4OL8A

Ty3 reverse transcriptase bound to dna/rna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
438
structure length
390
Chain Sequence
b'PVWLQQKYREIIRNDLPPPVKHDIEIKPGARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPITEKQDKAIDKLKDAPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLEYPAGELELLGIIKALHHFRYMLHGKHFTLRTNHARRVQRWLDDLATYDFTLEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Ty3 reverse transcriptase complexed with an RNA-DNA hybrid shows structural and functional asymmetry.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase, hydrolase/rna/dna
total genus 82
structure length 390
sequence length 438
chains with identical sequence B, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ol8A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ol8A01
2FVPA 2JEGA 1RTHB 1REVB 4IFVB 4O3RA 1XR6A 5DQHA 4WZQA 1T3NA 3PW7A 5KFPA 2R2TA 1HQEB 3GV7B 2W9AA 1RT5B 2WONA 4ID5A 4PQUB 4RW4A 4IOBA 3E51A 2ASJA 4IH6A 3BSNA 4J9MA 4IRCA 3NMAA 2VG7B 4ZPCA 4IQXA 4Y34A 5KFQA 2B5JA 3HKWA 2AGOA 5C24B 1S9GB 2IJNA 3Q8SB 4IR1A 3FFIB 1LWFA 2VA2A 1QE1A 4NLOA 3M8QB 1HNVB 4KE5A 1TKZB 3LP0B 1BQNB 4G1QB 4LSLB 4NLPA 5K14A 5J2QA 1K1QA 5EWFA 3IN5A 2WB4A 4IKAA 2CKWA 2R8IA 5DLFA 1JX4A 4DL6A 2AGPA 2WOMB 4TXSA 2AGQA 2RDJA 1GX5A 2YNHB 4FS2A 1S1VB 5HP1A 5JUMA 2AX1A 3KK3A 2HAIA 1IKWB 1RT1A 3H5SA 2J6TA 3DLEB 1SV5A 3V81A 1TQLA 3FQLA 2W7PA 4O3NA 2HNDB 4ZP8A 1S6PA 4KBIA 3DOKB 1JLAA 5KFOA 4H4OA 2XI2A 1TL1A 5FDLB 1W25A 3I5CA 5HBMB 4J9PA 3CJ3A 3DMJB 3LP1B 2C28A 1GX6A 4K4YA 3PW0A 1RTJA 2XCAA 3FDSA 3NKYA 5KT7A 2E9ZA 4RNMA 1S0NA 1VRUA 1MMLA 5CYQB 4ZVFA 4JV1A 3I0SB 2YKMB 5JXSA 3DM2A 3KLFA 3H5UA 1RT6A 4MIBA 1RT7A 1N5YA 3LANA 3CDWA 4H4MA 1N48A 3KLHB 3QLHB 4R5PA 3G6VA 3H5XA 1S49A 4DL5A 1DTTB 4IG3A 4LQ3A 4QWEA 5KFKA 3MEDA 1KLMA 4PWDA 3OL8A 2JEFA 4RW6B 5CYMB 1N56A 3KJVA 3KLIB 3UDLA 1HQUB 4ECQA 4ECTA 3OL6A 1FKPA 3KK2A 4TN2A 4J9NA 4RW7A 1TV6A 5KFFA 4QWAA 4ECUA 4ZHRB 2V0NA 4I7FB 5KT2A 2VG6B 4ED7A 5C5JA 3M9MB 2R8HA 2HWIA 3C6TA 4QW8A 4WE1A 4ZP9A 1IKVA 1S1WA 4RNOA 2OPSB 3OSPA 4IH7A 1Z4UA 1JLGB 1JLQB 3DYAB 3EZUA 3H5YA 4KV8B 1RTHA 4IRKA 4IFVA 3OLBA 3HVTB 1HYSB 3IRXB 5KG3A 3KLVA 1S9EB 3NAIA 4QW9A 4ECYA 2IMWP 1EETB 4KFBB 3NGDA 3KHHA 5KT4A 4PQUA 1S48A 3N6MA 3H40A 2HWHA 5J2NB 2VG7A 3GV8B 3T5KA 4IH5A 2EC0A 5KFXA 4X2BA 2V9WA 3MTKA 2OPQA 2D3ZA 4F4YA 2E9TA 3H2LA 1JLEA 5DQIA 2IM0A 4TQRA 3FFIA 3H4BA 4MFBB 4ZPBA 1NNDA 3MEGB 4Q0BB 4RUCA 4NLVA 1TL3A 4Y3CA 5KFRA 4Q8EA 1TKZA 3LP0A 1FKOB 3CIZA 3BQ1A 3OL7A 2F8EX 4RNHA 1JLCB 4XPEA 1T03A 2UVRA 4RNNA 3T19A 2IM1A 3T5HA 1DLOA 2WOMA 3TAMB 3IS9B 2IAJB 1UWBA 5EWEA 3V6KA 4YP3A 4ZPAA 3MR3A 1S1VA 4IFYA 3T1AA 5J2PB 2UVUA 3DRRB 4R8UB 3DLEA 1S1XB 4NLWA 4Q43A 1FK9A 4I2QA 4M95A 3T5LA 3DDKA 1XR5A 4ICLB 2HNDA 1JLFB 3EPIA 3KLGB 2XWYA 4WFYA 1QAJA 2W9BB 5KFTA 5FDLA 3LAKA 5J2MB 5KFUA 2OPRA 1J5OA 3DMJA 5DG9A 2RKIB 5KFEA 4WZMA 3DI6B 3IG1B 4EEYA 2BE2A 3UQSA 4NLYA 2IA6A 4MK8A 3FQKA 3H98A 5CYQA 1C1BA 4URQU 3I0SA 5I3UB 1S0MA 1LWEB 1MU2A 2CJQA 4OL8A 4RU9A 3NL0A 5DG7A 3PW5A 3KLHA 3PVXA 2ILZA 4IG0B 1DTTA 1JLBB 2HNZA 3EPGA 1RA6A 4ED8A 2HMIA 4DG1B 4DL3A 1HNIA 3QIDA 3LAMA 4J9QA 5CYMA 3MF5A 4GC7A 2V4RA 1JKHB 3DRPB 1HQUA 3QIPB 3KLEB 4K4ZA 2YNFB 4NLXA 5EDWA 4KHMA 3E01B 1IKXB 3G86A 4TY8B 2R8GA 4KKOB 1HMVB 4I7FA 4EBCA 2VG6A 3LP2B 2VA3A 4K4VA 3PR4A 3D28A 2R8JA 3DLGB 4XO0A 4HYKA 4JV2A 1K1SA 4LSNA 5DGBA 4ECVA 1S9FA 3DLKB 1S1UB 5KT6A 1JLGA 1JLQA 4ZP7A 1D1UA 4KV8A 3Q8RB 3KOAA 3HVTA 1HYSA 2YKNA 5EWGA 1LW0A 1LW2B 1EETA 1HPZA 3GIKA 3ICLA 2RF2B 2YNGB 2ILYA 2VG5A 4U6PA 4I2PA 1S97A 4WYWA 2UVWA 3I0RA 2WCXA 4KO0B 1D0EA 5EUHA 1EP4A 2OPPB 5DQGA 3RB0A 2ATLA 2BQ3A 3N6NA 5KFNA 1ZTWA 5KT3A 2JC0A 3PR5B 4MFBA 5KG4A 3QO9B 3JYTA 3CDUA 3HHKA 3MEGA 4Q0BA 3MFHA 1RYRA 3KMQA 2JEJA 3DOLA 3BSAA 2D7SA 2ZE2B 1FKOA 4Q44A 2WHOA 5DLGA 3KHRA 4MK9A 2I5JB 1JLCA 3QZ8A 3V6JA 3GIIA 3HVWA 1BQMA 1N6QB 3TAMA 1IM4A 2BRKA 1TKTB 3IS9A 4YR3A 3V4IB 5I42B 2FJXA 3H59A 3QYYA 3JSMB 5J2PA 4NZ0A 3CWJA 3SFUA 5D3GB 3DRRA 3V6DA 4YR0A 3GIJA 4Q45A 3KMSA 4R8UA 2DPJA 4URGA 2BANB 4NLDA 4ED3A 4O4GA 2C2DA 4DL2A 1U09A 3HVAA 4RW9B 4R0EA 5KG2A 1JLFA 4NLSA 3KLGA 2XCPA 3MFIA 4NRUA 1TKXB 3G6XA 1TVRA 5J2MA 5KFDA 1T05B 1RTDB 4GC6A 2RKIA 5J1EA 3BQ0A 3DI6A 4K4TA 1ZETA 1C0TB 5F8JA 2W8KA 1S6QB 2GIRA 1RT3A 2IM2A 2YNIB 3KK1B 5I3UA 3NAHA 3RBDA 1LWEA 3GV5B 2UUTA 1REVA 4ID5B 2QV6A 4RW4B 2UVVA 4O44B 4NLQA 4IG0A 3OSNA 1HQEA 1LWCB 4J9LA 2J6SA 1RT5A 3GYNA 4O4RA 3VQSA 4DG1A 3T5JA 1RYSA 1QUVA 3PZPA 5HLFB 2WRMA 3C6UB 2HNYB 3ISND 4J9SA 1LWFB 1VRTB 3KLEA 2D41A 5C24A 5KFMA 3M9NB 1S9GA 4HKQA 2BRLA 1I6JA 3CJ4A 2W9CB 2W7OA 3BJYA 2J6UA 1QE1B 2O5DA 4FBUA 2IC3B 3NBPB 3SFGA 5J2QB 3KHLA 2OH2A 3DLGA 3M8QA 1HNVA 1R0AB 4G1QA 3G6YA 1BQNA 4LSLA 5KFZA 3TQ1A 5KFJA 4YQWA 3GILA 3V6HA 4TYBA 4ECRA 4B3OB 4QWDA 4ECZA 5HP1B 4RW8B 4NRTA 4TYAA 1KHVA 2YNHA 4FBTA 1LW2A 2BR0A 2YNGA 1RAJA 1IKWA 3CVKA 4RUAA 2C22A 1RT2B 4YR2A 3DRSB 2WTFA 1S1TB 4JUZA 3GQCA 2ZD1B 2OPPA 1RTJB 3DOKA 1C0UB 3RB6A 2XI3A 5HBMA 3LP1A 4NCGB 1VRUB 3IGVA 3QO9A 2B6AB 2FVCA 5KFWA 3MR2A 2AQ4A 1RT6B 2QE5A 1RT7B 1N5YB 4ED1A 3RAQA 2FLLA 2ZE2A 3BQ2A 1HARA 