4OMEA

X-ray structure of human glutamate carboxypeptidase ii in complex with dccbl, a urea based inhibitor with distal carborane moiety
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title X-ray structure of human glutamate carboxypeptidase II in complex with DCCBL, a urea based inhibitor with distal carborane moiety
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 262
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4omeA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4omeA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4omeA02
1BLLE 3B2YA 3JRUA 2PE3A 1F2PA 3FEEA 1PYTB 1VHEA 5LRJA 2PJ0A 5J1QA 4C9EA 1LANA 1TF8A 2CF4A 4UIBA 2F7VA 3B3CA 4IK2A 4OIDA 1XF1A 4PXCA 1VIXA 2NSMA 3ICUA 1NSAA 4OC0A 4OC3A 2RFHA 4F9VA 1EE3P 5K8OA 2PIYA 4P44A 1BPNA 3V38A 4MHYA 5LYLA 3GUXA 4CDKA 8CPAA 4C9VA 3I6SA 1HDUA 4P4JA 2EK8A 4MRIA 1Z2LA 2ZEGA 4EMEA 4F8ZA 3KZWA 2EK9A 5THWA 3PRTA 2ZEDA 7CPAA 3PBBA 1LOKA 4B6ZA 1RTQA 2GREA 1IGBA 4PQAA 4UIAA 3BI1A 4NGNA 2WYRA 4FAIA 2C6CA 4OC2A 2PIZA 4K3NA 4C9RA 1CP6A 2EWBA 5LRKA 2F8HA 3CT9A 3IJ3A 4TJXA 4FUUA 1XFOA 2HB6A 4ZX9A 2CIJA 3KHXA 4NGRA 2ZOFA 1IY7A 2WZNA 1CP7A 2PJ3A 1CPXA 1ELLP 4JYWA 1ZG8A 3B3VA 4FBEA 1XMBA 4A39A 3ISXA 5LYFA 3KL9A 4KSIA 4YN3A 1TKJA 1UWYA 1GYTA 2G9DA 3D7FA 3IO1A 3TX8A 3LMSA 4TWEA 3KASA 2ABZA 3LWUA 3D7GA 2V8HA 2ZENA 3KHZA 1ZLHA 1DE4C 4ZY0A 1Y9ZA 1XJOA 4NGQA 3D68A 1QMUA 2O4HA 3B3TA 4ZI6A 2PJ9A 1Q7LA 1F2OA 3HUVA 3I74A 5LYIA 2ZEEA 4TJVA 1TF9A 3VH9A 2PJ7A 2HC9A 1R3NA 2PVWA 1V6CA 2BO9A 1CG2A 3B35A 5I4MA 2J9AA 4P4FA 2C1CA 1H8LA 4A94A 3WABA 3B7IA 1YW4A 3H8GA 3B3WA 4KNGE 2XEGA 2GLJA 3KQZA 4UEZA 4C86A 1Z5RA 3KGQA 1TKFA 3NH5A 5IB9A 3SJFA 1ZG7A 2GU2A 3DGVA 2V8GA 3SI2A 3EIFA 2QJ8A 3SJEA 3RBUA 1DTDA 3NA6A 4O23A 1LAMA 4MCSA 1ZG9A 2JEWA 5JM6A 2PJ1A 1XRYA 2PJAA 1YW6A 2AFMA 1BAVA 4P10A 3D4UA 3FVLA 4P4BA 2ZOGA 2ZEMA 4YWYA 2XEJA 4OKOA 4EFDA 3PB4X 2JBKA 4R76A 5HXDA 3MN8A 5HVGA 3KR4A 4C84A 2PVVA 2CTBA 3WC6A 2C6PA 2NYQA 4C8TA 4ZY2A 3B3SA 5F09A 1FNOA 5K8PA 4C8PA 2PJBA 2V8VA 2QYVA 3KI9A 1HDQA 5HVFA 1Y0YA 1CBXA 4RUHA 3I1UA 1OBRA 4EWTA 4MXUA 4WWVA 3WT4A 1PCAA 4MCRA 1LFWA 2BCOA 1CPSA 3IFEA 3PFOA 3MRUA 4UEFA 4C85A 1TXRA 4R6TA 4ZYQA 4MHPA 3K9TA 2V8DA 3IWWA 4P4EA 2FVGA 1AYEA 5D8NA 3CPAA 2PJCA 3FX6A 4A37A 4C8AA 4MHNA 3S9MA 3FMCA 3N5FA 2PCUA 4ZX8A 3SJXA 2XEIA 4DUKA 4C8CA 1KWMA 4OMEA 2IMOA 3QNVA 5K8NA 2POKA 1YSJA 2AFUA 3H8EA 3TC8A 1M4LA 3NH4A 3PB8X 1WVMA 4NJQA 3VARA 1QQ9A 2VL1A 4C9UA 3RZAA 1VHOA 1LCPA 2I3CA 3DLJA 3T8WA 2AFZA 4YU9A 3IC1A 4MHZA 2PJ2A 4PPZA 2V77A 4GM5A 1XBUA 3FECA 3CDXA 2AFWA 4JZ0A 4MCPA 3BHXA 4A38A 1HEEA 4C99A 4PXDA 5CPAA 4ZY1A 3PFEA 4PXBA 4TNUA 2AFOA 2O53A 1TKHA 4Q7AA 2CTCA 2Q43A 2BOAA 4DJLA 4OC4A 1LAPA 4PXEA 4UEEA 2PRQA 2IQ6A 4OIWA 2ZEHA 4LQGA 4CPAA 3GLJA 4IHMA 3WC7A 5DS0A 2OOTA 3K2KA 3D67A 4BD9A 4CDJA 5JH9A 1YLOA 3KR5A 4NJRA 4NFRA 4MCQA 3V7ZA 4W9YA 2PJ4A 3RAMA 3IIBA 4ONWA 3D66A 3D7HA 4UF4A 3WC5A 2ZELA 5JGFA 3PBEA 3VTAA 3IEHA 3NH8A 3S9NA 4FWUA 3VATA 1ELMP 2ZEPA 3D7DA 4X2TA 2C6GA 4X8IA 2ZEOA 2DEAA 2PJ6A 3SI1A 3KQXA 3PB6X 3FF3A 4C8FA 4Z65A 2QVPA 4IAVA 1R43A 4P4DA 4R8FA 5LYDA 2JBJA 3HLPA 1Z8LA 2ANPA 3PB7X 2Q4ZA 1Y0RA 1BPMA 1Y7EA 4DYOA 3GB0A 4F9UA 4OC5A 1ZLIA 4MMOA 2AFSA 1ARMA 3S9LA 3L2NA 5CBMA 2PJ5A 4R7MA 4NGMA 3FJUA 4C8UA 5K8MA 3PB9X 3SI0A 4WJBA 1VGYA 2GLFA 3CPXA 2AFXA 1CX8A 2RB7A 3PEIA 4AXVA 4X3RA 3FEDA 2Q51A 1FT7A 4C9AA 1JQGA 5HVHA 2OR4A 3SJGA 2PJ8A 2XEFA 1YMEA 1F57A 4H2KA 1ARLA 4OP4A 4P4IA 2ZEFA 3FH4A 4NGTA 1AMPA 3ISZA 4P45A 3BI0A 3BXMA 4G1PA 5LRGA 4NGPA 5ELYA 3NFZA 4OC1A 5D29A 6CPAA 2IJZA 4P6YA 4NGSA 3H8FA
chains in the Genus database with same CATH superfamily
