4OM4A

Crystal structure of ctx a2 from taiwan cobra (naja naja atra)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Endocytotic Routes of Cobra Cardiotoxins Depend on Spatial Distribution of Positively Charged and Hydrophobic Domains to Target Distinct Types of Sulfated Glycoconjugates on Cell Surface.
pubmed doi rcsb
molecule keywords Cytotoxin 2
molecule tags Toxin
total genus 11
structure length 60
sequence length 60
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4om4A00
3KFDI 1MR6A 1B41B 1ABTA 2BHIA 1CB9A 1JBDA 2H5FA 2H7ZA 2JVEA 3PLCA 2N99A 1CDQA 1KL8A 1LSIA 2QJ9C 5DO6A 2OFSA 2HLRA 1FASA 1JE9A 1ES7B 4EY8B 4RUDA 2BTXA 4FAOC 4BIKB 1NTNA 1CODA 1S4YA 3ERAA 1NXBA 1H0JA 2NBTA 3FEVA 2FD6U 2LA1A 5DU1A 2MUOA 2HLQA 2L03A 2UX2A 5IMYC 5IMTD 1F8UB 1CCQA 1ERAA 1ZADA 1NEAA 1QKEA 3LAQU 1L4WA 1NORA 2CCXA 1LJZA 1IDLA 2I9BE 1HOYA 1CDTA 1LXGA 1CTXA 2UWRA 2K3GA 4OM4A 1CRFA 1JGKA 1G6MA 1VB0A 1LX5B 1KC4A 1F94A 1FF4A 1QKDA 4HQPF 1V6PA 5EBXA 2QJBC 1NYSA 1MAHF 4AEAA 2MHYA 1HC9A 4ZQYA 3U74U 1REWC 3QB4B 3VTSA 4DO8A 2H62C 1HC9B 3NH7A 1KTZB 1I02A 2CTXA 2MJ0A 4UY2C 3EVSC 4IYEA 2QC1A 2H8UA 4QTIU 1CREA 2ERAA 2MUPA 1TXBA 1NTXA 1CDSA 2L5SA 2LCRA 1IDIA 1RL5A 3KFDE 1KU6B 1IKCA 6EBXA 4XJJA 4BDTB 1IQ9A 1TXAA 1YWHA 1KBAA 1TGXA 1KBSA 3NDSA 2H64C 1CVOA 1TFSA 4FAOE 1IJCA 1BXPA 1NYUA 3BT2U 1PLOA 2J8BA 2H64B 1W6BA 1CDRA 1IDGA 3HH7A 1QM7A 1KFHA 1FSSB 1IDHA 2QJAC 1CXOA 2ABXA 4OM5A 1XT3A 1FFJA 1KBTA 1IK8A 2H7ZB 1BTEA 1UG4A 1CXNA 3EBXA 2CRTA 2MJ4A 1FSCA 2JQPA 2GOOC 1ERGA 4LFTA 1RGJA 2PJYC 1KS6A 3NEQA 5DZ5A 1KXIA 1HAJA 2H62D 1CHVS 1ONJA 2GOOB 2VLWA 2PJYB 3BT1U 1DRSA 1COEA 1LXHA 1M9ZA 2X8BB 3U73U 1FRAA 2MJYA 4P7UA 2MFAA 2CDXA 1HAAA 2CRSA
chains in the Genus database with same CATH superfamily