4H4MB 2ASLA 1RTIB 2XC9A 2YKMA 3RAXA 4PUOB 4IG3B 5KFBA 1KLMB 1N6QA 4U7CA 3QLHA 1TKTA 2B43A 4ED2A 1N4LA 1NHVA 5I42A 3JSMA 1DTQB 4Y2AA 5KG7A 5DG8A 4MKBA 1FKPB 3PW4A 3KK2B 5C25B 3IGNA 4ZMMA 4RW6A 1KHWA 3KLIA 4O3OA 4RW9A 3BREA 1TKXA 4JV0A 2FVRA 1C1CB 4WFXA 5KG6A 4QWBA 4MH8A 3MR5A 4ZHRA 4F4XA 1C0TA 2JC1A 2FLNA 1YVFA 1CSJA 4LQ9A 1S6QA 1ZTTA 2R2RA 1SH2A 2OPSA 2GC8A 2YNIA 3KK1A 3BGRB 5KFVA 3DYAA 5KFHA 1JIHA 5L1IA 5KT5A 3IRXA 2WK4A 4F50A 3UR0A 1S9EA 2R2UA 4O44A 4EBDA 3QGGA 4O3QA 2AWZA 5F8NA 1LWCA 4KFBA 4ZP6A 2FJVA 2ALZA 4ZVEA 3CJ5A 4M94A 2OPQB 4EBEA 5J2NA 4DL7A 5HLFA 2BQUA 3C6UA 1JLEB 2HNYA 3QGHA 5KFGA 1VRTA 4EYHB 2W9CA 2FVSA 4WXWA 1TL3B 3MEEB 2IC3A 3NBPA 4IDKB 4NLTA 2BQRA 3D5MA 2ZKUA 1T03B 4YMEA 5F9NA 1IKYB 1R0AA 1DLOB 5F8LA 4ED0A 5KG5A 1QAIA 1UWBB 3OHAA 3M8PB 5L1JA 3MECB 4B3OA 1SH3A 4IFYB 4KSEB 4RW8A 2ASDA 1WNEA 4WYLA 2FLPA 2IAJA 3RB4A 4WFZA 1FK9B 4I2QB 5KFLA 4ECXA 1S1XA 4RNFA 3ITHB 1RT2A 2V4QA 1SUQB 5HROB 3DRSA 3KHGA 1S1TA 2OPRB 4ICLA 1J5OB 4ZVHA 4F4WA 2ZD1A 1RT4B 4K4XA 1NHUA 2BE2B 2JLEA 5C42B 1C0UA 3CDEA 2W9BA 5F8HA 4NCGA 3Q8QB 3IG1A 4QWCA 4FS1A 2B6AA 1C1BB 3RBEA 5KFAA 1MU2B 5F9LA 3MR6A 5L1LA 4K50A 5KFCA 1RTIA 4KAIA 4ZPDA 5T14A 4K4UA 4PUOA 5KG0A 3KNAA 2HNZB 4QPXA 5DGAA 2WONB 2XGQA 3I5AA 2HMIB 1OS5A 4O3PA 4NYZA 1HNIB 4MIAA 2E9RX 4H54A 1JLBA 1DTQA 5L9XA 2UUWA 2RDIA 2DPIA 2B5JB 5C25A 2AU0A 2IBKA 4Y2CA 3BSCA 5KG1A 1RDRA 3I5BA 1JKHA 3DRPA 3GIMA 1S0OA 4RZRA 3QIPA 2IJFA 2YNFA 1C1CA 4NLRA 3E01A 1IKXA 4TY8A 4ZVGA 4LSNB 4KKOA 1HMVA 5K14B 3LP2A 4J9RA 3OLAA 2JEIA 3QGIA 2YKNB 3DLKA 1S1UA 4WXOA 3BGRA 3RB3A 1LW0B 3PJWA 5F8GA 1HPZB 1SH0A 3SI8A 3N6LA 3KK3B 1JXLA 2GIQA 1RT1B 2VG5B 4DL4A 2C2EA 3ISNC 4I2PB 1SV5B 3V81B 1TP7A 3OHBA 3FRZA 4IR9A 3I0RB 2RF2A 3UPFA 1S6PB 1EP4B 3BR9A 1JLAB 4H4OB 1TL1B 3CJ2A 5KFYA 4MKAA 5F8MA 4J9OA 4EYIB 4KO0A 4KB7A 5KFIA 2R8KA 4K4SA 3H4DA 3JYTB 4TY9A 4O3SA 3PW2A 3DOLB 3MEEA 1XR7A 4IDKA 2FVQA 4MK7A 3Q8PB 3OL9A 4URSA 3DM2B 3KLFB 1T94A 4NLUA 1IKYA 4ED6A 2IM3A 1S10A 3FSIA 1BQMB 4ECWA 2I5JA 4R5PB 4TQSA 4K4WA 4NLGA 3LALA 3M8PA 3MECA 2XGPA 3PJXA 3PHEA 3MEDB 3CO9A 3V6DB 4Q8FA 4PWDB 4XPCA 4TLRA 4DEZA 4G3IA 3V4IA 4J9KA 3TVKA 2C2RA 3KJVB 4O4GB 3QZ7A 1S4FA 5D3GA 4IRDA 5KFSA 2R2SA 2BANA 1TVRB 3ITHA 4KHRA 3BSOA 4ECSA 1SUQA 4RW7B 5HROA 1TV6B 3M9OB 4EO8A 2AX0A 5J1EB 1RT4A 1C2PA 5F8IA 5C42A 3C6TB 1T05A 1RTDA 2W8LA 4WE1B 1RA7A 2I1RA 3CJ0A 4EO6A 1RT3B 1IKVB 1S1WB 2FJWA 2D3UA 5L1KA 4F4ZA
chains in the Genus database with same CATH superfamily
2DCUB 2BABA 1TAQA 3OR1A 3MCMA 2E5LJ 5H1SV 2EFNA 1QVFR 4R25A 4IQXA 5B08A 2LXFA 4Y65A 4ES3A 1RKJA 3QQCD 1DZ5A 4CQ1A 1EZZB 4NLOA 2XULA 3R5DA 3G2XA 2UXDF 1ZPWX 2EVZA 4DFKA 3P3DA 2DNOA 3G9CA 1H7XA 3E2EA 1MWZA 2GNKA 2QA4G 2YKMB 4MIBA 4TU9A 1YBUA 1OY8A 1X9MA 2PC6A 2VPZB 4PWDA 1N32J 4DSIA 4N8NA 2GO9A 2F1FA 3WBZA 4Y00A 1XNQJ 4IH7A 1JLGB 3EZUA 3A8EA 1HR0F 4YDDB 4K8RA 2AMCB 5C2CA 3T5KA 2P6SA 2QLFB 1IBMF 4O23A 5ETNA 2E9TA 4MFBB 4LF9J 3HCXA 3LP0A 5JMNA 1RLDA 3V6KA 4DOZA 2GQCA 3DLEA 4NLWA 1Y5IB 4WFYA 1X4AA 4CO0A 3B78A 1M5PC 3M8ZA 5J1PA 1UTAA 1S0MA 1MU2A 2HQCA 3GSDA 2PA3A 2YQ0A 3OW2R 3MM5A 1SKSA 2GMJA 4NLXA 5EDWA 4DR6F 3G86A 2VV5A 1WG5A 2X1FA 4XO0A 4JV2A 4X62J 2E7XA 2JH3A 4UQTA 4DV2F 2K7KA 1HPZA 1RXOB 4KH1B 2N4CA 1EP4A 2OPPB 1ZTWA 1U1PA 1A7GE 3CDUA 4Q0BA 1SL0A 3K17A 1QVGR 1SJRA 2N82B 1WHWA 4YR3A 4DCJB 2PFDA 3NCPA 3KMSA 4WFBQ 4URGA 2BANB 2XNQA 4M5DB 4LFBJ 3DDIA 2XCPA 2NSCA 2HQ3A 1M5KC 2DNHA 2OD6A 3A8JA 2WBRA 1RT3A 2DHAA 4USMA 3DLLQ 3CJQA 2Q79A 2CQPA 5KTQA 2QV6A 2G2ZA 2R7TA 4OHWA 2MGZB 1VQ5S 2J6SA 4QJVA 2BKOA 4A47A 1Y5NB 5J2QB 1PAUB 4C97A 3TQ1A 4ZVTB 3V6HA 3HJFA 2KHCA 4ECRA 2AEMA 5IT9Y 3D6MB 3VHQA 2MB0B 2CXEA 2OO4A 3D1HA 5D4OA 3GQCA 1C0UB 3LP1A 4L3NA 2AYGA 2V63A 2A0FB 5F3TA 1KS2A 1DURA 2FJEB 5E0OA 1TKTA 2HHXA 1UMJA 5IC6B 3PW4A 5C25B 3R5AA 4RW6A 2VIHA 3PX4A 3THTA 1CJTB 5CZXA 1K44A 1Q8KA 1MMNA 4UOFA 2HAFA 2R2UA 1P8GA 4OYPA 4C11A 2ALZA 1F9HA 2JFDA 2XMVA 4DL7A 1JLEB 1XMQF 1L5UA 4FYXB 1KD1T 3BYRA 4U7UK 4NLTA 4ED0A 3S7RA 3M8PB 4B3OA 2ZHBA 4X64F 2COLA 3N28A 3AJ2A 1FK9B 2GCFA 1N34J 3LQVA 2OPRB 1GTHA 3CJSA 2JLEA 1K9MT 4B9NA 2FHJD 3OBIA 3HKZD 3MR6A 3M30A 1GMWD 3FNNA 1RU2A 3AD9C 1OS5A 2E9RX 4M63A 3HHLA 4Y2CA 3GIMA 2XY7A 3W2VB 2YNFA 3CXCR 2DGXA 3TJAA 3H20A 1AZSB 1MROB 1V5IB 2G9OA 2W7AA 1XBWA 2OP5A 3PTWA 3OTDA 4ZVPB 2AF6A 1FJEB 4DL4A 3OV7A 3T1YJ 1VOMA 5E3QA 4DS5A 3TA1A 4DSJA 3ZZRA 1T94A 3HMJG 1ZYQA 1S6UA 3SV3A 1EKRA 3MEDB 4Q8FA 4DZDA 1B64A 3OT9A 4IRDA 2H54B 5C2GA 3ITHA 3THVA 1B70B 2YXLA 1RTDA 5K8NA 2I1RA 3CJ0A 2FJWA 3M2UB 6AT1B 2AT1B 3HSJA 1REVB 5FLXU 3RRGA 3GYXB 4EZ6A 2A10A 4PQUB 3PXGa 4J9MA 3NMAA 2MY7A 2MQ8A 2H9ZA 1S9GB 2IJNA 2EI5A 4NI2B 2J0QD 4K59A 2DISA 1FERA 5EWFA 4DR7F 4JI1J 3QSYB 2PD1A 5HP1A 5JUMA 3M6VA 1NKEA 5FDLB 2NSBA 3CTRA 3W9IA 5KT7A 2KFZA 1XWLA 3P45B 2L9NA 1F5AA 3FEYB 1YTYA 1SVDA 3SQOP 4YB7A 1T9VA 3UDLA 2KFNA 1KBRA 4P75A 1WG4A 2DR6A 3PRDA 2LQ8A 2YBVA 3QFWA 4ED7A 2VG6B 2HWIA 1IKVA 3TUJC 3OSPA 4LJMA 5GADU 1ACMB 4B9LA 1PG5B 3WDOA 3NGDA 3KHHA 3QWUA 3B4MA 1KNZA 4NCBA 2OPQA 5L8RC 2IM0A 4E2FB 1AW0A 2YY3A 1B0VA 3BQ1A 2AYMA 3T5HA 4PWUA 2K06A 4B3MF 5EWEA 1TK0A 2NR0A 