4OLYH

Crystal structure of antibody vrc07-g54r in complex with clade a/e 93th057 hiv-1 gp120 core
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
228
structure length
228
Chain Sequence
QVRLSQSGGQMKKPGDSMRISCRASGYEFINCPINWIRLAPGKRPEWMGWMKPRGGAVSYARQLQGRVTMTRDMYSETAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Enhanced Potency of a Broadly Neutralizing HIV-1 Antibody In Vitro Improves Protection against Lentiviral Infection In Vivo.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 40
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2014-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4olyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4olyH01
1ND0B 2BC4B 2EYRA 4YXHH 4WHYH 5IHLB 5DJ2A 1HHJA 4ZFZB 3N1FC 4I3GA 3C6LB 4X5XB 3SGKA 3HE6D 4XTRD 3ARYA 3EYVB 3KLAA 1T03H 2AJXL 3ILQC 1RUAL 2QKIA 3MFGB 4U0RB 5JNYA 2YPLA 4F33B 3RA7L 1SMAA 1NC4A 4JG0H 2M2DA 1RUPL 4KUZH 2ZSWA 5DZOA 8FABB 1LQSR 5J13C 5DHXB 4H0GA 1S7UB 4KRPB 1H5BC 4HDIA 3ZKND 2K3TA 2IH3A 3GNMH 3SDAB 3RBSA 4O58H 3T0VA 4KQ4L 4IS6B 2F58H 4LLQA 3VXTA 3L9RA 1RURL 5CBAB 1HYSC 3RU8H 2WINB 5GS1C 2P1YA 5GS2D 1VPOL 3KJ6L 3OAZH 1X5YA 2B7DT 4Z7QF 4XVSH 2R29H 2DQFA 4FFVD 4AEHL 5T3XL 1L9NA 1U93B 4J8RB 3OGCB 2EIZB 5E6ID 3I6GA 3KPOB 1IC7L 1JNHB 1OP5H 3SEPA 1CFNB 5IROC 5FYKD 3L3KA 5D5MA 3GSQA 2JCCF 3GEWB 4BSVB 5MEQA 5HDQL 1Q9OB 1LP9F 4FQ2H 4PRAB 2VLRB 3Q6GL 4YC2C 2D7MA 2ZG2A 4OF6A 1EAPA 4YBLB 1N6UA 4AL8L 1HSAB 3ESVF 3WNKA 1KCLA 2PO6C 4S1RH 2AJZB 2X7LB 2ZOLA 4KKCC 1BVLA 1X5JA 4ZAKC 4GRMA 3QH3B 5DHVA 3WLWC 3EDJA 1II4E 4DGIH 5C0ND 2HVJB 3NPZB 4NRZA 1P7QB 4JN2A 1CFSA 4G7YL 4H26A 4WTWA 3WFEH 2MPAL 3GGWB 4PP1D 1JGEB 5JW4Q 3VMOA 4LL9A 4Y0GA 2CKBB 2BNUA 5JLZA 2O5ZL 2WWMC 3PHQA 1RUQL 1Z9SA 1KBGL 1H3PL 3QFJD 2PXYC 1FNFA 4JAMB 2PNDA 4PGBA 1QRNE 2AXFB 4YBQD 2C26A 1N64H 4H8WC 1QLEL 1CTOA 1YEDA 1S9YB 4KDTA 4XP4H 5T5FH 4OFPA 2A73A 5IESH 1G6RB 4U49A 3GSXA 3QDME 2DTSA 5SX5K 1FZMB 5KAQF 4X9HA 3IXAA 4PBXA 1WAAE 5EO9A 4IOFC 5EUOF 4ZFOL 4OIIL 3SKMB 1KULA 2LFGA 3G6JB 3QXTA 2HTKC 1BOGB 3FN9A 2CMRL 2YR3A 4DZ8A 4X4XB 4APQA 2YWZA 1EGJH 5EC1A 3EO1B 5IFJA 1FH5L 2XG4A 4XPHL 1KCSH 1A1MA 2C1PA 1EHNA 3IDXH 4RQQA 5F7DA 4L8SA 3T77B 2A0LC 3I75A 3O2VL 4JFPB 2HH0L 3RNQB 2FRGP 4C4KT 5I73B 4UZGA 3EGSB 4GSDH 1MAKA 2B39A 1FNLA 3GSVA 3VFTB 4Q6IB 1JWMB 3QO0B 2IBZX 4XNMA 4DN3H 1QSVA 1J88A 4XP9H 5D6CB 3P11L 3OL2A 4PJEB 3V6OE 2HLAA 4XMLL 3P9MA 4Z7WE 4AT6A 4X9IA 3ARSA 1ADQA 5L2JB 3OJVC 2H2SD 4LHUB 5KVFL 4HXBH 5L2KE 2EXYC 3JV4B 1J05A 1SJEA 2BK8A 3B9DA 1GXEA 2FJGB 4G6MH 5FXCH 3E1F1 1T3FA 3QFDA 3ZTNH 1C12A 35C8H 4Z7VB 2EDOA 4WW2B 1BBDH 5I0DA 2AVGA 3CCHA 4CVZB 5BQ7B 4Y5XB 4OB5L 1F3JB 1W8OA 1WJ3A 3IFPA 5JUEH 4XHJC 2C1OA 4U2ZA 2EDJA 3PGDA 5DHYB 2X4TA 3UBXB 2R1WA 4RBPH 3FOLB 2IANA 4TUKH 1U8IA 4QCIB 4ZO7A 5IEHB 1CGSL 3V5KB 3OZ9L 1T66C 4ODSL 1OTUD 2DJ4A 4GG6B 3AMKA 5CJ8A 3RWFA 1ZLSL 4DFHA 4BELD 1PBYA 1XEDA 5EU3B 4ZXBB 5IVOA 3OPZH 4YXLH 4NPYA 2ED8A 3FT2B 4G80A 3B3IA 3NCYS 3QA3A 1IAOB 3FT3A 5BXFA 4UTBH 3LRSB 3DPBA 5EU4B 4HWBH 5GGQL 4GJTB 4OQTL 2ICCA 3OB0H 3C8KA 5JW5A 4QHLA 4PJAB 4Z7NE 2PW2A 2YPVH 2EKSB 3PHSA 1F45A 3HE7C 4FFZH 4OLZH 2EDLA 3WFCL 4C56A 2AJYL 2GJJA 1N2RA 2F74A 4U1HB 1QRND 1V7MH 4Y2DA 5IF0A 2B2XH 3HI5L 5GGRB 1RJLB 1BECA 2VH5H 3CMOL 4AG4L 3MBEC 5F89A 3PIQA 4I48A 5HVHB 4Y4KA 3O2DH 5CZKA 5CIPA 1EMTH 1ZKAA 5GS0H 4N8VG 4RX4A 5JIPA 5I1LB 5A2LH 1I1FB 1R5WB 4M6NL 4Y4HC 2ADGA 2Y9RT 3RJQB 3OR6B 5J7CC 3RVUC 4PLNC 4G8FA 4L4TE 3UYOD 4M1CC 2I26N 2UZIL 1MHPL 4LNRA 2NXYD 2NY6B 5T1LA 3RWGB 2AK4B 4TOYL 1ED3A 1K6QL 4XZUB 1YPZA 4WFFE 4LLVB 4PUBH 4X80L 4V1DB 1RZGA 5J3HC 1D3CA 5HI3C 1HHGB 3C60B 1KXVC 1IEBA 4DZBA 3E8UH 1S9XB 3QPQC 4NZJA 5D8JH 5IM7A 2YD6A 4YHOH 2Q7YA 4XBEL 1AQDA 4HJJH 1AXIB 2GAZA 3VFNA 1J11A 1NCWL 5FO9A 2Z92A 3BT2H 1IGCL 4PRBB 5FYKH 4YLQT 1U8KA 4HKJB 5C92A 4LSRH 4PJ9B 2JF1A 2OX5A 2QQLL 3VFSA 1UGNA 2SEBB 5DK0A 3LY6A 5DEGA 3MRPA 4U1NB 4RRPA 5CP3A 1FO0A 3MRNA 43C9B 5IK3B 4N8CH 3HC0B 4CKVX 1YC8A 5D2NE 3HCVB 1ORQB 2JJTC 1H5BA 1OGTB 5MENA 2E9BA 2DI8A 5D2LB 1JHTB 4LKCA 5EC2A 1I1CA 5L6YL 2ATKB 5GS1A 2NNAB 1QBMH 4GXVL 4FFWC 1GC1L 3E6HA 2F5AH 2W65A 2I07B 5DJYA 2EH8H 4ZTPH 1A7PL 5ICYB 5IMLB 1U2CA 4FTVE 1MREL 1T04A 5FDYA 3DIFA 3VRIA 1NGYA 4FXLA 2I27N 3C2AH 3TH4T 3ARFD 1P5UA 3WO4C 5KG9B 4FQIL 4XCCH 1L4IA 3TESA 1HDMA 3VD7A 2QQKH 1N4XL 2DLGA 3D85D 1D9KB 4AYFA 1XR8B 4YX2L 3O3BA 3MRBA 4R3SB 3B4NA 1AKJD 3FB5B 4NKQB 1BFTA 2J8UA 2BSSB 4TULL 3V0WH 3WXVH 4ZAKA 1NGPL 4YHLH 1ONQA 3BRFA 4NCDA 4CJ0A 5T3ZL 3DHMA 4RAVA 5BO1H 5GGTH 4RFOH 3QCVL 4OT1L 1AIFB 5JHDE 3P77A 5J9PA 2BFVL 3DVFA 4D0BB 3T0AA 5DQDH 2E7CA 2GKIA 3BDBA 3UCRA 5E03A 1BQSA 2ZUWA 1R5VA 3C6SA 1QYGH 2V2TB 1RMFL 4QRUA 4L4TD 5L9DH 3EOBB 2VQ1B 5IMKA 4MLIA 2KQNA 2F53B 2PXYA 3TBTB 3SPVB 4MMZC 1GGBH 2QHRH 3NH7L 4U33A 3BE1L 5JIKA 1DQDL 4WFFD 4WO4B 5IFHL 5I74C 5EWIH 1CFVH 4J1UA 3REWB 4MD0B 5FYJU 2CIIA 1RULH 3VG9B 1X5FA 3MRHA 2DLIA 3V5DA 1LNUB 1S9KC 1KOAA 3DSFH 4JPWL 2BSRA 1G7MB 1N0XL 3EYUL 3BZDA 3ZHLA 3HB3C 3TYFB 1GHFL 1T5WA 2Y6SD 2YSSB 3BISA 3S96B 2NY0B 1FCCA 2VLME 1BFOB 3HMXL 1B0WA 1Q0XH 2EZ0C 1KCVL 1CXEA 