPZA 4P5KB 3VXPB 5ANMA 1C12A 2UV3A 3ARFA 1YZZA 5CSZB 3UYRL 1VERA 3O4LB 4N1HB 4CMHC 5CS7A 4P23D 2QKIA 4FFWD 3TO2B 3ZHDA 1MH5A 1Y0LA 1A0QL 1BLNB 2HA1A 5F9OL 4LNVA 1MF2H 2QADB 4GS7C 5IG7A 3MV8E 4Y5XB 3MV9A 5FA3A 3ZYOA 3B9VA 2H2SD 5HSFA 3VA6A 4B7LA 4G6FD 3IDYB 3RFZC 1LE9B 2A73A 4Q0XL 3WS6A 1JPTH 2A6JA 1JZ7A 3CLEH 1I8LC 1OB1B 2CKBH 5GS1B 1G9MH 3BPNC 4BA8A 1QSEA 1HH9B 1N64L 3T77B 2CK0H 1AGCB 4Q9QL 3T0AA 4KK5D 2E7BA 1W72L 8CGTA 3O2VH 1A6TA 3ARUA 3QUMB 5IBUG 3UTTA 4LMQE 3G08A 1EO8H 5E4EB 1EVTC 4GW5B 3LKOA 4G7YH 1XGTB 1P4BL 3HNVH 4S11A 5F7LB 4HDIA 1K2DA 2ZUXA 3ARGA 4HFWA 4JHWH 2UWEA 1IAKA 4HK3N 1XR8B 3IDJB 3EOTL 3PWPE 5H37G 3P40A 3MRJB 4NRXA 1KUMA 5IVZB 5F9AC 4PG2A 5D7JD 4U3CA 2OCFD 5IHZB 4UV7L 3QIUB 3MA7B 4N8VB 3RWJB 3RGVD 2NY0C 4XTRC 5GISL 1NFDF 4YPGA 4D9LL 2ADJA 3UTPD 3GDBA 4OFVA 5DRWA 1HXYA 3T0BA 5C0BB 4ZDHB 3L7FA 4NOBA 4P46D 5TFSH 1NGYA 2FLBT 1RFDH 3MJ8B 1NFDB 2J8UA 2EDWA 3QJFA 5HHQA 1CYGA 4RAVA 1R5IB 4ZTOL 3KPQB 1X6LA 1QFPA 2VQ1A 5FHBL 4OCRH 2QHRL 4L4TD 4FQJH 1IC7L 1JNLH 3PWVA 1CK0H 5D2NE 1LP9A 3DX6B 5EOCJ 3MODH 4KPHL 2PXYD 3T3ME 2IAND 1XGQA 2GHWB 4YBQD 5DJ2A 4LVEA 4UQ2B 3HFMH 3R0NA 3DETC 4S1QL 1QHOA 1R3JB 1D7FA 5IVNA 2CKNA 2G5RA 3SBWC 4L5FH 2VZVA 5F89B 3ES6B 4P2CG 1CICC 4O2EB 3SKJL 1QTYT 3CD4A 2K7QA 1RK1B 5CILL 1HKLL 4AMKH 4JY4B 4LLUB 3KLAB 5E8NB 2VDQH 5IV2B 3VFPB 1BD2E 5DD6A 4NBXB 4MMXC 5SWSB 1C7TA 5D72H 1K3ZA 1FHGA 5ALCH 4EXKA 4D9RE 1L7TH 3ZE0E 3T4YB 4W4OC 3OR7B 1Q9OA 4YFDB 4PJCE 4JFQB 2GK0A 5B38G 3V5DB 1IVLA 2WINA 4GRWH 2F74B 4ISVA 5I1JL 3TESA 4WNQB 4PTTB 1AGFA 3WFHA 2VIRA 1U8MB 3BGMA 5DS8A 3CFBA 5DVKA 1REIA 5DK2A 2WUBH 5KVGL 1MCFA 3QIBA 3O6FA 1LEIB 2DQHH 4M3KB 