4OL8A

Ty3 reverse transcriptase bound to dna/rna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
438
structure length
390
Chain Sequence
PVWLQQKYREIIRNDLPPPVKHDIEIKPGARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPITEKQDKAIDKLKDAPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLEYPAGELELLGIIKALHHFRYMLHGKHFTLRTNHARRVQRWLDDLATYDFTLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Ty3 reverse transcriptase complexed with an RNA-DNA hybrid shows structural and functional asymmetry.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase, hydrolase/rna/dna
total genus 82
structure length 390
sequence length 438
chains with identical sequence B, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ol8A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ol8A01
5FDLA 1RT4A 1T03A 3GIIA 2VG7B 4ED1A 3MR3A 3I0RA 1DTTB 3MTKA 4MIAA 4ED0A 5JXSA 3MEEA 5DG8A 1D1UA 1JKHA 5T14A 3V81A 3CVKA 3QIPA 4O3OA 1C0UA 1C1BB 4RW8B 1D0EA 1S6PA 3HVWA 5KFFA 4RW7A 1RT6B 3BJYA 1IKXB 4R8UA 3M9OB 4NLYA 2OPRB 1DLOB 3KK1A 1BQMB 4URGA 4ECRA 3KLHA 1XR6A 4RNOA 5C24A 4IH5A 4O44B 4O3QA 2YKNB 2JEIA 5KG4A 2E9RX 3G6VA 1SUQB 5DQGA 2D3ZA 3GILA 4LQ3A 1BQNB 4ID5B 4NLWA 4NZ0A 4ZPCA 2VG7A 3RB6A 1QUVA 5F9LA 1DTTA 4TQRA 1KHWA 4NLTA 3JYTB 3OL6A 5KFKA 1NHVA 3DDKA 3FRZA 1N6QB 4K4XA 5EUHA 4Q0BB 3PJXA 3V6DB 3KLFB 5KFUA 1S1VA 2IJFA 1R0AB 1RT6A 1IKXA 2IBKA 5EDWA 4YP3A 5J2NA 2OPRA 3PW2A 2ZKUA 1BQMA 2R2RA 4RNMA 2GIQA 4RNNA 4RW4B 4URSA 4WFZA 3OHBA 4F50A 2YKNA 1JLQA 1K1QA 2AGOA 3KHHA 1TL1B 5KG3A 1SUQA 2BQRA 2D3UA 2RF2B 4EO8A 1BQNA 4ID5A 1S1TA 1U09A 3KJVA 2D7SA 3JYTA 3M8QA 4MK7A 1C0TB 4TYAA 3UQSA 3C6TB 1N6QA 4URQU 2VA3A 3KK3B 4QPXA 3BQ2A 4Q0BA 2FLNA 1TKZB 4IR1A 1JX4A 4F4YA 3PW5A 4ECSA 5L1IA 2C28A 1FKPB 5C25B 1RA6A 4RW9A 5EWGA 2BR0A 1N5YB 1JXLA 4QW9A 1S1WB 3H5UA 1RTJB 2IAJA 2RKIB 4PWDA 1S10A 4RW4A 1REVB 2FJXA 3H5XA 1IKWA 1W25A 1RAJA 1UWBB 1LW0B 1NNDA 1TL1A 1TQLA 4LSLB 2AU0A 3EZUA 2RF2A 5KFTA 2HNZB 2FLLA 5KFMA 3IG1B 3SFGA 4RNHA 3DM2A 3BQ1A 5KFBA 3C6TA 3PW0A 4TXSA 3BGRA 4GC7A 1TKZA 4H4MB 4DL3A 3KNAA 4KSEB 5C25A 3KLEA 4TY8B 4DL7A 4KB7A 1EP4A 2W8LA 1YVFA 1N5YA 1S0MA 4FBUA 1MMLA 2W9CB 2RDJA 4KV8A 1RTJA 2IM3A 1WNEA 3TAMA 1HARA 4R5PA 3CJ2A 2DPIA 2EC0A 1SH0A 4Q45A 1MU2B 2VG5B 2CKWA 4ZPAA 3NGDA 2YNFB 4IG0B 2ZE2B 3C6UB 3DYAB 4I2QB 5C42B 4G1QB 4ED3A 1S4FA 3DMJB 1HYSA 4I2PB 4H4OB 5KFZA 3MFHA 3GIMA 3PW7A 3LAMA 5KG6A 1HQEB 4RZRA 5HROB 5L1JA 3H2LA 5J2QB 1S0NA 4WE1B 1TVRB 3KHLA 4ECUA 4IRKA 4TY8A 2ASDA 4IKAA 4QWCA 3D5MA 4O3NA 2BRKA 2WONA 3NKYA 4KFBB 5KFAA 3H98A 1LWFB 4EO6A 5KT4A 2XWYA 4FS2A 3DRSA 2VG5A 3M8PB 2AWZA 2OPPB 5KG2A 3OL7A 2YNFA 4IG0A 3C6UA 4I2QA 4WFYA 5C42A 4G1QA 3DMJA 2AX1A 4I2PA 5CYMB 2IMWP 2VA2A 2GC8A 4ECZA 1HQEA 2R8HA 1T05B 1RT5B 3HVTA 3Q8PB 1C1CB 4WE1A 1TVRA 1S49A 3KHGA 2IM0A 3NMAA 2FJWA 4JUZA 3ITHB 3QIDA 3KMSA 4QWBA 5KFNA 2JEJA 4EBEA 3DOLB 2JEFA 5L9XA 4ZHRB 3VQSA 5KFJA 3DRRB 4OL8A 4KFBA 1RTDB 4ED7A 1KLMA 3MR5A 4KHMA 4WFXA 3RB3A 1FKOB 4QW8A 3M8PA 4ICLB 5KT5A 1RYSA 4MKAA 3DLKB 2C22A 1JLCA 3EPIA 4ZVGA 2XGQA 4TLRA 1XR7A 3I0SA 4EEYA 2AGQA 3DI6B 3DRPB 3N6LA 2WRMA 2HNYA 4IFVB 4XPCA 1RT5A 1T05A 3TVKA 3MECB 1DTQB 2J6UA 4H54A 2OH2A 3ITHA 3MEGB 4YQWA 4PUOB 4U6PA 1RTHB 3PHEA 4DG1B 3RAQA 4NCGB 1S6QB 3LALA 4R0EA 2UVVA 2YNGB 1RTDA 1C2PA 3RB0A 4WYWA 3HVAA 3EPGA 5KFGA 3ISND 1QAJA 1FKOA 3BSNA 1HQUB 1JLGB 2W8KA 1OS5A 4NRUA 1S48A 3BREA 1C1BA 4RW8A 2WTFA 3GV8B 5DGAA 1ZETA 5KT7A 3GIKA 4J9MA 4IH6A 3MR2A 4EYHB 2RDIA 4B3OB 4J9RA 3FQKA 3DRPA 1DLOA 2GIRA 4IFVA 4QWDA 3DLGB 4U7CA 4K4TA 3MECA 4JV1A 3PR5B 4MK9A 1DTQA 4K50A 3NBPB 4O44A 2JC1A 4F4XA 5DG7A 3KOAA 4IG3B 1HPZB 4IDKB 1S6QA 5HLFB 1QE1B 2B5JB 2YNGA 2UUWA 2ZD1B 2HWIA 3QGHA 1S9FA 2WCXA 5EWFA 1IKYB 3E01B 4FBTA 2BANB 2UVWA 1JLGA 1VRTB 1HNIB 4KO0B 1J5OB 2R2TA 3KLIB 2HMIB 5KFYA 2C2DA 2AGPA 5EWEA 3V6DA 3KLFA 1LWEB 4K4UA 1LW2B 1R0AA 1N56A 4IRDA 1RTIB 1EETB 4B3OA 4NYZA 4RUCA 2FVPA 3QLHB 4ZPBA 3OL9A 4NLXA 3DLGA 5I42B 1XR5A 2V4QA 1VRUB 3UR0A 4KBIA 2V0NA 1FK9B 4IG3A 4NLDA 1HPZA 2IC3B 4YMEA 1QE1A 1S9EB 2B5JA 1RA7A 2ATLA 2ZD1A 3SI8A 4WYLA 4O3RA 2XCAA 3CJ5A 3N6NA 3E01A 2BANA 1C0TA 4KO0A 5F8IA 2UVUA 1J5OA 3KK3A 1JLEB 2HMIA 3M9NB 3FQLA 1T94A 3LAKA 1LWEA 5L1KA 1FKPA 1RT7B 1LW2A 2WB4A 2ASJA 1RTIA 1SH3A 4IQXA 3NAHA 4TY9A 1S1WA 3LP2B 2RKIA 3MF5A 1RT1B 1REVA 1VRUA 4Y3CA 3IS9B 1JLBB 3MEDB 4RU9A 2W9BB 1UWBA 4K4SA 1LW0A 2R8IA 4EBDA 4LSLA 4ED8A 1GX5A 5KFWA 5KT3A 4QWAA 3OSPA 2IC3A 1S9EA 3DOKB 2HNZA 3PW4A 2R8KA 3KLGB 2R8JA 4IR9A 3G86A 3IG1A 1KHVA 4LSNB 5CYQB 4ZP8A 3V4IB 4HYKA 1JLEA 2YKMB 2IJNA 4WZQA 3MR6A 4H4MA 2ASLA 4FS1A 3H4BA 2W9AA 4YR0A 3CJ0A 2W9CA 4MFBB 5KFXA 4ECXA 3IS9A 4IRCA 5K14B 3SFUA 1LWCB 1MU2A 3IGVA 3DOKA 4MIBA 1JLAB 1RT2B 2ZE2A 3LANA 3DYAA 3LP1B 3KLGA 4PQUB 4IFYB 4ZVEA 2XC9A 4J9NA 1S1UB 4LSNA 5CYQA 3LP0B 3KMQA 3OHAA 4H4OA 4O3SA 1GX6A 2YKMA 5HROA 5KG0A 5J2QA 1N4LA 4NLQA 2IA6A 4O4RA 2FVCA 4DL4A 2IM2A 4MKBA 3GIJA 1RYRA 2ILZA 1T03B 5KG5A 1RDRA 2B6AB 1TKXB 3T1AA 4DL5A 3T5HA 4NLGA 5K14A 3V6HA 3MEEB 1ZTTA 1LWFA 2WHOA 4Y2CA 1LWCA 3PR4A 2ILYA 4MH8A 5F8HA 2OPPA 1S6PB 3CDEA 4KKOB 4PQUA 5KFQA 3GV5B 4IFYA 