3K59A 2ZZNA 3LAKA 5J2MB 4WZMA 3IG1B 3UQSA 4NLYA 4PXEA 1A0OB 4YFUA 3FQKA 3H98A 2OMOA 4N8OA 2X3GA 2M5YA 2V4RA 1BWEA 2DGSA 3H25A 2LEPA 1TKDA 4ECVA 1S1UB 1PJ5A 1YITS 5GMKa 4ZVOB 2RAQA 2ILYA 1YIJS 3C15A 4YN3B 4F8RA 3R2DJ 1RAHB 5AXKA 2Z2MA 4A4JA 3DOLA 4DF8A 3KHRA 4MK9A 3ZZPA 3WC0A 2ZKTA 1DARA 4O0NA 3C66A 4DR5J 2YWWA 2JOQA 2UP1A 4I6WA 5KG2A 2AJ1A 3MD1A 2KHDA 4GC6A 3UCUP 3DI6A 3HO1A 4DV3J 5CD4H 3GV5B 3HZGA 3D68A 2DK2A 2N3OA 4X4NA 2D3OR 3IO1A 4Y2IA 1LWFB 3FKBA 3MMAB 4BHQA 4X84A 2LA4A 3M8QA 4G1QA 1FF2A 2EFVA 2V9KA 5CQGA 3CT9A 4DLEA 3UN2A 1IKWA 5HI7A 3CIMA 3I4HX 3R5CA 1RTJB 2XI3A 4DQQA 1SI9A 2B6AB 4OMFG 3BO2A 4QR0A 2BX6A 5KFBA 1A9NB 1Y10A 1NHVA 2XS5A 3KK2B 4LF6J 5U47A 1FD8A 1KHWA 4JI6F 3RJMB 4ENOA 4O0IA 4FXWA 4MH8A 1N36J 1ROFA 4BDPA 5CHCB 2R2RA 2XZDB 4MYUA 1RI7A 1X5PA 2MKSA 4EZ9A 1YJUA 1KQKA 2UXBF 1RWXB 3CD7A 4LBPA 3W62A 2PFFB 4JP8A 4RW8A 2G0JA 2FLPA 3M8WA 2KT2A 1RWNB 1H72C 4RNFA 2DR9A 5A8RA 2PMHA 2AJ0A 4CT9A 2ZD1A 4K4XA 2W9BA 2E5IA 4QZVB 4BC7A 2IA0A 5KFCA 1PYTA 1GAOA 5SZTA 2WVDA 4QPXA 4WBFA 4N41A 1RBAA 3SDEA 3A3NB 2CNKB 3JSBA 1IBKF 2KRBA 2DO0A 2AU0A 4PZVA 2NREA 4FYDA 1U1KA 3ZTOA 2V5HG 4QIWD 5KOWA 1DHMA 2R42A 3VZHA 4YHHF 2L9DA 4ELTA 4DQPA 1PIEA 4FNIA 1T02A 4TY9A 1CJKB 2ACMA 4KR0B 3KLFB 3QT8A 4PPZA 5E3PA 4Y2MA 4OHYA 2MYFA 3V6DB 1RE1B 5GAEI 1UCNA 2F4VF 5HROA 3M9OB 3R2CJ 3AT1B 5F8IA 5C42A 2KYXA 2W8LA 2V69A 1VMBA 3J81Y 1AT1B 1RTHB 1SQEA 4OYWA 2VFUA 3QT5A 3I82A 3RRHA 4OZ3A 3W9JA 3LTOA 1UZDA 2DRBA 4IR1A 4Q7AA 4DPXA 1PILA 2KXHA 4YEAA 2C2OB 2KFYA 2Y8WA 3AY0A 4OJ3A 3BBCA 7FDRA 2R7XA 4A8OA 3M8RA 2EG2A 1WEYA 1U6FA 1TL5A 4JV1A 2K7JA 4ZPVR 3TJ8A 3IBCB 2R7WA 5BJRA 1YJ7A 4OHZA 1WF2A 3UFCX 4YB5A 2KZZA 2DGVA 3HJVA 3C6TA 3HVRA 4WE1A 2XBPA 3OVAA 5CABA 1QY7A 2VH7A 2O66A 3C14B 2ZHOA 2FJAB 1S48A 2UUAF 1TUGB 1X0PA 2AJ2A 1WOPA 1D9DA 5KFXA 4OX7A 2XMWA 2CPDA 3ZNJ1 3FFIA 3MEGB 1KFDA 1TL3A 2CG8A 4RNHA 2YWGA 3RAMA 3ENAA 3UCGA 1UVKA 2BV3A 4I2QA 3H90A 3EICA 2FJBB 3BN7A 1EB0A 5CYQA 1LWEB 3BKUA 3DCAA 1BXNA 5EX3A 1GFWB 3UN3A 2B9EA 5LL6d 5IFMA 4KKOB 3GCWP 1RGVA 1X31C 4H4KC 4WTOB 3C46A 1IM6A 3UVJB 3SSRA 2G2YA 1HWLA 2CQIA 1RHKB 2RH3A 4U67Q 3RBZA 1FEHA 2JEJA 2QN6B 2X1GA 3K5MA 2I5JB 5GAEU 1W7WA 2HS3A 3HSDA 2FJXA 2BKPA 2V6AA 2YKOA 1YX2A 1VIXA 1HA1A 2ZITA 1U09A 2FC8A 1BY9A 1Y4ZB 2OSRA 2WSCC 1ZETA 1C0TB 4DQIA 2RE1A 1NB2A 1X4BA 5I3UA 4ZN1A 5DZ7A 1U26A 1SIWB 4LSZB 1NH8A 2OAUA 2HHWA 3ZNUA 4LRAA 4B3RJ 4C9DA 4HTIA 5H9EK 2H5JB 2IVYA 2EC2A 3C2PA 4GRSA 1Y7PA 3SCJE 1IBCB 1AXQA 1YBTA 1KHVA 3J80Y 2Z57B 5HMWA 1QTMA 1N0UA 1PC5A 3NGSA 5I3QA 1REGX 4PCQA 2NZ4A 5DM6Q 3RAXA 3I87A 5I42A 5DG8A 3F73A 2VKZG 4ZMMA 4ED5A 1XIQA 4KIAA 4CO1A 3E3XA 3H8YA 4MKVA 1U4BA 1NSKL 1VI7A 1ZM2A 4WF9Q 2EW9A 3SZ2A 3KK1A 2HG4A 5DETA 1VIOA 1ELOA 4WJBA 4EBDA 4O44A 2HVHA 1WC4A 2M8HA 3EE3A 3N4WA 1WSVA 5A8WA 5KFGA 2FVSA 1EQMA 4NEYA 3ZZUA 1R0AA 1DLOB 3SCLE 4IFYB 2V4JB 2IAJA 1HBMB 4S0MA 2MQQA 4N77A 5D4NA 5IWAF 2W4PA 3WIUA 2BE2B 3Q8QB 4M5NA 5T14A 2B9YA 2ZM6J 4OFZA 2DNYA 2UUWA 2DPIA 1TFWA 2RHQB 2XMTA 3KUEA 1HMVA 1HWKA 5HJXA 2XO6A 3BGRA 1LW0B 3B54A 1VS3A 4C8YA 4I2PB 2BE7D 2RF2A 3BPDA 4MKAA 4J9OA 4LF4J 1EHWA 3H4DA 1N0VC 3PW2A 4LBHA 3N5FA 4URSA 4NLUA 1Q16B 1VBYA 4ZVQB 4F25A 4PWDB 1ITPA 4P71A 4ECSA 1K47A 2AX0A 1WSRA 1RA7A 2UXDJ 4DV0J 2JEGA 1FNMA 5IM0A 5DQHA 4RW4A 2HBRB 3T9NA 1J2VA 3R1HA 1HNVB 3LP0B 4NLPA 5K14A 2Q6CA 1LKZA 3EMTA 3G96A 1S7IA 4J90A 1RT1A 3DLEB 2OSQA 2DR7A 2HRTA 2LQBA 2HGMA 5AXLA 5KFOA 1JLAA 5HBMB 1UZHA 4ZIWA 3PW0A 3CO0P 2ZWOA 2E9ZA 5JXSA 1RT6A 3O1LA 3I55S 3G6VA 1HR0J 3CE8A 1KLMA 2VKRA 4F0KA 3KJVA 4DUTA 1IBMJ 2A3JA 4TN2A 1LWXA 2K1RA 3UI3A 3NEKA 1SC6A 4NZ6A 2CPEA 4QIVA 3GG1A 3RR8A 4AXJA 2VG7A 1IN0A 1DQAA 5C7PA 1EX8A 1PGZA 2U2FA 5DQIA 4WIIA 1NNDA 4Q0BB 1C4AA 2HZVA 3R6LB 3VAIA 2QX0A 3IXQA 1S1XB 5LT5A 3P5BP 3DDKA 2L08A 1X8DA 1Q5YA 4DR6J 3LGMA 2FYXA 4MK8A 1FCAA 1F9EB 1C1BA 3I0SA 4RU9A 3NL0A 2XMUA 2HNZA 4DFJA 2QLJB 1SCJB 1U1NA 5L39A 3HHLD 1HQUA 2IIHA 2E5GA 4JI3F 1IKXB 1S9FA 3DLKB 4ZP7A 1OQ6A 3BH6B 4PG8A 3AXKA 1HBUB 2QO3A 4CLTA 1JLCA 4F36A 5B09A 1TKTB 3PFOA 3LH2S 2DXFA 2C2ZB 4U8VA 4ETZA 3TZZA 2ZBRA 2KO1A 1RWPB 3NGRA 3O6QA 4C11B 4OZJA 1RT5A 2W01A 4ZOSA 1F60B 1Q0NA 2VFRA 1KN6A 3ISND 2R7RA 4EI2A 2OFHX 4ECZA 4B3OB 2DHSA 4TYAA 3FBBA 2RQMA 2C22A 1Y00A 1OIAA 5E3AA 3RB6A 4JV5F 2YWHA 3R1LA 1K73T 2ZH1A 2RD5C 3E8OA 1R0CB 1NHKL 1ZS6A 2GIFA 2AZ1A 1FFSB 3CCLS 4CCHA 1FKPB 3BZQA 3HHLB 1F6TA 1XMQJ 1ZA1B 4QWBA 1FRLA 3V4MA 1URRA 2BDPA 1TELA 1VYAA 2YNIA 1UEKA 1GMUA 3JS9A 2Y0SD 1S9EA 4X64J 2DGWA 1U8SA 4ZP6A 3PDNA 4EFAC 4ZCIA 2Y1JA 5BYSA 1RAAB 1RWWB 1HBNB 2HZAA 1V3SA 2X1BA 4F2SA 1XN9A 3TZXA 4JI2F 1WNEA 3RB4A 2Q43A 5KFLA 3ITHB 1FD2A 1QTNB 2AIRB 2D9PA 4NA3A 3IWLA 2P9GA 2Y1LB 1PKUA 1N5VA 3NNAA 4AT1B 3FZBA 2OMLA 1CULA 4LRBA 3DRPA 1PO6A 3EDRB 3MAHA 1HD1A 1U1QA 1JQGA 3BKFA 1XNRF 1RAOA 2FDNA 1X0FA 4CRJA 1WC3A 1TP7A 1VLYA 3OHBA 4IR9A 4RL1A 4DPTA 5KFYA 5F8MA 3UCZP 2FHOB 1VQ7S 1UVJA 1V9OA 1HNZJ 2DHGA 2XLJA 3V4IA 3TVKA 2HFVA 3ZFVA 3FCWA 2HLUA 4OHXA 2NPFA 3PIPQ 2ZHAA 3BBBA 3QRPA 2LDIA 2RDDA 1IKVB 3LPEA 2D3UA 4DR7J 1R8BA 3FRYA 3QJPA 3I4PA 3QJJA 4I67A 5KFPA 1YI2S 1HQEB 5FJ4A 3IM8A 4Z37A 3HD1A 