2Y1NA 2IL4A 5H84A 1BLLE 3R96A 5HKWA 3B2YA 3JRUA 1MJ9A 2PE3A 2PRBA 2DIKA 1B6BA 1WK4A 2PR1A 2Q4YA 4KOWA 1SQHA 4IIXA 1F2PA 2B5GA 3FEEA 1PYTB 4MI4A 1VHEA 1RO5A 4MJ8A 4MFKA 5LRJA 1UFHA 2PJ0A 4U9ZA 5J1QA 3LD2A 5IB0A 2ZW7A 3U88C 1LANA 1TF8A 2CF4A 3QAYA 4JWPA 4UIBA 4CAWA 2F7VA 3TO9A 3B3CA 4C7HA 4IK2A 4OIDA 4F0YA 4B10A 2Z10A 1VIXA 3FB3A 4PXCA 4II9A 1XF1A 2NSMA 3ICUA 2EVNA 3LODA 2ZXVA 2OLSA 2QECA 1NSAA 1C3OB 5GCNA 4OC0A 4OC3A 2RFHA 1X10A 2Y0MA 4BTFA 1EE3P 3IWGA 3QAHA 1K4JA 4F9VA 1M6VB 5K8OA 1YK3A 2PIYA 4P44A 1BPNA 3NFQA 3V38A 1YVKA 4AG9A 3OB2B 3PZJA 2NMTA 4FD5A 5F49A 2YNCA 4MHYA 4R9MA 3BUWB 4A31A 5LYLA 4NSQA 3G3SA 3GUXA 4PSXA 3FXTA 4E94A 3KRVA 5JQ4A 4K30A 3TO7A 1C30B 5KTCA 1XIXA 4JVOA 3OAKA 4CDKA 3KKWA 1M4DA 2B58A 3F8KA 3TLCA 4H89A 3EO4A 4C68A 1XOVA 8CPAA 4C9VA 3RO0A 1FY7A 4P4JA 1HDUA 1S7FA 2BSWA 2C27A 2EK8A 3I6SA 4MRIA 4CYPA 1Z2LA 2EZBA 2ZEGA 4MFPA 4OADA 5G22A 3NOJA 4C2YA 3TE4A 2FE7A 4EMEA 1ZYMA 2Z3NA 1B87A 1AUGA 3KZWA 4F8ZA 2EK9A 5THWA 4NXYA 4JLYA 3PRTA 4KOUA 2ZEDA 2P0WA 7CPAA 2REFA 3PBBA 1LOKA 4B6ZA 1Y9KA 1I21A 4OLLA 1RTQA 2GREA 1IGBA 4PQAA 4UIAA 4DNCA 3BI1A 4NGNA 4PK2A 1Q5XA 1JWQA 5IV0A 1Y9WA 4KVME 2WYRA 4LX9A 4FAIA 1WJTA 3JTKA 2Z3KA 3CXPA 2C6CA 4OC2A 2VQYA 2PIZA 4K3NA 4MY3A 3HPHE 1KBLA 3W6XA 4A4BA 1VI4A 4C9RA 1CP6A 2EWBA 5LRKA 2F8HA 3CT9A 3IJ3A 3ZZIA 1YVHA 4E8OA 4L8AA 4TJXA 2DLAA 4FUUA 4XNHB 2G0BA 4B13A 3B8GA 4CYNA 3TLAA 3ZNIA 4C2ZA 1EZAA 1XFOA 1CM0A 2HB6A 2CIJA 4ZX9A 3W6SA 2UV8G 2FS5A 2XPNA 1KUVA 3KHXA 4NGRA 2ZOFA 3SXOA 1RXTA 3TT2A 1IY7A 2WZNA 4BINA 3BUXB 1CP7A 2PJ3A 1QSTA 1CPXA 1ELLP 1YVOA 4BPXB 1ZL0A 4JYWA 1PUAA 2MP0A 1IYLA 4COBA 1ZG8A 2OU2A 1S3ZA 2WSAA 4A95A 4J3GA 5F13A 1CS0B 3B3VA 4FBEA 1MK4A 4KZTA 1XMBA 3D8PA 5BWAB 1VBGA 4A39A 3ISXA 5LYFA 3KL9A 4KSIA 4YN3A 3R9GA 2OZGA 3H4QA 1VKCA 1YR0A 3TOBA 1TKJA 1UWYA 4UA3A 3E0KA 1GYTA 5K99A 2G9DA 1JDBC 1R57A 2FT0A 3D7FA 2BL1A 1YX0A 3EC4A 3FYNA 3IO1A 4MFLA 1QSMA 3TX8A 3VRNA 4JJXA 3LMSA 4TWEA 2VI7A 3KASA 2ABZA 2B4DB 5C88A 5J8FA 3D7GA 2ODFA 2V8HA 2ZENA 3LWUA 3KHZA 4KUAA 1ZLHA 4NF1A 1XF8A 1DE4C 4ZY0A 4NEXA 1J3LA 1Y9ZA 5C82A 1XJOA 4NGQA 3OP0A 3D68A 1NE9A 1QMUA 2O4HA 3B3TA 3R1KA 3TO6A 4A2ZA 4ZI6A 4MJXA 2R82A 4NCZA 2PJ9A 1Q7LA 1F2OA 4MBUA 3HUVA 4ORFA 5LYIA 2ZEEA 3S6GA 4AVAA 1S60A 3I74A 4TJVA 3TLYA 2XPLA 3FBUA 1TF9A 3VH9A 4RI1A 4COGA 4B11A 5HKYA 2B0AA 4Y49B 4UCMA 2PJ7A 2HC9A 1R3NA 2PVWA 3T0TA 4CGPA 4E0AA 3VRRA 1MJBA 1S5KA 4KVXA 1V6CA 2Q4VA 2HUZA 3CXSA 4KSFA 2BO9A 2Z3PA 1CG2A 2FCKA 4U9YA 1M4IA 1Z4EA 3B35A 2ATRA 4MFJA 4XPDB 3SXNA 5I4MA 2J9AA 3EZEA 4CO9A 2WPXA 5AG4A 4P4FA 2ZW5A 1YLEA 2C1CA 1H8LA 2HQYA 1ZO0A 3PGPA 4A94A 3WABA 3F9KC 3TOAA 3B7IA 1YW4A 3H8GA 3N7ZA 3B3WA 5AXIA 4UCPA 3PLFB 2AJ6A 4KNGE 2XEGA 5JYBA 4UFWA 1Z9UA 1CJWA 3LACA 2GLJA 1KZFA 4MY0A 3KQZA 5ISVA 4UEZA 4C86A 4CAXA 2VKZG 3IWEA 3BJ8A 3GY9A 1Z5RA 3KGQA 1TKFA 4CS0B 2B5GB 3NH5A 5IB9A 4Y49C 3SJFA 3MGDA 1YGHA 4B12A 4JXRA 3H5ZA 5G21A 1LRZA 1ZG7A 2JDCA 1P0HA 2WPWA 3IU1A 3R9EA 2HV2A 1XMTA 2GU2A 3DGVA 2V8GA 4XPDC 3T90A 1XEBA 1I12A 3G8WA 4B14A 2CNTA 5FD8A 4KOTA 3SI2A 3WR7A 4A32A 3EIFA 4E5SA 4CZ1A 2QJ8A 1OZPA 4FD4A 3SJEA 4B5PA 3RBUA 1DTDA 3NA6A 3TLGA 5J8CA 3GJZA 4R3KA 4AG7A 2GE3A 4O23A 2J8RA 2B3UA 5F9MA 1LAMA 3D2MA 4MCSA 1ZG9A 4CGLA 2X7BA 4C9EA 2X0SA 2JEWA 3IU2A 1IB1E 2Q7SA 5JM6A 2PJ1A 1XRYA 2PJAA 1YW6A 2VZZA 4GXHA 2AFMA 1BAVA 4P10A 3D4UA 3R9FA 3FVLA 3UY5A 4F0XA 4P4BA 3P2FA 4UBRA 3BUNB 1P4NA 5HMNA 2ZOGA 3C8OA 2ZEMA 4YWYA 1ZRSA 3FRMA 2XEJA 3S6KA 4OKOA 4EYSA 1S7KA 3EXNA 2FIAA 5HH1A 4PV6A 4EFDA 3PB4X 5IR2A 1QSOA 2JBKA 3NE7A 4R76A 3EFAA 4F6AA 5HXDA 3K4IA 2EBJA 4M3SA 3MN8A 3BJ7A 4CGNA 3KR4A 3JVNA 3D3SA 5HVGA 2E28A 4C84A 5EMIA 2PVVA 3PP9A 3VRPA 2CTBA 3WC6A 1NBWA 2C6PA 2NYQA 1GHEA 2BUEA 2YNCC 4ZY2A 1X12A 4C8TA 3TYXA 3B3SA 5AG5A 5F09A 1DIKA 4GPLB 2P6GA 4H6UA 1FNOA 1Q2DA 4KVOE 4RN7A 4A4CA 4HNXB 5K8PA 4C8PA 1IYKA 4KOSA 1Y7RA 2PJBA 2V8VA 2Z3MA 2QYVA 3KI9A 1HDQA 3TLEA 4M6IA 2CNSA 1KUXA 5EC4A 3W91A 2R8VA 3U1BA 3HPGG 5I0CA 5HVFA 1Y0YA 1CBXA 4BPUB 4RUHA 3TLZA 3I1UA 4RR2B 1Z8WA 2B4JC 1OBRA 2REEA 3DR8A 4MXUA 4WWVA 5CNPA 3WT4A 4EWTA 1A9XB 3TLBA 1PCAA 4MCRA 1LFWA 2BCOA 1CPSA 1M44A 