4RW7B 4J9LA 5CYMA 4LQ9A 2FLPA 4QWEA 4R8UB 4K4ZA 3KK1B 1TKTB 4ECVA 1IKVB 2VG6B 2WOMB 1SH2A 1C1CA 4J9KA 2YNHB 3GYNA 5C5JA 3H4DA 4M94A 5L1LA 3PVXA 3RAXA 3QZ8A 4K4WA 2AQ4A 2FVSA 4MK8A 1CSJA 5I3UB 3DOLA 3GQCA 4IOBA 3FDSA 4G3IA 4YR3A 4ZHRA 3M9MB 2F8EX 1SV5B 2B6AA 1TKXA 3DRRA 3G6XA 3HKWA 5KT6A 3Q8RB 3BSOA 4O4GB 3CIZA 4ECTA 3H40A 3DLEB 4ZP6A 4ICLA 4JV0A 2FVQA 3BSAA 3KLVA 4KKOA 4XO0A 3DLKA 5KFDA 4EBCA 2FJVA 1S1VB 5D3GB 5DG9A 3NAIA 5J2NB 1N48A 3QO9B 5J2PB 3QYYA 4ZP7A 1TKTA 3DI6A 1IKVA 2OPQB 4I7FB 2VG6A 2WOMA 4NLSA 4ZVFA 2DPJA 2E9TA 3T5JA 2YNHA 4J9PA 4M95A 3OSNA 4X2BA 3PZPA 1JLQB 3MEGA 4PUOA 5I3UA 3TQ1A 1RTHA 2BQ3A 5KT2A 4DG1A 4NCGA 1T3NA 1S1TB 1SV5A 2O5DA 2R2UA 1RT3B 3IRXB 3KJVB 5HP1B 4O4GA 3PJWA 3M8QB 5KFHA 4RNFA 2J6TA 1HQUA 3DLEA 1QAIA 3T5LA 1ZTWA 2XI2A 3CDWA 2QE5A 3JSMB 5D3GA 1HMVB 3I5BA 3RBEA 4RW9B 4ZVHA 1S1XB 3OLBA 4EYIB 3QO9A 5J2PA 1TP7A 2V4RA 4KHRA 2OPQA 4I7FA 3FSIA 4NLVA 2BE2B 2IAJB 4IH7A 4PWDB 4DL6A 3ICLA 3RBDA 1IKWB 3NBPA 4NLOA 2UUTA 3G6YA 2AX0A 3OLAA 1JIHA 1JLFB 4GC6A 4ED2A 4IDKA 3Q8SB 5HLFA 2C2RA 2I5JB 1S0OA 5F9NA 1RT3A 3BSCA 3IRXA 5HP1A 4RUAA 3OL8A 2XI3A 1IKYA 4ZMMA 2XGPA 3DM2B 2BQUA 1VRTA 1HNIA 3BGRB 3KLIA 2JC0A 5KFRA 5F8GA 2IM1A 3JSMA 1I6JA 1HMVA 3KLEB 1EP4B 1S1XA 4K4YA 2YNIB 1EETA 4RW6B 5KFCA 2D41A 3QLHA 4KV8B 2BE2A 5I42A 4WZMA 3TAMB 3D28A 1S97A 4R5PB 5DLGA 3UDLA 1FK9A 4DL2A 1JLFA 1TV6B 3UPFA 3E51A 2I5JA 1NHUA 3BR9A 1Z4UA 5KFIA 2I1RA 3H5SA 1HYSB 2C2EA 4KE5A 3T19A 3QZ7A 4ED6A 3CDUA 4Y2AA 5JUMA 4TQSA 2XCPA 4ECYA 3BQ0A 4ZP9A 1HNVB 2HWHA 5F8LA 3RB4A 3FFIB 4TYBA 2HAIA 1RT7A 3CO9A 2YNIA 2E9ZA 5KFOA 4RW6A 3IGNA 4KAIA 4TN2A 5KFEA 2ALZA 2WONB 4K4VA 4XPEA 3LP2A 5HBMB 2W7OA 2UVRA 4ECQA 1RT1A 5J2MB 1S9GB 1JLBA 3MEDA 3N6MA 3MFIA 2W9BA 2OPSB 3DRSB 3KHRA 4WXWA 2B43A 1TV6A 4F4WA 5KFLA 3CJ3A 3IN5A 4JV2A 2W7PA 2JLEA 1K1SA 3H5YA 2WK4A 3V4IA 3CWJA 3KK2B 2R8GA 3I5CA 2HNDB 5J1EB 3HVTB 4Q8EA 4F4ZA 1HNVA 3T5KA 3FFIA 5KFSA 1TL3B 5DLFA 2R2SA 2QV6A 5KFVA 1IM4A 5DQHA 5FDLB 2JEGA 4DEZA 1RT4B 4J9QA 4Q44A 3GV7B 4J9OA 4O3PA 5F8JA 4MFBA 5HBMA 4NLPA 5KG7A 4YR2A 1KLMB 3I0RB 5J2MA 4HKQA 3NL0A 2FVRA 1S9GA 3ISNC 4Y34A 2V9WA 5DQIA 2OPSA 4Q43A 2CJQA 1JKHB 3QGIA 3V81B 3QIPB 5DGBA 1C0UB 3V6KA 1JLAA 1RT2A 2BRLA 4ZPDA 5KG1A 3LP1A 4WXOA 1JLCB 4ECWA 1S1UA 3LP0A 3I0SB 4J9SA 3HHKA 3KK2A 4NLUA 4NLRA 5F8MA 3V6JA 4NRTA 4Q8FA 3Q8QB 2HNDA 2HNYB 5J1EA 3I5AA 3QGGA 2J6SA 5F8NA 3KLHB 3CJ4A 5C24B 1TL3A 3H59A 5KFPA
chains in the Genus database with same CATH superfamily
2GAHC 2MQNA 3MMAA 3OR2A 1NB7A 2WVCA 1D1UA 1IKXB 1BQMB 2AW0A 2H9ZA 4DCPB 2ZNZA 3SCJE 2G1HA 3BR8A 3OVAA 1X9MA 3GJTB 1RHMB 1NHVA 1G2EA 3SIPB 1SL2A 2IBKA 2EKYA 2LQ9A 5DM7Q 2ASYA 3RUBL 4FKXA 2HVIA 3SV4A 1BQNA 4ID5A 4M5MA 3MPVA 5GVQA 3AD9C 2N4DA 2HK2A 1KQFB 1JX4A 4BWJA 3GG0A 1S1WB 3R5DA 1PJ5A 1QAXA 2IMOA 1MWZA 1YGYA 5KFBA 3C19A 1N5YA 1S0MA 1MSWD 3DLJA 1OYDA 4IG0B 2HHHJ 4ES1A 3AOCA 4NXMF 2J7KA 3DLBA 3MM9A 5FD1A 5LMNF 4IRKA 4IKAA 2YY3A 3ZC4A 3U27A 3DKDA 2Z2LA 4NWBA 4OZJA 4IO1A 2JH3A 4I2QA 4G1QA 2BJEA 2AX1A 2J9CA 1RAGB 2X1BA 2F8HA 2IM0A 4FYDA 4ZLPA 2R7WA 3VGUA 2C3OA 5A8RA 4DV7J 4QCLA 5LSOA 1KFDA 3MAHA 3MM6A 4OYBA 2FZGB 4WFBQ 1S59A 2OH2A 3TA1A 3LA0A 2YNGB 3BSNA 2YKAA 2QLWA 5B0FA 1Y10A 2W8KA 4N47A 4E2FB 3GV8B 5LM7E 3Q8VA 1WG5A 1RU1A 3SMZA 3FQKA 1VBZA 1PC5A 4K50A 1DQAA 4CTAB 2M5YA 5DG7A 3ILIA 2ZD1B 3WX8A 1N32J 3TZYA 1VJWA 2LXIA 1FDNA 4PYDA 1LXNA 5HQMA 1R31A 5D4PA 3CCWA 4IG3A 1S9EB 2PI4A 4PKDB 3M1VA 2QZ8A 4C6AA 1T94A 2DTJA 1R8CA 5HK4A 3NAHA 1VRUA 2EWHA 2FHJA 4DUYJ 1KHVA 4NMXA 3V4IB 3S8SA 4YFUA 3FSXA 5E7OB 3TNVA 1XMOF 1A6LA 1FJCA 3NCRA 5CD4A 4IRCA 2R7QA 4JBCA 1WKLA 1YRUA 2KJWA 2A3JA 3KMQA 4H4OA 2YKPA 5B0EA 4X62J 4NLQA 2I0XA 2KTQA 5AXMA 1FEEA 2FHMA 1X9SA 1GMWA 4ZA1A 2DR8A 1W2BR 4RW7B 3PHTA 1JXEA 1CSJA 3Q22A 1SV5B 2CZ4A 1UL3A 4FYVB 2XMWA 2PT0A 4FYXB 2DPJA 1UA0A 3PZPA 3RGIA 1NKCA 2GJIA 1D8YA 2BQ3A 2ZH7A 1HW8A 4RNFA 3L9ZA 1I94F 3OT9A 3DLEA 4DX6A 4J91A 3O44A 3KDNA 3THTA 1J27A 2V4RA 4I7FA 3UNGC 2CG4A 1CULA 1S0OA 3Q8SB 2I5JB 1HNXJ 4C11A 3BSCA 1VCTA 5KFRA 1HMVA 2EBGA 1ZOTA 2P6TA 2HHHF 1BQXA 1SQEA 4YS2A 5I42A 3AFGA 1MG7A 5H9FJ 1FESA 1CBKA 2I1RA 1M5OC 4HR2A 2DHHA 2IIHA 2LDIA 3QRQA 1L3TA 5KFOA 3IGNA 2ZHAA 2CJYB 5AT1B 1RI7A 1K1SA 3H5YA 3CWJA 2R8GA 3W5ZA 2R7OA 3HVTB 4C2MA 4USVA 5KFSA 1F5CA 2R2SA 4DV7F 4HI2A 4U7UD 2K2PA 2OPSA 2DNKA 4LFBJ 1IR0A 1HA1A 1S1UA 2GV1A 3QGGA 2J6SA 3I5AA 3NNHA 1AFJA 3K8WA 2F7VA 3C14A 4A8YA 1OY8A 3W2WA 5CA5A 2B7BB 4L75A 3KJFB 3VAKA 3NCQA 2LECA 3P49B 5KFFA 5ETOA 2CQHA 3BJYA 1LEOA 3M9OB 1DLOB 1H38A 4O44B 1N32F 2GAGC 1CJUB 2OAUA 3H2VE 1G7CB 3ZZZA 3V6DB 1S1VA 1RLCL 5J2NA 3MAQA 2CRLA 1NH8A 5CD4H 1NBEB 2MQMA 1TL1B 2FJBB 5FIIA 1GAOA 1S1TA 4Z7CA 3MR7A 4GO7X 3EVWA 4KRWA 5AE1A 1UTAA 4Y28C 4B3TJ 4X4VA 4J9UE 3ZTPA 2XYGB 2DNPA 4YUDA 4GC7A 4L74A 1URRA 3N0VA 2W8LA 2MTLA 3BDEA 2W9CB 4CO1A 4G6VB 3CJ2A 1RGVA 2CKWA 4X62F 3WX4A 2UV8A 4PZVA 3GIMA 1N34J 5KG6A 1XEZA 2AMCB 1F3VA 3DDIA 1DRZA 4KH0B 4CO3A 1LWFB 2M52A 4FF2A 1FXRA 1EARA 1T95A 5K9FA 1L3VA 1NHKL 2BDPA 4OL8A 1YQHA 2HIYA 1CS4B 5KT5A 1LK5A 3P8BB 5FLXU 2VIHA 4TLRA 1XR7A 4IFVB 4DSEA 4WWSA 3AJ2A 1PG5B 4OX9F 3SV3A 