5EPMB 2CUMA 3EFDH 3GB7B 4PJIE 5CZXC 5LGHL 1A3RH 1YEKH 1OAQH 3HTLX 4Z76A 3RUGA 1LE5B 3QCUL 1ED3B 1NCUA 5DYOA 2R29L 1PKOA 1IEHA 4WHDA 3PP3K 2ESVB 3L3OA 4F8QA 1I1FA 3LPWA 3RWFA 2M8XA 3V4VH 2Z31D 2IFFH 1EHLL 4LCCB 5ACLA 3VXSE 4FQHA 2OL3H 1FVEA 1GIGH 4G8GE 5DUPH 5FYJE 3VD9A 1W0VB 1FJ1B 3CK0H 2BK8A 4EI6B 5HHVH 2JK5A 1JTOA 3D39D 3W0WE 2I27N 3SDCD 1T4KB 2AI0L 3QNZB 4OFIA 1RUPL 5EIQA 3SO3B 2FO1A 4ZYKA 3F5WA 1IC5H 1DP0A 2DIAA 4YAQA 5KSUB 2B4CH 2DD8L 3SDYH 5L2KB 4Y5YB 1TFHA 3OKMA 2X4RA 1JVKA 1NCWL 1KCUH 3MV8A 4L8SB 1X5GA 3IB4A 3P0VL 4Q9RL 2CMRL 4QXWA 4PS4H 3CZJA 1MCWM 1TITA 4GKOA 2YPKA 3HAEA 5JOFA 2D9CA 5ISZB 4F33B 2IBZY 2XA3A 4XAKD 4TUJA 3MJ7A 3VWJD 1S9WA 3CXHJ 5KVEH 2NX5D 3VXMB 2PW1A 5EFIB 1T6VN 4UINL 4GQ9L 3NCYP 3QULB 4LSDA 3NACH 3HHRB 4V1DD 5EB9A 4U1MA 3QYCA 2NY6B 1LEGB 3GNML 3LEYL 3VFMA 4GAJL 4MAYD 1I1AB 4KHXH 3DO7B 4KK6D 1NDMA 4GKSB 5EBLB 2HKHH 2ZPKH 3MOAH 1JWUB 1GGCH 4PLKD 5TDPB 1I7ZA 2R0KL 5EZIH 3BZEA 4MD0A 3RPIB 4UQ3A 1MCLA 1GRWA 1ZE3C 3FN0H 3FB5A 4M43H 1FNSH 3TA3B 2R0WH 1U8KB 2IBZX 2BOCB 4W6YB 3LS4L 2VAAA 5T33L 3IETB 4D3CL 4UUJB 4GBXB 4UBDD 4DTGL 4L3EB 4ZS7H 2BNRB 3R0MA 3REWB 3SOBH 3BN3B 2W9EH 3O3DA 2V9RA 4MDIB 4JREB 2X41A 5KSVB 4M62L 4QEGA 4G6JL 3H9HA 1RZIA 2VL4A 3L95B 1OP9A 1E27A 1IM9A 1UXSA 3FO1A 4V2BA 5DF0A 5KZCB 4HIEB 4OZIA 5LAXB 1NQBA 2YHGA 4XXCA 4P5TB 4K7FB 1A1MB 1AGDB 3HUJE 5DZNA 3KPOB 4JGMA 4UB0H 4DK6A 1SJVA 3DX7B 3QNYB 5E08H 1VKXB 1U3YA 5D2NA 5KW9L 2PW2A 3MRBB 3W9EB 4DAGL 3LB6D 5DQDL 5HDLA 1KENL 5F7NC 1BPVA 3IU4H 2JCCF 2YZ1A 4DGIL 1G7QA 4PJEF 4PRNA 1PKQB 3DV4B 1CD0A 1CBVH 2NXZB 2AEIT 4GRMB 5INCA 4FFVD 2W9DL 5EIVA 3S35H 1WAAE 2IADA 2V17L 2JCCB 3LRSA 4PJEB 