2VEZA 3DNSA 3IFEA 3QB8A 1IIDA 1Z4RA 3PFOA 3MRUA 4UEFA 2HI6A 4C85A 4ZBGA 1TXRA 2PQ8A 5IX3A 3T5MA 4R6TA 2FIWA 4ZYQA 4MHPA 1IOFA 4QUSA 3K9TA 2V8DA 4QB9A 3IWWA 3DDDA 4P4EA 2FVGA 1AYEA 1V0CA 2PDOA 3JUWA 3PT1A 4R3LA 5D8NA 3R95A 3TCVA 2Z0ZA 1Z9EA 3CPAA 3D2PA 2PJCA 1QSRA 3FX6A 2VXKA 1M4GA 1ON0A 2K5TA 4XNHC 2Q04A 4A37A 2EZAA 3VWEA 2YJTA 4C8AA 2GFQA 5F48A 4YGOA 4MHNA 3S9MA 1VHSA 4XPLA 2G3AA 3C26A 4HPSA 1J4JA 4FD7A 3FMCA 3N5FA 2PCUA 4ZX8A 4B5OA 3DR6A 3SJXA 3NE8A 2XEIA 3SHPA 4DUKA 3SR3A 1Q2CA 4BBHA 5BY0A 1KWMA 4C8CA 4OMEA 4LQ6A 1YQEA 1S7NA 2IMOA 3QNVA 2DPSA 5K8NA 2POKA 4JD6A 4H1HA 1YSJA 2AFUA 2I00A 3P2HA 3H8EA 3TC8A 1M4LA 4ONUA 4FD6A 3NH4A 2GIVA 3DSBA 3PB8X 1WVMA 4NJQA 4RS2A 1QQ9A 2VL1A 3VARA 5A28A 5KTAA 4J0NA 2D4PA 4C9UA 4KORA 3RZAA 3S6FA 1VHOA 1LCPA 2I79A 2I3CA 3O8ZA 2YGWA 3DLJA 3T8WA 2R98A 2OH1A 2AFZA 2JDDA 2JEVA 2R1IA 4YU9A 3I3GA 3IC1A 4MHZA 2PJ2A 4PPZA 2V77A 4GM5A 1XBUA 3G23A 1KUYA 3GIUA 3FECA 1NMTA 2EUIA 3CDXA 3CZXA 2AFWA 2Q0YA 2A4NA 1QSNA 4JZ0A 4MCPA 3BHXA 4KS9A 4Q36A 3FIXA 4A38A 1HEEA 1TIQA 4C99A 1T36B 4I49A 1GGOA 4PXDA 4PK3A 5CPAA 4CAVA 4ZY1A 5G20A 3OWCA 3PFEA 4U5YA 4UWJA 2YJVA 4PXBA 4TNUA 1A2ZA 5G1ZA 4PSWA 2PCNA 4KOXA 2AFOA 2O53A 2DPTA 1TKHA 1U6MA 2YNDA 4Q7AA 4UCNA 4QBJA 2CTCA 5KTDA 1Q2YA 2CBLA 2Q43A 2BOAA 4MHDA 4DJLA 4OC4A 3BUOB 1LAPA 2PR8A 4PXEA 4UEEA 1MJAA 2PRQA 5AGEA 3T05A 2HWGA 2IQ6A 4OIWA 1IICA 2VBQA 2ZEHA 2Z11A 4LQGA 4CPAA 1NXJA 1M1DA 3GLJA 4IHMA 4OAEA 5DS0A 3S6HA 2OOTA 3WC7A 1JDEA 4M6HA 4B5PB 3K2KA 3D67A 4BD9A 3TLGB 4ZGYB 1S7LA 2HROA 2C5QA 2R7HA 4LUAA 4CDJA 3BUMB 5JH9A 1YLOA 2ZW6A 3HMJG 3KR5A 4AB7A 4NJRA 3EZAA 4NFRA 5DWNA 4MCQA 4L89A 4MFQA 3V7ZA 4W9YA 2ZW4A 1WWZA 2PJ4A 3I9SA 4IUSA 4JXQA 3RAMA 4UFXA 5F5XA 3IIBA 4ONWA 1BO4A 4HNYB 1EZBA 4UFVA 4CGMA 3D66A 3CXQA 1I1DA 2EO8A 4A33A 2P6EA 2FXFA 2D4OA 2J8MA 2Z3OA 3D7HA 4QC6A 4UF4A 5DWMA 3IGRA 3WC5A 2ZELA 4BMHA 2FSRA 5JGFA 1PU9A 4Q38A 2Z3LA 4KOVA 3BLNA 1CE8B 5F47A 3PBEA 3OB1B 3GYAA 5J3XA 3VTAA 4C2XA 2N3AB 2CXAA 2DF5A 2YNEA 3IEHA 3NH8A 1NSLA 2GANA 3S9NA 4FWUA 3VATA 2G3TA 1ELMP 2QIRA 2ZEPA 5FVJA 1IU8A 3D7DA 2D0OA 2CNMA 4X2TA 2Q7BA 3ZJ0A 2C6GA 3PFVA 4X8IA 4C7IA 4MFZA 2ZEOA 1Z8TA 2VZYA 1Z8XA 2DEAA 2PJ6A 4YRHA 3SI1A 3KQXA 3PB6X 4R87A 4IIYA 3FF3A 2XPOA 4Z65A 2PC1A 2QVPA 1R43A 2OB0A 3VGOA 2CY2A 4IAVA 3EZBA 2BEIA 4P4DA 2J8NA 4A30A 4R57A 4R8FA 2B3VA 5LYDA 3V8IA 4M6GA 4UWIA 4INJA 2JBJA 3HLPA 1FBVA 1Z8LA 2ANPA 2B4BA 3PB7X 4KUBA 2Q4ZA 4KSAA 1Y0RA 3K9UA 2DXQA 1BPMA 1KEEB 1Y7EA 4DYOA 3GB0A 2O28A 3GKRA 1XE4A 4IF5A 2Y1MA 4F9UA 4OC5A 1IOIA 1ZLIA 4CAFA 1VBHA 2PSWA 4QVTA 4AVCA 4MMOA 2AFSA 4H6ZA 2EZCA 1ARMA 3S9LA 4M85A 3L2NA 3F5BA 5CBMA 2ARHA 2P6FA 2PJ5A 4NGMA 4R7MA 3FJUA 5JVLA 2FL4A 4BPWB 3TTHA 4YFJA 5K8MA 4C8UA 3PB9X 3SI0A 4WJBA 5A27A 1L0CA 1VGYA 5AG7A 2GLFA 3TFYA 2AUNA 2AE6A 3T9YA 1BXRB 3CPXA 2AFXA 3FNCA 1CX8A 2B4DA 2RB7A 3PEIA 2WUUA 2KCWA 1N71A 4AXVA 4X3RA 3FEDA 5F1YA 2ZPAA 5AG6A 3F0AA 3T07A 2H5MA 2Q51A 3VROA 4MI1A 1FT7A 1KC7A 4C9AA 1JQGA 5EBVA 4CRZB 4CAEA 5HVHA 2OR4A 3SJGA 4XPKA 1EO0A 2PJ8A 5HKZA 4KOYA 4C8FA 2XEFA 1YMEA 3RYOA 1F57A 4H2KA 4M8DA 5H86A 1ARLA 1YREA 2GP4A 2RC4A 4OP4A 4P4IA 2ZEFA 4E2AA 3FH4A 4KLVA 2OZHA 3VWDA 2JLMA 4CYOA 4NGTA 1AMPA 1R61A 3ISZA 4GS4A 4P45A 3BI0A 3BXMA 4G1PA 4HNWB 5LRGA 3RNZA 3EY5A 4HKFA 4CGOA 5JPHA 3VRQA 1B47A 4NGPA 4CRYB 4CYQA 2AUMA 5F46A 5ELYA 1BOBA 3NFZA 2QMLA 2Q44A 4OC1A 2D0PA 2F5IA 4AVBA 2FM4A 5D29A 6CPAA 2IJZA 2OZUA 4NGSA 4P6YA 4X5KA 4EVYA 2XPPA 3H8FA 5E96A 3A9LA 4KLWA
chains in the Genus database with same CATH topology