1Q86T 5IV3A 4U6PA 2DEJA 2DXFA 2PEHA 1FKOA 4NRUA 1TZ0A 1RWXB 2GW8A 1HNXF 4OZNA 1DTQA 2D1CA 1VQSA 2D9OA 5FLXY 1QE1B 1R3NA 3CEDA 2PEBA 3AA8A 3E01B 4M5NA 1HNIB 2R2TA 3H20A 1R0CB 1W7WA 4DHVA 4ED5A 2PMHA 2GNKA 2UZAA 4YMEA 3MMBA 2LA6A 3DFEA 4C8MA 3TVZA 2VH7A 3SI8A 4KO0A 1J5OA 3KK3A 2QLFB 2W2QP 1LW2A 3LWMA 4WKYA 3R1HA 3MF5A 1RT1B 3IBWA 1F1BB 1NK0A 4QWAA 3KYLA 2PA3A 4TU8A 4FNIA 3IM9A 3ETOA 1T9YA 3CCMS 2V4JB 4I69A 2N3OA 1Y9OA 4YR0A 4M1KA 4LFBF 2OLWA 4LF2A 1N33J 3NS7B 3BBCA 4FPRA 2KZZA 1LWCB 4ZVEA 4DJBA 4IFYB 2VPZB 2KRRA 1RTZA 2EBEA 2XG8A 4ZJOA 4MKBA 3I56S 5KG5A 4ZKAA 3MMAB 4P7VA 1WC5A 3CDEA 2MGZA 1VQNS 1Y7PA 4F3OA 3TUZC 5CYMA 2CPJA 1K0VA 3SCIE 2AD9A 3RR7A 3H4DA 4M5KA 3K2YA 3G6ES 3Q8RB 3G71S 6FD1A 1WACA 2MQPA 2QT7A 1W26A 3PXGa 1QVFR 5GADI 2OPQB 2E9TA 1AZSA 3GR0A 1PBUA 1BWVA 5KT2A 5KOXA 1QAIA 2QE5A 4B3TF 3OR1A 3TRGA 2CNOB 4ZVQB 3CCZA 3A3NB 1VFJA 3MPUB 1SJ4P 2AX0A 4KGZB 2K1RB 4NA3A 4DR2J 2C2RA 4ZK7M 4E98A 5HP1A 2XI3A 2XGPA 4YB7A 1EJ7L 4LSZB 5J1NA 3JSMA 3H90A 4LF7F 2D41A 5E5NA 3QLHA 2BE2A 2G1DA 1N34F 1ZAVA 5IZHA 3UPFA 1VIXA 3R2CJ 5EHHA 3QZ7A 3IAM9 1G3OA 3NS5A 3EICA 2ZUGA 3U1MA 1DARA 4RBUA 2FD2A 1TV6A 5BXIA 3TOQA 3WDOA 3X3UA 1CLFA 1IM4A 1U48A 4KHPJ 5HBMA 5HATA 1S9GA 4WU2A 5A8RB 2HGMA 3LP0A 1Q81T 3QWUA 2E7VA 2R8KA 3FZBA 1RT4A 1DTTB 1ZM4A 2E5JA 2I2YA 3CF5Q 2GFFA 2EKNA 5THWA 3PIPQ 2W24A 2JEIA 3QWPA 1NK7A 3JAMU 5E2QA 1CJVB 3PACA 5F9LA 4TQRA 3JYTB 3A8IA 2UUCJ 1IVZA 4Q0BB 1BWEA 3H2UB 1R89A 2GIQA 1Q7LB 1KVJA 3TA2A 2ZOGA 3SSSA 2YKNA 5BYSA 2HYIB 4UY8T 4MK7A 2QLJB 4ETZA 4QPXA 3P5BP 2ZZTA 3JAMY 1YG0A 2BR0A 2EPIA 2O01C 1JXLA 2DIUA 3Q83A 1CVJA 1NSAA 2ZFHA 2E44A 2E5IA 3PW0A 5HQ8A 1EP4A 3JSBA 4I67A 4HHJA 5DM6Q 3TAMA 2JFKA 1IWGA 4ZPAA 2ROGA 4GKKJ 4H4OB 2R4FA 2XZWA 2R7XA 3VTIA 4C3MA 2DNNA 4O3NA 4NZ7A 1OSCA 4CT8A 1U7LA 3GONA 3KJNB 2QX0A 1WDTA 1RT5B 1UZHA 1TVRA 1RQ0A 2DRBA 2FC8A 5T41A 2MZRA 4HHHA 4EBEA 5HVFA 2JEFA 3HHNB 2K8GA 4I0WA 4J37A 3EZOA 2EFVA 4F67A 2R7RA 2WRMA 4WP3A 3MECB 4HH0A 2M0GB 1WWHA 2HG4A 1XTZA 3UW1A 2G4BA 4DR2F 2V8GA 3KWMA 2OEJA 4DPXA 4LRBA 3QBCA 1EQMA 1S6QA 2UUWA 4C11B 2LXUA 2CG8A 2L9WA 2L9DA 1N56A 1X5TA 4K0KJ 5I42B 1XR5A 2LCWA 2ZZMA 2FGCA 2E1RA 2HMIA 1U47A 2QGFB 1HBOA 1MROB 3BN4A 2DYAA 4EBDA 2IYIA 5KT3A 2IC3A 3G8TA 4KR0B 2VPYB 4LSNB 4U8VA 4KHPF 2F4FA 3MPYA 4FS1A 1TTHB 5KFXA 4ECXA 2VB6A 4Y6IA 1O0PA 1S1UB 5CYQA 1EKRA 4AXIA 4HDHA 1GMUA 3BB5A 1NDPA 4O4RA 3C14B 1UFLA 2IM2A 3GIJA 3MPWA 3VAGA 3R3TA 1JJHA 4Y2CA 1UEKA 4PQUA 3OVSA 1Y5IB 4BC7A 2ZH1A 3PYFA 5A2QU 4QWEA 2FJAB 1UVIA 3UDCA 2UUCF 3PDNA 3TUIC 1TKXA 1HI1A 4OIXA 5KT6A 2J7UA 2B0GA 3H40A 4RJVA 1S1VB 5J2NB 4USKA 3PX0A 2GVDA 1KR4A 3QYYA 1FXDA 2X1FA 1PBAA 2HQIA 2VOOA 1U26A 1S1TB 5A2QY 1RT3B 2VDHA 1V3SA 1S99A 2W4DA 4IQMA 1KTQA 4LR7A 5A8KB 3D0GE 4PG8A 3P5TL 2RT3A 4F0HA 4UY85 2PE8A 1HFEL 3CJRA 4IDKA 2BQUA 1Z2LA 4U7UK 2H5JB 5K5MA 1S1XA 3NXZA 1YITS 4GKKF 1VHFA 3C15B 3PNIA 1FK9A 4QYZJ 4HI1A 4M5JA 2V2VA 2XCPA 1KFSA 1Q8LA 2D74B 5KFEA 4K4VA 2OIHA 3FRYA 5KFLA 5D6GA 2CWKA 2KM8C 5J1EB 4IUFA 2L9NA 2MJUA 4F4ZA 3FFIA 2IBOA 2H54B 4WIIA 1JB0C 4F3QA 4NLPA 2UP1A 3NL0A 3EM1A 3V81B 2OEMA 4ZPDA 2XO6A 1FD2A 2XEXA 1OSDA 3HHKA 1QAYA 2VICA 2APOA 1NJXA 4ZJLA 3QFHA 2VG7B 3TUPA 1N5VA 3I0RA 3QJLA 2GVZA 2XLJA 3MEEA 3KG0A 3CD0A 1WORA 1V6HA 1NSQA 5IOLA 4CO0A 1RJJA 3N4WA 4ECRA 1XR6A 4RNOA 5HMYA 3I87A 3G6VA 1SUQB 1B0TA 4K0KF 3ZTRA 1YJRA 4P7TA 2KFZA 5EDWA 2AIRB 4WFZA 2A10A 2RF2B 1U09A 2HAFA 1SKUB 3UQSA 3KK3B 1DURA 4F4YA 2NUUG 4Y00A 1WSRA 2HVHA 4CO4A 1IKWA 5L8RC 1VQ5S 2W2PP 1NU4A 3K89A 4USHA 2FLLA 2FHKA 4X84A 5GAEI 4P2SA 3BGRA 4DL3A 1GXLA 4UF4A 3SQGB 1PCAA 1OQ3A 2MKKA 2YQ1A 2HQGA 2YNFB 2BACA 2IRXA 4OI1A 1S4FA 1VJQA 3ZO7A 1HQEB 2CQ0A 4I6YA 1T02A 1MW7A 3CO0P 2G2ZA 3NKYA 5KFAA 4EO6A 2AWZA 3C6UA 1ZAXA 5C42A 2BX6A 3DMJA 5CYMB 2RVJA 2R8HA 2V5HG 4WE1A 2MB0B 2OO4A 4DSFA 4E0DA 1TL4A 1RTDB 4L73A 5F3ZA 4QW8A 5ETPA 3VGTA 5T7LA 1NPPA 4ZVGA 2XGQA 4NL5A 3DRPB 4CWBA 1RAIB 4DSKA 1AZSB 2XULA 2FJDB 4DR5J 1K73T 2D69A 5HL7Q 4WYWA 1P9QC 1QAJA 1B0PA 2M4MA 3BDPA 2G2OA 4DCJB 4CNZA 1TAUA 2EG2A 3GSIA 2LU1A 1NEEA 1XK8A 1GTHA 2UVWA 2M7SA 3F73A 4NEYA 1KONA 3TX0A 3QLHB 1RXOB 4LRCA 3NNAA 4NLDA 5IC4B 2KKHA 1RA7A 2B5JA 2PA8D 2E7XA 3N6NA 1RCXB 1M1GA 3IAS9 4QR0A 4K2XA 4DPOA 1YJ7A 1KRPA 2RKIA 3IS9B 4AYBD 1UWBA 1UMJA 1MNEA 3I4PA 3OSPA 4WIQA 1YBAA 5HI7A 3D54A 4QIGA 2MDAA 3CJ0A 3NGSA 1X4GA 1NUEA 2AT1B 1IR1A 2O67A 2RD5C 5A0YB 1TUWA 2OMOA 4ILMA 2ZBIA 2NQPA 3LP0B 5KG0A 1SCJB 2XZTB 4DL4A 5A8WA 3ENVA 4W92B 1RWPB 1WG1A 4MAKA 1NSPA 2H4WB 2ILYA 2OD4A 4Y2MA 2UXCF 4M5IA 2YX1A 1U6BA 2RSQA 2AYBA 3GYNA 3K5OA 5C5JA 3FNNA 3GQCA 3JS9A 3FZ2A 3DRRA 4K8RA 2JX2A 1SB6A 5DG9A 1VISA 1IKVA 1QTMA 4X2BA 3MEGA 3T9NA 3C16A 1NSKL 1T3NA 1M5SA 1HNZJ 3PJWA 3ETMA 3CDWA 1N0VC 2RQCA 4ZVHA 3ZTOA 3FSIA 3P96A 2MPUA 5E3QA 4NLOA 4JP8A 2DHSA 2DNHA 4JI5J 4YY3J 1EP4B 1YSJA 3TAMB 1K44A 1U4BA 3Q2TC 2NUHA 3H5SA 1L3KA 3N9UC 3SYZA 4ECYA 1H2VZ 4K5RA 5F8LA 1TR0A 2HAIA 1WEZA 2OSRA 4O0NA 2MSTA 4XPEA 2Q43A 1DQ8A 1FERA 4F8RA 3HSGA 2Z30B 2HNDB 2QL9B 3V5RA 2VL1A 2JEGA 2RU9A 3MDFA 5J2MA 2FVRA 2ZJPQ 1JKHB 1Z2ZA 1C0UB 2QIFA 5DJBA 4C8OA 4ECWA 5EX3A 4DR5F 4M63A 3CJ4A 