4OFYD 5D70L 2PTVA 4Y16B 3VWJD 3DWTA 1FGVH 5FHAH 1AGEB 1NAML 2ENSA 4HK0A 4XVTL 1E4XI 4JB9L 3GI8H 1P4LA 2WUCH 1HXMA 3V2AR 2MNUA 2X9WA 4G43A 5GISH 1JHKL 4JM4L 4QXUH 1LD9A 3LKQB 1OTSD 4Y89A 3PUCA 5J11C 3HNSL 4I5BA 4FQQB 3BP7A 5KZCB 3HLAA 5SWQA 2IADA 3OKLA 2FZ3A 3IF1B 3QEQE 4MQTB 5HHOE 1WQVT 1ACZA 1EEZB 3MRRB 4PJHF 4LPVA 3IFOB 3A6OA 5TF1L 4UDTB 1ZVHA 4KTYA 3WHXA 2N1KA 2PO6B 1NDMA 4OLVH 4POYA 1O0VA 5DD6B 2EO1A 1MCEA 3I3EA 1KN4L 1G7LB 4XCYA 1A5FH 1CDGA 4WI2A 2F5BH 4FTVD 2JTDA 3O3DB 4M61B 3ZL4H 1UM4H 1MRDL 5IVXF 3EYOA 5DJDA 1W72A 2WWKT 5FIEA 3TYGH 4R4BB 1ZXQA 3FRPG 1KCKA 4X9GA 3PHOB 5AZ2L 1M7IA 2O5YL 4MXWL 1S78C 4R0LB 4U1KB 5FUOH 5CZVL 7FABH 5H94A 5EU6B 2GY7B 1JTOA 5J6HA 4EDXB 3UTPE 1YECL 4R2GB 4HC1H 5IB1B 3IU3A 3RPIA 1LO5A 1NBVL 5BV7C 3BXNB 4HUWB 2BVPB 5I1DB 1U91B 3D18B 3RL2A 3HPLA 4XPAH 5JHDD 3CSGA 1MHEA 1NGXB 1JYWA 3JWOL 4PBWD 4OBRA 1U2HA 1AY1H 5EIVA 1MJJA 4XNZC 1MLBB 3EOTL 3I02B 1JV5A 5C0GA 2VXVL 1ZLUH 1GSMA 3DGGB 4I77H 1AD0B 2Z8VC 3MLYH 3AC0A 4HPYL 1BIHA 5EUKA 2UV3A 4FQJL 1UH2A 1N6QH 1SJVA 4EI5B 1U6AH 2MTPA 3WIFA 1BJ8A 3MBEA 3FZUC 4WIQA 1YQVH 2CK2A 1NQBA 2NYYD 2WBJC 3BP4A 3LKNB 5ICZA 1ZMYA 1UH3A 3MLUH 2CKBH 3HI1B 2OSLA 3H9SB 3WFDL 3N9GL 1ZHLA 5DGRA 2F19H 4Y4HA 1EFXB 1KTRL 3MNVA 4K94H 4XVJH 4HIXH 5T33H 2VL5B 1MQKH 3AREC 4K23L 4F8QA 5D7LB 5JPMA 5HDBF 2BRRL 2UVEA 1FGNL 5IBUB 1BX2A 2FBJL 5J6GA 1G6RH 4P59H 4BSWB 1G1YA 4K9EH 5IQ9B 4L3CA 1RUKH 4YE4H 1H15A 2OZ4H 3MRKA 4F7PB 3IAQA 3FN0L 5C0AB 1YNKL 4UIMB 4YHNB 1TJGH 2JCCB 3S8WA 3ULSA 2FX7L 1A4JB 1IGTA 4QYOA 2AV7A 3VGEA 1KF9B 1LP9B 4WNQB 3PABB 1ZEAH 5E9DA 3NFNA 3QEQD 1SVCP 5HHOD 5DC4B 3KPLB 4PJCF 1H3XA 1WLHA 3HZMB 3NCMA 4LAJH 4J3UA 2DBLL 1S7SA 4TSBL 1ZHKB 1UB6A 4JFFA 4MD5A 1KIRA 4ZO8A 4OZ4A 1KB9J 5C6TL 2BCKA 3VFGH 4HS6A 1OGAB 1FVEA 3ARXA 2XWJA 3OR7B 4TTDC 4WUUE 4DUWA 2PCPA 1A4KA 4WO4D 1UCTA 2JJTA 3JTSB 1MSPA 3U83A 2Y5TA 4NJ9L 2H9GA 4PV9B 3U9PL 1HHKB 1MQ8A 1FZKA 3VFUA 1C5CH 1QO3A 1OSZB 2OMNA 4K3JH 4R4NC 3FO9A 5E1AA 2R2EB 3H9ZA 5I6XB 2VXTL 4OZFB 1UJ3C 1G7PB 3HE7B 3IGAB 4RBPK 3UTPD 5AWNH 1MCRA 1MCPL 2Q8BH 3F7YA 3MLRL 5IQ7L 1KIPB 3SE8L 1SYVA 4P4KC 3P0GB 2G9HB 4HKBA 3M07A 3I9GL 5HJ3B 3CFCL 4X6BB 4UTAH 2F8OA 3RBGA 4NQEA 2BJML 3HZYB 3QIUA 1E6JH 5KZCD 4HGWB 3KYNB 2PN5A 1S7TA 2IMMA 4LCWB 1WIPA 1KLUA 2NY7H 4ONOA 3SGDI 1INDH 3HPJA 4NO3A 1KJMB 3GI9L 5HI5C 4Q97A 3E3QE 4KRNA 4PRHA 4ZQKA 4M02A 4P9HH 3IJSB 2VAJA 4WFEE 2RBLA 3TNMA 4HG4J 3UTTB 3LKPB 3BKMH 4LARL 2GJ6E 3GHBL 5DSCA 5GRWA 5C0JB 5TGBB 4U4BA 1XGYH 3S3JA 2FECI 1I8MB 1OD9A 3JWNC 3D3VB 3S36X 5AG9A 3QUZD 1KXQE 4M7LL 3EO0A 4NRYA 2RFXB 2XKNA 1UKQA 4Y1AE 5AD0B 3BKJH 3ULUC 5EZOL 2AJVL 3BZ4A 3JXAA 2QQNL 5SWZA 3TCLB 2A2QT 1H9VA 3GJEB 4UT7L 4XBPB 1VACB 1FZOB 2CH8A 5CBEB 3B5TA 4HJGA 3S97C 2FJHA 5IB5A 3CVHL 1FC1A 3VI4E 3HNTH 4RIRA 3V4UL 4J2XA 5EDXA 2OP4L 3HAEG 3KXFE 3OXSB 3MV9B 4KROD 4NZRL 2AEPH 2BVOB 4ZG1A 2W0LA 3CH8A 5CD3A 2NLJB 3CU1A 3PWPA 5CJOL 2HJLA 4XGZA 5INCA 1KPRB 2AAVA 5CSGA 1JHLH 5DWUH 3VJ6B 1E4KA 3HA0A 4CVXA 1L7TH 1P1ZB 1CXHA 3C08H 2P7TB 3EHBD 2X1PA 5HGAB 4XCEA 5D71H 1DANT 2R2CA 3QUKA 3IFNL 5I1GL 2EKJA 5JA8B 2FO4A 4O00A 1X6LA 2P5EB 3GRWH 2AV1A 1YEIH 1N5YH 4ETQA 2HFEA 3TT1H 1INEH 1CICA 1Q0YH 1KIQB 2GTWA 1F11B 3GB7B 1XGQA 2R1YA 3FB6A 1OCWL 4EI5D 4WUUD 4QT5A 5DJXA 4LCYA 1U8JA 2CKNA 4UQ3A 1ZAGA 2IPUK 3N1GC 1BEYH 3FONB 5C0IB 1VSCA 3DUSA 4NBYB 1EFXD 3G5YB 1UCBL 5ICXB 3ARBC 1MCBA 1G9ML 2J4WH 2Z0BA 2P47B 4XPBL 4HUKB 3G5XB 5DTFA 1PX4A 3BGMB 1OAYL 2DWDA 4Y2OA 3T2QA 1O5DT 4EBQH 1SY6H 5K33A 1CFBA 3KVQA 1IT9L 2YRZA 1INQA 3T65A 3RI5K 1HQRB 2XQYK 4ODXA 2XWBB 3DURA 1V8HA 3D69B 4R8WL 2I5YL 1CF8H 4LOUC 1T7YA 5F9OL 1B6DA 3HI6L 2WV3A 4F7CA 4QEGA 3PP3H 5I17B 4P2QB 4GG8A 2H32B 4WFED 3RWCB 5I74B 3GBNH 5IBTL 5DRWA 3LKRB 5TDPA 1LHZA 2GJ6D 1DQLH 4M3KB 3WIIH 2HTLD 1RJZB 5H37G 4OLUL 2H6PB 4F58L 2EDRA 3G6AA 4LGPB 4Y1AD 5F3HB 3P3YA 1QLFB 3L3IB 3IETB 1OB1A 4PJ5E 1K8IA 3MR9A 1IGJB 2EC9T 1E4WL 3WN5C 1MI5B 4L8DA 4LLMB 2NXZB 4NFCA 1OAQL 4JY4B 3IRZA 1J8KA 3BHBA 2PYED 1F4YL 4OI9A 3V7AG 3K0WA 3KXFD 5E24E 4OJFL 1NGQL 1PSKL 2VSCA 2WBJA 5BJTA 3WUWA 1DVFC 3SE3C 1WV7T 3WNPA 1GVIA 1QNZH 4YUEH 5TQ2H 4NQCB 4OIBA 4PRDA 2HYMA 3QYCA 1OHQA 5C07E 1MCDA 2ESVE 4LCWD 4NNYB 4OLXH 3MLPA 2IC2A 4JZJA 5E94B 2ZCLL 1RPQA 4NC2B 3L5JA 3SDDC 3ZDXE 4GRLB 4P46B 3GIVB 5ILTH 1MELA 3FFCE 1P2CB 3UTTD 3WLBB 4JO3L 3GO1L 1HKFA 5HGDB 3S4SB 4Z78B 1RZIB 4Y4FB 3KLHD 1FNGA 4M7LT 1FFNB 2MSPA 3BGAA 4FZEH 3PXJA 4UAOC 4LLWA 4NQUA 3D3VD 1IAKB 4HCRL 4QRTB 1SM3L 1ZLVK 5C86A 2VDPL 1WF5A 4RFEB 1KELL 4KJWD 5I1KL 2OR8A 4CUCA 4HUUB 4F7MA 1YNTA 3W11C 1J1PL 4FNLH 4ODWA 1CIDA 1X5AA 5F9JB 3UJIL 4B53A 4IRJB 2GSGA 4JPIA 1G9NL 4EIGB 1HIML 1IM9D 5BS0B 4XC3L 3C2SA 2HVKA 2LE9A 4BH8B 3RX8A 3F5WB 1U8LA 5GS3A 1FSKC 3QG6B 3LCYA 3QHFH 4ZUVA 2DYPB 3CFBB 5CJQL 5ALBL 3RUGA 1UJ3A 3RY6C 2Q6WB 5C9JB 5HBBA 4MX7B 3NAAL 1XF2B 2H26B 2CDGA 4HAGA 5K9OA 1UG9A 4YDLC 3QG7H 1CE6A 1NGWA 4QRQB 2DQIL 2P5ED 4P5MA 5F7MC 5TPWH 3ORJA 4P4KA 3WS3B 2CR6A 3JVGC 3TBSA 1AO7B 4N5ED 4V2CB 4FMKA 4ODHH 4KI5C 5H2BA 4GT7A 4AEFA 15C8H 3AREB 4ZUSB 4H1LB 4PJ5D 3ZYOA 3DJ9A 3PE9A 3TC9A 1IGML 4WV1C 5FDWA 