1BLLE 3B2YA 3JRUA 2PE3A 1F2PA 3FEEA 1PYTB 1VHEA 5LRJA 2PJ0A 5J1QA 4C9EA 1LANA 1TF8A 2CF4A 4UIBA 2F7VA 3B3CA 4IK2A 4OIDA 1XF1A 4PXCA 1VIXA 2NSMA 3ICUA 1NSAA 4OC0A 4OC3A 2RFHA 4F9VA 1EE3P 5K8OA 2PIYA 4P44A 1BPNA 3V38A 4MHYA 5LYLA 3GUXA 4CDKA 8CPAA 4C9VA 3I6SA 1HDUA 4P4JA 2EK8A 4MRIA 1Z2LA 2ZEGA 4EMEA 4F8ZA 3KZWA 2EK9A 5THWA 3PRTA 2ZEDA 7CPAA 3PBBA 1LOKA 4B6ZA 1RTQA 2GREA 1IGBA 4PQAA 4UIAA 3BI1A 4NGNA 2WYRA 4FAIA 2C6CA 4OC2A 2PIZA 4K3NA 4C9RA 1CP6A 2EWBA 5LRKA 2F8HA 3CT9A 3IJ3A 4TJXA 4FUUA 1XFOA 2HB6A 4ZX9A 2CIJA 3KHXA 4NGRA 2ZOFA 1IY7A 2WZNA 1CP7A 2PJ3A 1CPXA 1ELLP 4JYWA 1ZG8A 3B3VA 4FBEA 1XMBA 4A39A 3ISXA 5LYFA 3KL9A 4KSIA 4YN3A 1TKJA 1UWYA 1GYTA 2G9DA 3D7FA 3IO1A 3TX8A 3LMSA 4TWEA 3KASA 2ABZA 3LWUA 3D7GA 2V8HA 2ZENA 3KHZA 1ZLHA 1DE4C 4ZY0A 1Y9ZA 1XJOA 4NGQA 3D68A 1QMUA 2O4HA 3B3TA 4ZI6A 2PJ9A 1Q7LA 1F2OA 3HUVA 3I74A 5LYIA 2ZEEA 4TJVA 1TF9A 3VH9A 2PJ7A 2HC9A 1R3NA 2PVWA 1V6CA 2BO9A 1CG2A 3B35A 5I4MA 2J9AA 4P4FA 2C1CA 1H8LA 4A94A 3WABA 3B7IA 1YW4A 3H8GA 3B3WA 4KNGE 2XEGA 2GLJA 3KQZA 4UEZA 4C86A 1Z5RA 3KGQA 1TKFA 3NH5A 5IB9A 3SJFA 1ZG7A 2GU2A 3DGVA 2V8GA 3SI2A 3EIFA 2QJ8A 3SJEA 3RBUA 1DTDA 3NA6A 4O23A 1LAMA 4MCSA 1ZG9A 2JEWA 5JM6A 2PJ1A 1XRYA 2PJAA 1YW6A 2AFMA 1BAVA 4P10A 3D4UA 3FVLA 4P4BA 2ZOGA 2ZEMA 4YWYA 2XEJA 4OKOA 4EFDA 3PB4X 5IR2A 2JBKA 4R76A 5HXDA 3MN8A 5HVGA 3KR4A 4C84A 2PVVA 2CTBA 3WC6A 2C6PA 2NYQA 4C8TA 4ZY2A 3B3SA 5F09A 1FNOA 5K8PA 4C8PA 2PJBA 2V8VA 2QYVA 3KI9A 1HDQA 5HVFA 1Y0YA 1CBXA 4RUHA 3I1UA 1OBRA 4EWTA 4MXUA 4WWVA 3WT4A 1PCAA 4MCRA 1LFWA 2BCOA 1CPSA 3IFEA 3PFOA 3MRUA 4UEFA 4C85A 1TXRA 4R6TA 4ZYQA 4MHPA 3K9TA 2V8DA 3IWWA 4P4EA 2FVGA 1AYEA 5D8NA 3CPAA 2PJCA 3FX6A 4A37A 4C8AA 4MHNA 3S9MA 3FMCA 3N5FA 2PCUA 4ZX8A 3SJXA 2XEIA 4DUKA 4C8CA 1KWMA 4OMEA 2IMOA 3QNVA 5K8NA 2POKA 1YSJA 2AFUA 3H8EA 3TC8A 1M4LA 3NH4A 3PB8X 1WVMA 4NJQA 3VARA 1QQ9A 2VL1A 4C9UA 3RZAA 1VHOA 1LCPA 2I3CA 3DLJA 3T8WA 2AFZA 4YU9A 3IC1A 4MHZA 2PJ2A 4PPZA 2V77A 4GM5A 1XBUA 3FECA 3CDXA 2AFWA 4JZ0A 4MCPA 3BHXA 4A38A 1HEEA 4C99A 4PXDA 5CPAA 4ZY1A 3PFEA 4PXBA 4TNUA 2AFOA 2O53A 1TKHA 4Q7AA 2CTCA 2Q43A 2BOAA 4DJLA 4OC4A 1LAPA 4PXEA 4UEEA 2PRQA 2IQ6A 4OIWA 2ZEHA 4LQGA 4CPAA 3GLJA 4IHMA 3WC7A 5DS0A 2OOTA 3K2KA 3D67A 4BD9A 2C5QA 4CDJA 5JH9A 1YLOA 3KR5A 4NJRA 4NFRA 4MCQA 3V7ZA 4W9YA 2PJ4A 3RAMA 3IIBA 4ONWA 3D66A 3D7HA 4UF4A 3WC5A 2ZELA 5JGFA 3PBEA 3VTAA 3IEHA 3NH8A 3S9NA 4FWUA 3VATA 1ELMP 2ZEPA 3D7DA 4X2TA 2C6GA 4X8IA 2ZEOA 2DEAA 2PJ6A 3SI1A 3KQXA 3PB6X 3FF3A 4C8FA 4Z65A 2QVPA 4IAVA 1R43A 4P4DA 4R8FA 5LYDA 2JBJA 3HLPA 1Z8LA 2ANPA 3PB7X 2Q4ZA 1Y0RA 1BPMA 1Y7EA 4DYOA 3GB0A 4F9UA 4OC5A 1ZLIA 4MMOA 2AFSA 1ARMA 3S9LA 3L2NA 5CBMA 2PJ5A 4R7MA 4NGMA 3FJUA 4C8UA 5K8MA 3PB9X 3SI0A 4WJBA 1VGYA 2GLFA 3CPXA 2AFXA 1CX8A 2RB7A 3PEIA 4AXVA 4X3RA 3FEDA 2Q51A 1FT7A 4C9AA 1JQGA 5HVHA 2OR4A 3SJGA 2PJ8A 2XEFA 1YMEA 1F57A 4H2KA 1ARLA 2GP4A 4OP4A 4P4IA 2ZEFA 3FH4A 4NGTA 1AMPA 3ISZA 4P45A 3BI0A 3BXMA 4G1PA 5LRGA 4NGPA 5ELYA 3NFZA 4OC1A 5D29A 6CPAA 2IJZA 4P6YA 4NGSA 3H8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLL E;  3B2Y A;  3JRU A;  2PE3 A;  1F2P A;  3FEE A;  1PYT B;  1VHE A;  5LRJ A;  2PJ0 A;  5J1Q A;  4C9E A;  1LAN A;  1TF8 A;  2CF4 A;  4UIB A;  2F7V A;  3B3C A;  4IK2 A;  4OID A;  1XF1 A;  4PXC A;  1VIX A;  2NSM A;  3ICU A;  1NSA A;  4OC0 A;  4OC3 A;  2RFH A;  4F9V A;  1EE3 P;  5K8O A;  2PIY A;  4P44 A;  1BPN A;  3V38 A;  4MHY A;  5LYL A;  3GUX A;  4CDK A;  8CPA A;  4C9V A;  3I6S A;  1HDU A;  4P4J A;  2EK8 A;  4MRI A;  1Z2L A;  2ZEG A;  4EME A;  4F8Z A;  3KZW A;  2EK9 A;  5THW A;  3PRT A;  2ZED A;  7CPA A;  3PBB A;  1LOK A;  4B6Z A;  1RTQ A;  2GRE A;  1IGB A;  4PQA A;  4UIA A;  3BI1 A;  4NGN A;  2WYR A;  4FAI A;  2C6C A;  4OC2 A;  2PIZ A;  4K3N A;  4C9R A;  1CP6 A;  2EWB A;  5LRK A;  2F8H A;  3CT9 A;  3IJ3 A;  4TJX A;  4FUU A;  1XFO A;  2HB6 A;  4ZX9 A;  2CIJ A;  3KHX A;  4NGR A;  2ZOF A;  1IY7 A;  2WZN A;  1CP7 A;  2PJ3 A;  1CPX A;  1ELL P;  4JYW A;  1ZG8 A;  3B3V A;  4FBE A;  1XMB A;  4A39 A;  3ISX A;  5LYF A;  3KL9 A;  4KSI A;  4YN3 A;  1TKJ A;  1UWY A;  1GYT A;  2G9D A;  3D7F A;  3IO1 A;  3TX8 A;  3LMS A;  4TWE A;  3KAS A;  2ABZ A;  3LWU A;  3D7G A;  2V8H A;  2ZEN A;  3KHZ A;  1ZLH A;  1DE4 C;  