2ZHOA 3I82A 5KFPA 3SZ2A 3W1YC 2V8PA 3WHIA 4OLOA 3D1HA 1U8WA 2R3VA 4ED0A 1YJTA 4N56A 1S6PA 2OP5A 3SEOA 3W65A 2AHOB 1NDLA 4P72A 1R6VA 4NZ0A 3S1TA 3UCUP 3DDKA 1N6QB 2R9LA 2ZKUA 2GQQA 2R2RA 2DHGA 5LSLA 1NLKL 3EX7B 1B70B 1XMBA 3MEKA 1WTBA 3KJVA 4LVOP 4B9MA 3CMQA 4F04B 4P75A 5L1IA 1FJGJ 1HBOB 4ETXA 4LIWA 2IAJA 4AE5A 3M6XA 5B0GA 1HNWJ 3KG4A 3HM9A 4TXSA 3K5PA 5C25A 1H72C 3CMAS 4FBUA 4QIEA 4CDIA 1RTJA 4LFCJ 1WNEA 2G0JA 5G0RA 3W60A 2XMKA 2FIUA 3DNCA 2N3LA 4TY8A 2BJ3A 3MUVP 4PYAA 1KNZA 1EAYC 1U0SA 4JV5F 2I6WA 2DNZA 3CJKA 4JOUA 5MLCV 3DRSA 2VG5A 2OGUA 1BXNA 2U1AA 4I2PA 2VA2A 2FY1A 3KHGA 3NMAA 5KFNA 4Q7AA 3HHLB 1M1HA 4KFBA 2HVDA 2OSQA 3M8PA 3BKTA 5IQ6A 2F1FA 4WJBA 3IWLA 2GVDB 3NG8A 2AGQA 3TVKA 1HNZF 1A9NB 3M8SA 2P5VA 2Z4PA 1TK5A 3O3LA 3M8YA 1N8RT 2YPYA 4R0EA 5DDQC 4CZCA 2AYEA 7AT1B 4DV1J 5DGAA 2Q6BA 1XNRJ 1ICEB 2H51B 4LFAJ 2F4VF 4JI5F 4YY3F 5CCLA 4IDKB 1WD6A 1N5TA 1GFWB 5EN1A 2C2DA 1H2UX 2B9YA 2VU5A 1R0AA 2MKCA 1VLOA 2MKJA 4B3OA 3MM8B 3OL9A 4NLXA 4XIUA 1S0VA 2IY5B 4RKUC 4USIA 1I5OB 1IQTA 1FK9B 4LBPA 2MLXA 4L72B 4WFNQ 5L1KA 2K7KA 1SH3A 1GXTA 4PG6A 4A8MP 4M5GA 4NCAA 2R8IA 5H9FK 2C42A 3PW4A 4FN5A 2R8JA 1RBAA 4HYKA 2HZCA 2WAQD 2KVIA 2YH1A 4V19J 4QIFA 1MMNA 3Q89A 1OJ4A 2HRYA 1R8PA 2H65B 3IGVA 4RUBA 1OY6A 2CYYA 1PAUB 2ROEA 2YKMA 5HROA 3RRHA 3DN9A 2ACMA 4XDCA 2A6OA 3T5HA 3IM8A 3MEEB 2WHOA 3OTOJ 2DGUA 2FLPA 4LQ9A 5K8MA 5LMUJ 3OUYB 4OX8A 2YNHB 3EVOA 2AJ4A 2FB0A 3EZ5A 1M5KC 4YR3A 3M9MB 2ZBCA 3A8EA 4ZP6A 4JV0A 4KKOA 4XO0A 2GGPA 3ZXWA 5IC6B 3MOZA 2MEWA 2KG0A 2LKZA 2R2UA 3Q8UA 1X4CA 2PGCA 1P1LA 4KHRA 1QDUB 1IKWB 3HP6A 5L38A 1ZH5A 3W5YA 3M2VB 1NH7A 3BGRB 1BGXT 4DR6J 3M32B 1F9FA 3OXGA 4DV6J 3FKBA 2V50A 2UXBJ 7FD1A 2CDRB 2HFUA 2DNLA 2L3MA 2JOQA 4ZITA 3HCXA 2NR0A 3CSKA 3BS9A 2L48A 4LRDA 3R7NB 4TYBA 3TI0A 2E9ZA 2CPFA 3MEDA 1YTYA 2AJ2A 3LGMA 1P9YA 3IN5A 1NJYA 1NK4A 2V94A 1HNVA 1RP5A 1TL3B 3VAJA 4CQ1A 2CPHA 2X1AA 5ETNA 1N36J 2RRAA 2AJQA 4DFJA 4Q43A 4OHWA 3QGIA 5DGBA 1NMEB 2DGWA 4AQYF 3AHPA 4J9SA 5F8MA 4A8FA 3ENWA 2DNMA 5C24B 1TL5A 4DV1F 2EG1A 4LVNP 2HVEA 3GIIA 3VCDA 4ED1A 2Q79A 1Q53A 5IWAJ 1XNRF 2OTJS 4LFAF 1FD8A 1CG2A 1BC6A 3TAQA 2IA0A 2YBVA 1YJWS 4NLTA 4K4XA 1TU0B 2XS5A 2XHWA 1IKXA 3ZTQA 1BQMA 3MZIA 4F50A 1JLQA 1K1QA 5CABA 4RX6A 1FVSA 3CW2C 4A8WA 3D6FB 1ZYQA 4URQU 2VA3A 2QRRA 1AW0A 3CJTA 3N79A 2XBPA 1LFWA 1JJ4A 2BJ9A 2GMJA 7FDRA 2RKIB 3NLCA 4ZVSB 1UWBB 3LO3A 2UV8G 3EZUA 4DXLA 1MN9A 1FE4A 5DZ7A 4ZN3A 1N5SA 2G0IA 4U9RA 2HLTA 3CXCR 3R5GA 5KAKA 2BKOA 2QFIA 3BN7A 5F0UA 4TU9A 4ED4A 4K7QA 2UXDJ 3PFEA 3PW7A 3LAMA 4EZ6A 4OJHA 3OTOF 3DGPA 5A8WB 2LQJA 1FVQA 5LMUF 2YWEA 1JJ2R 3QJJA 4IG0A 3Q23A 2Z56B 3PEHA 5L9XA 2H4YB 3DRRB 3NCPA 4KHMA 2EK1A 4C0BA 2ZH6A 1SJQA 2FY8A 2LQ8A 2YWHA 4JI0J 2QYCA 3MEGB 1JK9B 2DY1A 1FI4A 3C16B 3LALA 1Q8IA 2UUBJ 2W7AA 1LWXA 4H4KA 5M2RA 2RAQA 5LJ3Y 4ERDA 4J9MA 4IH6A 4FF1A 2NXJA 4QWDA 3DLGB 3PR5B 2O3DA 1DQ9A 2CQ1A 1HPZB 3KDOA 2YNGA 4DV6F 1QSSA 2GHWA 2UXBF 1SC3B 1LWEB 2J0WA 4ILLA 3CCVS 2ZOMA 3O6QA 3G96A 1ZPVA 4YEAA 4CTAA 1VI7A 4Z37A 2DEIA 2ZD1A 4O3RA 1O8BA 5ETSA 2HFNA 1VMBA 4B08A 1ZM2A 1YDLA 1RLDA 1HHSA 4DQIA 1M5VC 2YTCA 2AEFA 3FEXB 1S9EA 4DV0J 4IR9A 2Q66A 2MSSA 4NA1A 2AYGA 1N36F 3R8YA 2ASLA 2FGOA 1T7PA 2J5AA 2OUGA 2C2MB 5M2PA 2WVFA 2KM8B 5DRKA 5B0CA 3ZFVA 3CCSS 1V3ZA 4J9NA 4F26A 3T41A 1GX6A 1B7FA 4JI6F 1IBLJ 1OYEA 5IWAF 3B4MA 1HLWA 4UUXA 3PR4A 1S6PB 3R2DJ 2LMIA 4ECVA 1NXIA 4ZLJA 4NYOA 4PCQA 3BSOA 4ECTA 2V8DA 2C2KB 1NJWA 2FVQA 1RWNB 5D3GB 3J7YU 5IM0B 1RB0A 2QL5B 5AJ3F 3OXFA 1P27B 1Y00A 3OSNA 3TQ1A 4UZBA 1SV5A 3KJVB 1YK9A 3RBEA 3BBFA 4EGLA 2IAJB 1WOPA 4HACA 5GMDA 4RBTA 2NXUA 3R7SB 1PC4A 1ULRA 3JQKA 4WK1A 4ED2A 3OFHA 3HT3A 1NJIT 3EXYA 3GCXP 4L3NA 4PEOA 2UXDF 3D28A 4PPDA 1WUUA 2YWKA 4DPUA 5HVGA 2I5JA 1NHUA 2F65A 4MIWA 2OFGX 3T19A 3TA0A 2W4CA 5H9EJ 4ES2A 4TN2A 3LP2A 2W7OA 2VFVA 3DRSB 2ZDPA 3M8ZA 2V2QA 4B3SJ 5G4DA 4HTJA 5F3TA 4QIWD 4J9QA 1LKZA 4K4UA 4WP9A 1X4FA 4HKQA 4DU8A 1B99A 1CJKA 4JI0F 1RACB 2LU2A 2QLBB 1X4HA 2H1YA 4Q8FA 2GJ2A 1FKAF 3FGVA 5U47A 1U1KA 2GJFA 2YQ3A 2RS8A 4JI8J 1CEZA 5D8HB 4URGA 3T1HJ 5D0RA 1VRQC 4O3QA 3FC9A 4UOFA 3RB6A 3FRZA 3T3FA 1Q82T 1R0AB 4C4WA 2J8SA 2YXLA 1FJEB 2FTRA 5E3PA 5K8OA 2BQRA 2GO8A 3F41A 4EO8A 1FWKA 2XMUA 1IWAA 1IJFB 2U2FA 1RA6A 3VAMA 4DV0F 2ABYA 1CJTB 1FDBA 2ZNYA 1W25A 2LDYA 5ETTA 1TL1A 3CCLS 2ZC3A 4HEA9 5IV4A 2P8IA 2XS7A 4KB7A 1YKWA 3HSZA 1KWMA 2JJ4D 1G6BA 3NEKA 4ZLLA 3C3LA 3T1YF 5KFZA 2A6MA 1UCNA 4QYRA 5HROB 2VODA 2ZWOA 3D7SB 4ALZA 1TUVA 3ZTSA 2LEAA 1SKWA 2RH3A 4OMFG 1WC6A 3C8YA 3ITHB 2JEJA 4QWBA 3G8QA 2AYMA 3HK2A 2XYPB 4TLQA 1I1GA 4WFXA 1FFGB 1D9FA 3CJQA 4CIOA 2F3JA 4LUBA 4OJGA 2QA4G 2CQ2A 4AFFA 2HNYA 4RL1A 1Y5LB 4X4SA 4QJVA 3PHEA 1UVLA 5KFGA 2AF6A 3X1LB 1CS4A 1OS5A 3G82B 4C7QA 3FBEA 1C1BA 3TEGA 1EKSA 3MTJA 3CJSA 1YZ7A 4IFVA 1WC0A 3K0JA 3OJUA 3QGHA 2BANB 1X5OA 3H42A 3OTBA 2HW3A 5I4MA 3BYRA 3KLFA 4XK8C 3MCMA 2I9SA 1AFIA 1WKKA 1LOUA 1JMTA 3G9CA 1TMJA 1HL6A 1QE1A 4DUTA 3ZNJ1 4P2MA 3E01A 5F8IA 4NPOA 2Z2ZA 5KTQA 2VC0A 5EGYA 4IQXA 4X65J 2YWFA 4TY9A 3Q2SC 3JTPA 1VC0A 5C2CA 3MEDB 3LWLA 3AB4B 2BJ1A 3GIRA 2PDAA 3VZHA 3LW5C 2DK2A 2PMZD 3IG1A 2BZ2A 3E8OA 1N54B 