3K8KA 3W0WB 5DD3H 3UTZA 1DQML 2ZJSL 3UJTL 5EU5A 5D7JB 1AQKL 2UWEB 3QULB 3QCUH 5HYFA 3FQXB 2ZZUT 5IEKB 3I6KB 2YA2A 3W9DB 3P9WB 3LEVL 1E6OL 4R96B 5DZNA 5DFTA 1A2YB 5C08A 4PJHB 3TO2A 4D94A 5F88A 5JMOC 4HFUL 3I3BA 4JFHE 2X4RB 5E5UB 5MEOA 2NY2C 4NUGH 3V6ZA 5C07D 5HVFB 5KS9E 2R2BA 1B6UA 4M5YL 1ZWIA 2Y36H 3T8XB 2ESVD 5KVEH 1KYOJ 2J8UF 1XH3A 2HT4C 4U3HA 3D2UD 4LAQL 3F7VB 1LMKA 1U58A 1MCOL 1EJOL 3MPCA 1S9WA 1OAXL 5IVXB 1IILE 5FYJE 1U3HA 3E6FA 3FFCD 3CPLB 1IKFL 1Z5LB 3TNNB 1YEJH 3HMWH 3HR6A 5BCAA 1KC5H 4PGZA 1PKQA 4OFVA 3FFDA 3QRGH 5JDSA 4S0SD 3C8HA 3PP4L 2DLHA 3X12A 5JHLL 1WFUA 1ZANL 5FGRA 5FA3B 3UX9B 4JR9L 1F97A 5F7WC 1MI5D 4M9OA 3IDNA 2NXZD 3P4LA 1AGBB 1AR1D 3VFOA 5DD1L 3Q5OA 4ODTH 5I1AA 3DO7B 4IIQC 5FOBB 3RVXD 4X6DA 3ROOA 4I18C 3GBMH 4PJGA 2YD1A 3G6DL 2CLVA 3NA9H 5IVZB 4KK6C 1KJ3L 4OF5A 4DK6A 5HHQB 4YXKL 1BREA 4R97B 3RVWC 3WIHH 1XAUA 3UPAA 3ARBA 4NQCD 1P4BL 5DDHB 3O2WL 2ADFH 4AK1A 1KJ2B 1LO4H 3DVNA 2XICA 2XQBH 1FLRL 3BESR 5BVPL 3EJZC 1AFVL 3BKYL 1F6FB 4AENB 3MNWA 4GRLD 1TJIL 3GMRB 3LMJH 3N1QC 4JFYA 4OZFH 5EORL 3RHWF 4JQXC 3KPSA 2DJUA 4D8PA 2ADIB 5EIIA 5IT2L 4QHUB 4KK9D 4GQPH 5IIEB 2CO6B 3GHEH 5CINL 3U1SL 4IOIA 4U7SA 2BNRB 2QSCH 3J7HA 4URTB 1H0DA 4DGVH 1LK3H 4OCXL 2FGWH 2QEJA 1DLFL 3WSQL 2HRLA 5F21B 3KYOA 3HG1E 3NIFE 4Q0XH 1HCVA 1JF5A 5FB8A 3V8OA 2IALB 1CL7I 3CK0L 3SDYL 2VRAA 2VDLL 3RX7A 4ZFOA 4K07A 4JHZA 4PJCB 3BVNB 3O3AB 4N8VA 4CMHB 5BS0D 3M17A 2YBRA 3WHE0 3NCBB 2NY1C 2HT3C 5IKCB 3WE6B 3WN5A 4NNPL 4WY7L 1WZ1H 4KU1A 3X11A 2OJZH 4HV8B 3L7FA 2X5PA 5C0CA 5EFIA 2J12B 2P43B 4Q9RL 4DJMA 1DVFA 1KPVA 5JPNB 3TA3A 5DUPH 5FYJD 3RDTD 1YN7A 3ZE2F 2RIKA 1JWSA 4JKPH 3TBYA 1B4JH 4PLKD 4CN1A 1AP2A 1Z6JT 2Z31B 4MB4A 4RAUA 5LCVH 2ID5A 4G6AC 4ODBD 4LP5A 5JORA 3MYJB 4M62L 4DKAA 4P2RB 1ROWA 5ID1A 3MRDB 5CJBA 3SDDA 1OF2B 1U8PA 2NY5H 4ZPVA 1AC6A 2CDFA 4YNYA 1ITBB 3IDYB 5GXBB 3QNZB 5EZLA 3MGTA 3VGDA 2UYLB 4O58L 3MV8E 4L5FH 2F58L 3NFPB 4Y19A 4KVNH 2KL6A 5FO7A 3TBWB 4DUXA 4KDVA 4PV8B 5E4EC 4WHCA 3WKNA 4XVSL 1A7BA 2DQCH 4FXKA 2R29L 4QO1A 5BW7C 4ZUTB 5JZ7D 4S1QL 1QTYT 1K4CA 5I76A 2AKRB 5F1NB 3AS2A 2P5WE 3T0XA 4WWKC 5TE7L 1WTGT 1BZ7A 3IDJA 3LAFA 3QUXB 4EI6A 3IKKA 3JV6B 4M8QB 1TQBB 2D31A 3K46A 4N0CC 4NT6A 5E2WH 4DVRL 3DETD 1C1EH 4LSPL 5ANMB 5EG6C 3CH1B 4X8JA 4L4VB 3QWOB 1REIA 4OQTA 4S1RL 2BSTB 2IPTL 2X4OA 1WBXB 5CJ5A 1KENH 3O4LB 3U4BH 1A7OL 2VAAB 1UWEH 2V2XB 3SGEI 3JWDL 3RY6A 2VC2L 3UC0H 5INDA 3VRJB 4DGIL 2D0GA 4BUHA 4MJ5B 3T1WA 2XN9A 3SDXB 3LD8B 4X6FA 4PGDB 3HG1D 3WFEL 3Q5YA 3JVGA 1ERNA 2R39A 3EFFB 3CD4A 1ZT4B 5ESAA 4QRPA 1RK0B 2YPLE 1EA9C 2QJDA 4Q9CA 2J8OA 3GKZA 4HMCA 4JY6A 2A77H 5TJWK 4AIZA 2VYRE 3ARQA 2H32H 2KPNA 5B22A 4XP4L 1DBAH 4WV1A 5IESL 3QHTC 1D6EB 4X6CA 4ELMA 4IOSD 4YHZH 1WVZA 3HS0B 5E70A 4ALAH 2CLRA 3KPNB 3MJGX 4TNVK 5DD0H 3G04B 1T20A 2WIMA 4QXGL 2YA1A 4JJ5A 3U7YH 1CG9B 5DZLA 4LKXB 3ULVF 5D5ME 5EA0L 2QADD 1KCSL 1LO2L 3IDXL 3PDOA 5E7FA 2BY2A 2JIXB 4EN3C 4KUCF 2RHEA 4GS7C 3EZ8A 3CDYA 2FDBP 1ZT1B 1W0YT 1ETZB 3B2UD 1BBJA 1YYLL 4HW6A 2FWOA 4MA8H 1N26A 4WEBH 2WWKO 1EHXA 3OSKA 2P8MB 3RNKB 1IL1A 3U79A 3MV8D 4OCNC 1U92B 2IFGA 4PS4H 3UO1L 5CMAB 3MUHL 5F6IB 1CFQB 2QQQA 4TVSa 1BJMA 4OFIA 1DQJA 3L5WB 2DWEA 3MA9H 3SKNB 3ZTNL 3GIZH 35C8L 4OZIA 2P5WD 1Q9LA 2E6PA 5IP4A 2APTA 1JZ2A 2PETA 3U0PA 1TZGH 3QQ4A 5GRJL 4IIQA 1YEKH 5F1IA 4PD4K 1S7QA 1JN6A 1FC2D 5JUEL 1BIIA 3L95A 2EIBA 4RGNE 4I18A 4ZODA 3O11A 4NQVA 2OJEB 4GAFB 2ATPB 4KH2A 5LKNA 4GW5A 4MAUH 4TUKL 3BOVA 4ZDHB 1RK1B 4ENEC 1MUJB 3JZ7A 5HD8C 3FRPA 1E4XH 1NBZA 2BMKA 5T1KB 3RWIA 4X0KA 4MB3A 3PF2A 3HRZA 2VB5A 5D7KE 3RTQB 5J56B 3E2HC 4LCUA 25C8H 2WBWB 1IZJA 4G8IB 4XXCC 3OPZL 1I1AC 1NLBH 1WK0A 5FKAB 4YXLL 5J1AA 5DJ6A 4FMFA 3BN9C 4CAGA 2J8HA 1M05B 4YGVA 3L7EB 4K3GA 4PJIA 3LN4B 2DQGH 3BP5A 2G5BB 3L3DA 2W9DL 4ACPA 1AR2A 4KAQH 3DMMB 4JQXA 4PRNB 3RWHB 1VENA 3U36B 3ES6B 4KKAD 2YPLD 1T7VA 1ZS8A 2YPVL 1CLYH 4H20H 3NIDF 2O61A 1IQWL 4OLZL 4PB9H 1V7ML 4OCYH 2MFNA 2FL5A 2B2XL 1DLHB 2VLKB 4HIJB 4K7PL 2R4SH 4R9HA 2VH5L 1JRHI 5GGSY 5D96C 1U8HB 3B8SA 1MCSA 4CN6A 3WEXA 4CMMA 1LEKB 2J1KA 5BZWA 4G6FB 3O2DL 3W9EA 4G6JL 1EMTL 2E27L 5GS0L 1TZHA 2B4CC 3PWVB 4H1LH 4S1DC 2EICA 3QPXH 4BZ2H 5C2BH 1ZGLB 5FUCE 1U8QB 2EDBA 5L0QC 4HK3J 1RZJH 3HMXA 3QXUA 5E00A 4FQXA 1UZ6E 2KZWA 4L4VD 2XPGA 1KN2H 4PUBL 5C0RH 5DFWH 5LGJA 4G9FB 2W38A 3ROLB 3VFVB 5TH2A 5C6WH 1Q9KA 5IV2A 1Y6MR 1A3LH 2HN7A 4LNRB 3VD5A 3D1MC 2IANE 3CZFB 2G75B 5GGUA 1EIBA 5D8JL 4E41B 2DQDH 2DQUH 4PP2B 1F8TH 3GMLA 4YHOL 4CBPA 4HJJL 5DFVC 2Q86B 4RDQF 4OCRH 3UROR 2ARJA 1IEHA 1LEGB 3IJHB 3WYRA 4JVUA 1I7RB 4J6RH 4NHCH 5DJ0B 3OV6A 1NFIA 5DQ9A 1BGXL 3I84A 4WDIA 5CWSB 1MFAH 5E8NA 2A6JA 1L6XA 3CC5B 4N8CL 3W39A 3O4OB 4JKWA 1A0QH 1A02N 4PREB 2IG2H 2JELH 1Z0MA 1DL7H 3KPMB 5A2JH 1MEXH 3R06B 2GUOB 2D2OA 4YO0A 4L8CB 1CDHA 4C56E 1Q38A 2Y72A 1M6OB 4RGND 4GLRI 3CSYA 4L3EB 3BUYA 3QI9B 1IGIL 3D0LA 2CD0A 2F5AL 1I3RA 2EH8L 4ZTPL 3UAJD 5BW7A 1FNEA 2CPCA 3VI3E 3LH2H 1AE6H 4WWKA 5D7KD 4X5WA 1B0GA 1BPVA 5HYSA 3RWEB 3C2AL 4XWGL 3GDBA 1EXUA 4A6YB 4MDJA 3QNXB 4O02H 1YPZE 4P5TB 2HG5A 1S5HA 1M71B 1CVSC 4PJ8B 1A6AB 3CDFA 2GY5A 3MUZ1 4WTXA 