4OM4A

Crystal structure of ctx a2 from taiwan cobra (naja naja atra)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxin 2
publication title Endocytotic Routes of Cobra Cardiotoxins Depend on Spatial Distribution of Positively Charged and Hydrophobic Domains to Target Distinct Types of Sulfated Glycoconjugates on Cell Surface.
pubmed doi rcsb
molecule tags Toxin
total genus 11
structure length 60
sequence length 60
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4om4A00
2NBTA 3QB4B 1ONJA 4LFTA 1LSIA 1QKDA 2H8UA 5IMTD 1NXBA 1BXPA 2CDXA 2L5SA 2MUPA 1I02A 1BTEA 1TXBA 1KXIA 2OFSA 3HH7A 2H64C 4IYEA 1JBDA 1MR6A 1B41B 3BT1U 4P7UA 1NORA 1ABTA 1XT3A 1HAJA 1NTNA 1TXAA 1HAAA 2H7ZB 1REWC 3NH7A 2UX2A 3EVSC 5DZ5A 1RGJA 2CTXA 1FSCA 1HC9A 1ERGA 1KC4A 1MAHF 2BTXA 1CDRA 1IDIA 1CHVS 3U74U 2QJ9C 2N99A 4AEAA 1ERAA 2JVEA 4DO8A 4UY2C 1KBTA 1KS6A 1IJCA 2QJAC 2JQPA 4QTIU 2CCXA 2ERAA 4OM5A 1CB9A 2LA1A 2MJ0A 4FAOC 1RL5A 1COEA 3EBXA 2MHYA 2QJBC 4BIKB 3KFDI 1FASA 4FAOE 1IDLA 1CDTA 2BHIA 1YWHA 1NYSA 1ES7B 3VTSA 1HC9B 1TGXA 3LAQU 4ZQYA 1F8UB 3U73U 1FRAA 1IK8A 2L03A 1CDQA 1CRFA 2GOOB 2H5FA 1CXOA 1VB0A 1KBSA 2H62D 1CVOA 3NDSA 1JE9A 1NTXA 4XJJA 2UWRA 3ERAA 4OM4A 2HLRA 2VLWA 1LXGA 1FFJA 1ZADA 1PLOA 2J8BA 1KU6B 1FSSB 2MUOA 1TFSA 2K3GA 2H62C 1G6MA 3FEVA 2HLQA 2MJ4A 2X8BB 1UG4A 5EBXA 2PJYB 1L4WA 1KFHA 2QC1A 1IKCA 1CTXA 1HOYA 1IDHA 1LX5B 1S4YA 2MJYA 6EBXA 2I9BE 1IDGA 2FD6U 1CDSA 1CREA 1M9ZA 1IQ9A 4RUDA 1QKEA 1H0JA 1NEAA 1CCQA 1W6BA 2PJYC 3KFDE 5DO6A 4BDTB 1KBAA 1F94A 1LXHA 4EY8B 3NEQA 2ABXA 1CXNA 1NYUA 1QM7A 2GOOC 3BT2U 5DU1A 1DRSA 1V6PA 5IMYC 2CRTA 1JGKA 4HQPF 1FF4A 1CODA 1KL8A 2LCRA 2MFAA 2CRSA 2H7ZA 1LJZA 2H64B 3PLCA 1KTZB
chains in the Genus database with same CATH superfamily