2DNYA 1UVJA 1CQMA 4DL0C 5CYJA 4K59A 2R7SA 5J1PA 2BXJA 2DRDA 1U2RA 2V6AA 3TW0A 1U0HB 3KNGA 6FDRA 8AT1B 4JI8F 3NP5A 4DFKA 2ZBQA 4AL7A 4NLGA 3T1HF 1LWCA 4IFYA 1UEUA 5SZTA 1TKTB 2WOMB 2CQBA 4MYUA 1T9XA 2AQ4A 4OI3A 5I3UB 3RW7A 2MKIA 3D9BA 3BSAA 4PWUA 3NAIA 3W9JA 1V5IB 2VV5A 4ELTA 1JLQB 5HMZA 5LSRA 1HI8A 4Q2MA 4ITSA 3HT0A 3R5BA 2MKYA 3BEGB 2OPQA 3TJ9A 4IH7A 4RBVA 1UPPA 1JLFB 2BVZA 5DETA 2ZH2A 5F9NA 4DX5A 2E5LF 4OYOA 2YNIB 4RW6B 1I94J 3VGVA 4F4AA 1AROP 1QVGR 2E7WA 2K1RA 4KY3A 3E51A 2V69A 2YX4A 4Y2AA 3L7OA 4J9VA 2JVRA 2V2ZA 3DGPB 2MKSA 4QPTA 2AJ1A 2GQ2A 3A4TA 1X4DA 2QG9B 2FYXA 1UPMB 3CJ3A 2DGTA 1K8AT 3NY0A 2MQQA 2W01A 1AUDA 4UOCA 2QSFA 5HQLA 2NZ4A 2V9WA 2GS8A 1JLAA 5D0GA 1URNA 5DS7A 4DQPA 3CUNA 3Q8QB 2JLFA 3KLHB 2KN4A 3OPKA 1UKUA 1RWWB 1KSPA 3RRGA 3I96A 2PC6A 4J90A 2HBZB 1VQMS 2CZVC 2KDOA 5DQGA 3SDEB 4ZLNA 1DTTA 4DZ6A 4JYAJ 1ZBTA 2CPIA 5IQQA 3O5TB 1X5SA 1RU2A 4OQJA 4PXDA 2NYIA 2ACYA 2D3UA 1Q95G 4DV5J 1CJVA 3GE9A 1VQPS 2EFOA 2D7SA 3JYTA 4X65F 3HO1A 4Q0BA 3NGKA 4W4MA 3UFCX 2R42A 4BHQA 2QEXS 3S01A 3FUYA 3A12A 4LF9J 5LXYA 3HSDA 2A0FB 3PCOB 4DX7A 3HFVA 3A13A 5E33A 2FZCB 2POKA 2HBYB 1Q5YA 2ATCB 3MUTP 2DGQA 3RRKA 1PILA 5L1JA 3KUEA 3KHLA 3I9V9 5A6WA 3QRPA 2VQEJ 4UOGA 1VBXA 2XWYA 2E1CA 2HK3A 2B4UA 3EGVA 3LGHA 3OJSA 1XMQJ 3ISZA 3MMCA 2Y8YA 2ZEJA 2CJBA 1KLMA 4OYWA 1JWWA 1NDCA 2HRUA 4MKAA 3KKFA 4DCOB 3I0SA 4U96A 3N6LA 1HKAA 1RT5A 2FUG9 4F2SA 1C2PA 4MYTA 3RB0A 4L3KA 2XHCA 1GEHA 4KPYA 3PYDA 1NPRA 1YHQS 1R27B 2CQDA 3FMBA 2GIRA 3MECA 4HACB 3NGTA 2XO7A 4MKYA 4KC5A 4OX9J 2AGPA 4DR3J 1UWAA 5E0OA 4IRDA 2FZKB 3AQPA 4OHVA 4OYAA 4DQRA 1CPZA 4X4TA 3J80U 4DR1F 1BD6A 2WB4A 3LP2B 5BJRA 2C3MA 2RQKA 3R97A 2GQCA 3KLGB 3MR6A 2DNRA 2OEKA 2CJKA 1MROA 2QA1A 3M2UB 3G4SS 1LQ9A 3J80Y 5CH7B 1HBNA 1E6VB 1CJKB 3F44A 3PJ9A 2RRBA 3DYAA 4LSNA 4FYWB 1RWKB 2P9GA 4BLGA 4DV3F 2KZMA 3UD3P 5J2QA 2DO0A 1N4LA 4FXVA 4CH7A 3GB0A 2IA6A 4C98A 2B51A 3GG1A 4B9UA 4PABA 1U02A 3VQTA 4RPFA 2CFXA 4NYPA 2DXDA 3IFEA 3D2WA 4K4WA 4JYAF 4LF1A 4DV2F 3G6XA 3HKWA 3U7JA 1R8HA 4OV6A 5KFDA 2FJVA 2ZHBA 3MD3A 2J0XA 4DV5F 1N48A 4NEZA 3QO9B 2CQPA 2AKWB 5HJYA 4NA2A 5B0DA 1RTHA 1VOMA 2V67A 1U6FA 2HQ3A 5L39A 4PRFA 2J6TA 1HQUA 4LF9F 1T9WA 3HHLD 2M9KA 2VASA 3R1LA 3OLAA 4ID8A 2CQIA 1RT3A 1FTCA 1VRTA 2VQFJ 5A8KA 2ZZNA 3EMTA 4KH1B 3BBBA 1IBMF 3RU0A 2W1BA 1NDKA 4RLEA 4DL2A 1XWLA 3EJMA 3BR9A 3UE2A 2RS2A 2C2EA 3DRXA 2VQEF 2HWHA 4M5LA 5E3RA 1RAAB 3Q8YA 3K57A 4TVAB 5CAAA 4K2JA 3CCUS 2UVRA 3C15A 4DPYA 4HTIA 4LF7J 1NPKA 1XMQF 3D4JA 3KK2B 3I6PA 3OVBA 4Q8EA 3QMQA 5KFVA 1LV5A 4DEZA 4Q44A 4O3PA 3O8WA 4USMA 1VC5A 2XMJA 4WFAQ 3QIPB 4J7CA 2B9WA 5HSPA 4OFZA 2RILA 2HNYB 5J1EA 3U1NA 4HLBA 1HR0J 1Z1ZA 1RZMA 3A3OB 4FXDA 2CVEA 1ZS6A 5DG8A 3V81A 1FT8A 4O3OA 1C1BB 3HVWA 4LF4J 1KDNA 4ELUA 4NLYA 3GFXA 3QT5A 3BH7B 4IH5A 4ZPWR 1NZ8A 4DR3F 1UAWA 2D3ZA 3AOBA 4NLWA 2VG7A 1U49A 1U6ZA 2LP4A 2VFSA 3U02A 5HMWA 5CZXA 4ILRA 3KLFB 4YP3A 2J9DA 4RNNA 4RW4B 3T6JA 1IJEB 1SUQA 1SC1B 3RG6A 4OZ0A 5L46A 3C6TB 1IBKF 2BJDA 3MCSA 2PFDA 4QW9A 2IHR1 2GCFA 2G2YA 2AU0A 2RF2A 3IG1B 3BGLA 3QSIA 5AE3A 2RHSB 4LF6J 1YVFA 1MMLA 3JSYA 8ATCB 1D3WA 1SH0A 2DCUB 4ENOA 3NGDA 1M90T 3WIVA 4WCEQ 4L6V3 4WK3A 3SQGA 4OHYA 4B9VA 2HHUA 4ZJQA 2IVMA 2QSWA 2YNFA 4M5DA 3POTB 1S12A 1SL0A 4ZCMA 2CQ3A 1M0SA 3UWTA 1HQEA 2FJWA 4DSJA 2CNKB 3O1LA 4YHHF 4X4PA 3HI9A 1YBTA 2HS4A 1YI2S 2H5IB 2HRTA 2Y1RI 4ZOSA 4DSIA 1FX2A 2C22A 3HHLC 4N77A 1RTDA 5D77A 1OO0B 1K9MT 1JLGB 3BGOP 4J9RA 3DRPA 4NMLA 4U7CA 2NSBA 3W64A 2MLZA 3U1LA 5BR8J 4V1Ak 2VQFF 2HQFA 5B09A 1UFWA 2VUGA 4G1IA 1Q16B 2QFJA 1YJ9S 4NYZA 4CP5A 2D9PA 2QA4S 2BKPA 3IBFB 2ATLA 4DSLA 3WC0A 4BDPA 1J2VA 1FRHA 1SKRA 3MPDA 3TUJC 4LSLA 2I8EA 3DOKB 1RKJA 5IT9U 3WC2A 3G86A 3J7Z5 3MWBA 1PIEA 1T9VA 3IS9A 3QATA 3B82A 1JLAB 2EFNA 4GO5X 1HR0F 3VALA 1RAHB 2DXEA 4B9TA 2E1PA 3DLHA 2XLKA 5IT9Y 4LF4F 2ZVSA 3BH6B 2ZDOA 5A0YA 2ZJQQ 2OPPA 4C9DA 2HBQB 4XDDA 1QY7A 4L76A 3HHEA 1IXKA 1UVNA 8RUCA 1WHYA 4MK8A 4C0OC 4IOBA 1AXQA 4O4GB 3CIZA 2Z58B 1U24A 2RUGA 1J5EJ 4LJMA 2YVSA 3DI6A 4I6WA 1FRMA 3HULA 4NLSA 4YDDB 4NCGA 4ZVTB 5KFHA 3TYTA 2XI2A 4CRJA 1VQKS 4EYIB 1YJNS 4DUZJ 3IWXA 4CLYA 3G6YA 1KQKA 3MAAA 3K5NA 2WVDA 4LF6F 3W3SA 1O5JA 4ZPTR 1HWKA 5GMKa 3JTOA 3FCWA 1F60B 3HFKA 1GMVA 3CCJS 1VIOA 3ADAC 1GTEA 2WBRA 1AT1B 1S97A 2AJFE 1ZM9A 4BC9A 2MY7A 3FEZA 5A6PA 2VKRA 4C3KA 4DF8A 1Z4UA 2KI2A 5JUMA 4ZCLA 6AT1B 5ITHA 3NWGA 2DR5A 2LXFA 2A1BA 4GKJJ 2N7YA 1WELA 2C2NA 2CPYA 3H8YA 2KHDA 3N01A 5DQHA 5FDLB 2DB1A 3MMCB 3EVMA 1KLMB 3ZZOA 5DQIA 2HFVA 3UDVA 1HI0P 3NGUA 4P9SA 3I0SB 2CA9A 2HNDA 1SL1A 2GZOA 1C4CA 3TJ8A 3HFZB 3RR8A 1A0OB 1JKHA 2RU3A 3CVKA 1C0UA 3TARA 2ALYB 2K3KA 5BR8F 5JJBA 1RISA 2IRUA 2OPRB 1NCLA 5CQGA 4PG4A 2H5EA 4NI2A 1TFWA 1T3OA 1IQZA 1WOSA 2W2NP 1G1XA 2DISA 3MXHP 1MMDA 5FJ4A 2XSJB 2HQDA 1F5AA 1N6QA 1PJ6A 1VS3A 2IYGA 3DGVA 4A4JA 5IS2A 3UCZP 1X4BA 5EWGA 1WDDA 2WW8A 1XERA 3HJFA 1UP1A 4PR6A 4FDFA 2M70A 1H6KX 3SFGA 1FX4A 1JNRB 1M5HA 3BGFA 1HBNB 1HARA 4QR1A 1H2TZ 1N52B 3D0IE 3DYAB 3LPYA 2OJ3A 1FHTA 3P45B 4WTOB 2E29A 1S7HA 5J2QB 4ZS6A 4QWCA 2FQQB 3IMQJ 2Y3YA 4HH1A 5KT4A 5KG2A 5H1SV 1FDAA 2R7TA 3JSRA 2Y8WA 1T05B 1S49A 