4ZY0 A;  1Y9Z A;  1XJO A;  4NGQ A;  3D68 A;  1QMU A;  2O4H A;  3B3T A;  4ZI6 A;  2PJ9 A;  1Q7L A;  1F2O A;  3HUV A;  3I74 A;  5LYI A;  2ZEE A;  4TJV A;  1TF9 A;  3VH9 A;  2PJ7 A;  2HC9 A;  1R3N A;  2PVW A;  1V6C A;  2BO9 A;  1CG2 A;  3B35 A;  5I4M A;  2J9A A;  4P4F A;  2C1C A;  1H8L A;  4A94 A;  3WAB A;  3B7I A;  1YW4 A;  3H8G A;  3B3W A;  4KNG E;  2XEG A;  2GLJ A;  3KQZ A;  4UEZ A;  4C86 A;  1Z5R A;  3KGQ A;  1TKF A;  3NH5 A;  5IB9 A;  3SJF A;  1ZG7 A;  2GU2 A;  3DGV A;  2V8G A;  3SI2 A;  3EIF A;  2QJ8 A;  3SJE A;  3RBU A;  1DTD A;  3NA6 A;  4O23 A;  1LAM A;  4MCS A;  1ZG9 A;  2JEW A;  5JM6 A;  2PJ1 A;  1XRY A;  2PJA A;  1YW6 A;  2AFM A;  1BAV A;  4P10 A;  3D4U A;  3FVL A;  4P4B A;  2ZOG A;  2ZEM A;  4YWY A;  2XEJ A;  4OKO A;  4EFD A;  3PB4 X;  2JBK A;  4R76 A;  5HXD A;  3MN8 A;  5HVG A;  3KR4 A;  4C84 A;  2PVV A;  2CTB A;  3WC6 A;  2C6P A;  2NYQ A;  4C8T A;  4ZY2 A;  3B3S A;  5F09 A;  1FNO A;  5K8P A;  4C8P A;  2PJB A;  2V8V A;  2QYV A;  3KI9 A;  1HDQ A;  5HVF A;  1Y0Y A;  1CBX A;  4RUH A;  3I1U A;  1OBR A;  4EWT A;  4MXU A;  4WWV A;  3WT4 A;  1PCA A;  4MCR A;  1LFW A;  2BCO A;  1CPS A;  3IFE A;  3PFO A;  3MRU A;  4UEF A;  4C85 A;  1TXR A;  4R6T A;  4ZYQ A;  4MHP A;  3K9T A;  2V8D A;  3IWW A;  4P4E A;  2FVG A;  1AYE A;  5D8N A;  3CPA A;  2PJC A;  3FX6 A;  4A37 A;  4C8A A;  4MHN A;  3S9M A;  3FMC A;  3N5F A;  2PCU A;  4ZX8 A;  3SJX A;  2XEI A;  4DUK A;  4C8C A;  1KWM A;  4OME A;  2IMO A;  3QNV A;  5K8N A;  2POK A;  1YSJ A;  2AFU A;  3H8E A;  3TC8 A;  1M4L A;  3NH4 A;  3PB8 X;  1WVM A;  4NJQ A;  3VAR A;  1QQ9 A;  2VL1 A;  4C9U A;  3RZA A;  1VHO A;  1LCP A;  2I3C A;  3DLJ A;  3T8W A;  2AFZ A;  4YU9 A;  3IC1 A;  4MHZ A;  2PJ2 A;  4PPZ A;  2V77 A;  4GM5 A;  1XBU A;  3FEC A;  3CDX A;  2AFW A;  4JZ0 A;  4MCP A;  3BHX A;  4A38 A;  1HEE A;  4C99 A;  4PXD A;  5CPA A;  4ZY1 A;  3PFE A;  4PXB A;  4TNU A;  2AFO A;  2O53 A;  1TKH A;  4Q7A A;  2CTC A;  2Q43 A;  2BOA A;  4DJL A;  4OC4 A;  1LAP A;  4PXE A;  4UEE A;  2PRQ A;  2IQ6 A;  4OIW A;  2ZEH A;  4LQG A;  4CPA A;  3GLJ A;  4IHM A;  3WC7 A;  5DS0 A;  2OOT A;  3K2K A;  3D67 A;  4BD9 A;  4CDJ A;  5JH9 A;  1YLO A;  3KR5 A;  4NJR A;  4NFR A;  4MCQ A;  3V7Z A;  4W9Y A;  2PJ4 A;  3RAM A;  3IIB A;  4ONW A;  3D66 A;  3D7H A;  4UF4 A;  3WC5 A;  2ZEL A;  5JGF A;  3PBE A;  3VTA A;  3IEH A;  3NH8 A;  3S9N A;  4FWU A;  3VAT A;  1ELM P;  2ZEP A;  3D7D A;  4X2T A;  2C6G A;  4X8I A;  2ZEO A;  2DEA A;  2PJ6 A;  3SI1 A;  3KQX A;  3PB6 X;  3FF3 A;  4C8F A;  4Z65 A;  2QVP A;  4IAV A;  1R43 A;  4P4D A;  4R8F A;  5LYD A;  2JBJ A;  3HLP A;  1Z8L A;  2ANP A;  3PB7 X;  2Q4Z A;  1Y0R A;  1BPM A;  1Y7E A;  4DYO A;  3GB0 A;  4F9U A;  4OC5 A;  1ZLI A;  4MMO A;  2AFS A;  1ARM A;  3S9L A;  3L2N A;  5CBM A;  2PJ5 A;  4R7M A;  4NGM A;  3FJU A;  4C8U A;  5K8M A;  3PB9 X;  3SI0 A;  4WJB A;  1VGY A;  2GLF A;  3CPX A;  2AFX A;  1CX8 A;  2RB7 A;  3PEI A;  4AXV A;  4X3R A;  3FED A;  2Q51 A;  1FT7 A;  4C9A A;  1JQG A;  5HVH A;  2OR4 A;  3SJG A;  2PJ8 A;  2XEF A;  1YME A;  1F57 A;  4H2K A;  1ARL A;  4OP4 A;  4P4I A;  2ZEF A;  3FH4 A;  4NGT A;  1AMP A;  3ISZ A;  4P45 A;  3BI0 A;  3BXM A;  4G1P A;  5LRG A;  4NGP A;  5ELY A;  3NFZ A;  4OC1 A;  5D29 A;  6CPA A;  2IJZ A;  4P6Y A;  4NGS A;  3H8F A; 
#chains in the Genus database with same CATH topology