4IH6A 1WTBA 4IRCA 3PX6A 1UETA 4Z7YA 3UWTA 2PI4A 2J9DE 2GZOA 2ZEJA 3HT3A 2AGQA 2UUCF 3TYTA 3OFGA 3H5SA 2XB2D 4BCAA 1Q8LA 3FQLA 4J7CA 3VWSA 4CO2A 5GAGI 4LRCA 4B9VA 3SQGB 5IS2A 2WBMA 4R5PA 3T6BA 2LVWA 3OL8A 1UW9A 3ETOA 2YH1A 3PV8A 4X4TA 2LU2A 4J9NA 3Q22A 1TUVA 2V0NA 5C5JA 1YKWA 1T0TV 1FDDA 5M2RA 3EGVA 3H5YA 1FTCA 3IRXB 4B3MJ 4NXMF 4ITSA 3N6MA 3H40A 2HWHA 3C15B 2V9WA 2CQ4A 1FWPA 3VGTA 3DXSX 3SIPB 4Q8EA 3OTOF 1T03A 2UVRA 1TK5A 1DBDA 4YP3A 1QLNA 2KYZA 1CJUA 2CIMA 3DI6B 2GHPA 3D0IE 3C16A 2BE9B 1S76D 5ETVA 3TW0A 1Q53A 4HACA 4J9QA 1DQ9A 2MPUA 3M8YA 3LW5C 2CJXB 3MM6B 4KV8A 4G1IA 1PYOB 1ZZNA 3I32A 4DPYA 2AD9A 5JVGQ 1ULRA 4KO0B 4ZS6A 2VBYA 1Q78A 3KMQA 5CA5A 4LF7F 3QATA 2W24A 4X4QA 3GIIA 2PIIA 3HVWA 1YZ6A 4AQYF 4D3HA 3TEGA 5D3GB 3SV4A 2OIHA 2CJKA 2V2QA 4NRUA 1TVRA 1WF0A 5KFDA 1T05B 4FKXA 1FA0A 5D15A 1VBXA 1T11A 2DH8A 1NAQA 4I69A 2M52A 4ID5B 2DY1A 4BWJA 1O0PA 1N52B 4OI4A 4A8XA 3JSRA 3PZPA 2ADCA 5KFMA 3CJ4A 1WC5A 3TARA 2PT0A 1BQNA 2FJDB 4DBQA 4OLOA 4RW8B 2CQGA 3H2UB 4FYYB 1G1XA 2YNHA 4OYZA 4F04B 1VK8A 2MJUA 5BR8J 3GJRB 2XYHB 1FE4A 5GAGU 2VU5A 3J7YU 4JUZA 2ZD1B 1OJ4A 1WACA 2EK6A 2Z4PA 1SJFA 2QL7B 3ISZA 1XMBA 4HDHA 4ZLNA 2ZNZA 1N6QA 1HHTP 1LNQA 1RWMB 3I31A 2UXBJ 2KJWA 2EBGA 2HPUA 1X7VA 1YVFA 2YX4A 1TL7A 2FLOA 3DYAA 2MSTA 5KFHA 5L1IA 3TR5A 3MMCA 4HLBA 1URNA 3QGGA 2W9CA 2Z0GA 4WFNQ 4DFMA 2V50A 4NXNJ 3D5MA 3BEGB 1UWBB 4B3SF 1RCOB 4M1KA 1IBKJ 1TTHB 3W2WA 1YDLA 5HROB 3DRSA 1S1TA 1J5OB 5C42B 2LDYA 2IMOA 8RUCA 5ITHA 1FRIA 4DPWA 3JAMY 2ZJQQ 5M2UA 5DDQC 5DGAA 1EKSA 4WIQA 3J7A1 5H9FK 4NLRA 2GMHA 1LFWA 1MW7A 3LP2A 2HHUA 5CXTA 1QD1A 3F41A 3KG1A 3ISNC 4DUYJ 3POTA 4I56A 2HSEB 1QSSA 2F4VJ 2HGLA 5A6WA 1B4SA 2XYGB 3PM9A 4RWXA 1RABB 3MOJB 1HLWA 1RQ0A 3OL9A 4J91A 3KYLA 2J5AA 1XQIA 3GJQB 4LF2A 4ED6A 1U0HA 3IR5B 2YX7A 2PI5A 5DO2A 4CLPA 4O4GB 3MI7X 4TU8A 2C3OA 2Q6BA 4P2XA 1SUQA 2F9DA 3R7SB 3G71S 1NDLA 1RT4A 4KGKA 5IC4B 1KEKA 3C6TB 1KOOA 4WE1B 1KR4A 3CCRS 2HVDA 1GMWA 1XR6A 3OJUA 4UUWA 1T9YA 3PFEA 1SKUB 2MTLA 4A8QA 1RB0A 2X1AA 3CB4A 4FVMA 3CUNA 3Q8SB 3FFIB 3Q24A 4P2MA 4DV4F 2VA2A 3TRGA 4DZ6A 3V5RA 4UTGA 4KT0C 3BYPA 2KRRA 1SV5A 3MM9A 4ZP8A 5ETMA 1FHTA 4OZ1A 3CJRA 5CYQB 3H5UA 3GLJA 4H4MA 4JI0F 3H5XA 1L3UA 3HI9A 4IG3A 4AD6A 4GO7X 4DXLA 1PJ6A 3FMWA 2VQFF 3U7JA 2Y3YA 3NOGA 2HS0A 4IFVA 4KFBB 1LFPA 1X4EA 1VQ6S 1G7CB 4H4KA 3UDCA 2QLWA 2D3ZA 2CQCA 3H2LA 3H4BA 1YJVA 2B7BB 4LVOP 3NY0A 1KC8T 2HFNA 3AOAA 2E5HA 1P1LA 1GK8A 5AXNA 3N0VA 3T5LA 2HNDA 2CQ2A 4CLWA 3LWMA 4USUA 3VAMA 1LXJA 5I3UB 2AV5A 4IUFA 4DR1J 1JLBB 2L48A 1NZ8A 2FD2A 2C2KB 3TWZA 3JTPA 3JQMA 4DV7F 3DOMA 4K2JA 2LMIA 1K1SA 3T1HF 1BD6A 5KT6A 2Z56B 2DD8S 4PXBA 1UFWA 2DKOB 1N5SA 4C8ZA 4JYAJ 3JXOA 2UVWA 2H5IB 2ZVIA 1VQYA 2YH0A 3PR5B 2NUUG 1FKOA 3R5BA 2UU9F 5I42B 1H3DA 2DNGA 3K8VA 4LREA 3GJTB 4C8LA 2C2DA 2AEFA 1YRTA 4R0EA 4NLSA 4P2FA 4C3KA 3DN9A 3W5YA 3KK1B 2PE8A 1TK8A 4O44B 4MTPA 1FDAA 3D1OA 4DUZF 1W26A 1QUVA 5G0RA 3KLEA 4FYWB 4HKQA 2BRLA 4L75A 1UEVA 3DGVA 1R0AB 3GILA 4YQWA 1BUXA 2K3KA 3HFVA 3GONA 2BJ3A 4B9TA 5I3PA 4QQBA 1CQMA 3M6UA 1JXVA 2DNNA 1WKJA 3DOKA 1VRUB 3K2YA 3K5LA 3HT0A 1HARA 3MM8B 3Q83A 2ASLA 1SC4B 4N56A 1I51B 1TZ0A 3RTVA 3NNCA 2V8GA 4CTAA 3MUVP 2J0SD 3J7AN 2FC9A 5KG6A 4ZHRA 1O8BA 5CCLA 1S6QA 3BGRB 1GXTA 2WK4A 5F8NA 4DV6J 3EVOA 2U1AA 3AD8C 1NK8A 1AYEA 2HNYA 1Y3KA 3HLUA 3QGHA 3CC4S 2IC3A 1HNXJ 1NMEB 2LA6A 4ES2A 4GVBA 5F9NA 3FMBA 3BGLA 4M8LA 1UKUA 2CJAA 2KG0A 4JI4F 4DPUA 2C3YA 4CZCA 2ZH9A 3EVWA 1RAEB 2RVJA 2G13A 1BGXT 1W2BR 4ICLA 4TNOA 4KPYA 4HHHA 2DIVA 1C4CA 1OSDA 2FHKA 2XSFA 3NCRA 2HMIB 4P52A 3RYLA 2E1AA 2QGFB 2BJ1A 3BSCA 2F3JA 3ILOA 3PYGA 2GX8A 5AJ3J 4ZVGA 5K14B 4AL6A 3CDAA 4W4MA 2IDEA 4IOCQ 4WXOA 3RB3A 3N6LA 1RT1B 2EWHA 3I0RB 2LEAA 3CC7S 2VQEJ 1JLAB 3R8YA 2JDJA 3D6HB 5DJBA 4CWBA 2DNKA 1IKYA 2IM3A 1U1LA 4LVNP 3M32B 1U2CA 3PJXA 1GMVA 3X1LB 4J9KA 3BO4A 3KJVB 5RUBA 5HVFA 5J1EB 3KJNB 4L3KA 3GPAA 4QIFA 5L1KA 2AKWB 2X3DA 3ZC4A 1IR0A 3R3TA 1XTZA 3K5NA 4BWMA 2WSEC 2R2TA 1B99A 1S59A 1MLAA 2YTCA 4KRWA 2VG7B 4ZPCA 4X65F 1NSAA 4LFCF 3O8WA 5C24B 3L9ZA 3MOZA 1QE1A 2VFTA 4LSLB 2RRBA 3PX0A 3ETMA 4DL6A 1PCAA 2DHHA 5D0HA 1HWUA 3MMBA 5H9EJ 1S6PA 4H4OA 2XI2A 3BGOP 3D66A 4LF8F 1VQOS 4OI3A 3CMQA 3I0SB 1I94F 4JI7F 2DEIA 5LJ5Y 4X66J 1SBRA 3KLIB 1HQUB 4ECTA 1XMOF 4DN0A 4KH0B 4QWAA 1RHMB 5KT2A 4KGXB 4QW8A 2GA7A 1U2RA 4ILRA 2V8DA 3OLBA 4CM0A 7AT1B 1F2HA 1UPPA 1H2VZ 2EC0A 3HULA 2F63A 2VFSA 1CPZA 2QMUB 4F4YA 1N88A 2HQFA 3K8WA 2V67A 2D1CA 3TO8A 1JLCB 4OYOA 1YK9A 1Q7LB 1WOOA 1UJ6A 2XMMA 2YWEA 1YJWS 4OYBA 3K5OA 4RBVA 2GW8A 2QTWA 4CLYA 4W98A 5D8HB 3NLCA 3NGKA 4MT1A 2ZOMA 4WK3A 3S1TA 2IRXA 2E7WA 3HDSA 3R9LA 1DTTA 3SSQA 2J9DA 3OPKA 4DL3A 3UNGC 3QIPB 2QJ3A 4OYMA 2AJ4A 5B0FA 3A1YG 2C2MB 4G1PA 5HMZA 1S6OA 1WI8A 2YKNA 4M5IA 5EWGA 3GSIA 1BWVA 4ZIVA 3BB5A 2DGQA 1S97A 2JWNA 2DNQA 3RB0A 4WK1A 3JYTA 4Q44A 3LGHA 5AXMA 4CNYA 3D4JA 3TAMA 4LRFA 2GVDB 2DH7A 2I9SA 3H59A 2XS7A 4A8YA 4NLDA 3J81j 2GHWA 1H73A 4RKUC 3M1VB 4ZVUB 2KG1A 1M0SA 3BQ0A 4MYTA 2ZC4A 2YNIB 5KOXA 2HHQA 2J7KA 3UO0A 4DPOA 4AFFA 3OSNA 4YB6A 3VQSA 3MGJA 1VQSA 1U7LA 1VBKA 4EWTA 1N32F 3MAQA 2J7WA 2ZOGA 2EEYA 1M5OC 4X4PA 1R43A 