4JUZA 1J5EF 1XIQA 3ZZTA 3W61A 1S76D 4W90B 3HJVA 1JLCA 2FLOA 3HF5A 3PY8A 3W7BA 1R8BA 2J6UA 4YQWA 1IN0A 2HFOA 1RTHB 4EK2A 1SIWB 1D9AA 2MJNA 3RAQA 3HHLA 3AD7C 2XY6A 3EPGA 4DUZF 1HQUB 1RHQB 1VQLS 3LF0A 3CDBA 3MMJA 2FC9A 4K4TA 3AXKA 3N5BA 4OZ1A 3QT8A 2C3YA 4QZVB 1VRTB 5GAHU 5EWEA 3AT1B 1OWXA 1RTIB 1Y3KA 3EGWB 2PI5A 3I4HX 2ZH3A 4KBIA 1RADB 3PTWA 1OMSA 2XNRA 3TAPA 1C0TA 1JLEB 3KFWX 5D4NA 3D3CJ 1WG4A 3RAMA 2ASJA 3MM8A 4ZVRB 4GKJF 2GHPA 4Y65A 1GX5A 2EC2A 3P4UB 2JHEA 3NOGA 2NPFA 5H9EK 1Q0NA 1TL7B 3D6HB 1BUXA 4E8UA 1FE0A 4MIBA 2ZE2A 1R8AA 4B17A 1WEXA 2A18A 3HSJA 2VONA 4OLPA 3VV2B 3W2VB 4MH8A 3SSRA 1VHIA 3A8JA 3ET6B 2VG6B 3MM5A 4KGMA 1C1CA 3RAXA 1VQ6S 4A48A 1VDHA 4DX8H 1CC7A 1WI8A 4ICLA 4CLWA 2F40A 1Q1KA 3OUYA 1UW4A 2KT2A 2YNHA 4J9PA 1UVKA 4O0IA 1PJ7A 2UXCJ 5IT4A 2K7JA 2NLWA 3FSYA 3IRXB 3CPWR 2BA9A 4KGKA 2XSFA 4BWMA 3K5MA 5B0AA 3UD4P 4CLPA 3JB9k 2UUTA 2GHVC 2VF3A 3OL8A 3QFWA 1IKYA 4FYYB 4D3GA 5D15A 1R43A 2HVZA 4K4YA 3HX9A 3HD1A 3LH2S 4WZMA 1KQGB 3ILOA 2HHXA 3DHWC 5KFIA 3M2VA 3W62A 3CJ8A 4X4OA 3M32A 2W2MP 1RUSA 2KT3A 2ALZA 1QUPA 4ELVA 4M5HA 4LREA 5CCMA 1NAQA 3AY0A 2KG1A 4F4WA 4M5DB 4JV2A 4CLKA 2WK4A 2XQCA 1GQEA 4DI6A 1S5ZA 3KJQB 4I4BA 1HW9A 2HQCA 3VHQA 2MXYA 3VAHA 3LP1A 3OQ2A 2NPIA 3G2XA 1TL3A 2BM0A 5IXUA 3FBCA 2HEKA 1T03A 4W98A 2KL8A 4OZ3A 1RT6B 3CT9A 1NO8A 3AB2B 4JI2J 3KK1A 1RWMB 2IRYA 5C24A 2CADA 2HS0A 2HHTA 2WSFC 3BGUA 1SIZA 2ZBRA 2CPEA 4EU0A 2IJFA 2HLUA 4MMOA 5ETRA 1NJZA 1TKDA 2J7WA 2KHCA 3F56A 4R0JA 4TU7A 4TYAA 2FLNA 1TKZB 2RMLA 3W9HA 4IR1A 3M2RA 1QD1A 2KO1A 1VBYA 3CCES 3TEHB 2JNJA 1RAFB 2VBWA 3H5XA 4DOZA 1L3UA 1TQLA 4LSLB 5KFTA 4I64A 3DM2A 2DHXA 3G87A 3RBZA 1M1KT 2VFRA 1Y4ZB 3DOMB 1C4AA 2IM3A 4K5SA 2DPIA 3GFYA 1JNZB 1FJ7A 1YJUA 4ECUA 4I6AA 4EZ9A 4KGVB 2E66A 3HVRA 4A8XA 2J8AA 2OPPB 2MQOA 2C1EB 1IBCB 4JI7J 3UVJB 1F6TA 1WKJA 1ELOA 3D1QA 1XJWB 4OZLA 3L3CA 3QGPA 2GA7A 4DDFA 2Q3PA 4ED7A 3QT6A 2CZ9A 2NXNA 1MLAA 3P3DA 1R0BG 3ONQA 4IO9Q 4JV5J 4EEYA 1Q8BA 3DI6B 3I31A 4H54A 2YWGA 4UOHA 2RDDA 2XB2D 4NCGB 2DGVA 2CXEA 5E3AA 4RW8A 4CYUB 3GJQB 1VR6A 4X66J 3RZAA 1S77D 2Y9HA 4GVBB 2JC1A 3LUYA 3MAAB 4U95A 4LF8J 2E1AA 2HWIA 2WCXA 3JQMA 4LMZA 4OHZA 2LYVA 4DUYF 3ILJA 3DLGA 2BUNA 2V4QA 3WIUA 1RWVB 4PXEA 1HPZA 1E6YA 3MCNA 2KFNA 2F4VJ 3M9NB 4PXBA 3SXLA 9ATCB 3FQLA 2ZH9A 4EMDA 1RHJB 1LWEA 3CULA 2KH9A 3J7YI 3M30A 2IJRA 3TZWA 3LTOA 4ZVUB 4GMKA 3HMJG 2V9KA 3W9IA 2EW9A 4V19X 4P6QA 2ZC4A 2GIFA 5K14B 1SJFA 5ETLA 3UN2A 4KPCA 1AA1B 2QO3A 1X4EA 1RYRA 2PN6A 3CC2S 2B6AB 3T1AA 4HT5A 3V6HA 4JI2F 4MT1A 2B3TB 2H3EB 3I32A 2UU9J 3UN3A 4DF4A 1BMQB 4K4ZA 3PVXA 2FVSA 4NI2B 3DOLA 3JTNA 2DY9A 2QTWA 3J7AN 1UJ5A 3KLVA 5ETMA 3DLKA 5J2PB 2RRNA 3EGNA 4ZVFA 3RYLA 1F3FA 1WF1A 2MLYA 4F25A 5DO2A 5D3GA 2WB1D 1FNXH 1VQ8S 5IM0A 1ZAWA 3TJAA 1X5PA 4BBYA 3RBDA 3C46A 3L7PA 1JIHA 3PX6A 3J81U 5HLFA 2YKQA 4RR5A 3S7RA 4RUAA 5D78A 3FCVA 4CI0B 5F8GA 1CC8A 1I6JA 1WC4A 1QTNB 1NKEA 1DHMA 4AL5A 2HPUA 4IOAQ 1RAEB 3MM7B 3BO2A 1RT7A 3J81Y 2VBXA 2P9EA 4JI7F 3HLUA 3GJSB 2WW4A 1U25A 2AP6A 2B43A 1U2CA 2JLEA 2BJ8A 1KOHA 4USTA 1NKBA 2QJ3A 3GV7B 4J9OA 1UJ6A 3OR2B 3DRYA 3TQEA 2JRSA 1JLCB 5F41A 4U8YA 1FRXA 1VQOS 3Q0AA 5F8NA 3FCHA 1FNOA 3H59A 3ZZYA 2RUSA 2W4PA 4USUA 1Q5VA 3NNCA 3MTKA 4X66F 4QR2A 1D0EA 1ZZNA 2CAJA 4LF8F 4FVCA 3B8HA 3M6VA 3ELHA 3D6MB 5KG4A 4AQYJ 2ZM6J 3GILA 1BQNB 4ID5B 4XAKA 2QMWA 4YB1P 2G9OA 2BJ7A 4OI4A 2OMLA 1VBKA 1N0UA 2EK6A 4URSA 2B4VA 2XY7A 3KHHA 2G13A 2YQ0A 3M4XA 1HWJA 3IO1A 2MQ8A 1C0TB 3OFFA 3PW5A 2C28A 1N5YB 1FRKA 2J76E 2B8PA 1PGZA 4ZPVR 2M88A 3JQJA 3GZ7A 4X64J 3K58A 2XY5A 3EDRB 5GAGU 4TKTA 2CVIA 1HHQA 3MM9B 3DLLQ 2AV5A 4N8OA 1R6YA 3WQPA 4KV8A 1CJTA 4CLFA 4WU3A 3VAFA 3PX4A 2CQ4A 2ZE2B 4I2QB 4G1QB 3R5CA 1AUSL 1HYSA 2B4PA 2HHQA 4UZCA 2F63A 3D1OA 4OJ3A 4B02A 1S0NA 2UU9F 4YB6A 3L4BC 1HIYA 4C8NA 4ES3A 4Y0FA 3QT7A 2AEJA 3OL7A 3BO4A 1YBUA 3MM6B 3MM5B 1C1CB 3VR1A 3KMSA 2KXHA 2VBZA 1WI6A 4EUVA 1FXLA 1KBRA 4ICLB 4DS4A 4JI1J 2QA2A 2F5GA 2LQ5A 3KUGA 4XPCA 3ITHA 4X4UA 3AJ1A 5E3CA 2CNLB 2DNOA 3HVAA 4HVZA 1FRLA 2BOPA 3BV8A 1FFSB 3BREA 4KJIA 1HHTP 3IRWP 1TMMA 5ADZA 4LRFA 3RBXA 3MR2A 2RDIA 4C3LA 3RTVA 2WZ1A 4IG3B 1GH8A 4NXNJ 1RHRB 5EWFA 3QJPA 1IKYB 3M1VB 3PG9A 1YWXA 3G82A 3IR6B 1ACMB 2HGNA 4DQSA 1FCAA 3AODA 1V5VA 5EX0A 1VRUB 3FVYA 4X4QA 5AXNA 4OYIA 1FWLA 2BANA 2DITA 1N33F 2B4OA 2EVZA 2OTLS 2KYZA 2W25A 3M6WA 3LGNA 5GMEA 3B4DA 4FZVA 2GX8A 1LW0A 4Q2LA 1T9TA 2HNZA 4ZP8A 1WOOA 2KFYA 1RE1B 2DGSA 4CLTA 1VK3A 2PIIA 2DNQA 3IR5B 4ZIWA 3IBCB 1MU2A 2BMBA 3LP1B 2C2OB 2XC9A 3OHAA 4O3SA 1NM2A 3VVTA 2D3OR 4UUWA 1K0TA 1T03B 3CD5A 2F8MA 1H7XA 2E5HA 2YX7A 1MN7A 1EQ0A 1YX2A 2ZM6F 2X3DA 3KK1B 1S57A 1U0HA 4C8ZA 2MHNA 3B78A 3TWZA 2J9EA 4ZHRA 2F8EX 4JI6J 3DLEB 2K06A 3QQCD 4EBCA 1TKTA 4DV4J 2WOMA 4I7FB 4AL6A 4M95A 4WBFA 4PUOA 2PFFB 5I3UA 1CULB 4DG1A 2HURA 3US5A 1X0PA 1VLYA 2V2KA 3PRVA 4C0HA 4X64F 1HMVB 3M2RB 4F3MA 3GP9A 2CQCA 1KTVA 1BLUA 4HHUA 1UETA 5AJ3J 4ZMMA 3DM2B 2W2OP 3C66A 1HD0A 1Q7YT 5JMNA 5ETQA 3PV8A 1JLFA 1HBUA 1RHKB 3G8SA 2HIQA 4F36A 1EB0A 3AD8C 2MQLA 4A8OA 4TQSA 2OFHX 2XWXA 2YNIA 4RW6A 1SVDA 4ECQA 2XNQA 2OPSB 2L08A 1NK8A 2V68A 2NXCA 3GWCA 4P73A 4PWWA 2LEBA 