5FA4A 5CEZE 2BOCB 1RZ8A 1KJ2H 4AEIH 1HI6B 4YHLL 2Z9TA 3EO9L 4D0CB 5KJRL 5GJSH 3BAEH 2BXYA 5E8DH 5GGTL 4RFOL 5B39A 3NACH 2F53E 3MOBH 4LP4A 1OTTD 3KJ4C 1KIUA 5I8EB 1T1ZB 5DQDL 3PWNB 4LEOB 4XNQB 3ULUH 2AQ1A 4EQ2A 2F8VA 5CGMA 3VFMA 3QO1A 1N59A 3T3ME 1NCDH 5L9DL 1SJHA 2FJFB 3WFHB 1JGDB 2C3VB 4M6AA 2VWEC 1RIVH 5MENE 5FGSA 3IFLH 1S7VB 3O9WB 3IDUA 5EWIL 4Z7UB 3FO0H 5C70A 3NN8B 4DWHA 3DUUB 3RUGF 5A1AA 1RULL 1VGEH 4LASH 2NY4D 1UACL 4NNXA 3T0WA 2IAND 2YC1A 3DSFL 1TQCC 3MCLH 3HAEA 4DTGH 3D39B 3OF6A 4BQBA 1RSFA 5FGBC 3MREB 1YN6A 1ZVYA 3SGDH 2HMID 4OSUH 2VIRB 1K8DB 1Q0XL 2A6IB 3O45B 4YIQA 1NSNH 1J5OH 3IDMA 5D1XC 3OWEA 2AERT 1FGVL 5FHAL 3EDEA 5DJZA 4P48A 2JK5B 4MNGA 1SEQH 2D0FA 4OD1L 5EPMA 5IW1A 5CHNB 2BVQB 3EFDH 4EN3A 1KFAL 1MFCH 3GI8L 2WUCL 4HPOL 5GISL 4OZHA 2VLKD 1J87A 3SCMB 4QXUL 3DRQA 3EYFB 1AGCB 5ESQA 2J8UE 3SGJA 3O8XC 1G9NC 5F44A 4UUJA 2AJUL 4UT6L 1S5IH 1V3KA 4Y2DD 4Y8AA 4LSTL 5EOCJ 5GRUH 1Z3GH 5D1ZC 4S10A 1B0RB 3FMGH 4X4YB 4WGWB 4OLVL 3KLDA 3FQTB 3GMOB 1S3KH 4RX4D 1A5FL 1CXFA 1ZA6A 4GBXC 2F5BL 5DC9B 4XP6H 5I19L 3MGOB 3ZL4L 1HWGB 1UM4L 2R4RH 2RQ8A 2A9NL 5BRZB 5DEFA 2XQYG 4F80A 5DMKB 3O6KH 1A6ZA 4ZPTA 5T1LD 3SKJH 2JKXA 1CGYA 4M4RA 2A83B 3TO4A 1NCCH 4E41D 1G7IA 2ICWI 4ZUWB 2GT9B 5FUOL 4GRWE 5DR5H 43CAA 5SWSB 3BWUC 3M1BA 3NCCB 5C0DB 5CEZD 5I2IA 4NUJA 5LWYL 4L8BA 2DQTH 2OR7A 1T1YB 3ARGB 4HC1L 4NYLB 4XXCA 2FSEB 1UKTA 4H5SB 1BAFH 1QSEB 4ODUA 4XPAL 3LEXB 1X6NA 1YY8B 3WNLA 3HUJA 4Y5YC 1RUMH 3PWLB 3ILQD 4JFOB 2D4DA 2EDNA 1R3KA 2P8LB 4IJ3C 5F71A 4JRXA 1JJUA 3CUPB 4NGHH 3VDAA 3QDGB 2OR9L 4PJGF 2Z8RA 1HEZA 1N6QL 1AXTH 1TJHL 5MEND 1U6AL 1PAMA 4HUNB 5ETUA 5C0BB 4I0PC 4P57A 1FYTA 4GS7B 5DVOA 5IG7A 3TPUB 1HYSD 2G5RA 2CKBL 2VKWA 2AABH 2RCSH 1DQTA 1Y0LB 5BZDA 2F19L 3MV7A 1OARH 4XVJL 1MQKL 5JOPE 2IQ9H 2XZAH 3I2CL 4X8XA 2RAMA 3RKPA 2XTJC 3HR5A 5A3ID 4BFIB 1G6RL 1JZ5A 4NO2A 5CS7A 4K9EL 5IB3A 4ORGA 2AW2A 1XZ0A 4JZNB 4Y8DC 4PJ8D 5I18H 1DFBH 2OZ4L 3BYYA 3FQUB 2AGJH 4GW4A 3GK8H 1CDBA 4HIEA 4OF0A 3RRQA 4K8RD 4LMQI 3O41B 5C09B 4Z77B 4TPRL 5BOZG 4DOHB 1FJ1B 1RU9H 1I7ZB 1AGDB 1ZEAL 3FQNA 2BSED 3DXAA 2FHFA 1HZHH 4ZAKD 3OX8B 1T22A 3GSNB 4QOKB 4XBGB 2PR4H 1BFVL 3O6FC 1WWBX 1BD2B 4FQCL 4M7JL 4NWTH 4HS8H 5DYOB 4H0HB 2A6DA 3WKML 4NOBA 4ISVA 3UEZA 3IDGB 1D5ZB 2X9XA 3N1MC 1OM3H 4OBSA 4HUVA 2GSIB 3LRHA 3EYSL 2EO9A 3E2HB 3VFGL 5GGSA 3V8CA 1MNUL 1KB5A 1I1AB 2WWMD 1CR9H 2NW2B 1QHPA 5FCUL 5MEPA 1UYWH 2PXYD 1AJ7L 4RFNC 2F54B 4PRPB 1C5CL 3OJMB 1TZIB 4K3JL 3T4YB 3DTXA 5CKAA 2VSDA 1NFDA 1FG9C 1QEWB 2B5IB 2Y7QB 3CVIH 3QJFB 4JLRA 2PTTA 4OUUB 2Z91A 1MHCB 1FVCB 1A9BB 4N0YH 3BPCB 3RGHA 1NBYA 4IOFD 5AWNL 4WUKH 3ZT5A 5IHUL 1FL5A 4R7DB 3B5HA 1CXLA 4B5EA 1W0VA 4TTGA 3Q5TA 4U6HB 1JPGA 2XY2A 4UTAL 4TUJA 4NKMA 4NDMA 1TVBB 1CD9B 4U1IB 1E6JL 2VZOA 2ITDA 3FRUA 3SJVB 1UENA 2APFA 5I1IH 4D9QE 1GZQB 1XT5A 2NY7L 1INDL 1W8NA 2GHWB 5L0QB 4NC1C 3D25B 2ZUSA 1QFOA 3WFZA 1KJVA 4P23B 5C7XH 5I75C 5E9DE 3QWRA 5KSBA 1RZFH 1DCLA 4G5ZH 3BKML 1BZ9B 3QNYA 1XGYL 2I24N 2FCBA 3CDGB 3LKSA 4JFFE 1WIUA 5JTWA 3QSKB 3CSPA 5DC0A 2CR3A 2XIDA 2FR4B 4O5LH 5F8RC 1KLFA 4AM0B 1FAKT 2UVFA 4KMTH 4M7ZC 2P48B 1MLCB 2B1AL 3T0DA 1RJYA 1P5VA 3OJDA 3R8BB 4I13B 1T83C 4BH7B 4GAGL 1MJ7L 5I30H 5AUMA 4AY0A 3BPLC 1VKXA 4HS3B 1JHLL 4HHAB 2EEAA 5DWUL 4U1JB 4XT1C 3CXDH 1MFDH 1KV3A 2J6EH 2QSTA 5B8CA 1QSED 3C08L 5FGBA 2XI9A 1T66D 5FGCE 4AIOA 4EVNB 3GKWH 4JREB 4M93C 3P73B 4P9ML 1D5BB 3F7RA 3PV6A 4DN4H 5K59F 1YEIL 1N5YL 1ZTXH 1J8HA 2VABB 1PFCA 3PWUB 5FECB 1Q0YL 3ME0A 4NQEE 3RFZC 1O7VA 2IAMC 3LPFA 3TVMC 3CFKA 1H3VA 3PL6C 3HC3H 5M95B 2EH7H 4PJFE 4QXWA 2R1YB 2YOCA 4S2SA 4X6CF 5EO1B 4ZYKB 4PRHE 2XA3A 3QCTL 2D4FA 1BEYL 3ILPB 1GZPA 2VE6A 3SO5A 5LGHH 3MBED 1QSFB 3IDIA 2P49B 3S5LA 1RHHB 5M7QA 2DIBA 3OGOE 5KSAC 2X70B 3FB7B 3ZLQC 4FFYL 4X6EA 4M5ZH 4GBXA 2GFBA 2R1XB 4Y4HD 4KKNA 1JGUH 5I8CB 3VXPA 1XIWC 3RVUD 1FNAA 2XWTB 5F70A 5SWZE 4O2CA 3MRGB 4M1CD 4YDIH 2XZZA 5DI8A 4JFZH 4IRSC 1UXWA 4X7SH 2VXQH 4EBQL 1MVUB 4DKFL 1AD9A 4POZC 4GKZB 5CEXB 2YD2A 4XVUC 1VEPA 4G9DA 4PJXA 4Z5RA 5J3HD 2VZUA 5TQ0H 2P24B 2EDQA 5TFSH 1K4DA 4D9QD 1FRGH 5HGHA 2WAHA 3AU1A 3PWPE 1OSPH 3QPQD 2WLYA 4LIQH 5J12C 4OV5B 3OG4B 5E9DD 3QHZL 5DA4A 3KPRA 1R5IB 4A6YH 2R23A 1J18A 1EO8H 4EDWL 1MCIA 4L29A 4G3YL 3RGVC 1DQLL 3ARRA 3B2VH 3IKCB 3WIIL 4BKLA 3VWKB 4C58B 4OTXH 4Y5YA 3L6FB 1GGIL 1E28B 4JFFD 5DRWB 2BVYA 4QWWC 5DVLA 3MCKB 1F58H 4WI3A 3MX0A 5T1MB 2WIIB 3PQYA 2BOBA 4JFEB 2F54D 4PRPD 2E7LC 2WMPA 7CGTA 4OGXH 4PY8J 2OQJB 1V3JA 4YK4B 4GUPA 1UB5A 5D1XB 1J1XH 4MVBC 4UV7H 5F3BB 4ZD3H 4U1MA 4D9RE 5A2FA 1HSBB 4PG9B 3KDMB 3VGAC 3Q2CA 5H35A 3TZVB 1SYSA 3MRCA 4I0PA 2D9CA 1WCQA 4FRWA 3BZFB 4D0DA 1KPUA 3LOWA 4YAQA 1A6TA 5EN2A 1Q94A 3D9AH 1XGUA 1EPFA 3O8XB 4TN9A 3KYMA 1J86A 4Q9QH 3V6BR 3EJYC 1FPTH 3GMQB 4XNUH 4YUEL 3QZWG 5TQ2L 4MQSB 2ZNXA 3R1GL 1B4RA 2XXMB 3C5ZC 1GOGA 5D1ZB 3VXUA 3BDYH 3BP6B 4QRSA 4ZO9A 3TJHC 1YZZA 4K7PY 1EBAA 1FN4B 4R26H 4MGXA 3T2NH 2JJSC 1WCBB 4TUOA 4FQ1H 1CL7H 1FZJB 1JNJA 4HZLB 2V17H 1QD0A 4JDVB 1QR1B 5ILTL 3QIUD 2IMNA 3BEVB 4GXUN 1KB9K 2IQAA 2DLFL 1FDLL 3FQRA 5CD5D 3TPKA 5IOPA 1H3WM 4U6XB 3WXWH 2VO5A 5E08H 3WD5H 