3KFDI 1MR6A 1B41B 1ABTA 2BHIA 1CB9A 1JBDA 2H5FA 2H7ZA 2JVEA 3PLCA 2N99A 1CDQA 1KL8A 4KSNA 1LSIA 2QJ9C 5DO6A 2OFSA 2HLRA 1FASA 1JE9A 1ES7B 4EY8B 4RUDA 2BTXA 4FAOC 4BIKB 1NTNA 1CODA 1S4YA 3ERAA 1NXBA 1H0JA 2NBTA 3FEVA 2FD6U 2LA1A 5DU1A 2MUOA 2HLQA 2L03A 2UX2A 5IMYC 5IMTD 1F8UB 1CCQA 1ERAA 1ZADA 1NEAA 1QKEA 3LAQU 1L4WA 1NORA 2CCXA 1LJZA 1IDLA 2I9BE 1HOYA 1CDTA 1LXGA 1CTXA 2UWRA 2K3GA 4OM4A 1CRFA 1JGKA 1G6MA 1VB0A 1LX5B 1KC4A 1F94A 1FF4A 1QKDA 4HQPF 1V6PA 5EBXA 2QJBC 1NYSA 1MAHF 4AEAA 2MHYA 1HC9A 4ZQYA 3U74U 1REWC 3QB4B 3VTSA 4DO8A 2H62C 1HC9B 3NH7A 1KTZB 1I02A 2CTXA 2MJ0A 4UY2C 3EVSC 4IYEA 2QC1A 2H8UA 4QTIU 1CREA 2ERAA 2MUPA 1TXBA 1NTXA 1CDSA 2L5SA 2LCRA 1IDIA 1RL5A 3KFDE 1KU6B 1IKCA 6EBXA 4XJJA 4BDTB 1IQ9A 1TXAA 1YWHA 1KBAA 1TGXA 1KBSA 3NDSA 2H64C 1CVOA 1TFSA 4FAOE 1IJCA 1BXPA 1NYUA 3BT2U 1PLOA 2J8BA 2H64B 1W6BA 1CDRA 1IDGA 3HH7A 1QM7A 1KFHA 1FSSB 1IDHA 2QJAC 1CXOA 2ABXA 4OM5A 1XT3A 1FFJA 1KBTA 1IK8A 2H7ZB 1BTEA 1UG4A 1CXNA 3EBXA 2CRTA 2MJ4A 1FSCA 2JQPA 2GOOC 1ERGA 4LFTA 1RGJA 2PJYC 1KS6A 3NEQA 5DZ5A 1KXIA 1HAJA 2H62D 1CHVS 1ONJA 2GOOB 2VLWA 2PJYB 3BT1U 1DRSA 1COEA 1LXHA 1M9ZA 2X8BB 3U73U 1FRAA 2MJYA 4P7UA 2MFAA 2CDXA 1HAAA 2CRSA
chains in the Genus database with same CATH topology
3KFDI 1MR6A 1B41B 1ABTA 2BHIA 1CB9A 1JBDA 2H5FA 2H7ZA 2JVEA 3PLCA 2N99A 1CDQA 1KL8A 4KSNA 1LSIA 2QJ9C 5DO6A 2OFSA 2HLRA 1FASA 1JE9A 1ES7B 4EY8B 4RUDA 2BTXA 4FAOC 4BIKB 1NTNA 1CODA 1S4YA 3ERAA 1NXBA 1H0JA 2NBTA 3FEVA 2FD6U 2LA1A 5DU1A 2MUOA 2HLQA 2L03A 2UX2A 5IMYC 5IMTD 1F8UB 1CCQA 1ERAA 1ZADA 1NEAA 1QKEA 3LAQU 1L4WA 1NORA 2CCXA 1LJZA 1IDLA 2I9BE 1HOYA 1CDTA 1LXGA 1CTXA 2UWRA 2K3GA 4OM4A 1CRFA 1JGKA 1G6MA 1VB0A 1LX5B 1KC4A 1F94A 1FF4A 1QKDA 4HQPF 1V6PA 5EBXA 2QJBC 1NYSA 1MAHF 4AEAA 2MHYA 1HC9A 4ZQYA 3U74U 1REWC 3QB4B 3VTSA 4DO8A 2H62C 1HC9B 3NH7A 1KTZB 1I02A 2CTXA 2MJ0A 4UY2C 3EVSC 4IYEA 2QC1A 2H8UA 4QTIU 1CREA 2ERAA 2MUPA 1TXBA 1NTXA 1CDSA 2L5SA 2LCRA 1IDIA 1RL5A 3KFDE 1KU6B 1IKCA 6EBXA 4XJJA 4BDTB 1IQ9A 1TXAA 1YWHA 1KBAA 1TGXA 1KBSA 3NDSA 2H64C 1CVOA 1TFSA 4FAOE 1IJCA 1BXPA 1NYUA 3BT2U 1PLOA 2J8BA 2H64B 1W6BA 1CDRA 1IDGA 3HH7A 1QM7A 1KFHA 1FSSB 1IDHA 2QJAC 