3W2WB 4JI1F 2J0SD 3CD6S 1U1LA 1RSCA 3PYGA 5KG1A 4EWTA 4WXOA 2CIMA 2PSZA 4NRTA 1ZM3A 1OY9A 1S6UA 3W63A 3MR3A 1X4AA 2KYXA 4MIAA 4RWWA 5JVHQ 2DIVA 3FBFA 4RW8B 3MD1A 5LT5A 1DZ5A 1MWQA 2BOAA 1SQGA 4NXNF 1H98A 2IVYA 3KLHA 2XMVA 1APSA 3EXCX 2YKOA 4CH1A 2DRAA 1Q78A 4ATNA 4KGXB 5KFUA 2Y1LB 4NCBA 2DNGA 2IPOB 1S72S 2BYCA 4S0MA 2AGOA 1E6YB 3SDEA 4WTYA 2B8QA 3M8QA 2HHWA 4RW9A 1IUJA 1Y11A 1B4SA 3M30B 2FJXA 2N7CA 3QAUA 1RAJA 1NNDA 5AXKA 2MKHA 3N5FA 1HWLA 4JI4J 1O51A 3QSYB 4RUHA 2VDIA 2ADCA 2FHOB 4C8KA 1VK8A 2VC1A 4EI2A 5B7WA 1RBLA 3C2PA 4ZVOB 3BKFA 4B9SA 4FPIA 4CLLA 1VQ9S 2P6SA 4B3RJ 1B7YB 4CCHA 3TZXA 3W5XA 2O66A 4GRSA 3VWSA 4FS2A 2OHDA 1HBMA 4NE9C 2BM1A 1B0VA 4UT4A 2X51A 4ECZA 2J9DE 3Q8PB 2M2BA 1VQ4S 3T1YJ 3DOLB 4OYPA 1F9HA 3MR5A 2A2DA 4Z7YA 3CIMA 1FKOB 4DV4F 1SXLA 1SI9A 3UN5A 3DLKB 4YN3B 1RHUB 5SUHA 2VFUA 1DTQB 4P74A 3BKUA 4DN0A 3HKZD 2DKOB 3ISND 3M8RA 3PM9A 2WBMA 5KT7A 3OTEA 4OYXA 4YOEA 2DR6A 4NASA 4F4XA 1F9EB 1EX8A 5HLFB 3AOAA 3MMBB 2E5GA 4FBTA 1Y5NB 4KO0B 1J5OB 1LW2B 3RJMB 1OPIA 3K7RA 2HHSA 4BCAA 3QNWB 1HQ2A 1P1TA 2WSCC 5KOWA 3BPSP 3L95X 4DPTA 4WYLA 2QYGA 3CJ5A 1GNKA 4D3HA 3W66A 1UW9A 3DHXA 1V3RA 2RE1A 1RT7B 1FRJA 2QMUB 4N7TA 3GFHA 1REVA 4Y3CA 4RU9A 4K4SA 3O2IA 4ED8A 5KFWA 3V2UC 1DFDA 2DH9A 4DBQA 3ZZPA 2IJNA 4H4MA 3H4BA 3A3PB 1Y0HA 1P8GA 1VC6A 1ROFA 3L7UA 4X4NA 1Q4RA 3SFUA 4FNHA 4QBUA 3LANA 3KLGA 2MGZB 3I9ZA 3NGRA 1S4EA 3M2UA 2FVCA 5DDPC 3GYXB 1E6VA 4DL5A 5F8HA 1H0HB 4DLGA 2JFDA 2F9DA 2XMTA 1RK8A 2BKNA 2Y1JA 4M94A 4DS5A 2QLXA 4G3IA 3SSQA 4ED6A 3JXOA 1LXJA 1VQYA 4LR9A 3OR1B 3CC7S 1F2HA 3T5JA 3R7BB 3MOJB 2JSXA 1FFWB 5HP1B 2M3DA 1REGX 3EGZA 4UW2A 2P9CA 1ZTWA 3JSMB 4C48A 3GU0A 3OLBA 3QO9A 1TP7A 5E41A 3EWGA 5BYRA 1X60A 1JXVA 2BE2B 5HANA 3ICLA 4CO2A 3DXSX 4JI4F 1WHVA 1O6XA 2HWTA 2DT9A 4AD6A 4CO5A 1EETA 1GK8A 4KV8B 1NZAA 3LQVA 3GFZA 5B0BA 3UDLA 1CQNA 3KTQA 1TV6B 4B3RF 1HYSB 4KE5A 3K17A 3CDUA 3F0NA 3HHDA 3HDSA 2DGOA 4KAIA 2E5LJ 5HN0A 4AXJA 5HBMB 4MJKA 2XMAA 1S9GB 1JLBA 2EEYA 3KHRA 2VZ9A 4G65A 2W7PA 4LBHA 5GADU 4DR7J 3CE8A 2QV6A 3D67A 4TNOA 3GSDA 1RT4B 3THPA 1H3DA 4FF3A 4MFBA 3UNYA 1H7WA 3FEYB 3ISNC 2V63A 1EZZB 1PYTA 1PYSB 3KK2A 3OD2A 4CT9A 2DD8S 1WEYA 3MCOA 3GPAA 2V8HA 4UQTA 2XLIA 3R5AA 3HD2A 1G4CA 3QIPA 1U1OA 4R8UA 1X0FA 2ZH5A 3BPDA 2YKNB 4JI3J 2E9RX 4ZPCA 4N41A 3M7VA 1KHWA 2MZ1A 3D6TB 1FWPA 2EFGA 3PJXA 3EYZA 3FBBA 1YLXA 2CJXB 3PW2A 4N76A 4G1PA 4IOCQ 3NS6A 9RUBA 2CPXA 3OHBA 4FP9A 2XS2A 1FTRA 3ZZ0A 4WKRA 1X31C 1FDDA 2SXLA 1F0XA 2HFSA 4ECSA 1UZDA 5K20B 3H5UA 1S10A 4PWDA 4RW4A 4DR4J 1LW0B 3PRDA 2X3GA 2HNZB 1OIAA 2LQBA 3C6TA 3AA9A 3DU6A 1U1PA 3ZNUA 4KSEB 3KLEA 5D0HA 5AXLA 2PMWA 3ENAA 1TAQA 4KQZA 1RCOB 4DMZA 4R5PA 4F02A 5MAOA 1MU2B 1TELA 1M5PC 4ED3A 1D9DA 2JLGA 1I51B 4ANEA 4RZRA 1TVRB 1V9OA 4ZN1A 2XTJP 4LBIA 1IR2A 3R6GB 3SQOP 4WFYA 2IMWP 4PAAA 3PKYA 4AT1B 1AYEA 1X7VA 2RB7A 4ZHRB 5KFJA 4QIVA 3D0HE 3RB3A 3D66A 3V4MA 5L9NA 1DAXA 3POTA 5D4LA 4KT0C 1FNMA 2KVQE 4PUOB 2DR9A 4CM0A 4DG1B 1WHXA 4NX9A 2UVVA 1S6QB 1U1NA 1S48A 4PXCA 4OI2A 2DBBA 1KEKA 2HZAA 2RNEA 1FA0A 2Z2MA 2UUAJ 1UFKA 1JLGA 2HMIB 3NMRA 4M8LA 2ZBPA 2GMHA 2HS3A 4ZPBA 3D68A 2DO4A 1FO1A 2V0NA 2HFZA 4A8QA 1HBUB 2DH7A 2IC3B 2RQ4A 2UVUA 2VBYA 1P6TA 3BF4A 3LAKA 4I1TA 1FKPA 4CLSA 1FEHA 3DCAA 4DR7F 3LOUA 3S6EA 3ZZRA 1BHNA 5CYQB 2V34A 4OI6A 1Q8KA 1UEVA 4WZQA 3IWNC 2AJ0A 2W9AA 3UDEA 4DR1J 2XZDB 5CZVA 3DOKA 2MZQA 4PQUB 3R9LA 2Z57B 1GT8A 1PSDA 1RDRA 1TKXB 2XM3A 1ZTTA 2DVIA 5HJXA 4JI3F 1L3SA 3PIOQ 2B56A 3OV7A 2NS1B 4J9KA 4H4KC 3WZ0A 2H48B 3FDSA 3IR7B 2MHEA 4DV3J 2JVOA 3OTDA 2HGLA 3IA0A 2ZH8A 3DU5A 3M6UA 4CH0S 4FXWA 4ZIVA 1KD1T 2HBRB 1NK9A 3DC2A 3DDNA 3TP2A 4O4GA 3M8QB 3E2EA 3CGIA 1TFYA 3BO3A 4DR4F 1U1MA 4RW9B 1S1XB 4DV2J 3GYGA 4KYZA 3NBPA 2CJ9A 4F7VA 3FJ2A 3KLIA 5IT0A 5D4OA 4A46A 3PRBA 2QMXA 5CXTA 2DGXA 2CJAA 4F0MA 2VJUA 3QPIA 3R27A 3UCGA 1SQFA 3BQ0A 4ZP9A 3RB4A 3FFIB 2NYHA 2AZ3A 1HD1A 3L09A 4LR8A 3N6MA 2W9BA 1TK0A 1HBMB 3BYPA 1IBMJ 5C2GA 1EIYB 3K5LA 4LF5J 2Y0BB 4DU7A 3D3BJ 5F8JA 3I0RB 5AE2A 4Y34A 2GVZB 5HAOA 2CJQA 4AUKA 1RT2A 4ANCA 3UR3C 2OI2A 4P52A 3EDQB 1OPZA 3V6JA 4YDXA 4CLUA 4KTQA 5LOQA 4WF9Q 5FDLA 2MYFA 1ITPA 3NRBA 1QM9A 3R6LB 4QU7A 1JQGA 2DH8A 5JXSA 2HHPA 1ZPWX 4DLEA 2KXNB 2UUAF 1T11A 4C97A 4WP8A 4F0KA 1D8ZA 3J81j 2FDNA 1FJGF 1QUVA 1R7IA 3VZIA 4DQQA 5EUHA 4C8YA 4O23A 1X8DA 2OPRA 1HNWF 2E1MC 4Y2IA 2IDLA 4Q5VA 3PEJA 3MGJA 3OFGA 2RIJA 4OHXA 4ZVPB 4LFCF 3OFEA 2RQMA 3TZZA 4A8SA 2Q1LA 2XSJA 3AAWB 4U67Q 2Y1IA 1REVB 1N5QA 2KXFA 3OXLA 1XNQJ 4HDGA 3K8VA 2VD3A 5KFMA 1U1RA 1AB8A 1PO6A 2VKZG 2RHQB 4OZ5A 4H4MB 3PKMA 3KNAA 1H73A 2BW7A 4DL7A 1OQ6A 4CNYA 4J5OA 1IBKJ 2QN6B 2WSEC 4GVLA 4UQGA 4Q45A 1LFPA 2YPZA 3C6UB 3AQOA 5C42B 3BM7A 3DMJB 1ZA2B 3FMWA 3MFHA 3H2LA 2KU7A 5GAHI 4WE1B 3H25A 2GO9A 2BRKA 3VGSA 4FVMA 1YJVA 2JL9A 2WONA 3GLJA 1YIJS 2V8VA 4F4KA 4I68A 2ZKTA 5T7LB 3IC1A 4OZ2A 2Z8QA 2L41A 3E3XA 3QAEA 2GC8A 4MKVA 3VQSA 1KOOA 1DBDA 2HSEB 2J0QD 3PYEA 4P2XA 3Q86A 3KG1A 1SC4B 1RKIA 2C2ZB 1WSVA 1T05A 4NOHA 1ZA1B 4DPWA 4USJC 5GAEU 2MMYA 1A7GE 1LNQA 1SJ1A 4OYZA 1NRKA 4A47A 3B6BA 4YHHJ 2WTFA 1PAEX 2KT5A 3GIKA 2YH0A 4B3MJ 4JV1A 4P10A 2A2CA 3KOAA 3CD7A 2B5JB 