2NBTA 3QB4B 1ONJA 4LFTA 1LSIA 1QKDA 2H8UA 5IMTD 1NXBA 1BXPA 2CDXA 2L5SA 2MUPA 1I02A 1BTEA 1TXBA 1KXIA 2OFSA 3HH7A 2H64C 4IYEA 1JBDA 1MR6A 1B41B 3BT1U 4P7UA 1NORA 1ABTA 1XT3A 1HAJA 1NTNA 1TXAA 1HAAA 2H7ZB 1REWC 3NH7A 2UX2A 3EVSC 5DZ5A 1RGJA 2CTXA 1FSCA 1HC9A 1ERGA 1KC4A 1MAHF 2BTXA 1CDRA 1IDIA 1CHVS 3U74U 2QJ9C 2N99A 4AEAA 1ERAA 2JVEA 4DO8A 4UY2C 1KBTA 1KS6A 1IJCA 2QJAC 2JQPA 4QTIU 2CCXA 2ERAA 4OM5A 1CB9A 2LA1A 2MJ0A 4FAOC 1RL5A 1COEA 3EBXA 2MHYA 2QJBC 4BIKB 3KFDI 1FASA 4FAOE 1IDLA 1CDTA 2BHIA 1YWHA 1NYSA 1ES7B 3VTSA 1HC9B 1TGXA 3LAQU 4ZQYA 1F8UB 3U73U 1FRAA 1IK8A 2L03A 4KSNA 1CDQA 1CRFA 2GOOB 2H5FA 1CXOA 1VB0A 1KBSA 2H62D 1CVOA 3NDSA 1JE9A 1NTXA 4XJJA 2UWRA 3ERAA 4OM4A 2HLRA 2VLWA 1LXGA 1FFJA 1ZADA 1PLOA 2J8BA 1KU6B 1FSSB 2MUOA 1TFSA 2K3GA 2H62C 1G6MA 3FEVA 2HLQA 2MJ4A 2X8BB 1UG4A 5EBXA 2PJYB 1L4WA 1KFHA 2QC1A 1IKCA 1CTXA 1HOYA 1IDHA 1LX5B 1S4YA 2MJYA 6EBXA 2I9BE 1IDGA 2FD6U 1CDSA 1CREA 1M9ZA 1IQ9A 4RUDA 1QKEA 1H0JA 1NEAA 1CCQA 1W6BA 2PJYC 3KFDE 5DO6A 4BDTB 1KBAA 1F94A 1LXHA 4EY8B 3NEQA 2ABXA 1CXNA 1NYUA 1QM7A 2GOOC 3BT2U 5DU1A 1DRSA 1V6PA 5IMYC 2CRTA 1JGKA 4HQPF 1FF4A 1CODA 1KL8A 2LCRA 2MFAA 2CRSA 2H7ZA 1LJZA 2H64B 3PLCA 1KTZB
chains in the Genus database with same CATH topology
2NBTA 3QB4B 1ONJA 4LFTA 1LSIA 1QKDA 2H8UA 5IMTD 1NXBA 1BXPA 2CDXA 2L5SA 2MUPA 1I02A 1BTEA 1TXBA 1KXIA 2OFSA 3HH7A 2H64C 4IYEA 1JBDA 1MR6A 1B41B 3BT1U 4P7UA 1NORA 1ABTA 1XT3A 1HAJA 1NTNA 1TXAA 1HAAA 2H7ZB 1REWC 3NH7A 2UX2A 3EVSC 5DZ5A 1RGJA 2CTXA 1FSCA 1HC9A 1ERGA 1KC4A 1MAHF 2BTXA 1CDRA 1IDIA 1CHVS 3U74U 2QJ9C 2N99A 4AEAA 1ERAA 2JVEA 4DO8A 4UY2C 1KBTA 1KS6A 1IJCA 2QJAC 2JQPA 4QTIU 2CCXA 2ERAA 4OM5A 1CB9A 2LA1A 2MJ0A 4FAOC 1RL5A 1COEA 3EBXA 2MHYA 2QJBC 4BIKB 3KFDI 1FASA 4FAOE 1IDLA 1CDTA 2BHIA 1YWHA 1NYSA 1ES7B 3VTSA 1HC9B 1TGXA 3LAQU 4ZQYA 1F8UB 3U73U 1FRAA 1IK8A 2L03A 4KSNA 1CDQA 1CRFA 2GOOB 2H5FA 1CXOA 1VB0A 1KBSA 2H62D 1CVOA 3NDSA 1JE9A 1NTXA 4XJJA 2UWRA 3ERAA 4OM4A 2HLRA 2VLWA 1LXGA 1FFJA 1ZADA 1PLOA 2J8BA 1KU6B 1FSSB 2MUOA 1TFSA 2K3GA 2H62C 1G6MA 3FEVA 2HLQA 2MJ4A 2X8BB 1UG4A 5EBXA 2PJYB 1L4WA 1KFHA 2QC1A 1IKCA 1CTXA 1HOYA 1IDHA 1LX5B 1S4YA 2MJYA 6EBXA 2I9BE 