4PRHD 1C08A 3MLXL 3O6FA 2FIKA 5JO5B 3U0WH 4NO5A 3LB6D 4X9FA 2F9BT 3B9KC 3X3FH 5K9KA 1NL0H 4OKVA 2NX5A 1EEYB 1J0ZA 4Y5VB 3VXMA 1WBZB 32C2B 4FNLL 4KPHL 4K7FB 1QLRA 4MD4B 1YEEH 2H1PH 2XT1B 3T0EC 5GJTH 1KLGB 2BY3A 3RI5F 1CZ8H 1MCHA 1NMCC 4OAWB 3A6BH 4U1SB 3QHFL 1XR9A 4IJ3B 4MA1C 1KT2A 1CGUA 3KNBA 3QIBC 3MNZA 3QDJB 4WI8A 1NC2B 3HB3D 4LBEB 1D5XA 3L3HB 2ZUTA 3RUGB 4PYHA 4JRYB 4RWYH 3VXRA 3MZTA 2V9QA 4X83A 3SQBA 4F15B 1MH5A 1M7DB 3HE6C 1HH9A 4XTRC 4HG4K 3GMMB 5GS0C 1OP3H 2ZP0T 3BIKB 4ODHL 2VR5A 4S0TD 5FYLH 2V9RA 4AIXA 1LE5B 2VERN 2ICWB 4PJ7B 3MRIB 4HKZA 1CICD 1RZKC 1TETH 2OBGA 4H8WL 2DB8A 2OLDA 2LTQB 1WGOA 4Z76B 5H2BB 3MRJA 1SEBB 4RMUA 2OTUB 1YMMB 4LPTA 5HDLA 5DD3L 3BI9X 12E8H 1CU4L 3QDHA 1X7QA 1UM5H 1FVDA 1DDHA 3TN0B 4A2MA 1UZ8B 5C9KA 1T4KA 4M6OH 5HHVL 1CGVA 1ORSB 2XTLA 1VDGA 3SGEH 4TVPD 3MMEB 5B38A 4N0UB 4ZFFB 4N9GA 1ZVSA 2WANA 3WFBH 4NUGL 5KN5B 4E5XB 1G1CA 2PYFA 1FFOB 2Y36L 3TO2B 4WJ5B 5J89A 1D6VL 1T83A 4LSQL 2PTUA 4NN5C 3OXRA 5BVJA 4O2EB 1X3DA 1OWWA 1FYHB 1HHHA 4ERSL 5HY9B 1S78D 1RZ7L 3IS0X 4LNVA 5C6PB 2N4IA 4DVBA 1YJDH 4PG2A 3QJHA 4RFNB 1YEJL 3HMWL 4MDIA 4X98A 1KC5L 4JFXA 5E4IA 1BVKB 4TSCH 3VWKD 3RZCA 4PJBA 1A64A 4XCFH 3MJ9L 4ZSOB 3JUZA 3BWAA 1IE5A 3MLSH 3MXVH 1K2DB 1MPAH 2XNAB 1IBGH 3N85L 4PP1C 4JFED 4LF3A 2HWZL 2KDGA 1PZ5A 5K9QI 3AAZA 2IAMA 3NZ8B 3QIWC 2OMBA 1YEFH 3PL6A 3GSNH 1YUHB 3ECBB 1IQDA 3MSPA 5ISZB 1MVFA 3AB0B 1QVOA 5KANI 5I1HH 3JSSA 5DURB 1YC7A 1TVHA 3STLA 3LV3B 4YHPB 3OKOA 3FZUD 3GSOA 5K93A 4Z7OF 3V6FB 4PJGB 3V7MA 4DCQA 4JE4B 4PRIA 5AZEH 1F4WH 2ADFL 5EZJA 3QAZC 4UOJA 1S7RA 5M94B 5I75B 3UTSB 1ZGLP 1ACYH 3MRLB 4H88H 1XIWA 5C08E 3FO1B 2IH1A 3P4OA 4KJPD 2QR0A 4X99B 4IRSA 3ARWA 1VESA 2HFFB 5ADOH 4JFDB 4WU7B 3SY0B 1MRFH 5SV4A 3VE0A 2W9EH 4IDJH 1HH6A 4LRIC 4YDKH 1FV1B 2R0WL 4JN1L 5LJYH 1XF3B 4QHNA 4PY7A 3FT4A 4K71C 1GIGL 1T0NA 4P99A 3MYZA 4RMSA 1MFEH 4HEME 4YHKL 3MJ7A 2YPKA 1LK3L 4MNHA 5MERB 4YWGH 5I8KH 1ZT7A 5GRYA 1PKQE 1XGTA 4JANB 3LKOB 4Q0XL 4PJDA 3RGVA 5IB2A 2B4CH 3F6LA 3NGBC 3BPLB 2WSKA 4OD2B 4HH8A 1GPOH 3OHXA 3ULVH 5T3XE 3KS0J 3ARDC 2HKHH 4NSKB 2E7LA 3SDCB 1JNNL 2YEZB 3ALWA 4PR5B 4G8GB 4TTDD 1EGJA 2OJZL 2ZSVB 4RGOH 5F7UA 4N0FB 4X6DE 4DFIA 4HBCL 1CD1B 1XCTB 1BQHG 5DO2C 4BQ9A 4OCSH 2CDEB 1CFTB 3STZB 1JF1B 2YS4A 3X14A 3M8OH 3DX6A 5DK2B 3MLVH 3VXSA 3KYKL 5F9DC 3OAYH 3TVMB 3KWWA 5DUPL 1RQ5A 3SO3B 2ICES 3C6LC 4JRYD 5IHZA 1ITCA 3VXQB 1EFQA 3VD3A 4MSWB 1P84J 1U0QA 2FD6H 4JO1L 4WENB 3VA6A 4Z0XB 2CJUH 2ZNWA 3C5ZA 4OF8A 3HUJF 1BQLH 4JFQA 4NQXA 5D7IA 1JRHH 1MAML 5FUZH 4YFDB 5I66A 2FX8H 5KSUA 1I7TB 3LEYH 4KTDH 5KSAB 4O2FB 1HHIA 5IJKC 3CX2A 3MFFB 2JJSA 3PWJB 4KRPC 4RAUB 2WBKA 2VOTA 3KPSE 3UTOA 2NZ9D 4NZUH 4Q58C 3SDAC 4UQ2B 1YMMD 4K7PX 1E27B 3GUTB 1AGFA 4Z7NF 5LAXB 1GGCH 1QACA 4L5FL 2ZCHH 4MJIB 4YQXH 2CXKA 2EEDA 1T21A 4Q9BA 1T5XA 1S7XB 5I1CL 2CRZA 1WZMA 2Z93B 4FXGA 4H25B 2YRPA 4KVCH 3U6RB 2R0KH 3B9KA 4MCYB 1ZHNA 4G6KH 2HRPL 1MJUH 4E42A 1VADB 4CVUA 4QF1B 2VUOA 4KZDH 1OVZA 3VXOB 5C08D 5E2WL 3S36H 4YBLC 3AXLB 2K7PA 3GSRA 4NQDA 4F3FA 5DRZA 3Q3GA 4HWBA 2VDOH 5I15L 5L88H 5C0CE 3V0VB 1KCUH 4F37K 1KENL 3U4BL 4LCCA 3FQWA 5HYJB 1GAFH 5SX5H 5E99H 5KAQG 4WGVB 5KTEH 3IXTB 4XC1H 1HQ4B 1DEEB 1C16A 3UC0L 1U3JA 1U3HD 2EYSB 3DVGA 4OLEA 4MMXC 4EXKA 1VFUA 4TVPH 5HPMB 5HGGS 4LSSH 2R2HB 4GLRH 4M1GH 4UU9A 3O2DA 3HE6A 4K55A 4RMWA 5L8JB 8CGTA 3QUYB 4K94C 2VDMH 1FFPA 2A38A 5T3XD 3U0TA 3QEUA 4JPKH 5J57B 2A77L 4QHKI 5DURD 5IBLC 3WDIA 5I16A 4IEFB 1A1NB 3O6MH 4CNIA 1FAIL 3BPOB 2BNQB 3DV4B 5GHWH 2VZVA 2YD5A 4K9EC 1NFDF 4ONGL 4X7EC 1OY3B 3EOAA 1QA9B 2Z4QA 2I9TA 4Y19E 4GKSA 4OM0L 4HF5H 4YHZL 1X4YA 1T2QH 2E7MA 3FTGA 3TT1L 4HMDA 3IAGC 2BX5A 5ALCH 1NGZA 1S8DB 5ERWB 1KYOK 1DN0A 3BZEB 3X13B 5DLMH 3UJJL 1N0LA 1MRCH 4X6CB 3I6LE 3KYAA 2OS7A 4JFDD 3MJ8B 3QXAB 2PF6A 5JR1H 2W07A 4NO0A 3ARFC 4HFWA 5IJVA 5I73C 3BQUB 4XPFH 3TIDA 4WI6A 3HNVH 1FIGH 4XAWL 3MACL 3ARZA 4NN7B 5C0EB 4QHMB 1TPXB 3MUGB 4KWUA 3LS4L 4EUPG 4WEUD 1N5AA 5DJAB 1WFNA 4OKDA 4QRRE 2VN4A 1BOYA 3G08A 3FO2A 5C3TA 3T0EB 1F90H 2AJ3B 4LOUD 4MNQB 5I71B 1NMCB 5GGRY 3PV7A 1A9EA 2FWOB 2GITB 4I2XA 1IEAA 4ONFH 5HGBA 2XN9E 4FOMA 3LPGA 3BH9A 4CADA 5GZNC 1U95A 3ETBF 4OZGB 4MA3A 4XRCB 3B8YA 3QIBB 5ABDE 4WW2C 2R9HD 5JIIA 5HTSA 4QRPE 4KI5E 1YDPA 3OKMA 3BUTA 4QGTA 2P42B 2BHUA 1MIML 1TCRA 3UXFA 1Y18A 3QIWA 1YEKL 5FFLA 1NPUA 3LSOB 5EBMA 1I8IB 2BP3A 1T89C 5IMOB 3TBVA 5TE4L 4L9LA 5EO0A 4MAUL 4UNVA 5C0CD 4AQ1B 4UT9L 4MAYA 4ELME 1YNLH 3UTQB 2XRAL 1E4XL 1A6UH 2W59A 5BV7L 4ZXBC 3C5JA 3TA3D 5ELIA 1XGRB 2D03H 4P9HC 1KTLA 2V2WA 1R3JB 3JTTB 5GGTA 2W0PA 1JGLH 2FEDC 1B90A 1FFQA 1RIHH 4KAQL 2JB5H 4D3CH 4X7FC 3MZGB 3ZT7A 4U1LA 1KEML 1CLYL 4H20L 2VISB 3ZYZA 4P4RA 5E6IB 1NMBL 1U41A 5D2NC 3SDDD 4PB9L 4OCYL 3ZDYE 3FOMA 5TE6H 1OTSC 5D6DC 4JM2F 2X4PB 2R4SL 3V5HB 2OK0H 1DQQA 2V5SA 3LIZH 4HH9A 5ACZA 3NTCL 2DD8H 1RIUH 4Y19D 2PW1B 1Q9WB 5D9SA 1JVKA 4HX1A 4KTEH 3DRTA 4TNVF 1NANI 1HCFX 1UVQA 1QKZH 3GJFB 2VLJA 3H7BA 1HXYA 2VKXA 2B1HL 2ARWA 5CSZB 2I9LB 4BZ2L 2MCPH 3I6LD 4ZFGH 4OM1H 1DEDA 4OZIE 3ARDA 5FF6B 2NY6C 2P8PB 2BVEA 4IMLB 5HYQB 3W11D 1JTPA 1UJTA 1KN2L 3GBLA 3OKNA 5JDJA 