1CXOA 2ABXA 4OM5A 1XT3A 1FFJA 1KBTA 1IK8A 2H7ZB 1BTEA 1UG4A 1CXNA 3EBXA 2CRTA 2MJ4A 1FSCA 2JQPA 2GOOC 1ERGA 4LFTA 1RGJA 2PJYC 1KS6A 3NEQA 5DZ5A 1KXIA 1HAJA 2H62D 1CHVS 1ONJA 2GOOB 2VLWA 2PJYB 3BT1U 1DRSA 1COEA 1LXHA 1M9ZA 2X8BB 3U73U 1FRAA 2MJYA 4P7UA 2MFAA 2CDXA 1HAAA 2CRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFD I;  1MR6 A;  1B41 B;  1ABT A;  2BHI A;  1CB9 A;  1JBD A;  2H5F A;  2H7Z A;  2JVE A;  3PLC A;  2N99 A;  1CDQ A;  1KL8 A;  1LSI A;  2QJ9 C;  5DO6 A;  2OFS A;  2HLR A;  1FAS A;  1JE9 A;  1ES7 B;  4EY8 B;  4RUD A;  2BTX A;  4FAO C;  4BIK B;  1NTN A;  1COD A;  1S4Y A;  3ERA A;  1NXB A;  1H0J A;  2NBT A;  3FEV A;  2FD6 U;  2LA1 A;  5DU1 A;  2MUO A;  2HLQ A;  2L03 A;  2UX2 A;  5IMY C;  5IMT D;  1F8U B;  1CCQ A;  1ERA A;  1ZAD A;  1NEA A;  1QKE A;  3LAQ U;  1L4W A;  1NOR A;  2CCX A;  1LJZ A;  1IDL A;  2I9B E;  1HOY A;  1CDT A;  1LXG A;  1CTX A;  2UWR A;  2K3G A;  4OM4 A;  1CRF A;  1JGK A;  1G6M A;  1VB0 A;  1LX5 B;  1KC4 A;  1F94 A;  1FF4 A;  1QKD A;  4HQP F;  1V6P A;  5EBX A;  2QJB C;  1NYS A;  1MAH F;  4AEA A;  2MHY A;  1HC9 A;  4ZQY A;  3U74 U;  1REW C;  3QB4 B;  3VTS A;  4DO8 A;  2H62 C;  1HC9 B;  3NH7 A;  1KTZ B;  1I02 A;  2CTX A;  2MJ0 A;  4UY2 C;  3EVS C;  4IYE A;  2QC1 A;  2H8U A;  4QTI U;  1CRE A;  2ERA A;  2MUP A;  1TXB A;  1NTX A;  1CDS A;  2L5S A;  2LCR A;  1IDI A;  1RL5 A;  3KFD E;  1KU6 B;  1IKC A;  6EBX A;  4XJJ A;  4BDT B;  1IQ9 A;  1TXA A;  1YWH A;  1KBA A;  1TGX A;  1KBS A;  3NDS A;  2H64 C;  1CVO A;  1TFS A;  4FAO E;  1IJC A;  1BXP A;  1NYU A;  3BT2 U;  1PLO A;  2J8B A;  2H64 B;  1W6B A;  1CDR A;  1IDG A;  3HH7 A;  1QM7 A;  1KFH A;  1FSS B;  1IDH A;  2QJA C;  1CXO A;  2ABX A;  4OM5 A;  1XT3 A;  1FFJ A;  1KBT A;  1IK8 A;  2H7Z B;  1BTE A;  1UG4 A;  1CXN A;  3EBX A;  2CRT A;  2MJ4 A;  1FSC A;  2JQP A;  2GOO C;  1ERG A;  4LFT A;  1RGJ A;  2PJY C;  1KS6 A;  3NEQ A;  5DZ5 A;  1KXI A;  1HAJ A;  2H62 D;  1CHV S;  1ONJ A;  2GOO B;  2VLW A;  2PJY B;  3BT1 U;  1DRS A;  1COE A;  1LXH A;  1M9Z A;  2X8B B;  3U73 U;  1FRA A;  2MJY A;  4P7U A;  2MFA A;  2CDX A;  1HAA A;  2CRS A; 