1IDGA 2FD6U 1CDSA 1CREA 1M9ZA 1IQ9A 4RUDA 1QKEA 1H0JA 1NEAA 1CCQA 1W6BA 2PJYC 3KFDE 5DO6A 4BDTB 1KBAA 1F94A 1LXHA 4EY8B 3NEQA 2ABXA 1CXNA 1NYUA 1QM7A 2GOOC 3BT2U 5DU1A 1DRSA 1V6PA 5IMYC 2CRTA 1JGKA 4HQPF 1FF4A 1CODA 1KL8A 2LCRA 2MFAA 2CRSA 2H7ZA 1LJZA 2H64B 3PLCA 1KTZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBT A;  3QB4 B;  1ONJ A;  4LFT A;  1LSI A;  1QKD A;  2H8U A;  5IMT D;  1NXB A;  1BXP A;  2CDX A;  2L5S A;  2MUP A;  1I02 A;  1BTE A;  1TXB A;  1KXI A;  2OFS A;  3HH7 A;  2H64 C;  4IYE A;  1JBD A;  1MR6 A;  1B41 B;  3BT1 U;  4P7U A;  1NOR A;  1ABT A;  1XT3 A;  1HAJ A;  1NTN A;  1TXA A;  1HAA A;  2H7Z B;  1REW C;  3NH7 A;  2UX2 A;  3EVS C;  5DZ5 A;  1RGJ A;  2CTX A;  1FSC A;  1HC9 A;  1ERG A;  1KC4 A;  1MAH F;  2BTX A;  1CDR A;  1IDI A;  1CHV S;  3U74 U;  2QJ9 C;  2N99 A;  4AEA A;  1ERA A;  2JVE A;  4DO8 A;  4UY2 C;  1KBT A;  1KS6 A;  1IJC A;  2QJA C;  2JQP A;  4QTI U;  2CCX A;  2ERA A;  4OM5 A;  1CB9 A;  2LA1 A;  2MJ0 A;  4FAO C;  1RL5 A;  1COE A;  3EBX A;  2MHY A;  2QJB C;  4BIK B;  3KFD I;  1FAS A;  4FAO E;  1IDL A;  1CDT A;  2BHI A;  1YWH A;  1NYS A;  1ES7 B;  3VTS A;  1HC9 B;  1TGX A;  3LAQ U;  4ZQY A;  1F8U B;  3U73 U;  1FRA A;  1IK8 A;  2L03 A;  1CDQ A;  1CRF A;  2GOO B;  2H5F A;  1CXO A;  1VB0 A;  1KBS A;  2H62 D;  1CVO A;  3NDS A;  1JE9 A;  1NTX A;  4XJJ A;  2UWR A;  3ERA A;  4OM4 A;  2HLR A;  2VLW A;  1LXG A;  1FFJ A;  1ZAD A;  1PLO A;  2J8B A;  1KU6 B;  1FSS B;  2MUO A;  1TFS A;  2K3G A;  2H62 C;  1G6M A;  3FEV A;  2HLQ A;  2MJ4 A;  2X8B B;  1UG4 A;  5EBX A;  2PJY B;  1L4W A;  1KFH A;  2QC1 A;  1IKC A;  1CTX A;  1HOY A;  1IDH A;  1LX5 B;  1S4Y A;  2MJY A;  6EBX A;  2I9B E;  1IDG A;  2FD6 U;  1CDS A;  1CRE A;  1M9Z A;  1IQ9 A;  4RUD A;  1QKE A;  1H0J A;  1NEA A;  1CCQ A;  1W6B A;  2PJY C;  3KFD E;  5DO6 A;  4BDT B;  1KBA A;  1F94 A;  1LXH A;  4EY8 B;  3NEQ A;  2ABX A;  1CXN A;  1NYU A;  1QM7 A;  2GOO C;  3BT2 U;  5DU1 A;  1DRS A;  1V6P A;  5IMY C;  2CRT A;  1JGK A;  4HQP F;  1FF4 A;  1COD A;  1KL8 A;  2LCR A;  2MFA A;  2CRS A;  2H7Z A;  1LJZ A;  2H64 B;  3PLC A;  1KTZ B; 