4O58H 4MB4A 1NGWA 1QNZH 1GGBH 1BD2A 4P3DA 4NQDB 5F93C 2QLVB 2BOBA 4GAYA 4QHMB 2YD8A 4M7KH 2DQIH 3NFSH 4TOYH 3TBVA 1DQQA 2KL6A 2WUCL 4FXKA 4KVCL 1XR9B 1KB5H 4PJCA 5LXGH 4F7PB 1K6QL 4IMKA 5DFTA 5HVWA 1EGJA 4OFPA 2OR9L 2LU3A 5EU5B 5CJOL 1BVKA 5LCVL 1H8OA 3GMNA 3BEVB 1MAML 1TVBA 5DT1L 3DNKA 3WFZA 2XNAA 2XN9A 1AQKL 3OF6D 4MX7A 3TFKC 4PJIA 4WUUA 2AEPL 3HE6B 3FFCE 1PLGH 4U7SA 3MRCA 4XVJH 4MA3B 5CCKH 3U1SH 5E24E 4O02L 2ZSWB 1TTFA 2P46B 3DI3B 4PP1D 15C8L 4ELMF 5DDHB 4NQEB 4FS0A 1ZVSB 3C5ZD 1ZHBA 3VXSA 1OGAE 2B1AH 3KYMA 5T1KD 4G8GA 1HIMH 4ZO7A 5JDSA 1R24B 2FX8H 3ZKMD 1CWVA 1FLTX 4P59L 2R1YA 1WBZB 4K3JL 5TPWL 5D7JC 1MWAH 2YPLD 1MCEA 3W0WA 3BKYH 3TJEH 4HS3A 2ERJB 1A7RH 1S5IH 5E1AA 5C0AE 4HKBA 4RMUA 4U1HA 3DX8B 1G6VK 4NKQB 1OW0A 2H3NB 2FB4L 4LBEA 3WHE1 1FO0H 4BZ2H 3QWOA 3QI9C 3RWDB 5AWNH 1P2CB 4QXGH 1AKJD 4R4ND 4XP9L 3B9KA 4RQQA 1MIML 3L9RA 5HHMB 4Y2DC 4PYHA 1PEWA 5GRJL 5IOPB 1FIGH 4XP4H 5KJRL 1Y6KR 1U3HA 4K9EL 4E5XB 4OGYL 4ZXBC 1R5WA 4QY8B 1QLEL 5DMIL 1A7BA 1H3VA 3C8HA 5EC1A 3SDDC 4C58B 4KXZI 1A21A 2PXYC 3VFUB 3W39B 5ACZB 1BGXH 5BOZG 4TVPH 4XCNA 4M7JL 3QIWB 5K9JH 1T83C 2R69L 5IQ9B 2X09A 2FYYA 5DLMH 5GRXG 1U8IA 5A3IC 4HUNB 5FA4A 1NPUA 3GJEA 4XRCA 1MCOL 3H3PH 4H26A 4MXQC 4NRYA 4TNVF 4NKIL 3CDYA 3DX9A 3MXVL 4B53A 1FLRL 2V7HB 4IDJL 5IMLB 5D70L 1BIIA 3H9SB 1EEYA 5EUKB 3D9AL 5GGTH 2HWZH 2ITCA 1ORQB 1V7MH 1MRCL 1NEUA 3Q1SH 3ARVA 4MCZA 3QQ3A 1RZFH 1Y6NR 5F1OB 5C6TL 2ADIB 1ZGLM 4K8RL 4J3SA 4UDUA 1ORSA 5DD3H 4YX2L 4ENED 4R26L 3WO4B 2F53B 2H32H 3ARDB 3QFJA 2CO7B 2HT3C 5JQHC 1TENA 4XVUD 4FA8A 5T1DH 2OMNA 1KC5L 4PBVC 4XWOD 4EOWL 1XF3A 1ZV5A 1I7RB 3BO8A 3MJGX 4H8WL 1TLKA 4PV9B 5T1LA 4W68A 