 2Y1N A;  2IL4 A;  5H84 A;  1BLL E;  3R96 A;  5HKW A;  3B2Y A;  3JRU A;  1MJ9 A;  2PE3 A;  2PRB A;  2DIK A;  1B6B A;  1WK4 A;  2PR1 A;  2Q4Y A;  4KOW A;  1SQH A;  4IIX A;  1F2P A;  2B5G A;  3FEE A;  1PYT B;  4MI4 A;  1VHE A;  1RO5 A;  4MJ8 A;  4MFK A;  5LRJ A;  1UFH A;  2PJ0 A;  4U9Z A;  5J1Q A;  3LD2 A;  5IB0 A;  2ZW7 A;  3U88 C;  1LAN A;  1TF8 A;  2CF4 A;  3QAY A;  4JWP A;  4UIB A;  4CAW A;  2F7V A;  3TO9 A;  3B3C A;  4C7H A;  4IK2 A;  4OID A;  4F0Y A;  4B10 A;  2Z10 A;  1VIX A;  3FB3 A;  4PXC A;  4II9 A;  1XF1 A;  2NSM A;  3ICU A;  2EVN A;  3LOD A;  2ZXV A;  2OLS A;  2QEC A;  1NSA A;  1C3O B;  5GCN A;  4OC0 A;  4OC3 A;  2RFH A;  1X10 A;  2Y0M A;  4BTF A;  1EE3 P;  3IWG A;  3QAH A;  1K4J A;  4F9V A;  1M6V B;  5K8O A;  1YK3 A;  2PIY A;  4P44 A;  1BPN A;  3NFQ A;  3V38 A;  1YVK A;  4AG9 A;  3OB2 B;  3PZJ A;  2NMT A;  4FD5 A;  5F49 A;  2YNC A;  4MHY A;  4R9M A;  3BUW B;  4A31 A;  5LYL A;  4NSQ A;  3G3S A;  3GUX A;  4PSX A;  3FXT A;  4E94 A;  3KRV A;  5JQ4 A;  4K30 A;  3TO7 A;  1C30 B;  5KTC A;  1XIX A;  4JVO A;  3OAK A;  4CDK A;  3KKW A;  1M4D A;  2B58 A;  3F8K A;  3TLC A;  4H89 A;  3EO4 A;  4C68 A;  1XOV A;  8CPA A;  4C9V A;  3RO0 A;  1FY7 A;  4P4J A;  1HDU A;  1S7F A;  2BSW A;  2C27 A;  2EK8 A;  3I6S A;  4MRI A;  4CYP A;  1Z2L A;  2EZB A;  2ZEG A;  4MFP A;  4OAD A;  5G22 A;  3NOJ A;  4C2Y A;  3TE4 A;  2FE7 A;  4EME A;  1ZYM A;  2Z3N A;  1B87 A;  1AUG A;  3KZW A;  4F8Z A;  2EK9 A;  5THW A;  4NXY A;  4JLY A;  3PRT A;  4KOU A;  2ZED A;  2P0W A;  7CPA A;  2REF A;  3PBB A;  1LOK A;  4B6Z A;  1Y9K A;  1I21 A;  4OLL A;  1RTQ A;  2GRE A;  1IGB A;  4PQA A;  4UIA A;  4DNC A;  3BI1 A;  4NGN A;  4PK2 A;  1Q5X A;  1JWQ A;  5IV0 A;  1Y9W A;  4KVM E;  2WYR A;  4LX9 A;  4FAI A;  1WJT A;  3JTK A;  2Z3K A;  3CXP A;  2C6C A;  4OC2 A;  2VQY A;  2PIZ A;  4K3N A;  4MY3 A;  3HPH E;  1KBL A;  3W6X A;  4A4B A;  1VI4 A;  4C9R A;  1CP6 A;  2EWB A;  5LRK A;  2F8H A;  3CT9 A;  3IJ3 A;  3ZZI A;  1YVH A;  4E8O A;  4L8A A;  4TJX A;  2DLA A;  4FUU A;  4XNH B;  2G0B A;  4B13 A;  3B8G A;  4CYN A;  3TLA A;  3ZNI A;  4C2Z A;  1EZA A;  1XFO A;  1CM0 A;  2HB6 A;  2CIJ A;  4ZX9 A;  3W6S A;  2UV8 G;  2FS5 A;  2XPN A;  1KUV A;  3KHX A;  4NGR A;  2ZOF A;  3SXO A;  1RXT A;  3TT2 A;  1IY7 A;  2WZN A;  4BIN A;  3BUX B;  1CP7 A;  2PJ3 A;  1QST A;  1CPX A;  1ELL P;  1YVO A;  4BPX B;  1ZL0 A;  4JYW A;  1PUA A;  2MP0 A;  1IYL A;  4COB A;  1ZG8 A;  2OU2 A;  1S3Z A;  2WSA A;  4A95 A;  4J3G A;  5F13 A;  1CS0 B;  3B3V A;  4FBE A;  1MK4 A;  4KZT A;  1XMB A;  3D8P A;  5BWA B;  1VBG A;  4A39 A;  3ISX A;  5LYF A;  3KL9 A;  4KSI A;  4YN3 A;  3R9G A;  2OZG A;  3H4Q A;  1VKC A;  1YR0 A;  3TOB A;  1TKJ A;  1UWY A;  4UA3 A;  3E0K A;  1GYT A;  5K99 A;  2G9D A;  1JDB C;  1R57 A;  2FT0 A;  3D7F A;  2BL1 A;  1YX0 A;  3EC4 A;  3FYN A;  3IO1 A;  4MFL A;  1QSM A;  3TX8 A;  3VRN A;  4JJX A;  3LMS A;  4TWE A;  2VI7 A;  3KAS A;  2ABZ A;  2B4D B;  5C88 A;  5J8F A;  3D7G A;  2ODF A;  2V8H A;  2ZEN A;  3LWU A;  3KHZ A;  4KUA A;  1ZLH A;  4NF1 A;  1XF8 A;  1DE4 C;  4ZY0 A;  4NEX A;  1J3L A;  1Y9Z A;  5C82 A;  1XJO A;  4NGQ A;  3OP0 A;  3D68 A;  1NE9 A;  1QMU A;  2O4H A;  3B3T A;  3R1K A;  3TO6 A;  4A2Z A;  4ZI6 A;  4MJX A;  2R82 A;  4NCZ A;  2PJ9 A;  1Q7L A;  1F2O A;  4MBU A;  3HUV A;  4ORF A;  5LYI A;  2ZEE A;  3S6G A;  4AVA A;  1S60 A;  3I74 A;  4TJV A;  3TLY A;  2XPL A;  3FBU A;  1TF9 A;  3VH9 A;  4RI1 A;  4COG A;  4B11 A;  5HKY A;  2B0A A;  4Y49 B;  4UCM A;  2PJ7 A;  2HC9 A;  1R3N A;  2PVW A;  3T0T A;  4CGP A;  4E0A A;  3VRR A;  1MJB A;  1S5K A;  4KVX A;  1V6C A;  2Q4V A;  2HUZ A;  3CXS A;  4KSF A;  2BO9 A;  2Z3P A;  1CG2 A;  2FCK A;  4U9Y A;  1M4I A;  1Z4E A;  3B35 A;  2ATR A;  4MFJ A;  4XPD B;  3SXN A;  5I4M A;  2J9A A;  3EZE A;  4CO9 A;  2WPX A;  5AG4 A;  4P4F A;  2ZW5 A;  1YLE A;  2C1C A;  1H8L A;  2HQY A;  1ZO0 A;  3PGP A;  4A94 A;  3WAB A;  3F9K C;  3TOA A;  3B7I A;  1YW4 A;  3H8G A;  3N7Z A;  3B3W A;  5AXI A;  4UCP A;  3PLF B;  2AJ6 A;  4KNG E;  2XEG A;  5JYB A;  4UFW A;  1Z9U A;  1CJW A;  3LAC A;  2GLJ A;  1KZF A;  4MY0 A;  3KQZ A;  5ISV A;  4UEZ A;  4C86 A;  4CAX A;  2VKZ G;  3IWE A;  3BJ8 A;  3GY9 A;  1Z5R A;  3KGQ A;  1TKF A;  4CS0 B;  2B5G B;  3NH5 A;  5IB9 A;  4Y49 C;  3SJF A;  3MGD A;  1YGH A;  4B12 A;  4JXR A;  3H5Z A;  5G21 A;  1LRZ A;  1ZG7 A;  2JDC