1SJ4P 1XNQF 2IVFB 3X3UA 5AE1A 3EVMA 9RUBA 2VJVA 1IJFB 3TX8A 1HQ2A 1S99A 1LW2A 2OJ3A 1FJGJ 4Z2XA 1GQEA 1JJ4A 4NMXA 2NQPA 2WTFA 2G0CA 2R7SA 4N47A 1FRMA 1SL2A 1CC7A 1FRXA 1K0VA 2FVCA 4LF9F 4P74A 1RT7B 3IR7B 2YKMA 1F2GA 3W5XA 1VQ9S 1M90T 1CULB 1KVKA 1R0BG 3JSMA 1AA1B 1I5OB 1ZH5A 3BREA 3IA0A 2RJZA 3L7UA 1JB0C 3D54A 3TEHB 3GU0A 3W7BA 4JI2J 2ZH5A 4X4UA 3A13A 3Q8VA 3CJ5A 3P8BB 2HURA 5HLFA 2F40A 3VV2B 4F3QA 3HD2A 3NBPA 4DR2F 5A0YB 2XYPB 4C0BA 3AOCA 4ED4A 2CQ0A 1JK9B 3OTCA 1RT2A 2VODA 4F4WA 4NCGA 4FS1A 3Q2SC 5L1LA 1NPPA 4N5SA 1YHQS 3HM9A 1QJHA 3NOCA 2MKIA 5IT4A 2RMLA 1HNIB 4XDCA 1DTQA 2HVIA 4TU7A 1PBUA 4J9RA 3QGIA 4I6AA 3EGZA 5LSOA 3VAFA 1U6BA 3FBFA 2GIQA 2VG5B 3VZIA 2I38A 5HATA 4FXDA 2ROGA 3MR7A 3R6GB 3DGPB 2ZH2A 5AT1B 2RB7A 4F4AA 4O3SA 4IDKA 3KUGA 2YKPA 4DV5F 4R5PB 3MECA 4NZ7A 5KFSA 2BANA 4OYAA 3DLBA 2W4CA 3ZTSA 2QYCA 1SIZA 2W9AA 1UW4A 1O6XA 2MGZA 1LK5A 2ZZTA 3AXMA 1U48A 3R7NB 3SXLA 3OUYA 1KWMA 5J2QA 2W2NP 1JX4A 2AGPA 4D3GA 1GX5A 4B9SA 1SXLA 5HN0A 2AX1A 2PO4A 3CCUS 1WC1A 2H5EA 4I4BA 2W7PA 1RCXB 3OVBA 3KNGA 3BGUA 1K0TA 1HNWF 1TL1A 3C16B 3FDSA 1MSWD 4IO1A 1MMLA 4EU0A 3D6TB 3DM2A 1F5BA 3C3LA 4NXMJ 1N34F 3OL6A 2JNJA 5KFFA 1RWOB 5CYJA 1HHQA 1CJTA 3OTOJ 5K8OA 3CGIA 1Z4UA 4NPOA 4C8OA 4KV8B 2QLXA 4B9MA 3A3OB 4OIXA 4OJGA 1YZ7A 1NDKA 2D9OA 2J0XA 1JLEA 2PA8D 3PKMA 4NLVA 3W66A 1JNRB 2OELA 4USVA 2LXIA 4AL7A 3H2VE 2PN6A 1S1VA 2P8IA 1OYDA 3GFZA 1FK9A 3DRYA 3T1YF 3TZYA 3EPIA 3T41A 1F1BB 5KFTA 2OPRA 2QFJA 2RUGA 2JLFA 3FCHA 2XWXA 3J7ZT 2CQ1A 2IVMA 1WWHA 3K5PA 5FIIA 4X4OA 3EX7B 1NJIT 1JKHB 2GMLA 1VQKS 4N7TA 3E01B 4TY8B 4I7FA 4EBCA 2VA3A 1AZSA 2O1PA 1MROA 3GB0A 3Q8RB 1NEEA 3ZZZA 2DXDA 4AQYJ 1CC8A 2V2VA 4WKRA 3ZZYA 3C8YA 1E6YA 3DRXA 3HXMA 4CNZA 4NYOA 2QMXA 2HVEA 2I8EA 3HSGA 4JI1F 1R8PA 3V6JA 4GVLA 1N6QB 3G82A 3EUNA 1AFJA 2ZNYA 4FP9A 3CULA 4ANCA 3TUZC 3GCXP 1Q81T 3LA0A 3ZTQA 4B3TF 1TL7B 3M2UA 3SCKE 1REVA 4M5GA 1VQ8S 3MMCB 4FF3A 5A76A 4DV1F 5IT9U 1R8CA 4O4RA 3T5JA 4LIRA 5E3CA 3CEDA 4L72B 2W9CB 1S9GA 4C3LA 1ZZFA 2RU9A 4QYZK 5GAHI 2BJ8A 3KHLA 4DF4A 1ZM9A 1FXRA 1OPZA 1O5JA 1B3TA 2DR8A 1NLKL 2OLWA 1UEUA 1WEZA 2ZDPA 3TAQA 1QM9A 3DRSB 1S1TB 1B0PA 1JXEA 1OYEA 3BH7B 1N5YB 4ED1A 3RAQA 2RSQA 4GKJF 3TX0A 2E1MC 2BYCA 4DDFA 4I6YA 4ED2A 1UWAA 4ZITA 3G87A 4U95A 1MN7A 4O3OA 4CO5A 7FD1A 2GC8A 3W1YC 2XMKA 2Y1IA 2VDIA 1FDNA 2VC0A 3QAUA 5K5MA 2LXUA 4EYHB 1NO8A 5A2QY 3OFHA 1HW8A 2YQ3A 2RQ4A 1U0HB 3NCQA 6FDRA 1MMDA 1R31A 4KSEB 2FY8A 1IWAA 2QA2A 1BC6A 3TZWA 2Z2YB 1SUQB 2EK1A 2KH9A 1RT4B 2ZUAA 5F8HA 4DX8H 3IG1A 3EGWB 2IRUA 4ZCLA 2R7QA 4ZJQA 2DEJA 4ZPDA 5D0GA 3ZZOA 1FRHA 2VZ9A 2GVZA 1V3ZA 4CP5A 3ENVA 2QA1A 3I5BA 1FNOA 3WZ0A 2IJFA 3OFFA 2PSZA 2R7OA 4UQGA 3N79A 2OTLS 4DV3F 4FPRA 2KKHA 1NU4A 4P73A 1S1UA 3QT7A 2DVIA 3VCDA 1S7HA 4LUBA 1SV5B 3BR8A 3MM9B 3UPFA 3UD4P 3CJ2A 3H7HB 1CS4B 3B82A 2MZJA 3FZ2A 3MEEA 1H98A 3Q8PB 1FXLA 3AQOA 1BQMB 5LMNF 2DR5A 3PHEA 2DRDA 4LIWA 4TLRA 3FEZA 4XIUA 2MJNA 1KQFB 1XJWB 4DV4J 4ZVSB 4UT4A 4FF2A 4IFVB 1T3NA 3GFXA 2CZ9A 9ATCB 1SKWA 3E51A 2C3PA 4F2RA 3QBCA 3HKWA 4LF6F 3PHTA 2CZ4A 1LWFA 1RP5A 3CJTA 3MMAA 2H1YA 1N36F 3VGUA 5F41A 4I0WA 4ZLPA 2VOOA 4ATNA 1YGYA 3NS6A 3KK3A 4PYDA 3V81A 2HNDB 2B4VA 4FDFA 1AUDA 1RTJA 4UZBA 2V94A 1WHXA 3HFKA 1CEZA 4ELUA 4C8NA 3QLHB 2KDOA 3NRBA 2HIQA 2HRYA 3QGPA 4HDGA 4ZJLA 3KK2A 2E44A 3L95X 2MLZA 3DOMB 3MM7A 2R8HA 5GVQA 2VD3A 2CPJA 4RNOA 1HWJA 1P6TA 5FD1A 1S5ZA 2VONA 2RNEA 4C6AA 5K9FA 5CZVA 3PO5A 4BBYA 3EZ5A 1VGYA 1RBOB 1FKOB 2VBXA 4Y28C 3TVZA 4RNNA 3HX9A 1T9WA 2VFVA 1VFJA 2NCKL 1ZPVA 2ZDOA 2MQMA 2QZ8A 4DV7J 2E66A 2FZKB 2DXEA 3T1HJ 4YDXA 1LK7A 4USTA 1EARA 2WW4A 1HHSA 3M2RB 5G0RB 5CYMA 3KLEB 4LF5J 3DU6A 2AYEA 2R8JA 3SCIE 2PEHA 3PEJA 1D1UA 1TMJA 4HTJA 3RR7A 2XSJB 3ZZTA 3OXLA 5H9FJ 2JSXA 2XS2A 3U02A 2BQ3A 3N6NA 4M5MA 3HHDA 1Q8IA 2KXNB 1Q7YT 5D4PA 4ALZA 4OZ0A 3V6DA 4DUZJ 3A3PB 5LMUF 4ED3A 4PAAA 3HVAA 1JLFA 3KLGA 2ERRA 1NB7A 2BM0A 1IBLF 2RKIA 2EFQA 1RUSA 1S6QB 4KY3A 3BO3A 4J9LA 3MTJA 2Z30B 3FBEA 3US5A 5LM7E 1GTEA 1ZAVA 2HNYB 3GP9A 2IC3B 2DITA 1H38A 5ETRA 5EX0A 3TVYA 4MJKA 2GGPA 1X4DA 4OX8A 3TI0A 3I56S 1NK6A 2YNGA 4USWA 2EG1A 1PYSB 2MEWA 2F4FA 2C2NA 5IZHA 3IGVA 1RSCA 1Q82T 3TNVA 3AAWB 2OEKA 4C3MA 3FC9A 2GQQA 2YQ1A 2JHEA 4MKBA 2HLTA 1D8ZA 4LBIA 2JC1A 2FLNA 1KKHA 1UFKA 1CSJA 3CMAS 4JOUA 3C14A 1TR0A 3DNCA 5KT5A 4JI4J 4WKYA 4M94A 3C6UA 1VRTA 4WP8A 2HFOA 2QEXS 2EFGA 1NSQA 1IKYB 3OHAA 5L1JA 1PAEX 2QYGA 5IT0A 4QYRA 4NASA 5MAOA 1NHUA 1NDCA 3WQPA 3R27A 3ET6B 4B08A 3Q89A 2I0XA 4DX7A 2KB2A 5BYQA 2A2CA 4P9SA 3IRWP 4H54A 5KG1A 3NS5A 4RZRA 2UV8A 1P1TA 4RU2A 5IOLA 1FX2A 1VC0A 1KOHA 5CH7B 4LSNB 4KKOA 4M5KA 2MHNA 1I3OB 4B3RF 3UVJA 1S6PB 2POKA 2XTJP 4H4OB 3EXCX 4NEZA 2LFVA 4CLSA 4X4RA 2HQDA 3UNYA 2I5JA 3J81U 3CNQP 3CO9A 3OXFA 3NGUA 3ILLA 4X65J 3IWNC 4OI1A 4ANEA 1KONA 1HBOA 3QRQA 1G3OA 1V3RA 3KDOA 4AL5A 3PW7A 1S57A 1FWKA 1FJ7A 1HI8A 1UJ4A 4LF8J 1H0HB 4CLFA 1I94J 1YRUA 4GKKJ 2DRAA 2CRLA 5EGYA 4RR5A 2HAIA 3QT6A 3VTIA 4NA2A 5HMYA 2XQCA 1D3WA 1XMOJ 2K2PA 3DLHA 2LQ9A 1FFGB 3NKYA 3TA2A 4HT5A 1IUJA 2BA9A 2OI2A 1DTTB 3VGVA 5KFKA 4UY85 1NKBA 2JEFA 5T7LB 3MPUB 2RT3A 2VDHA 1F3FA 1WJ9A 1FI4A 2OPSB 4IRKA 