#chains in the Genus database with same CATH topology
 3KFD I;  1MR6 A;  1B41 B;  1ABT A;  2BHI A;  1CB9 A;  1JBD A;  2H5F A;  2H7Z A;  2JVE A;  3PLC A;  2N99 A;  1CDQ A;  1KL8 A;  4KSN A;  1LSI A;  2QJ9 C;  5DO6 A;  2OFS A;  2HLR A;  1FAS A;  1JE9 A;  1ES7 B;  4EY8 B;  4RUD A;  2BTX A;  4FAO C;  4BIK B;  1NTN A;  1COD A;  1S4Y A;  3ERA A;  1NXB A;  1H0J A;  2NBT A;  3FEV A;  2FD6 U;  2LA1 A;  5DU1 A;  2MUO A;  2HLQ A;  2L03 A;  2UX2 A;  5IMY C;  5IMT D;  1F8U B;  1CCQ A;  1ERA A;  1ZAD A;  1NEA A;  1QKE A;  3LAQ U;  1L4W A;  1NOR A;  2CCX A;  1LJZ A;  1IDL A;  2I9B E;  1HOY A;  1CDT A;  1LXG A;  1CTX A;  2UWR A;  2K3G A;  4OM4 A;  1CRF A;  1JGK A;  1G6M A;  1VB0 A;  1LX5 B;  1KC4 A;  1F94 A;  1FF4 A;  1QKD A;  4HQP F;  1V6P A;  5EBX A;  2QJB C;  1NYS A;  1MAH F;  4AEA A;  2MHY A;  1HC9 A;  4ZQY A;  3U74 U;  1REW C;  3QB4 B;  3VTS A;  4DO8 A;  2H62 C;  1HC9 B;  3NH7 A;  1KTZ B;  1I02 A;  2CTX A;  2MJ0 A;  4UY2 C;  3EVS C;  4IYE A;  2QC1 A;  2H8U A;  4QTI U;  1CRE A;  2ERA A;  2MUP A;  1TXB A;  1NTX A;  1CDS A;  2L5S A;  2LCR A;  1IDI A;  1RL5 A;  3KFD E;  1KU6 B;  1IKC A;  6EBX A;  4XJJ A;  4BDT B;  1IQ9 A;  1TXA A;  1YWH A;  1KBA A;  1TGX A;  1KBS A;  3NDS A;  2H64 C;  1CVO A;  1TFS A;  4FAO E;  1IJC A;  1BXP A;  1NYU A;  3BT2 U;  1PLO A;  2J8B A;  2H64 B;  1W6B A;  1CDR A;  1IDG A;  3HH7 A;  1QM7 A;  1KFH A;  1FSS B;  1IDH A;  2QJA C;  1CXO A;  2ABX A;  4OM5 A;  1XT3 A;  1FFJ A;  1KBT A;  1IK8 A;  2H7Z B;  1BTE A;  1UG4 A;  1CXN A;  3EBX A;  2CRT A;  2MJ4 A;  1FSC A;  2JQP A;  2GOO C;  1ERG A;  4LFT A;  1RGJ A;  2PJY C;  1KS6 A;  3NEQ A;  5DZ5 A;  1KXI A;  1HAJ A;  2H62 D;  1CHV S;  1ONJ A;  2GOO B;  2VLW A;  2PJY B;  3BT1 U;  1DRS A;  1COE A;  1LXH A;  1M9Z A;  2X8B B;  3U73 U;  1FRA A;  2MJY A;  4P7U A;  2MFA A;  2CDX A;  1HAA A;  2CRS A; 