5FO8B 2A1WH 5C0RL 1UXSA 3V4VL 2X4QB 5HYJD 1A3LL 4I4WA 4N9OB 1J12A 1ND0A 2VITB 2BC4A 2DQDL 2DQUL 1F8TL 1B9ZA 1NAMB 3P30H 2K9UA 3QFJB 4ZFZA 2LU4A 3C6LA 2HN7B 3K2UH 4M1DH 1NDGB 4X5XA 1XF4B 3FHQA 4PJ9C 3EYVA 5T3ZE 1KTDB 4NHCL 4U1GB 3QDAA 3SKOB 3QUYD 1NEZG 2XN9D 4LVHB 4F33A 3DBXB 1CVRA 4PJIE 1JPFB 1CD8A 1MFAL 4G7VH 3UP1A 5IJKA 8FABA 2AJXH 2H8PB 1S7UA 4QRPD 3PGFH 4KI5D 3MLTB 5IUSA 2BNQD 2IG2L 3QQ9C 3SDAA 4Y7MA 2E9WA 1MEXL 3J8F7 4IS6A 1ZSDB 5IR1B 5FKPB 1RUPH 2QV2A 5CBAA 1EVTC 2WINA 3R8QA 2W0KA 1CT8A 1QZ1A 3VDBA 1F6AB 1ZV5A 5F9AC 2NYYC 2O93L 3P4NB 1MCNA 5HXMA 1RURH 1U93A 2KUTA 4J8RA 3OGCA 2EIZA 3KJ6H 3KPOA 4JEGB 1JNHA 3H8NA 1AE6L 1CFNA 4HC1A 4BSVA 3TIEB 4WI4A 3SE9H 1Q9OA 3VGHA 5CLWA 4LRNL 4PRAA 2VLRA 2R56L 4BFEA 1MCWM 1IC7H 2DL9A 1D9KC 1UC6A 3MRFB 1HSAA 3ISWA 3WJLC 4FQHB 1FG2B 2AJZA 4NOFA 2X7LA 3RIAK 4GKNB 3Q6GH 1R0AL 3RKDC 2DDQH 2HT4D 4AL8H 3QH3A 1LO0H 1NJ9B 3W5NA 4AEIL 1HN1A 4PLJD 2JB6B 2HVJA 1P7QA 1UWGH 5GJSL 1U3YA 2NTFB 4YDJB 1DBJL 1XCQB 2DQEL 3NACL 3GGWA 1JGEA 5HYIA 4H1LG 4D9LL 2EDYA 4CU7A 2CKBA 4G8EB 4O9HH 3ULUL 2DM2A 4G7YH 4JAMA 2AXFA 2HFTA 2G2RB 2GI7A 1VHPA 1S9YA 4WO4C 2WQRA 2O5ZH 1JI1A 3IFLL 1H3PH 1G6RA 4F7EB 3VG9C 1FZMA 5TDNB 4HLJA 1RVFL 2OZ4A 5FM4A 4M7KL 2EIEA 3EOYG 3MCLL 4DKEH 3SKMA 3G6JA 4LLDB 1BOGA 2NY0C 5IW6B 1QRNB 4X4XA 4R7NB 4OSUL 1CN4A 4NNXB 3EO1A 3OAYK 2AS5M 5ACMA 2XV6B 4Y16C 4B7LA 2Q3AA 1U8OB 3EDFA 3P0YH 5T3ZD 2EEBA 3T77A 4JFPA 3RNQA 1A3RH 3EGSA 3QDMB 1SEQL 1VEOA 3VFTA 4Q6IA 1JWMA 3QO0A 3G9VA 5HHPB 1G7QB 5D6CA 1UADC 4PJEA 3GSWB 1B3JA 5DJZB 4W4NA 5F6HJ 1HNFA 5L2JA 2EIDA 2NXYB 4HJ0C 4LHUA 4OCMC 3P11H 4W4OC 2ORBH 5GRUL 3JV4A 2DICA 1R3HB 2FJGA 3FMGL 2FYYB 2ZUQC 3WV0A 4P2YA 4Z7VA 1JFQL 2UUDK 4YR6B 3QUZC 1IARB 4WW2A 3U4EB 3F65A 4XP6L 4CVZA 5BQ7A 5HHME 4Y5XA 1YEGL 4Z7WB 1F3JA 1T1XB 1NUNB 4ZMAT 3NCJL 2VQUA 2NY3B 3O6KL 2OI9C 4R4FH 5DHYA 3U9UB 3BO8B 4KRMB 3H42H 3SKJL 5L2KB 4FQXD 3UBXA 3FOLA 4R0LC 5AAWA 4M6MH 2CLZB 4QCIA 4JO2H 5IEHA 3V5KA 3VI4F 2BY0A 3C9NB 4HMEA 4KROC 4GG6A 4R2GC 5EU3A 4ZXBA 4Z7OE 1CGSH 4U6YB 4W6WB 3T09A 2WP3T 4PJBF 3AM8C 3FT2A 5K9JL 4ODSH 3EHBC 3VDCA 1IAOA 1BAFL 1ZLSH 3LRSA 5EU4A 4HK3N 3TP4A 5L8KB 4OFYA 1RUML 4Z0BL 4PJAA 4MNGE 3VH8B 1KXTB 4U1HA 5GGQH 1BP3B 4OZHE 4ONHB 4OQTH 5AG8A 5GGRA 4EI5C 1RJLA 4XH2B 1AXTL 3ARFB 2H41A 3TV3H 4V2BA 3WFCH 5EBGA 3HI5H 5I1LA 3D85B 2BZDA 1DSFL 1I1FA 3CMOH 3EYQC 1R5WA 1VFBB 3INUH 3QXDB 5KVGH 2A6KB 3IB4A 1AKJB 3OR6A 3CVHB 5DQJB 4MXVE 1OARL 1FORH 3G5ZB 3KR3L 4RA0C 2IQ9L 2FO1A 1Z2KA 2XZAL 3ZKMC 1Z0NA 5DUBB 4WWKD 3RWGA 2ITCB 2AK4A 2AK1L 4J4PC 4XZUA 3BGFB 4P2OB 4LLVA 4V1DA 4LFHD 1PY4A 2UZIH 5EOTB 4N0CD 3GRWA 1LVEA 1HHGA 3C60A 1DFBL 3W82A 2XXCB 3GK8L 1S9XA 4WHTB 2YUWA 2V5TA 2X44D 4L4TB 3N1PC 1HZHL 3TWCH 4PRBA 1WC7B 4PLOB 4HKJA 5L7XL 2PR4L 4PJ9A 3AS3A 2SEBA 4NWTL 4HS8L 1NCWH 2YMXH 5F7YC 4CDGC 3THML 4U1NA 3T04D 1I8KB 4CGTA 43C9A 5IK3A 4S1SH 5E2TH 3WS6C 3HC0A 3HUJE 2HTLC 1V7NH 1OM3L 3HCVA 1ORQA 1A7NH 2X9YA 1AXSA 1OGTA 4JRXE 4JQIH 5HHMD 5GRVK 3HZKB 3VMPA 5D2LA 1JHTA 3LQAC 5J0BA 1EV2E 1UYWL 4EKXA 5I6XC 2ATKA 1SY6A 2NNAA 3VWJB 2IBGA 4KJYB 4MXQD 4XMPH 2EDDA 2I07A 3L3OB 5ICYA 2PUQT 1FYTE 1VGKB 5DA0B 4NKIH 3TJEH 5IMLA 3CVIL 5D2NB 3V7AE 5A40E 3H3PL 5E1HB 2EYTB 3MV7E 4WUKL 4BA8A 5D7IF 1PKOA 1RY7B 3OF6D 5KG9A 3QDMD 3S35L 3MXWH 2RGSA 2E9IA 1D9KA 1XR8A 3Q6FB 4R3SA 5FK9B 3FB5A 3QWQB 4NRXB 1RZKH 2BSSA 3FL7A 5ESVB 2OYPA 4OLWH 4FTVB 3L3JB 3ZDXF 2BVTA 3NOIA 5C7XL 2MCG1 4TULH 3QZWB 3DXAE 3KLHC 1AIFA 1RZFL 2BHYA 5GS2H 5DMJB 1NGPH 4EXPX 2ED7A 4D0BA 4OGAC 1H8NA 4FP8H 4UIKH 2V2TA 4XNXH 3EOBA 2VQ1A 2NY3D 2F53A 3TBTA 3SPVA 1MCJA 3VXNB 4O5LL 5L2KD 5D72L 3F7QA 4KMTL 4WO4A 4DAGL 1TIUA 3REWA 5JHDB 5JOFB 4MD0A 4LHJB 3UPRB 3P2TA 5D93B 1LNUA 3NH7H 3TO4D 4J3XA 3GJFH 1MCWW 3BE1H 3BEWB 1DQDH 1G7MA 1NFDE 4JVWA 3TYFA 2NY5C 4YHYC 2YSSA 5ENWB 4LLUA 3TEUA 3S96A 3NZHH 1MFDL 4M00A 4QTHB 3BSZL 5HD8D 1BFOA 2V7NB 3ZE1E 3D5OF 3EYUH 4PPTA 4XPGL 4Y16A 3GSUB 5D1QB 1AGEA 3S3SA 3CFEB 1G7JB 4DN4L 1KEGH 4G42B 1ZTXL 5AEAA 4N5EC 1PYWB 1ZHBB 4YEFA 1NAMH 3LKQA 5IROA 4FQQA 3AFLA 4JRXD 1I9IL 3OMZA 3T08A 3IF1A 4JB9H 1T0MB 3UYRH 1EX0A 5CP7B 1EEZA 1JHKH 1NBQA 4JM4H 3U4AA 3MRRA 4LEXH 3IFOA 3OKEB 3LHPL 4UDTA 3HNSH 1GJIA 3EZJB 5KSBE 2PO6A 3S37X 1NUDA 5DD6A 3KPPB 3RPKA 3K8LA 1FYTD 1G7LA 4LGRB 3CFDB 4GAYB 1A14H 5TF1H 4KMQA 1MJ8H 4JM2B 1OWRM 5TDOB 4JGJA 3O3DA 4M5ZL 4FG6D 4M61A 4P2OD 3U7WL 3MV7D 5FYKU 4S1DD 3QEQB 5JXAH 5HHOB 1J0JA 2ZOKB 4YDIL 1J1OL 4JFZL 4X7SL 4R4BA 1DUYB 2VXQL 4TNWF 3PHOA 2KQMA 3W81A 3U2SB 4U1KA 1MFNA 4KK5C 1I7UB 5EU6A 4N1CA 5KS9F 5TFSL 4EDXA 1FRGL 5IB1A 1QFUL 2C5DC 1OSPL 3BXNA 4XAKE 4MXWH 5CZVH 2YRLA 2HA1A 4HUWA 3O6LL 2BVPA 2DIAA 5I1DA 1U91A 1A7RH 3D18A 3AM8A 3DXAD 4ELKB 4A6YL 2HLFC 1NGXA 1EO8L 5DJ8B 2NW3B 3B2VL 1MLBA 5IWLC 3I02A 4LQ1A 1J8HE 3DGGA 3RVTD 1B2WL 1AD0A 4K3HA 5MHSE 3JWOH 1F58L 1TVDA 1I3UA 2NXZC 4N90E 5C3LD 1WWCA 3TFKC 4LVNB 4EI5A 1WEJH 4UV7L 4ZD3L 1J0YA 4UB0H 3LKNA 1SVZA 4FQJH 3HI1A 3H9SA 2V7HB 1EFXA 3LZFH 4MJ6B 2VL5A 4KDWA 3D9AL 1DP0A 1ZLVH 3QXWA 5D7LA 4Q9QL 2VR9A 4XNUL 1MCFA 1JI2A 5E0QA 3BN3B 4BSWA 5A16B 4J4PA 3BDYL 5IQ9A 3QUMB 3MJ9A 