1P9QC 4ETXA 4ECYA 3GG0A 4AYBD 5J2NB 2ZM6F 1V5VA 2ZJRQ 2M8DB 4RUCA 3OJSA 1DLOA 4PWWA 3TAMB 3QRRA 4ZPAA 4IFYA 4W90B 2V4JA 2DNPA 2MKJA 5ETQA 4BS2A 2XWYA 1U0SA 2BE2A 3D6FB 2KVIA 4KC5A 5B0GA 4OL8A 5A8KA 3AB2B 2XG8A 3MAAA 3QIDA 2B8QA 1Q8BA 2FQQB 3GIRA 5HANA 1YJTA 1QAXA 4UOGA 4HYKA 2GFFA 2MKHA 2RU3A 4DV0F 4MIWA 1J5EF 3HVTA 1QDUB 4F4KA 1LW0A 1LW2B 4KHPF 4ZK7M 1U45A 1PBAA 4U6PA 4I2PA 5J1NA 2KN4A 2HBZB 2ATLA 5KFNA 2BZ2A 4QBUA 3KJQB 4F3MA 2HHHF 2K8GA 2HFZA 3IS9A 1NPRA 3CCZA 3JSMB 4NYPA 5D0EA 3DRRA 1YRXA 3OR2B 3EJMA 3CCQS 1UJ5A 4DN9A 2IPOB 3R97A 4K4TA 2CADA 2DHXA 5ETLA 1CJVA 3OR1B 3VR1A 5DM7Q 1Q86T 3EGNA 3KJFB 2N4DA 2IY5B 4EK2A 5E33A 4KGMA 3OVSA 3J80U 5HLFB 2QC3A 3BV8A 3BJYA 1NDPA 3CPWR 3NBPB 1GXLA 5F3ZA 2QLBB 1HNVA 2XMJA 1UVNA 4DR3F 2BEFA 4UF4A 4FBTA 2BR0A 2FUG9 3CD0A 2MQNA 3FJ2A 1RT2B 2EFPA 1E6VA 3DFEA 2ZH3A 2QT7A 5HBMA 4NCGB 4JI8J 2FHMA 1RKIA 2J0WA 1P9YA 5ADZA 4ZJOA 4DI6A 1DTQB 2VB6A 4ZCKA 3ILJA 1TKXA 2FGCA 4WFXA 4OHVA 5A6PA 1RHJB 4DR2J 2BW7A 4DS4A 1HD0A 2C3MA 1NK5A 1SH2A 4DSLA 3RRKA 2KM8B 4USKA 4A46A 3THPA 4BLGA 4FYVB 2JZ5A 2G2OA 4WTYA 2B4UA 4IDKB 4RBTA 2N3LA 2CQHA 4F0MA 1QAIA 3MECB 3GZ7A 2OHDA 1S1XA 3JQJA 1FDBA 1K8AT 2GV1A 2APOA 3DDNA 5DDPC 3JQKA 1MU2B 5D78A 2UXCF 2MQLA 2M88A 4A8WA 3MM5B 2E7VA 2HS4A 1YG0A 1BMQB 2ZFHA 1NZAA 1Q1KA 3IC1A 1IKXA 3OUYB 5EHHA 3GFYA 1N8RT 4DV5J 3DLKA 3CCES 1G2EA 1HPZB 1SH0A 2H4YB 1JXLA 2R3VA 3JTOA 3QAEA 4PRFA 3UD3P 1EP4B 3BR9A 1TL1B 1M5SA 1OWXA 5KFIA 2R8KA 2W1BA 2GO8A 2XLKA 2B4PA 3KG0A 3AQPA 1WORA 2HYIB 3DM2B 2XHWA 1HBUA 3FSIA 4P72A 3UR3C 2HRUA 1S77D 2OGUA 4XPCA 4G3IA 2DNRA 2FGOA 3KDNA 3N9UC 3AD7C 4ZKAA 2Z2ZA 1C2PA 5HK4A 3UDEA 2R4FA 4HEA9 1RT3B 1FVQA 2CJYB 2MKKA 5GADI 2WVCA 5IV4A 4DV2J 4DMZA 2WONA 1DJ0A 2YKAA 3KFWX 3VVUA 4Y34A 2AGOA 2E29A 1HNWJ 2KL8A 3SMZA 2QMWA 5FLXY 3CF5Q 3GWCA 2EBEA 4K2XA 2RDJA 1S1VB 1NRKA 1Y9OA 3VAJA 3W8PA 3LP1B 2UUBF 2HEKA 2H48B 2XZTB 4LQ3A 4QWEA 2DYAA 2Z2LA 4RW6B 3NNHA 4DX5A 1FKPA 4UOCA 4RW7A 1TV6A 2KXFA 5EN1A 4I7FB 2OUGA 1YSJA 2GJFA 1IWGA 3IBWA 3NAIA 2N7YA 1ZM4A 2BMBA 1KVJA 5F0UA 3K89A 3MTKA 1E6YB 5CCMA 4NMLA 2Y8YA 4ZPTR 5KFRA 1TKZA 1HBNA 2F8EX 4XPEA 1A6LA 1KRPA 2WOMA 3G82B 3OFEA 2GAGC 2Z58B 2Q1LA 4HR2A 1XR5A 3ENWA 4DSKA 5KFUA 2BXJA 2H3EB 4A8FA 3DMJA 1H7WA 3D3BJ 3L7OA 3M30B 4OX9F 1TFYA 2CVIA 3PW5A 1HNZF 2ILZA 4A8MP 2OEMA 3EPGA 3OQ2A 4G6VB 3MF5A 3W8GA 5BXIA 2YNFB 4QR2A 1F0XA 1UAWA 4K4VA 3TANA 5DGBA 4M5JA 1JLQA 3I9ZA 3M2VA 4BC9A 5HVGA 2MQPA 4OJ1A 4OZNA 4WYWA 3MUTP 2E1CA 1D0EA 5DQGA 2M3DA 1O51A 2D7SA 5ETTA 4B3TJ 5DLGA 4C4WA 2DB1A 2CYYA 3TA0A 5J2PA 4DV1J 4AUKA 1X9SA 3CJ8A 4Q45A 4R8UA 3EYZA 2EKYA 1RTDB 2G1DA 3GR0A 2CAJA 2NXJA 3MDFA 2B9XA 4WFAQ 2IM2A 2NYHA 1VQNS 3RBDA 3CSKA 3T6JA 1HQEA 1ZM3A 2D41A 2HVZA 3FEXB 2OH2A 3DLGA 2HFSA 3G6YA 4QOTA 4GKJJ 4DU8A 5HP1B 4P6QA 2CPXA 4PG5A 4YR2A 3W60A 4CLLA 3O44A 3MR2A 5GMDA 5MLCV 3SQGA 5B0DA 1AROP 2RS8A 2GVZB 2ZH6A 3IGNA 2QSWA 1FVSA 2DGOA 4P2SA 1Y5LB 5DDRC 5D6GA 3EDQB 2PMWA 3IRXA 2AWZA 3CCTA 1NUEA 4ILMA 2OPQB 2ACYA 2BM1A 2BVZA 3MEEB 4HI2A 3KWMA 2HBQB 2ZKUA 4YMEA 1M1GA 2KM8C 3U1MA 1FXDA 2NPIA 4IO9Q 4WFZA 2XNRA 1XEZA 4CYUA 1HIYA 2NXNA 5D0RA 3I6PA 5KFAA 3MD3A 1RTIA 2YX1A 1RHUB 4CH0S 3SBMA 1JMTA 4NYZA 2BJ9A 2RDIA 3W63A 3HFZB 2RUSA 2WAQD 3RW6A 3MURP 3MM6A 5JJBA 4R0JA 5LMNJ 2J76E 3KK3B 3CDBA 3V81B 1VQLS 1JNZB 3H0PA 1SJ1A 1U2FA 2RIJA 4K7QA 4KO0A 4LF1A 1S0VA 3Q8UA 3DOLB 3HK2A 2E1PA 2ZBIA 1SL1A 1EJ7L 1CBKA 4L73A 1GXUA 4OZ2A 3BS9A 4RUBA 1T9UA 2MQOA 4DEZA 1M5HA 5BR8F 5D3GA 2NUHA 3KXDA 2CWKA 4KHRA 1Y11A 2VASA 3MM7B 1T05A 3ZTPA 4DWIA 1LEOA 3CJKA 3O3LA 2FVPA 2VBZA 1VBZA 1CVJA 2RRAA 3L7PA 1QUPA 2W25A 4ID5A 1IR1A 1KTVA 4USHA 2R7VA 2VF3A 2HQIA 2FY1A 1JJ2R 3K7RA 3M8QB 2FLLA 4G1QB 4IKAA 2R8IA 4TXSA 5IQQA 4RX6A 4FS2A 1VHFA 1OPIA 2J6TA 1IKWB 1RBLA 4ZA1A 4NL5A 4EUVA 1JJCB 4QYZJ 4K4YA 4U7UD 3DU5A 1ZBTA 2HKEA 2CWXA 1SJ3P 4NXNF 1LOUA 2XY5A 1N48A 4DQRA 3CCMS 1R8HA 5CYMB 2RS2A 2P2CB 4ECQA 2W2OP 3AFGA 2ROEA 4NX9A 4ECUA 2BJDA 4ZVRB 3GE9A 3P5TL 2PMZD 2IRYA 4QW9A 3FVYA 2HHTA 1X5TA 1RU1A 2NZCA 1FJCA 3AA9A 4CO3A 5IQ6A 4YUDA 3PYFA 1B0TA 4UZCA 3FCVA 3PIOQ 4YY3F 3OL7A 4GO5X 4OV6A 4AE5A 1UWBA 2P6TA 5I4MA 3MR3A 4Q43A 4CO4A 4JI6J 5A8RB 4DUYF 1JLFB 3A8KA 3KLGB 2W9BB 1L3SA 1J5OA 3M6WA 2RKIB 3U1NA 1U02A 4FNHA 4C8MA 2M7SA 2YWKA 3LF0A 2CJQA 3KLHA 3PVXA 4IYQA 3O5TB 3SDEB 5BYRA 3JB9k 2RQKA 1LQ9A 3RUBL 1T9TA 3IM9A 4J9VA 1NBEB 3J7Z5 2GGPB 4OI2A 3BKTA 1EETA 3HPOA 2YNGB 1X5OA 5LMUJ 1U24A 4DU7A 2WCXA 1IBLJ 2JC0A 3MWBA 4V1Ak 1F3VA 2XEXA 4EMDA 3CWJA 2CNOB 4E98A 2DPJA 3VQTA 4O4GA 4DL2A 2HZCA 3MFIA 1ZAWA 4QU6A 2DGTA 2B8PA 1HWIA 2GIRA 3D2WA 2BBEA 4YHHJ 3LWLA 4IG0A 3CMES 3C6UB 1VRTB 1HI1A 4JB8B 4B17A 1D9AA 3SFGA 2XO7A 4AXIA 4K5RA 3TJ9A 3DKDA 3FSXA 4C7QA 4PKDB 3G8QA 1WEXA 3RW7A 1RAJA 4FF1A 4G65A 4NWBA 4ILLA 1FFWB 5DS7A 3VAGA 3QO9A 2AP6A 2AQ4A 1FTRA 2BJEA 3DC2A 3BQ2A 2M0GB 3AHPA 5HMXA 4WP9A 4U96A 3FUYA 2Y0BB 1WHVA 1ZAXA 2FTRA 4RW9A 1L3TA 3MR5A 3UD5A 3QNWB 1UP1A 2YVSA 2YPZA 1NJZA 1KP6A 3P6YC 4DR1F 1QAYA 3BN4A 3UR0A 2CPFA 4KFBA 2KJVA 1KSPA 3W5ZA 2BW2A 2HHPA 2ATCB 2B51A 3QSIA 4WXWA 4C98A 1TL3B 3LOUA 4FF4A 4UW2A 1OMSA 2CPZA 1BLUA 3H42A 3D0HE 1YQHA 