2N82B 4B9NA 3TX8A 3FK4A 5KFYA 2OD6A 2FJEB 2Q6CA 3PO5A 1EETB 4RUCA 2FVPA 2EI5A 4CLZA 2VPWB 2ROPA 4FKYA 2ZOFA 4DWIA 4PQAA 3CNQP 3DXBA 1RTIA 2XYHB 1S1WA 2BE7D 1JLBB 3TO8A 2KB2A 4LF5F 5M2UA 4ANDA 5K8PA 1SBRA 1JLEA 3CMES 2R7UA 1KS2A 3K59A 3TVYA 4MFBB 1RBOB 2NREA 2AEMA 4WPAA 3J7ZT 3HZEA 3CCQS 3OW2R 3V6KA 4RU2A 3NWRA 4RO0A 2ERRA 4ZCKA 5C7PA 4YB5A 1TL7A 1QJHA 1RWUA 4P2FA 1QSYA 2ILZA 3ULHA 3N28A 3TR5A 2M8DB 5ETKA 5KFQA 3GV5B 4J9LA 2YWWA 2CWXA 4R8UB 3VF0B 1IKVB 5L1LA 3VAIA 2EXUA 5I3PA 3W2VA 1B64A 3A8KA 5LJ5Y 3QRRA 2EFPA 4ZP7A 3ET6A 2VG6A 2HKEA 3MI7X 3IXQA 1U1QA 4QQBA 3Q24A 3ENQA 4DR6F 1F5BA 2O5DA 1U2FA 1I3OB 3T5LA 1VYAA 3I5BA 1XNQF 3EUNA 2OELA 1BE4A 4BS2A 4NLVA 4PWDB 2BE9B 1RAOA 2BV3A 1QSLA 2CPZA 2CDQA 3UD5A 2O1PA 1KQSR 5A76A 4GC6A 2GMLA 3IRXA 3OBIA 2ZWPA 4UTGA 4HL9A 1NK6A 3KLEB 3AJDA 1S79A 2NSCA 3MURP 5KFCA 3R5JB 1SPBP 4R5PB 1YZ6A 1KVIA 2QL7B 3I55S 4HT7A 2VJVA 3BZQA 1Q79A 4B9LA 2JDJA 2B9EA 1S7IA 2JZ5A 3CO9A 3M05A 3IP0A 2NCKL 5J2MB 3MFIA 1PYOB 1T9UA 5DDOC 3B54A 2BBEA 3V4IA 1RWOB 1YRTA 2R7VA 3T5KA 1PKUA 2FHJD 2MY8A 1XN9A 1TUGB 4F2RA 2COLA 4OI0A 2X1GA 5HO4A 2MZTA 3CTRA 2MZJA 4NLRA 2KJVA 3PFOA 4ZDNA 2HHVA 1XC9A 5T14A 4I56A 4B3MF 1KN6A 1T0TV 4RW7A 3H7HB 3M8WA 2BW2A 2LEPA 3AXMA 2K3IA 1GMWD 4LQ3A 2VHGA 4Y2KA 1SJ3P 1KVKA 3OL6A 5KFKA 4N8NA 4R25A 4PPZA 1K47A 2ZVIA 1RT6A 2G0CA 3EE3A 1VQ7S 5F0WA 2HZVA 4RNMA 5KG3A 1W2IA 4OX7A 3CCRS 2LLZA 1N88A 1NB2A 3BQ2A 2OKQA 5I3QA 1FKPB 5C25B 2DHAA 2VPXB 2I38A 2X7IA 3GR1A 2C3PA 4EFAC 4PG5A 1RTJB 2QC3A 3AH6A 2DJWA 1NK5A 5G0RB 1S6OA 2CNNB 3W8GA 4RNHA 3BQ1A 1TKZA 3NOCA 3HXMA 4TY8B 1Y3JA 4A8KA 1FF2A 2JWNA 2RDJA 3CJKB 4DFMA 2XMMA 2EC0A 1WF0A 2VG5B 4P71A 4MTPA 3PO4A 4I2PB 1WC3A 4N5SA 1H74A 2ASDA 5BYQA 4IYQA 3D5MA 3DOMA 1X9WA 4KFBB 2ZITA 5D0EA 2VOPA 3H98A 2LA4A 4FF4A 3M8PB 4DFPA 3CB4A 3HVTA 1XBWA 2UUBF 1UA1A 3QIDA 1XQIA 2B7CB 4LIRA 5K8NA 3GCWP 1ZZFA 3H0PA 3VVUA 3UI3A 3KUHA 1RYSA 4NZ6A 3UVJA 3EPIA 3P6YC 3T9ZA 2M8HA 2IDEA 3MUMP 2VFTA 4OV1A 4XTTA 2Y0SD 2Z0GA 1ZETA 4EYHB 1WF2A 4B3OB 3TANA 1DLOA 4QOTA 4X4RA 1B3TA 4MK9A 4DN9A 3NBPB 5JVGQ 4O44A 4CM2A 1CJUA 5LL6d 5HMXA 5HVHA 1F2GA 1S9FA 5B08A 3KLIB 5ETVA 1SC6A 3V6DA 2AZ1A 4CYUA 1GXUA 4LRAA 5LXRA 4GVBA 4DZDA 3UR0A 1WTFA 3MHYA 2XCAA 3J7A1 1KC8T 1BY9A 1HWUA 1UJ4A 2PD1A 3RW6A 2WVEA 3CDAA 4LT6A 2W9BB 1L5UA 1IBLF 1WJ9A 3SCLE 2N4CA 3W8PA 3UO0A 2BABA 1WHWA 2YKMB 2KRBA 2LFVA 4KIAA 2ZH4A 5IFMA 2W9CA 4JB8B 3T6BA 5CHCB 1RABB 4Z2XA 1RT2B 2CUYA 2F9JA 1SJRA 3KXDA 1IM6A 3THVA 4NXMJ 4OJ1A 5LMNJ 5K14A 1LWFA 1KLNA 4KKOB 2NXEA 2GGPB 3HPOA 2LVWA 1MWYA 1SH2A 3QZ8A 3ILLA 1QLNA 1T8EA 1DJ0A 2B6AA 2DCLA 1HWIA 3HZGA 2EFQA 2PO4A 4QU6A 1D09B 1EHWA 1YRXA 1VGYA 2ADBA 2RJZA 2Z2YB 1SKSA 2WVBA 4PG7A 4C8LA 3SBMA 2DR7A 1U8SA 5J2PA 4ZCIA 3ZZUA 4DL6A 3A1YG 2MZSA 2CPDA 2NZCA 1DY3A 3OTCA 2ZUAA 1UVMA 1HNIA 2JC0A 2IM1A 4USWA 3CC4S 3GMGA 1U45A 1WC1A 4B3SF 5DLGA 5RUBA 3GTYX 2ZJRQ 2CQGA 4QYZK 1KKHA 1HNVB 1TK8A 4OX6A 3SCKE 2WONB 4RWXA 1RT1A 4OYMA 4WXWA 2P2CB 2D3O1 2C3UA 3MM7A 2IVFB 1LK7A 3I5CA 1KP6A 3GJRB 2V4JA 5DLFA 4ER8A 2B9XA 1JJCB 2FPHX 5KG7A 2IFXA 4YR2A 5DZ6A 5DDRC 1XMOJ 2BRLA 3LPEA 4NLUA 1FRIA 5GAGI 3CCTA 2BEFA 3WBZA
chains in the Genus database with same CATH topology
1ZM3A 1S6UA 2MQNA 4OLOA 1Z1ZA 3D1HA 3MR3A 1X4AA 2KYXA 4FXDA 2CVEA 3MMAA 3OR2A 4MIAA 4ED0A 4RWWA 5DG8A 1NB7A 1D1UA 5JVHQ 1YJTA 3V81A 2DIVA 1FT8A 4O3OA 1C1BB 4RW8B 4N56A 1S6PA 3HVWA 3MD1A 2OP5A 5LT5A 3SEOA 1DZ5A 1IKXB 4ELUA 4NXNF 4NLYA 1H98A 3GFXA 1BQMB 2IVYA 2AW0A 3KLHA 2H9ZA 4IH5A 2XMVA 1APSA 2ZNZA 4ZPWR 3EXCX 2YKOA 4CH1A 4DR3F 2DRAA 1UAWA 2D3ZA 3SCJE 4NZ0A 4NLWA 2VG7A 3BR8A 3OVAA 1X9MA 1U49A 1U6ZA 3S1TA 1Q78A 2VFSA 4ATNA 1NHVA 3DDKA 3UCUP 1N6QB 3U02A 5HMWA 5CZXA 2R9LA 4ILRA 1G2EA 3KLFB 5KFUA 4NCBA 2DNGA 1SL2A 2IBKA 2EKYA 4YP3A 2J9DA 2ZKUA 2GQQA 2R2RA 2DHGA 1S72S 2LQ9A 4RNNA 4RW4B 2BYCA 2ASYA 5LSLA 3T6JA 3EX7B 5DM7Q 1IJEB 2AGOA 1XMBA 1SUQA 2HVIA 3SV4A 1E6YB 1BQNA 4ID5A 3SDEA 4OZ0A 3MPVA 5GVQA 3MEKA 4WTYA 1WTBA 2N4DA 3KJVA 3M8QA 4LVOP 4B9MA 1KQFB 3C6TB 2HHWA 1IBKF 2BJDA 1JX4A 5L1IA 1HBOB 3MCSA 4RW9A 1IUJA 4ETXA 4LIWA 4BWJA 3M30B 3GG0A 4QW9A 2IHR1 1S1WB 2IAJA 3R5DA 2FJXA 2N7CA 2GCFA 3QAUA 1RAJA 4AE5A 3M6XA 1NNDA 5AXKA 2AU0A 2RF2A 2MKHA 3N5FA 2IMOA 1QAXA 5B0GA 1HWLA 1MWZA 1YGYA 3IG1B 3BGLA 5KFBA 3KG4A 3HM9A 4TXSA 3K5PA 5AE3A 1O51A 5C25A 4RUHA 1YVFA 3CMAS 1N5YA 1S0MA 2ADCA 4FBUA 1MMLA 3JSYA 4QIEA 1MSWD 2FHOB 1RTJA 1WNEA 4C8KA 1VK8A 3DLJA 1D3WA 1SH0A 2DCUB 5G0RA 3NGDA 2VC1A 4IG0B 1M90T 4ES1A 5B7WA 2XMKA 4NXMF 2FIUA 3C2PA 2J7KA 3DLBA 4B9SA 4WCEQ 3DNCA 3MM9A 4L6V3 5FD1A 5LMNF 2N3LA 1VQ9S 2P6SA 4WK3A 4IRKA 4TY8A 4IKAA 3MUVP 3SQGA 1KNZA 2YY3A 3ZC4A 4OHYA 3U27A 4B9VA 4CCHA 4JV5F 2HHUA 2Z2LA 2DNZA 3CJKA 2O66A 4JOUA 5MLCV 3VWSA 4FS2A 4NWBA 2IVMA 3DRSA 1HBMA 2VG5A 2QSWA 4OZJA 4IO1A 2YNFA 2BM1A 1B0VA 2JH3A 4I2QA 4M5DA 2U1AA 4G1QA 3POTB 2BJEA 2AX1A 4I2PA 1SL0A 2J9CA 4ZCMA 2VA2A 2FY1A 2CQ3A 2X51A 1M0SA 3UWTA 1HQEA 4ECZA 2J9DE 2X1BA 3Q8PB 3KHGA 2F8HA 2IM0A 2FJWA 2M2BA 3NMAA 4FYDA 4DSJA 1VQ4S 3O1LA 4ZLPA 5KFNA 4YHHF 3DOLB 2R7WA 4Q7AA 4X4PA 3HI9A 3HHLB 4KFBA 3MR5A 2OSQA 2HS4A 2A2DA 2C3OA 1YI2S 3CIMA