4K23H 3ARTA 2BRRH 4F7PA 2ZUQB 5C0AA 1KACB 4GRLC 4P46C 3T2NL 2QSQA 4UIMA 4YHNA 2VQTA 1I75A 3HFML 1QSZA 3QUZB 4RGMB 2JCCA 1BF8A 1A4JA 2V17L 3DX7B 4PJXE 1LP9A 4WNQA 3MOAH 3PABA 4Y4FC 3FN0H 1JWUB 5LXGH 3KPLA 4XHQA 4YBHA 3TH3T 3HZMA 3QB7C 2OI9B 4TSAH 3WXWL 3U46B 3DYMA 2FX7H 1ZHKA 4RMVA 3QWRD 2R0LH 1CLZL 1JK8B 2Q87A 3KPRE 3U0WL 4ZS6C 4CU8A 2ZUXA 4KROB 5AYUH 4XXDB 3CZJA 1NL0L 3WIHA 2DBLH 4RRPG 3NIFF 1OGAA 3DNKA 2WM0A 3OR7A 4IRJC 2C7UB 5IGXH 1XFPA 4I3RH 4I3SH 2CRIA 3WBDA 1W0WB 3JTSA 5E8EB 1D5MB 1MF2H 1YEEL 2OTWB 2YK1H 2H1PL 2DQJH 3PQYE 4PV9A 1HHKA 1BLNA 4KK8D 2MWCA 2EDTA 1OSZA 1Q1JL 3S88H 3MRMB 2R2EA 1CZ8L 2YZ8A 4HD9A 4XCNB 2XG5A 3C09C 4P2CG 4OZFA 4NJ9H 3OG6B 4MZ3A 5FM8A 1G7PA 3HE7A 1MHHB 3IGAA 3IVKB 4UILH 5GSRB 3RAJL 4WUUB 1EZVY 1KIPA 5D1QD 3VMNA 3OKKB 2CIKB 3EIFA 4RWYL 1WTLA 4PTUB 2G9HA 2W60B 4PLKC 5EZIL 2XFXB 5HJ3A 3VXUE 2XTJE 4X6BA 2FLRT 2JJUA 1BQHB 3SE8H 5HI4D 3HZYA 4E0RB 1CQKA 1P6FA 4HGWA 3KYNA 4O51B 5DS8B 1J8HD 2J5LC 4LCWA 2VLMD 4N1EA 4YH6A 1IGYB 2GCYB 3I9GH 3IYLW 3CFCH 4RZCB 1KJMA 1VERA 4N90D 1RZJC 2BJMH 3IJSA 3WNNA 5GSVB 3UTTA 1LK2B 3LKPA 5D7JC 5C0JA 5TGBA 3GI9H 5ITFB 1FL3B 1I8MA 4JM2D 1WITA 1IAMA 1IMHC 2D7TH 4QTIH 4PTTB 5E5MB 2RFXA 5AD0A 4LARH 4UOW1 1GCFA 2NX5E 5JZ7C 4M6OL 3TCLA 3GJEA 4XBPA 3VXME 1VACA 1FZOA 3VCLB 5CBEA 1GGTA 4GBXD 4X7TA 1LEIB 3GMNB 1O7SA 3WFBL 2OL3B 2QQNH 2GJ6B 3OXSA 3WL9B 3MV9A 5CEYB 3ZYIA 4C54A 2BVOA 4L9DA 1WIOA 2NLJA 3CVHH 3L5XL 2MHAB 5IMMB 1KPRA 4ZSOE 5EBLB 2KBGA 3VJ6A 4Y1AB 3V4UH 2OP4H 4JHWH 1P1ZA 4F2MB 4NZRH 3B9EA 2P7TA 1N8ZB 2VR4A 5HGAA 1B88A 3WNMA 5B3JE 4TSCL 4MLSA 5E2VH 2PYEB 2P5EA 4FN0A 3VXRE 3KPRD 3KXFB 3MXVL 1MPAL 1KIQA 2YUVA 3GB7A 4YJZL 4B41A 1S7WB 1IM3B 2WK2A 3IFNH 4QY8B 2Y06H 4DGYL 5I9QB 3ZZ1A 1CQYA 3MLWH 1HOCB 1YEFL 4U0QB 3PQYD 3GSNL 2X4UB 5EUOB 2ZKHH 4NC1E 3D48R 3OKDB 2CUHA 3FONA 5C0IA 3UZQA 4R97C 3G5YA 1Q72H 5ID0B 1JGVH 5ICXA 2YD9A 1KG0B 5E2UL 4PJFA 2X4SB 2G60H 2FHCA 3G5XA 4NHUB 5IW3A 1F4WL 1CE1H 4HLZH 3BGMA 4PGCB 3LN5B 3P0VL 4EOWL 2FGZA 4MZ2A 3NPSB 4HWNA 3S6CA 1EBPA 3EW3B 5DRXB 2APBA 1J10A 4GMTL 4XPBH 3T3PE 1BJ1H 3H9HB 3VXUD 2V5YA 3T1FB 4C83B 2QADC 1DN2A 1HQRA 1R24B 5D5MF 1YY9C 2W9EL 1G9EA 4IDJL 4UBDC 3PGCA 3IT8D 1T7XA 4QXTB 2XWBA 2NTSP 4YDKL 3D69A 3FHAA 3NBNA 5F7NC 1IT9H 1J7VR 5DMGD 3B2UC 3VRLE 4WTZA 4JY5L 5I17A 3G5VB 4P2QA 5GIRB 2H32A 3RWCA 1ZLWK 3HZVB 1MFEL 3LKRA 1IM9B 4R8WH 5I8KL 3LQZB 1IKNC 4K2UH 3ZKXB 3FB8B 4PJBE 2B4CL 1RJZA 3K80A 3O6FD 4Z7VF 5MP6H 5EU7C 2H6PA 5IWLA 5IBTH 3GMPA 5F1KC 3MLZH 2BDNH 1NMAH 4YHYB 4W81A 3C5SB 5F3HA 3MRQB 1QLFA 3L3IA 3ZYJA 4CMHC 1F2QA 1GPOL 1QBAA 2NX5D 3IETA 3RL1B 5ACLA 3ULVL 1IGJA 2HKHL 3PJSB 4RMRA 4EUPB 1PG7X 3VXMD 1MI5A 3PNWB 3C87A 4LLMA 1QFWH 1A6VH 4JY4A 4GXUM 3AS0A 4RGOL 5C1MB 1U36A 4JZOB 1E4WH 3EJJX 3RWDB 1R3LB 2HJFB 4OCSL 2UY7A 4GG6F 4JKMA 1OAQH 2AQ3A 5DVNA 1IGFL 3MLVL 4YPGB 4CW1B 1OAZL 1V5JA 2X10A 4OJFH 4N8PA 4F7TB 2W0FB 4PJ5B 4PRIE 3GJFK 4KHTL 4NQCA 4CN4A 2Z31C 2I60H 4YDVB 1WBYB 1AHWB 4U31A 1JRHL 5FUZL 3O81A 4PJAF 2FX8L 4NNYA 3VXRD 2RB8A 2GTZB 3LEYL 4X9BA 4OI7A 1L0YA 4KTDL 5E94A 4GRLA 4P46A 3GIVA 3TH2T 4HQQH 1KB5L 1XMWA 1NANH 1DE4B 3IDYC 4NZUL 2EE6A 3WLBA 2ERJB 1EO7A 5HGDA 3S4SA 4Z78A 1RZIA 4Y4FA 1FFNA 4HIHB 4RNRB 3RVVD 2ZCHL 4YQXL 1QQDB 4NBZB 3KPQB 2EXWC 1GRWA 1IAKA 3DX9B 5C07B 4QRTA 4JO3H 3GO1H 4OUOA 4ZOCA 2ESVB 1IVLA 3CFJB 3L3GB 1UWXK 3ALPA 2R0KL 4RFEA 3UBXI 4PJDE 3D2UB 4HUUA 4I0KA 4G6KL 5C71A 2WUBL 4HCRH 3QUXC 5I1JL 5F9JA 3O0RL 1SM3H 4HULB 3FFCB 4IRJA 4YHIB 1TQBC 2VDPH 1I1YB 1KELH 3ZKQD 4KZDL 3MA7B 5I8OL 5BS0A 3KHQA 4BH8A 1N3NB 3S36L 3BH8B 3F5WA 1RJCA 4AQOA 3TM6A 3QG6A 3RWJB 2DYPA 1HIMH 1UZ6F 3CFBA 3B9AA 4KY1H 5L88L 4XC3H 1VFAB 4HWZB 5LVEA 1KCUL 1JUFB 2Q6WA 5C9JA 4MX7A 4RMQA 1C5DB 2IPKB 5L8LB 1XF2A 1GAFL 2H26A 4PGEB 5E99L 3VXSE 5KTEL 4QRQA 5DJCB 3ZDZF 5CJQH 5ALBH 1TNNA 3H7LA 3LD8C 3B6SB 3WS3A 4LU5H 4ZUUB 4FABH 1NCBH 1AO7A 3ZKSD 4LSSL 4KV5F 4M48H 3RZCD 5D7IE 1EZVX 4F9LC 2DQIH 1OL0A 1JPSL 4P3DB 3AREA 4ZUSA 4H1LA 5D2LF 1I9RH 3ZE0E 2DAVA 4LPCA 1K5NB 4GW1B 3WJJC 5B4MC 2IAMD 3O6ML 1T1WB 4LLYB 1S9VB 2M1KA 4YGAB 5F7KC 3W0WA 1Z9OA 3PL6D 4LK4A 2YD3A 1MCCA 5DRNB 5D7JA 2UWEA 2IFFL 3QULA 1NCAH 1NEZB 3FQXA 1X5ZA 4HUXB 5BOPA 3NABH 5IEKA 5ALCL 3I6KA 3W9DA 3K4ZA 4R96A 2ZJSH 1A2YA 4PJHA 1AQKH 2C3XA 4PRID 5EBWB 3WHE1 2CRYA 2X4RA 2H3NB 3DHJA 1FP5A 3VI3F 3S3PA 1LO3H 3LEVH 1F4HA 1E6OH 3SQOH 4IHOB 1XIWD 3T8XA 4XPFL 3H6JA 1UA6L 4NQDE 2Z35B 3HNVL 3F7VA 3F12B 5IVXA 2ICEB 1YPZF 3CPLA 4AH2B 1Z5LA 4ZOAA 3TNNA 4JDZB 3CFIC 4NKOB 1MCOH 1EJOH 5F6IC 4NM8H 2X40A 4QGYA 3QUMH 2FNBA 3C09B 2GJZB 3VFWB 5KS9B 4K3EL 1IAII 4ONFL 4QNPF 2XACC 5DT1H 1I3GH 1OTTC 2FATH 1L0XA 3FCTB 3RGVD 1P7KA 2WP3O 1I4FB 1BWMA 2YA0A 2BXZA 1AGBA 1IFHH 3PP4H 4HKXB 4KJQD 5AYQA 3DO7A 1ZANH 5FOBA 3RDTB 4CL7A 3H0TB 3RIFK 4CJ1A 1C7TA 3T3MF 5IVZA 3OJ2C 5JQHC 1XF5B 5HHQA 1C5BL 3F8UB 5CFHA 2CK0L 2HFGL 4F37F 4MVBD 5GGVH 2XZQH 6FABH 2JLLA 1QFPA 1IAIM 2J5LB 3G6DH 1YNLL 1GOHA 1KJ3H 5C2UB 3IJYB 5DDHA 1I85C 3RTQC 4C4KO 3SKUD 3OTTA 5CILL 4YXKH 2A74A 1KJ2A 3VXSD 1LDPH 3RP1A 1UKSA 3P4MB 3QQ3B 4PB0H 1P6AB 2HJKB 4BQ6A 1JGLL 5HHNB 4AENA 3GMRA 2IGFL 