2CDRB 3JAMU 2V8VA 4I2QB 2B56A 4HI1A 8AT1B 4JYAF 1HBOB 4YB1P 3UDVA 3MZIA 4FVCA 3AODA 4XDDA 5F9LA 3RG6A 4K50A 3WIVA 2O67A 2XGQA 1FWLA 2UUAJ 1OO0B 1JLBA 4RPFA 4C48A 2BJ7A 1Z2ZA 3B6BA 4PXDA 1TMMA 5GMEA 3A4TA 1NK7A 2IBOA 2KT5A 4PPDA 3PJWA 3SI8A 4LR7A 1DRZA 4DR4F 3D0GE 1XR7A 3PG9A 1AFIA 2FVQA 4ECWA 1N33F 4TQSA 3LALA 1RHQB 3NGTA 4E8UA 3QZ7A 1NKCA 2LLZA 3GTYX 2MZRA 4PYAA 1DFDA 4F4ZA 2CA9A 2WSFC 4WZQA 2JRSA 2MLYA 4F02A 2LECA 3MPYA 1DY3A 3UN5A 2B5JA 3PYDA 2ZH4A 4K5SA 2KZMA 4TKTA 4MAKA 2ABYA 5DLFA 4K0KF 3K58A 2V2KA 1TQLA 4DV6F 3TAPA 2GJIA 1NM2A 4B9UA 4KBIA 1GEHA 3I5CA 1W25A 4CM2A 4J9PA 3IBFB 4RJVA 1HNXF 4UOHA 3R7BB 1VRUA 2MZQA 3LANA 3MM8A 5A8KB 1U1OA 3WC2A 5DZ6A 3MAAB 5L38A 2AEJA 1YLXA 3FBCA 3M9MB 5HQMA 3DHXA 1S1WA 4DSFA 4ES1A 3HVTB 4PG4A 3EM1A 3VAKA 2B9WA 3N01A 4V19X 5A8WB 2ALYB 4HVZA 1NPKA 2QA4S 1UL3A 4TQRA 3I9V9 1NCLA 5AJ3F 2ZH7A 3IS9B 2IAJB 2B3TB 3DRRB 2GHVC 1GNKA 1EIYB 4DFPA 1T9XA 2VQEF 1QAJA 3NWRA 3WX4A 3AJDA 5M2PA 4F67A 4WU3A 1CJVB 1U47A 1J5EJ 4RWWA 4KHPJ 4TLQA 2HMIA 3WHIA 1RTZA 4JI5F 4GC7A 2A18A 4M5HA 5ETPA 2HFUA 1BHNA 1HMVB 2HHHJ 2VL1A 4QPTA 3D28A 3K0JA 1F9FA 1HYSA 1OSCA 1R6VA 2DIUA 2BUNA 4MMOA 2RF2B 1OY9A 1E6VB 5IWAJ 3I0RA 2DT9A 5KT3A 1RYRA 3MFHA 3G8TA 5LOQA 2DY9A 5DRKA 1TAUA 3QZ8A 5L46A 3M32A 2NXEA 4F4XA 1R7IA 3P49B 1WDTA 2CPYA 1TKXB 2DTJA 6FD1A 5J1EA 1PJ7A 1Z2LA 3DHWC 5F8JA 2W8KA 3DXBA 5IM0B 1WD6A 4V19J 3TUPA 3NAHA 4DR3J 4RW4B 2UVVA 4X66F 3KUHA 3MEKA 3VAHA 1UA0A 4DG1A 1RYSA 2IYIA 3MUMP 4J9SA 5C24A 3CD5A 3M9NB 5LJ3Y 3ZTRA 4OZ5A 2YKQA 5E7OB 4LSLA 4E0DA 1IXKA 3V2UC 1WI6A 4NRTA 2RRNA 4Y6IA 4RUAA 4OI6A 2AHOB 4NA1A 2F8HA 2F5GA 2L41A 1RT6B 2ZE2A 2XC9A 1J27A 3Q2TC 4WPAA 1KLMB 1N4LA 4DCPB 3GJSB 3TOQA 2DBBA 1VCTA 5KG7A 3D1QA 5HVHA 2K1RB 3KLIA 2QRRA 1BQXA 4P10A 2G1HA 2ZC3A 3UW1A 1ZTTA 2ZBPA 4LFAF 5KFVA 1S79A 3M6XA 3W61A 3F56A 1VC6A 2HIYA 1LWCA 1WTFA 2FJVA 3AA8A 3M7VA 1RAFB 4DX6A 2CJBA 1MN9A 2EFOA 2UXCJ 2RHSB 2D74B 4RBUA 1SH3A 2J8AA 3FGVA 2HW3A 3EWGA 1RISA 4ECXA 4PG7A 2V4QA 4ZVHA 4J9UE 4XK8C 5HL7Q 5LSLA 4FZVA 4QR1A 4QWCA 1C1BB 3HHNB 4PEOA 2JL9A 2M9KA 2X7IA 4K4UA 1ICEB 2E5JA 4PUOA 1PC4A 5KG0A 2HNZB 2WONB 2V68A 3NWGA 3AOBA 3AJ1A 5E3RA 1RDRA 1SKRA 1S0OA 3QIPA 2ROPA 3QMQA 1C1CA 2I2YA 3HZEA 2FB0A 1UVMA 2H4WB 1FRJA 2JEIA 2BOAA 1UVIA 2YPYA 2AZ3A 2P9EA 2Y1RI 4NOHA 3PYEA 2A1BA 2G4BA 2KT3A 2CQBA 4KB7A 4KGZB 1FE0A 2VJUA 4K4SA 3IR6B 1TL4A 1T8EA 1WDDA 5SUHA 2MZ1A 4MK7A 2H51B 1Q95G 4NLGA 4OZLA 2J9EA 2EKNA 1VQMS 2GVDA 4N76A 1FJGF 2LCWA 2I6WA 1WC6A 1BE4A 4JI3J 4RW7B 1TV6B 4FXVA 3M1VA 4YOEA 4LMZA 4KQZA 3CCSS 2ZZMA 4QIEA 2LQ5A 1RT5B 4IOBA 2UUBJ 4I1TA 2BOPA 1TKZB 2WB4A 2WVEA 2E1RA 1VISA 1KDNA 2WOMB 1SJQA 1X4CA 5HSPA 2E5LF 3NS7B 2W2PP 1HFEL 2W2MP 4I64A 2JVOA 1KQGB 4I68A 2C28A 3A8IA 5T41A 3DMJB 1X5SA 5CAAA 3D3CJ 2XCAA 2NS1B 1S4EA 1HI0P 4RNMA 1L3KA 1RT7A 5HAOA 2AYBA 3IWXA 2DH9A 3MCOA 3P4UB 3OTBA 1Z1ZA 2X51A 1D9FA 1U49A 1JLQB 4KPCA 3M2VB 4W92B 2FPHX 1S9EB 2GQ2A 5KT4A 1UA1A 4HT7A 3ZO7A 2MZTA 4IH5A 5AE2A 4X2BA 2V2ZA 2VHGA 3FSYA 4JV5J 1Q5VA 3D9BA 3HHEA 1NJWA 2CNNB 3CIZA 5A0YA 4OX9J 3T19A 1HKAA 1NK4A 1WF1A 3T1AA 5J2PB 2ASYA 4ZPWR 4ID8A 4WCEQ 1Y0HA 4R8UB 1NK9A 1RZMA 1CQNA 1S12A 2IDLA 2D69A 5K8MA 2ZBCA 4URQU 4YS2A 4ZLLA 1NXIA 1RA6A 2IFXA 4ED8A 3BBFA 1HNIA 3RGIA 4F26A 3DRPB 3O2IA 3D7SB 5DDOC 4A8SA 2A2DA 3PR4A 3DLGB 5E2QA 1JLGA 3G4SS 1VC5A 3GIKA 3ICLA 2VG5A 1X4HA 3IP0A 4P7VA 1T3OA 2W2QP 5LXRA 4KTQA 1VJQA 3G8SA 3DGPA 3J7YI 4MFBA 3HHKA 5HQ8A 4X62F 3CCWA 1IM4A 2BRKA 3V4IB 4DHVA 4NZ0A 4DL0C 3GIJA 2MDAA 4YR0A 3S6EA 4PQAA 1RWVB 3Q0AA 4F3OA 1RK8A 2K3IA 3G6XA 2M70A 3M4XA 2V8PA 1XNRJ 2XM3A 5ETOA 2IJRA 3MCNA 4LFBF 1RWUA 2JFKA 3L4BC 4QU7A 4EGLA 3IAS9 2J7UA 2J6UA 2MMYA 1Q4RA 3QWPA 4FBUA 2CG4A 2O5DA 4LR9A 4JBCA 2CNLB 4QWDA 2AW0A 1DAXA 1R8AA 2RILA 4U9RA 1U25A 4CYUB 2OPPA 2D3O1 3EXYA 3RU0A 2EXUA 2V34A 5KFWA 2WB1D 1U1MA 4L74A 3GYGA 3T3FA 2JX2A 1RTIB 2ZUGA 3LO3A 4A48A 4X4VA 3MPDA 2V8HA 2DCLA 3RBXA 1MWYA 3TUIC 3PKYA 1RJJA 4M5DA 4OYXA 1IR2A 5KAKA 4JV0A 2CDQA 4CH7A 2MY8A 4LQ9A 1KVIA 4OJHA 2AJFE 2UUCJ 2F8MA 1D8YA 1RWKB 4O3QA 4OLPA 1U8WA 5E41A 4KGVB 2Y9HA 4LRDA 2B7CB 3VF0B 1WHYA 1G4CA 1T03B 5LXYA 5F8LA 1VQPS 4RUHA 1M5VC 4OQJA 2ASDA 2CVEA 4Q2LA 3KKFA 3PCOB 2XY6A 2DNZA 2RQCA 2VBWA 2KVQE 4C0HA 3KHGA 1CJUB 8ATCB 5B0BA 1C0UA 3CJKB 2CFXA 4RO0A 4HACB 2MXYA 2ZVSA 3Q23A 2LKZA 3I5AA 2F9JA 4MIAA 1VDHA 5L9XA 1HL6A 5C25A 1JKHA 5K8PA 1FEEA 4OX6A 3S8SA 4DJBA 3E01A 4TY8A 1N54B 4CDIA 1RAIB 1WOSA 2OD4A 2OFGX 5IXUA 5K20B 2FZGB 3MPWA 1V6HA 1T95A 4ANDA 2HQGA 4P7TA 1SC1B 4CLKA 2ADBA 4KYZA 4K4WA 2O01C 1MNEA 3M8PA 3F44A 2C2RA 1GH8A 1QSLA 1FO1A 2R2SA 1TVRB 1WUUA 1OQ3A 1LXNA 4DCOB 2ZWPA 4QIGA 2C42A 1WKKA 1VHIA 4EO6A 3W9HA 4O3RA 2QFIA 2B4OA 3BGFA 3GV7B 1R3NA 3HHLC 2UV8G 2ASJA 2MKCA 4WWSA 2OKQA 3MPVA 3PO4A 2CUYA 5KFQA 4CH1A 2P9CA 3W2VA 4LF7J 3DLJA 2H65B 3LUYA 4KE5A 1BQNB 3JTNA 2BQUA 1K1QA 3IN5A 2CKWA 2LYVA 2KI2A 2YNHB 1VK3A 4O3NA 1YJRA 3NP5A 1X9WA 3CJ3A 1GX6A 1MWQA 1TUWA 5THWA 4ZVFA 1B7YB 1N5YA 3KLHB 1N5TA 1S49A 4DL5A 3PACA 3T9ZA 3MEDA 3MHYA 1S72S 2VOPA 2A6MA 2EPIA 2C1EB 3LPYA 3KTQA 1VQ4S 1R27B 4B02A 1TU0B 4Z7CA 4ZP9A 4YY3J 3CW2C 2LQJA 2WVBA 3DYAB 