A;  1P0H A;  2WPW A;  3IU1 A;  3R9E A;  2HV2 A;  1XMT A;  2GU2 A;  3DGV A;  2V8G A;  4XPD C;  3T90 A;  1XEB A;  1I12 A;  3G8W A;  4B14 A;  2CNT A;  5FD8 A;  4KOT A;  3SI2 A;  3WR7 A;  4A32 A;  3EIF A;  4E5S A;  4CZ1 A;  2QJ8 A;  1OZP A;  4FD4 A;  3SJE A;  4B5P A;  3RBU A;  1DTD A;  3NA6 A;  3TLG A;  5J8C A;  3GJZ A;  4R3K A;  4AG7 A;  2GE3 A;  4O23 A;  2J8R A;  2B3U A;  5F9M A;  1LAM A;  3D2M A;  4MCS A;  1ZG9 A;  4CGL A;  2X7B A;  4C9E A;  2X0S A;  2JEW A;  3IU2 A;  1IB1 E;  2Q7S A;  5JM6 A;  2PJ1 A;  1XRY A;  2PJA A;  1YW6 A;  2VZZ A;  4GXH A;  2AFM A;  1BAV A;  4P10 A;  3D4U A;  3R9F A;  3FVL A;  3UY5 A;  4F0X A;  4P4B A;  3P2F A;  4UBR A;  3BUN B;  1P4N A;  5HMN A;  2ZOG A;  3C8O A;  2ZEM A;  4YWY A;  1ZRS A;  3FRM A;  2XEJ A;  3S6K A;  4OKO A;  4EYS A;  1S7K A;  3EXN A;  2FIA A;  5HH1 A;  4PV6 A;  4EFD A;  3PB4 X;  5IR2 A;  1QSO A;  2JBK A;  3NE7 A;  4R76 A;  3EFA A;  4F6A A;  5HXD A;  3K4I A;  2EBJ A;  4M3S A;  3MN8 A;  3BJ7 A;  4CGN A;  3KR4 A;  3JVN A;  3D3S A;  5HVG A;  2E28 A;  4C84 A;  5EMI A;  2PVV A;  3PP9 A;  3VRP A;  2CTB A;  3WC6 A;  1NBW A;  2C6P A;  2NYQ A;  1GHE A;  2BUE A;  2YNC C;  4ZY2 A;  1X12 A;  4C8T A;  3TYX A;  3B3S A;  5AG5 A;  5F09 A;  1DIK A;  4GPL B;  2P6G A;  4H6U A;  1FNO A;  1Q2D A;  4KVO E;  4RN7 A;  4A4C A;  4HNX B;  5K8P A;  4C8P A;  1IYK A;  4KOS A;  1Y7R A;  2PJB A;  2V8V A;  2Z3M A;  2QYV A;  3KI9 A;  1HDQ A;  3TLE A;  4M6I A;  2CNS A;  1KUX A;  5EC4 A;  3W91 A;  2R8V A;  3U1B A;  3HPG G;  5I0C A;  5HVF A;  1Y0Y A;  1CBX A;  4BPU B;  4RUH A;  3TLZ A;  3I1U A;  4RR2 B;  1Z8W A;  2B4J C;  1OBR A;  2REE A;  3DR8 A;  4MXU A;  4WWV A;  5CNP A;  3WT4 A;  4EWT A;  1A9X B;  3TLB A;  1PCA A;  4MCR A;  1LFW A;  2BCO A;  1CPS A;  1M44 A;  2VEZ A;  3DNS A;  3IFE A;  3QB8 A;  1IID A;  1Z4R A;  3PFO A;  3MRU A;  4UEF A;  2HI6 A;  4C85 A;  4ZBG A;  1TXR A;  2PQ8 A;  5IX3 A;  3T5M A;  4R6T A;  2FIW A;  4ZYQ A;  4MHP A;  1IOF A;  4QUS A;  3K9T A;  2V8D A;  4QB9 A;  3IWW A;  3DDD A;  4P4E A;  2FVG A;  1AYE A;  1V0C A;  2PDO A;  3JUW A;  3PT1 A;  4R3L A;  5D8N A;  3R95 A;  3TCV A;  2Z0Z A;  1Z9E A;  3CPA A;  3D2P A;  2PJC A;  1QSR A;  3FX6 A;  2VXK A;  1M4G A;  1ON0 A;  2K5T A;  4XNH C;  2Q04 A;  4A37 A;  2EZA A;  3VWE A;  2YJT A;  4C8A A;  2GFQ A;  5F48 A;  4YGO A;  4MHN A;  3S9M A;  1VHS A;  4XPL A;  2G3A A;  3C26 A;  4HPS A;  1J4J A;  4FD7 A;  3FMC A;  3N5F A;  2PCU A;  4ZX8 A;  4B5O A;  3DR6 A;  3SJX A;  3NE8 A;  2XEI A;  3SHP A;  4DUK A;  3SR3 A;  1Q2C A;  4BBH A;  5BY0 A;  1KWM A;  4C8C A;  4OME A;  4LQ6 A;  1YQE A;  1S7N A;  2IMO A;  3QNV A;  2DPS A;  5K8N A;  2POK A;  4JD6 A;  4H1H A;  1YSJ A;  2AFU A;  2I00 A;  3P2H A;  3H8E A;  3TC8 A;  1M4L A;  4ONU A;  4FD6 A;  3NH4 A;  2GIV A;  3DSB A;  3PB8 X;  1WVM A;  4NJQ A;  4RS2 A;  1QQ9 A;  2VL1 A;  3VAR A;  5A28 A;  5KTA A;  4J0N A;  2D4P A;  4C9U A;  4KOR A;  3RZA A;  3S6F A;  1VHO A;  1LCP A;  2I79 A;  2I3C A;  3O8Z A;  2YGW A;  3DLJ A;  3T8W A;  2R98 A;  2OH1 A;  2AFZ A;  2JDD A;  2JEV A;  2R1I A;  4YU9 A;  3I3G A;  3IC1 A;  4MHZ A;  2PJ2 A;  4PPZ A;  2V77 A;  4GM5 A;  1XBU A;  3G23 A;  1KUY A;  3GIU A;  3FEC A;  1NMT A;  2EUI A;  3CDX A;  3CZX A;  2AFW A;  2Q0Y A;  2A4N A;  1QSN A;  4JZ0 A;  4MCP A;  3BHX A;  4KS9 A;  4Q36 A;  3FIX A;  4A38 A;  1HEE A;  1TIQ A;  4C99 A;  1T36 B;  4I49 A;  1GGO A;  4PXD A;  4PK3 A;  5CPA A;  4CAV A;  4ZY1 A;  5G20 A;  3OWC A;  3PFE A;  4U5Y A;  4UWJ A;  2YJV A;  4PXB A;  4TNU A;  1A2Z A;  5G1Z A;  4PSW A;  2PCN A;  4KOX A;  2AFO A;  2O53 A;  2DPT A;  1TKH A;  1U6M A;  2YND A;  4Q7A A;  4UCN A;  4QBJ A;  2CTC A;  5KTD A;  1Q2Y A;  2CBL A;  2Q43 A;  2BOA A;  4MHD A;  4DJL A;  4OC4 A;  3BUO B;  1LAP A;  2PR8 A;  4PXE A;  4UEE A;  1MJA A;  2PRQ A;  5AGE A;  3T05 A;  2HWG A;  2IQ6 A;  4OIW A;  1IIC A;  2VBQ A;  