1DEDA 3WFDL 5IHLB 3MUGB 1HILB 3GSXB 2C3HA 4P23B 6CGTA 1RVFH 5FUOL 1T89A 3QZWG 4NYLA 4POZD 5MEQB 5B8CB 2A9MH 1PZ5B 2VXTL 3G6JE 4KJWC 3OJMB 2V6HA 2YK1H 3O4OB 4G6FB 2Z31C 1DQJB 3GJFA 5E0QA 4DUXA 3KPMA 3CAFA 4AQ1B 5MEND 3U9UB 1LO4H 2OYPA 3VXQB 4JFDA 2IBBA 1BM3H 4NQCA 3EOAB 2PR4H 4HUVB 1T7ZA 2I9TA 1OAUL 1TPXB 1Q0XL 3OAYK 3O0RH 3SDCC 3SCMD 1ZANH 1VEMA 3VG0H 3S36X 1RHHB 2RBLA 4KQ3H 3HR5A 1RU9L 4XZUB 5F6HI 2GTWB 2GJ6E 3LH2H 4JPWH 4N0RA 2IQAB 3I2CH 1N5AA 4JQXC 1XGPA 2JELL 4KTYA 1QKZL 3RIFF 5F7MC 3MLPA 4PY8J 3MJ9L 5CP7A 4KJYA 4QRQA 1CGUA 3GKZA 5F7EL 4LSVH 4OF5A 3VWKD 4U1SA 5BCAA 5D7JB 2UYLB 5B39B 5GGRA 1NGZA 3RGVB 2KH2B 2DBJA 4NUJB 1KTDB 2H6PA 3FFCA 5A2JH 1I8MA 3ULUE 3DMMC 5BQ7A 2CDGA 2FDBP 1UXWB 2R2HA 4UT6L 1JPTL 2HFGH 1N7MH 4P46B 3CLEL 4PRAB 4YHZL 4PJ5D 4MAYC 1G9ML 1N6UA 3B4NA 1ZK9A 2CK0L 1P4LA 1OGAA 5DQJB 4U1LB 4YFEA 4AIOA 4PLKC 1N6VA 1HHKB 3WFBL 4WI7A 4HUWB 2CLVB 1IKNC 4L4TB 1G6RB 3QO0B 3H3BC 4BSVB 1UB5A 2VWEE 5D1ZC 2PXYB 2GJZA 4JR9H 4LLYB 4Y16A 4M8QA 3ME0A 3S4SB 1WFOA 2IANB 2EECA 4Y4HD 3MRMA 1KGCD 4KRPC 2Q76A 5EORH 5IQ7L 2NY2D 2OTPA 5T5NG 3GI8H 5C0AA 3FT3A 3IJSA 5DEFB 2XICA 3L3IA 2H1PH 5DRNA 3MBED 5HGDB 5CBEA 4P2RE 2NYYD 4HIHB 2DMCA 3HC4H 4EI5C 4CGTA 1QFWI 4PJFF 4KUZH 3T77A 5I2IB 4XPHH 2QSTA 1FPTL 3RVUD 3EYSL 5I19H 4W81A 4PJFB 4JFEE 1U8QB 3TM6A 5I8OL 1KG0A 1A6UH 3PABB 4HGKC 4PTUA 8FABA 3IXTB 4LF3A 4HXBH 4JO1H 5IB1A 3G5VB 4LLMB 3OJDA 4G42B 2AKRA 5GS0C 4DN4H 3RY5A 5HPOA 4X4YB 2C1PA 1PYWA 2DQFA 2MCPL 4AEEA 3GFUA 4GKNB 4G5ZL 3WDIA 1ZHKA 4FQ1L 4XBEL 1LD9B 2L4OA 2B5IC 3ZDXF 1DN0A 1NGPL 3C60C 3V6FA 4JZJB 1CI5A 3RVXC 2ARJQ 1A6ZB 5MEOA 3HFML 3MRFB 4KKCC 3DVIA 3MO1B 4L5FL 1CFT