#chains in the Genus database with same CATH topology
 2NBT A;  3QB4 B;  1ONJ A;  4LFT A;  1LSI A;  1QKD A;  2H8U A;  5IMT D;  1NXB A;  1BXP A;  2CDX A;  2L5S A;  2MUP A;  1I02 A;  1BTE A;  1TXB A;  1KXI A;  2OFS A;  3HH7 A;  2H64 C;  4IYE A;  1JBD A;  1MR6 A;  1B41 B;  3BT1 U;  4P7U A;  1NOR A;  1ABT A;  1XT3 A;  1HAJ A;  1NTN A;  1TXA A;  1HAA A;  2H7Z B;  1REW C;  3NH7 A;  2UX2 A;  3EVS C;  5DZ5 A;  1RGJ A;  2CTX A;  1FSC A;  1HC9 A;  1ERG A;  1KC4 A;  1MAH F;  2BTX A;  1CDR A;  1IDI A;  1CHV S;  3U74 U;  2QJ9 C;  2N99 A;  4AEA A;  1ERA A;  2JVE A;  4DO8 A;  4UY2 C;  1KBT A;  1KS6 A;  1IJC A;  2QJA C;  2JQP A;  4QTI U;  2CCX A;  2ERA A;  4OM5 A;  1CB9 A;  2LA1 A;  2MJ0 A;  4FAO C;  1RL5 A;  1COE A;  3EBX A;  2MHY A;  2QJB C;  4BIK B;  3KFD I;  1FAS A;  4FAO E;  1IDL A;  1CDT A;  2BHI A;  1YWH A;  1NYS A;  1ES7 B;  3VTS A;  1HC9 B;  1TGX A;  3LAQ U;  4ZQY A;  1F8U B;  3U73 U;  1FRA A;  1IK8 A;  2L03 A;  4KSN A;  1CDQ A;  1CRF A;  2GOO B;  2H5F A;  1CXO A;  1VB0 A;  1KBS A;  2H62 D;  1CVO A;  3NDS A;  1JE9 A;  1NTX A;  4XJJ A;  2UWR A;  3ERA A;  4OM4 A;  2HLR A;  2VLW A;  1LXG A;  1FFJ A;  1ZAD A;  1PLO A;  2J8B A;  1KU6 B;  1FSS B;  2MUO A;  1TFS A;  2K3G A;  2H62 C;  1G6M A;  3FEV A;  2HLQ A;  2MJ4 A;  2X8B B;  1UG4 A;  5EBX A;  2PJY B;  1L4W A;  1KFH A;  2QC1 A;  1IKC A;  1CTX A;  1HOY A;  1IDH A;  1LX5 B;  1S4Y A;  2MJY A;  6EBX A;  2I9B E;  1IDG A;  2FD6 U;  1CDS A;  1CRE A;  1M9Z A;  1IQ9 A;  4RUD A;  1QKE A;  1H0J A;  1NEA A;  1CCQ A;  1W6B A;  2PJY C;  3KFD E;  5DO6 A;  4BDT B;  1KBA A;  1F94 A;  1LXH A;  4EY8 B;  3NEQ A;  2ABX A;  1CXN A;  1NYU A;  1QM7 A;  2GOO C;  3BT2 U;  5DU1 A;  1DRS A;  1V6P A;  5IMY C;  2CRT A;  1JGK A;  4HQP F;  1FF4 A;  1COD A;  1KL8 A;  2LCR A;  2MFA A;  2CRS A;  2H7Z A;  1LJZ A;  2H64 B;  3PLC A;  1KTZ B; 