5FYKE 1HINH 3C5ZD 3VFRB 3DMMC 4R6UA 1FLRH 1NFKA 5BVPH 2EE9A 4JKLA 2JB5L 4D3CL 3P9LB 4MCZB 1VCAA 1G7HB 4XP5H 2V5MA 4PYGA 3TJHD 2ADIA 5C8JB 4QHUA 1CXKA 5IIEA 1TJIH 3DROB 5EORH 2BNRA 2OXHA 5C0FB 3O3EB 2ZCKH 5IT2H 1DBBH 1Y6NR 3LIZL 4RDQG 4RMTA 4UV4H 1FNSL 4U3XA 4WW1B 1NCNA 4Y2DC 3REVB 4BQCA 5CINH 2X4NB 1IKNA 4BQ8A 2ADJB 2IALA 3A6CH 2C4FU 4I2XE 2VLLB 1A7QL 1FL6B 1DUZB 1YMHB 4OV6F 4PJCA 3BVNA 3B9KD 3O3AA 1UQSB 2GK0B 2MCPL 2B0SH 1KNOB 5IKCA 2Q76B 4JGMA 3WE6A 2OCFD 3VFPB 2VDLH 4HV8A 4WU5B 4XI5C 5CGYD 4KQ3H 4MA7H 4ZOBA 5KW9H 2A1WL 1P84K 2WZPD 4S11A 3HG1B 1CDIA 1WT5C 2MQ3A 3QISA 4NNPH 4NQDD 4DEPC 1ES0B 1X5LA 3LDBC 1LE9B 5JPNA 2NQCA 1UEMA 2Q8AL 2HKFH 5IB4B 3P30L 4GRWF 3DX8B 5E5RB 4Q9RH 4MQ7B 1JPST 3K2UL 4M1DL 4U6VH 2D7OA 4LQFH 2Z31A 2OL3H 1LGVA 4KZEH 3SHSA 1XGPB 3V4PH 2H2PC 3MYJA 1IZKA 2XA8H 4P2RA 3HC4H 1URLA 3MO1B 3O4OC 4UMGA 3DV6B 4NKDB 4XX1G 3MRDA 4G7VL 5GS0D 1OF2A 4MHHG 3T4AB 1UM6L 3PGFL 5LQBH 2R8SH 3LQAH 3QNZA 4LVOB 4M62H 5F7EH 2UYLA 3IU4L 1W2KT 4LDLB 4MWFB 3NFPA 1HILB 1Z9MA 3TBWA 1NH6A 3QI9C 4EEEA 4CU6A 2QADB 4PV8A 4NQSB 1CGTA 2VUYA 1MWAB 4ZUTA 1F4XH 2AKRA 4XWOD 5F1NA 3T2OA 1CT8B 3NCFB 3QEHB 4LSVL 4MQXD 3QUXA 1EHAA 5KSVB 3D0VB 2VLJE 3CU7A 3JV6A 4M8QA 3SE9L 4S1QH 3MV8B 4Q2ZB 5E8OB 4NN6B 5JW3H 5TE7H 5ANMA 3CH1A 5E2JA 4DK3A 5A3IC 4P5TC 4NO0D 4L4VA 3QWOA 1ZA3B 4HWEL 4PJ8C 2BSTA 4DVRH 1PQZB 1WBXA 3O4LA 2FB4H 4LPYA 4LSPH 3BW9B 2VAAA 2V2XA 2R69L 3MGAA 1UEYA 4JFHD 4M3JA 2DDQL 2P5WB 4K8RC 1LO0L 3VRJA 4DQOH 2YWYA 4WHDA 2IPTH 4MJ5A 4X4ME 1UWGL 1U8MB 1A7OH 3AROA 3SDXA 3JWDH 2VC2H 4PGDA 4AJ0A 5JA9A 3EFFA 2AEIT 2AXGB 1ZT4A 3SE3A 3L1OH 4F9LA 1RK0A 4YXHL 4O9HL 2KZ1B 4U2YA 3MROB 3I50H 1NEUA 1QRKA 1TXKA 1WUNT 2EYRB 3RX5A 1T03L 3O9WC 4NZTH 3WJJA 5DJ2B 1HHJB 1M7XA 2APVA 3QIWD 1D6EA 2COQA 1VB9A 4K3DH 4JG0L 4LGSB 4KUZL 3KLAB 3HS0A 5E6YA 2QKIB 3KPNA 5JNYB 3GNML 4DKEL 2YPLB 4MAYD 3G04A 4XPTH 1NC4B 2BHZA 4EUPH 2W91A 6CGTA 3S35X 2ZSWB 1CG9A 2AP2A 3RU8L 4HDIB 4LKXA 1EAJA 4JO4H 2IH3B 4L1HA 3P0YL 5MI0C 4QXGH 3K4AA 2DKUA 4MS8C 2VLRE 2JIXA 4LLQB 3VXTB 1A3RL 3L9RB 2WQ8A 3A67H 3SCMC 4XB7A 5EA0H 1ZT1A 1A6WH 1ETZA 2IF7A 1AC0A 1LO2H 1LWRA 2DQFB 3VD4A 2P8MA 3RNKA 2EC8A 4FQ2L 4NM4H 1U92A 3I6GB 3FN3A 5CMAA 1YYLH 3L3KB 1CFQA 1A1OA 3AMLA 2ORBL 3GSQB 5D5MB 5MEQB 1PLGH 3VA2C 1OAUH 1FQ9C 4QRRA 2APXA 3L5WA 1EAPB 1BFSA 3SKNA 2QL1A 4JG1H 4JPVH 3UO1H 4H0IA 2ZOLB 1BVLB 5JQ6H 2VLJD 1JCKA 4GRMB 4UNUA 3ARDD 5DHVB 4W68A 2H45A 2OJEA 4R4FL 3UZEA 4NRZB 3H42L 2ATPA 4JN2B 3RIAF 5GRJH 4M6ML 1CFSB 2Y1VA 4ZDHA 4JO2L 1RK1A 4H26B 1MUJA 5DO2D 5T1KA 2J3SA 3NIGF 1A47A 3ARGC 5ITBH 1N64L 5EIQA 3RTQA 1I85A 2O5XH 2BNUB 5JLZB 5T5FL 1WSST 3PHQB 3G6JE 4G8IA 1U8NA 5FKAA 4HGKC 1JIBA 3C6LD 4PGBB 1M05A 2HT2D 4RGNB 4PFEA 3L7EA 1K85A 3LN4A 1YEDB 2G5BA 2A73B 3DMMA 4PRNA 3RWHA 3U36A 2MKLC 3ES6A 3GSXB 4O4YH 4RSVA 1N6VA 1YEHH 5JIHA 3IXAB 1EGJL 2W9DH 5EO9B 4PJEE 1DLHA 2VLKA 4KRPD 4HIJA 1PZUB 3SDAD 1U8HA 3V79C 1IQWH 3TV3L 4GSDL 4DZ8B 3R0NA 4Z18A 4APQB 1LEKA 5EC1B 5IFJB 4DN3L 4PJFF 2VDKH 4XP9L 4K7PH 4J3SA 1A1MB 2C1PB 4RQQB 4BFGA 5F7DB 1T0PB 2DMBA 3INUL 4L8SB 5KVGL 4P49A 3I75B 1NLDH 2Y07H 5CCKH 3PWVA 3GSVB 1FORL 1ZGLA 4G6JH 4XNMB 1U8QA 2E27H 3I3DA 1YJDC 2J6EA 4Z7VE 2EDEA 3F6IA 4HXBL 2NR6D 2HLAB 3P9MB 4AT6B 4QKXB 4G9FA 5D7SH 4G6ML 3ROLA 3VFVA 1CLOH 2VLRD 2V5RA 2APWA 1WT5A 1J05B 1SJEB 3CZFA 2G75A 3BFOA 1BBDL 4E41A 4PP2A 2Q86A 1RFDH 4P3CH 1T3FB 3QFDB 4GG6E 4GKOA 1C12B 1EEQA 1X9QA 3SN6N 3HN3A 3TWCL 1CD0A 2YD4A 1LEGA 3IJHA 3CCHB 1P7QD 1I7RA 5DJ0A 4KXZI 5GRZA 2YMXL 3IFPB 5DVMA 2C1OB 5CWSA 1H3TA 4UDUA 3PGDB 4DW2H 4S1SL 3CC5A 5E2TL 2X4TB 2NY4B 1GH7A 1J0HA 2R1WB 2LAGB 1V7NL 5CJXC 3VGBA 2IANB 4PJAE 1U8IB 1A7NL 4PREA 3KPMA 1BGXH 3R06A 2GUOA 5DMIH 3QBTB 4JQIL 4L8CA 3RWFB 4TQEH 4UTBL 1M6OA 1OAKH 4HWBL 4L3EA 5IBLD 3QI9A 4NPYB 1AXSB 3L5IA 5FV2A 4G80B 2ENYA 2B5IC 2UZYB 3B3IB 4BZYA 4XMPL 2FEEL 3QA3B 4Z8FH 3FJTA 1NC4D 3FT3B 4NP4H 5BXFB 4UI2A 1KTKE 1VFOA 4KKLC 4FFZL 4NKIL 3TJEL 5FYJH 3C8KB 3B43A 5JW5B 4QHLB 1IGIH 2PW2B 4CDHA 2MQ0A 4R90H 3SBWC 3RWEA 2ED9A 4C56B 1N2RB 2F74B 4Y2DB 5IF0B 3MXWL 4HXAH 3QP3A 4A6YA 2AK4E 3QNXA 4V1DE 5F89B 4P5TA 3PIQB 4I48B 1DR9A 1M71A 1RZKL 4PJ8A 4Y4KB 1A6AA 4XWGH 5CIPB 3ULVC 2BOCA 2D9QB 4OLWL 1HI6A 2ADGB 3QIUC 4P23C 4D0CA 1DBKH 2DMCA 4G8FB 5CD5C 2HP4A 4LHUD 5T1LB 2EE2A 5I8EA 3ZDZE 1T1ZA 3EO9H 1ED3B 2J2ZA 3E8UL 3PWNA 1YPZB 5KJRH 4LEOA 4DEPB 3LDBB 4XNQA 1RZGB 4HIIA 3LB6C 3F58H 4FP8L 4UIKL 4HUMB 4KV5E 2I25N 4XNXL 2FJFA 4ETYA 3WFHA 5GZND 1IEBB 4DZBB 3BT2L 1JGDA 5T1DH 2C3VA 2D0HA 5FYKL 5IM7B 3WMSA 3ZTJG 2VZSA 4LSRL 2Q7YB 1AQDB 2GAZB 3VFNB 1S7VA 3O9WA 5FO9B 4Z7UA 5D2LE 2Z92B 1RV6X 3NN8A 3DUUA 4XNYH 1U8KB 3GZKA 3MV11 3VFSB 1EVUA 5DK0B 2NZIA 5DEGB 3CDCA 3MRPB 4ZTOH 3D39A 4Q6YA 1FO0B 3MRNB 3MREA 3NZHL 4EIZC 4JREC 3CX5J 1UACH 2VIRA 2WW8A 1K8DA 5J13B 2A6IA 4ZXBD 3O45A 1E4KC 1H5BB 1E0OB 1QBML 3ARPA 4FQLH 5MENB 2JJWA 4LLUB 2JK5A 1HWHB 4LKCB 5EC2B 1KEGL 5CHNA 2BVQA 3VW3H 2FEDD 1HNGA 1MOEA 5GS1B 3SCMA 3EYFA 1AGCA 3E6HB 2W65B 5DJYB 3LRGA 4CVWA 4OD1H 1CICC 4XCCL 1KFAH 4APQD 4HPOH 3UYRL 2NMSA 2QQKL 1T04B 3DIFB 3VRIB 4LEXL 1NGYB 2UWEF 1B0RA