#chains in the Genus database with same CATH homology
 3KFD I;  1MR6 A;  1B41 B;  1ABT A;  2BHI A;  1CB9 A;  1JBD A;  2H5F A;  2H7Z A;  2JVE A;  3PLC A;  2N99 A;  1CDQ A;  1KL8 A;  4KSN A;  1LSI A;  2QJ9 C;  5DO6 A;  2OFS A;  2HLR A;  1FAS A;  1JE9 A;  1ES7 B;  4EY8 B;  4RUD A;  2BTX A;  4FAO C;  4BIK B;  1NTN A;  1COD A;  1S4Y A;  3ERA A;  1NXB A;  1H0J A;  2NBT A;  3FEV A;  2FD6 U;  2LA1 A;  5DU1 A;  2MUO A;  2HLQ A;  2L03 A;  2UX2 A;  5IMY C;  5IMT D;  1F8U B;  1CCQ A;  1ERA A;  1ZAD A;  1NEA A;  1QKE A;  3LAQ U;  1L4W A;  1NOR A;  2CCX A;  1LJZ A;  1IDL A;  2I9B E;  1HOY A;  1CDT A;  1LXG A;  1CTX A;  2UWR A;  2K3G A;  4OM4 A;  1CRF A;  1JGK A;  1G6M A;  1VB0 A;  1LX5 B;  1KC4 A;  1F94 A;  1FF4 A;  1QKD A;  4HQP F;  1V6P A;  5EBX A;  2QJB C;  1NYS A;  1MAH F;  4AEA A;  2MHY A;  1HC9 A;  4ZQY A;  3U74 U;  1REW C;  3QB4 B;  3VTS A;  4DO8 A;  2H62 C;  1HC9 B;  3NH7 A;  1KTZ B;  1I02 A;  2CTX A;  2MJ0 A;  4UY2 C;  3EVS C;  4IYE A;  2QC1 A;  2H8U A;  4QTI U;  1CRE A;  2ERA A;  2MUP A;  1TXB A;  1NTX A;  1CDS A;  2L5S A;  2LCR A;  1IDI A;  1RL5 A;  3KFD E;  1KU6 B;  1IKC A;  6EBX A;  4XJJ A;  4BDT B;  1IQ9 A;  1TXA A;  1YWH A;  1KBA A;  1TGX A;  1KBS A;  3NDS A;  2H64 C;  1CVO A;  1TFS A;  4FAO E;  1IJC A;  1BXP A;  1NYU A;  3BT2 U;  1PLO A;  2J8B A;  2H64 B;  1W6B A;  1CDR A;  1IDG A;  3HH7 A;  1QM7 A;  1KFH A;  1FSS B;  1IDH A;  2QJA C;  1CXO A;  2ABX A;  4OM5 A;  1XT3 A;  1FFJ A;  1KBT A;  1IK8 A;  2H7Z B;  1BTE A;  1UG4 A;  1CXN A;  3EBX A;  2CRT A;  2MJ4 A;  1FSC A;  2JQP A;  2GOO C;  1ERG A;  4LFT A;  1RGJ A;  2PJY C;  1KS6 A;  3NEQ A;  5DZ5 A;  1KXI A;  1HAJ A;  2H62 D;  1CHV S;  1ONJ A;  2GOO B;  2VLW A;  2PJY B;  3BT1 U;  1DRS A;  1COE A;  1LXH A;  1M9Z A;  2X8B B;  3U73 U;  1FRA A;  2MJY A;  4P7U A;  2MFA A;  2CDX A;  1HAA A;  2CRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...