#chains in the Genus database with same CATH homology
 2NBT A;  3QB4 B;  1ONJ A;  4LFT A;  1LSI A;  1QKD A;  2H8U A;  5IMT D;  1NXB A;  1BXP A;  2CDX A;  2L5S A;  2MUP A;  1I02 A;  1BTE A;  1TXB A;  1KXI A;  2OFS A;  3HH7 A;  2H64 C;  4IYE A;  1JBD A;  1MR6 A;  1B41 B;  3BT1 U;  4P7U A;  1NOR A;  1ABT A;  1XT3 A;  1HAJ A;  1NTN A;  1TXA A;  1HAA A;  2H7Z B;  1REW C;  3NH7 A;  2UX2 A;  3EVS C;  5DZ5 A;  1RGJ A;  2CTX A;  1FSC A;  1HC9 A;  1ERG A;  1KC4 A;  1MAH F;  2BTX A;  1CDR A;  1IDI A;  1CHV S;  3U74 U;  2QJ9 C;  2N99 A;  4AEA A;  1ERA A;  2JVE A;  4DO8 A;  4UY2 C;  1KBT A;  1KS6 A;  1IJC A;  2QJA C;  2JQP A;  4QTI U;  2CCX A;  2ERA A;  4OM5 A;  1CB9 A;  2LA1 A;  2MJ0 A;  4FAO C;  1RL5 A;  1COE A;  3EBX A;  2MHY A;  2QJB C;  4BIK B;  3KFD I;  1FAS A;  4FAO E;  1IDL A;  1CDT A;  2BHI A;  1YWH A;  1NYS A;  1ES7 B;  3VTS A;  1HC9 B;  1TGX A;  3LAQ U;  4ZQY A;  1F8U B;  3U73 U;  1FRA A;  1IK8 A;  2L03 A;  4KSN A;  1CDQ A;  1CRF A;  2GOO B;  2H5F A;  1CXO A;  1VB0 A;  1KBS A;  2H62 D;  1CVO A;  3NDS A;  1JE9 A;  1NTX A;  4XJJ A;  2UWR A;  3ERA A;  4OM4 A;  2HLR A;  2VLW A;  1LXG A;  1FFJ A;  1ZAD A;  1PLO A;  2J8B A;  1KU6 B;  1FSS B;  2MUO A;  1TFS A;  2K3G A;  2H62 C;  1G6M A;  3FEV A;  2HLQ A;  2MJ4 A;  2X8B B;  1UG4 A;  5EBX A;  2PJY B;  1L4W A;  1KFH A;  2QC1 A;  1IKC A;  1CTX A;  1HOY A;  1IDH A;  1LX5 B;  1S4Y A;  2MJY A;  6EBX A;  2I9B E;  1IDG A;  2FD6 U;  1CDS A;  1CRE A;  1M9Z A;  1IQ9 A;  4RUD A;  1QKE A;  1H0J A;  1NEA A;  1CCQ A;  1W6B A;  2PJY C;  3KFD E;  5DO6 A;  4BDT B;  1KBA A;  1F94 A;  1LXH A;  4EY8 B;  3NEQ A;  2ABX A;  1CXN A;  1NYU A;  1QM7 A;  2GOO C;  3BT2 U;  5DU1 A;  1DRS A;  1V6P A;  5IMY C;  2CRT A;  1JGK A;  4HQP F;  1FF4 A;  1COD A;  1KL8 A;  2LCR A;  2MFA A;  2CRS A;  2H7Z A;  1LJZ A;  2H64 B;  3PLC A;  1KTZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...