4F7VA 4L6V3 1U6ZA 2IMWP 1EETB 4PQUA 3W3SA 2MLXA 4ERDA 4ZPBA 3JSYA 4NI2A 4Y3CA 1GT8A 1G6BA 2VPYB 4HH0A 4KJIA 4FPIA 1KLNA 1JJHA 3W2WB 3VGSA 5FDLA 5DG9A 5KFEA 2ZJPQ 1JWWA 2FHJA 1RHRB 4PABA 3W65A 3GFHA 4ELVA 5DG7A 4HL9A 1VJWA 2LU1A 4IG0B 1WC0A 4OI0A 2VPWB 3MXHP 3ILIA 4K4ZA 4KHMA 2SXLA 5ETKA 2VG6A 3LP2B 2QL5B 3PRVA 4NCAA 4ZN3A 4B3SJ 4UY8T 3NG8A 3POTB 2QSFA 3IMQJ 2HK3A 3R5JB 3Q86A 5EUHA 4ZDNA 1EQ0A 1FKAF 4DQSA 1CS4A 3WX8A 5KG4A 3QO9B 3BSAA 2QL9B 2WHOA 4LT6A 2ZOFA 1BQMA 3QYYA 3SFUA 4U8YA 1X4GA 3AH6A 4RW9B 5J2MA 1XC9A 1WELA 3AB4B 2HHVA 2UUTA 1ZA2B 1NSPA 1Q79A 4NLQA 4DR5F 3BDPA 1YBAA 2WRMA 1FX4A 1X4FA 2W7OA 1QSYA 2NYIA 1WG1A 2J8SA 3BDEA 5KFZA 1LV5A 2PGCA 3FK4A 3C19A 1KTQA 1SQFA 1YJNS 5LSRA 3SEOA 2JLGA 1Y3JA 2QE5A 4H4MB 2NXUA 3IAM9 4IG3B 2HBYB 3ULHA 3QLHA 2B43A 1AB8A 4Y2AA 2P5VA 4TVAB 2BKNA 2QG9B 5A2QU 3M05A 1H2UX 3IFEA 1JIHA 2HGNA 2DGUA 4ZVEA 1R6YA 3LGNA 5GAHU 3I96A 4LF5F 3G6ES 2BQRA 2FIUA 1M1HA 1RACB 4J5OA 5D4LA 1KFSA 4JI0J 5KG5A 5B7WA 2C3UA 3L09A 4ZCMA 3PJ9A 1IQZA 3MMJA 4PR6A 2UZAA 2VQFJ 4M5LA 1R89A 2MHEA 2B6AA 3RBEA 1VRQC 1H74A 3PNIA 3M2RA 2DJWA 2B5JB 3PY8A 4DR4J 2G0IA 3ZXWA 3A12A 2MZSA 3MCSA 3HP6A 1N33J 3OD2A 4Q5VA 1RLCL 5F8GA 3NMRA 3FRZA 3TQEA 2XSJA 4EYIB 3B4DA 4IOAQ 2VC1A 1SPBP 3HSZA 3TP2A 1HW9A 2OTJS 2CPHA 5L9NA 2O3DA 2F7VA 2W4DA 4PXCA 2J9CA 2B0GA 4EO8A 3SSSA 1S1WB 4FKYA 4L76A 2IHR1 1T7PA 4K0KJ 4XAKA 3BSNA 3CD6S 4UUXA 3QJLA 4HH1A 4CT8A 3F0NA 3S01A 4DSEA 3GR1A 1IQTA 1ZOTA 2UU9J 1KQSR 1APSA 1CLFA 3DOKB 3M8SA 3Q8YA 4A8KA 1CJKA 1UPMB 4CI0B 2CPIA 2N7CA 1XK8A 1SC3B 1S0NA 3KLFA 4OYIA 3OXGA 3CDWA 2M4MA 5HJYA 1N56A 4CTAB 4ZHRB 4OV1A 1U1RA 1SQGA 3NXZA 2L3MA 1FESA 1RTHA 3R5GA 1NJYA 1P27B 1HYSB 5KG3A 3KLVA 2PEBA 1DQ8A 3BPSP 3GV8B 2DNMA 4WP3A 2Q66A 1SB6A 4GVBB 4Y0FA 3PEHA 1X60A 2IM1A 1B7FA 2XZWA 2VICA 2UVUA 4M95A 4JI5J 4ICLB 4USJC 4C0OC 1UVLA 4EEYA 4CIOA 2IA6A 2L9WA 3ET6A 2JJ4D 5E5NA 3W64A 2CQ3A 1FNXH 1NH7A 4DG1B 3LAMA 3ONQA 2R8GA 4LSNA 2WW8A 1FT8A 2BACA 2WZ1A 3KOAA 3EZOA 4QCLA 4CLUA 3CCJS 5B0CA 3MEGA 2XLIA 4J37A 2CQDA 2ZE2B 2R9LA 4GKKF 3U27A 4WU2A 2HHSA 2PDAA 2IYGA 5AE3A 1FRKA 3B8HA 3PRBA 4Q2MA 1VR6A 2R7UA 5D77A 3SYZA 4ER8A 3QPIA 2WVFA 3HF5A 1LWEA 3KG4A 2Q3PA 2NXCA 1N5QA 3ENQA 3K57A 1LWCB 1H6KX 3GYNA 1MG7A 4XTTA 1D09B 4C2MA 2GAHC 1I6JA 1QE1B 1IVZA 1WKLA 1CG2A 5KFJA 1OY6A 4TYBA 2CZVC 3UE2A 2KTQA 3MMBB 1UFLA 3BM7A 3CVKA 2VUGA 4F0HA 3GMGA 3RZAA 3U1LA 4FN5A 2M2BA 2FZCB 3VVTA 1NK0A 4LFAJ 4PUOB 2GS8A 2XHCA 4U7CA 5JVHQ 4LFCJ 2LEBA 2NLWA 5ETSA 3L3CA 2FVRA 1C1CB 5B0AA 5T7LA 1C0TA 2Z8QA 2OPSA 1RADB 5F0WA 4F50A 3CCVS 1M1KT 4EBEA 5J2NA 2GJ2A 2A6OA 2KU7A 2JVRA 4JI7J 4ZLJA 2HWTA 3N5BA 2VPXB 4WYLA 3VALA 2MSSA 4DLGA 2LP4A 4Y2KA 3CDEA 2MKYA 1EAYC 1VLOA 4HHJA 1XERA 4KAIA 3P96A 3KNAA 5HQLA 1RAGB 4O3PA 4PG6A 3BF4A 2YWFA 1H2TZ 2IBKA 3ADAC 1L3VA 4X4SA 4IQMA 4C8KA 4LR8A 1I1GA 4GMKA 2DNLA 5HO4A 1YWXA 3OLAA 2CJ9A 2YKNB 4HHUA 1PSDA 4NE9C 5B0EA 1IJEB 2C2EA 3ELHA 3CC2S 3JYTB 3QFHA 2XMAA 2AJQA 2ZBQA 1F5CA 1S10A 4RLEA 1YJ9S 3ZZ0A 5CD4A 2F65A 2HK2A 2XGPA 2DO4A 1NJXA 4USIA 1AUSL 1W2IA 1HBMA 3D67A 1S4FA 4CLZA 5G4DA 2QIFA 3OR2A 3OTEA 3BSOA 5IV3A 4LF4F 2ZH8A 4JI8F 4MKYA 2OEJA
chains in the Genus database with same CATH topology
1R8BA 3FRYA 3QJPA 4FF2A 2WSFC 4IFVB 2DCUB 3I4PA 4WZQA 1T3NA 3GFXA 2BABA 3QJJA 4I67A 2JRSA 1SKWA 1TAQA 5KFPA 3OR1A 2LECA 4F02A 1YI2S 1HQEB 5H1SV 2EFNA 1QVFR 3MPYA 5FJ4A 3E51A 4Z37A 4IH6A 1WTBA 4IRCA 4R25A 3PX6A 1UETA 2C3PA 4IQXA 5B08A 4F2RA 2LXFA 4Y65A 4ES3A 1RKJA 2B5JA 3HKWA 3UWTA 2ZH4A 2PI4A 4K5SA 4LF6F 2KZMA 2CZ4A 1DZ5A 4TKTA 1LWFA 1RP5A 4CQ1A 4MAKA 2J9DE 3MMAA 2ABYA 4NLOA 2XULA 1N36F 3R5DA 2UXDF 5F41A 1ZPWX 5DLFA 2EVZA 3HT3A 4I0WA 4DFKA 4ZLPA 3P3DA 2VOOA 2AGQA 2UUCF 2DNOA 4ATNA 3TYTA 1YGYA 4K0KF 3NS6A 3KK3A 3OFGA 3K58A 2V2KA 3H5SA 2XB2D 4BCAA 1Q8LA 3V81A 1H7XA 1TQLA 3FQLA 4DV6F 3VWSA 2GJIA 3TAPA 3G9CA 2HNDB 2B4VA 4CO2A 4B9UA 4KBIA 1AUDA 3I5CA 4J9PA 1W25A 3E2EA 5GAGI 1MWZA 2GNKA 1RTJA 4B9VA 2QA4G 3SQGB 1HNXF 1VRUA 2MZQA 2V94A 2YKMB 4MIBA 1WHXA 3HFKA 5IS2A 1CEZA 4TU9A 4ELUA 2WBMA 3LANA 4C8NA 3MM8A 5A8KB 3QLHB 4R5PA 2KDOA 3NRBA 1U1OA 1X9MA 2PC6A 3WC2A 3T6BA 2LVWA 2VPZB 2HIQA 4PWDA 3OL8A 2HRYA 3QGPA 5L38A 3ETOA 4HDGA 2YH1A 4DSIA 3KK2A 3PV8A 2E44A 2LU2A 4X4TA 3L95X 4J9NA 3Q22A 1TUVA 4N8NA 2GO9A 2F1FA 2V0NA 3WBZA 3MM7A 5C5JA 3M9MB 2R8HA 5GVQA 4Y00A 1FDDA 3DHXA 2VD3A 2CPJA 1S1WA 5M2RA 4RNOA 1HWJA 1P6TA 4IH7A 4DSFA 1JLGB 3EZUA 5FD1A 3H5YA 4ES1A 1FTCA 3HVTB 4PG4A 3IRXB 3A8EA 1HR0F 4YDDB 3VAKA 2VONA 4NXMF 4ITSA 2RNEA 2B9WA 3N6MA 3H40A 2HWHA 3T5KA 3N01A 2P6SA 4V19X 5K9FA 5A8WB 5CZVA 1IBMF 2V9WA 3PO5A 2CQ4A 4O23A 4HVZA 2E9TA 2QA4S 1UL3A 4TQRA 4MFBB 3DXSX 3I9V9 4BBYA 3EZ5A 1VGYA 4Q8EA 5AJ3F 3OTOF 3LP0A 1FKOB 2VBXA 4Y28C 1T03A 2UVRA 3TVZA 4RNNA 2ZH7A 1TK5A 3IS9B 2IAJB 1DBDA 3HX9A 3V6KA 4YP3A 2B3TB 3DRRB 4DOZA 2GHVC 2GQCA 2VFVA 1GNKA 3DLEA 1VFJA 4DFPA 4NLWA 1QLNA 1Y5IB 2VQEF 1ZPVA 2KYZA 2ZDOA 4WFYA 1X4AA 1QAJA 2MQMA 2QZ8A 4CO0A 3B78A 3WX4A 2CIMA 3DI6B 2GHPA 3D0IE 5M2PA 4F67A 1M5PC 4WU3A 5J1PA 2E66A 1S0MA 1U47A 1S76D 4YDXA 1MU2A 1LK7A 3GSDA 3TW0A 1Q53A 2PA3A 1HHSA 4RWWA 4TLQA 3M2RB 2HMIA 3OW2R