2ZEH A;  2Z11 A;  4LQG A;  4CPA A;  1NXJ A;  1M1D A;  3GLJ A;  4IHM A;  4OAE A;  5DS0 A;  3S6H A;  2OOT A;  3WC7 A;  1JDE A;  4M6H A;  4B5P B;  3K2K A;  3D67 A;  4BD9 A;  3TLG B;  4ZGY B;  1S7L A;  2HRO A;  2C5Q A;  2R7H A;  4LUA A;  4CDJ A;  3BUM B;  5JH9 A;  1YLO A;  2ZW6 A;  3HMJ G;  3KR5 A;  4AB7 A;  4NJR A;  3EZA A;  4NFR A;  5DWN A;  4MCQ A;  4L89 A;  4MFQ A;  3V7Z A;  4W9Y A;  2ZW4 A;  1WWZ A;  2PJ4 A;  3I9S A;  4IUS A;  4JXQ A;  3RAM A;  4UFX A;  5F5X A;  3IIB A;  4ONW A;  1BO4 A;  4HNY B;  1EZB A;  4UFV A;  4CGM A;  3D66 A;  3CXQ A;  1I1D A;  2EO8 A;  4A33 A;  2P6E A;  2FXF A;  2D4O A;  2J8M A;  2Z3O A;  3D7H A;  4QC6 A;  4UF4 A;  5DWM A;  3IGR A;  3WC5 A;  2ZEL A;  4BMH A;  2FSR A;  5JGF A;  1PU9 A;  4Q38 A;  2Z3L A;  4KOV A;  3BLN A;  1CE8 B;  5F47 A;  3PBE A;  3OB1 B;  3GYA A;  5J3X A;  3VTA A;  4C2X A;  2N3A B;  2CXA A;  2DF5 A;  2YNE A;  3IEH A;  3NH8 A;  1NSL A;  2GAN A;  3S9N A;  4FWU A;  3VAT A;  2G3T A;  1ELM P;  2QIR A;  2ZEP A;  5FVJ A;  1IU8 A;  3D7D A;  2D0O A;  2CNM A;  4X2T A;  2Q7B A;  3ZJ0 A;  2C6G A;  3PFV A;  4X8I A;  4C7I A;  4MFZ A;  2ZEO A;  1Z8T A;  2VZY A;  1Z8X A;  2DEA A;  2PJ6 A;  4YRH A;  3SI1 A;  3KQX A;  3PB6 X;  4R87 A;  4IIY A;  3FF3 A;  2XPO A;  4Z65 A;  2PC1 A;  2QVP A;  1R43 A;  2OB0 A;  3VGO A;  2CY2 A;  4IAV A;  3EZB A;  2BEI A;  4P4D A;  2J8N A;  4A30 A;  4R57 A;  4R8F A;  2B3V A;  5LYD A;  3V8I A;  4M6G A;  4UWI A;  4INJ A;  2JBJ A;  3HLP A;  1FBV A;  1Z8L A;  2ANP A;  2B4B A;  3PB7 X;  4KUB A;  2Q4Z A;  4KSA A;  1Y0R A;  3K9U A;  2DXQ A;  1BPM A;  1KEE B;  1Y7E A;  4DYO A;  3GB0 A;  2O28 A;  3GKR A;  1XE4 A;  4IF5 A;  2Y1M A;  4F9U A;  4OC5 A;  1IOI A;  1ZLI A;  4CAF A;  1VBH A;  2PSW A;  4QVT A;  4AVC A;  4MMO A;  2AFS A;  4H6Z A;  2EZC A;  1ARM A;  3S9L A;  4M85 A;  3L2N A;  3F5B A;  5CBM A;  2ARH A;  2P6F A;  2PJ5 A;  4NGM A;  4R7M A;  3FJU A;  5JVL A;  2FL4 A;  4BPW B;  3TTH A;  4YFJ A;  5K8M A;  4C8U A;  3PB9 X;  3SI0 A;  4WJB A;  5A27 A;  1L0C A;  1VGY A;  5AG7 A;  2GLF A;  3TFY A;  2AUN A;  2AE6 A;  3T9Y A;  1BXR B;  3CPX A;  2AFX A;  3FNC A;  1CX8 A;  2B4D A;  2RB7 A;  3PEI A;  2WUU A;  2KCW A;  1N71 A;  4AXV A;  4X3R A;  3FED A;  5F1Y A;  2ZPA A;  5AG6 A;  3F0A A;  3T07 A;  2H5M A;  2Q51 A;  3VRO A;  4MI1 A;  1FT7 A;  1KC7 A;  4C9A A;  1JQG A;  5EBV A;  4CRZ B;  4CAE A;  5HVH A;  2OR4 A;  3SJG A;  4XPK A;  1EO0 A;  2PJ8 A;  5HKZ A;  4KOY A;  4C8F A;  2XEF A;  1YME A;  3RYO A;  1F57 A;  4H2K A;  4M8D A;  5H86 A;  1ARL A;  1YRE A;  2GP4 A;  2RC4 A;  4OP4 A;  4P4I A;  2ZEF A;  4E2A A;  3FH4 A;  4KLV A;  2OZH A;  3VWD A;  2JLM A;  4CYO A;  4NGT A;  1AMP A;  1R61 A;  3ISZ A;  4GS4 A;  4P45 A;  3BI0 A;  3BXM A;  4G1P A;  4HNW B;  5LRG A;  3RNZ A;  3EY5 A;  4HKF A;  4CGO A;  5JPH A;  3VRQ A;  1B47 A;  4NGP A;  4CRY B;  4CYQ A;  2AUM A;  5F46 A;  5ELY A;  1BOB A;  3NFZ A;  2QML A;  2Q44 A;  4OC1 A;  2D0P A;  2F5I A;  4AVB A;  2FM4 A;  5D29 A;  6CPA A;  2IJZ A;  2OZU A;  4NGS A;  4P6Y A;  4X5K A;  4EVY A;  2XPP A;  3H8F A;  5E96 A;  3A9L A;  4KLW A; 
#chains in the Genus database with same CATH homology
 1BLL E;  3B2Y A;  3JRU A;  2PE3 A;  1F2P A;  3FEE A;  1PYT B;  1VHE A;  5LRJ A;  2PJ0 A;  5J1Q A;  4C9E A;  1LAN A;  1TF8 A;  2CF4 A;  4UIB A;  2F7V A;  3B3C A;  4IK2 A;  4OID A;  1XF1 A;  4PXC A;  1VIX A;  2NSM A;  3ICU A;  1NSA A;  4OC0 A;  4OC3 A;  2RFH A;  4F9V A;  1EE3 P;  5K8O A;  2PIY A;  4P44 A;  1BPN A;  3V38 A;  4MHY A;  5LYL A;  3GUX A;  4CDK A;  8CPA A;  4C9V A;  3I6S A;  1HDU A;  4P4J A;  2EK8 A;  4MRI A;  1Z2L A;  2ZEG A;  4EME A;  4F8Z A;  3KZW A;  2EK9 A;  5THW A;  3PRT A;  2ZED A;  7CPA A;  3PBB A;  1LOK A;  4B6Z A;  1RTQ A;  2GRE A;  1IGB A;  4PQA A;  4UIA A;  3BI1 A;  4NGN A;  2WYR A;  4FAI A;  2C6C A;  4OC2 A;  2PIZ A;  4K3N A;  4C9R A;  1CP6 A;  2EWB A;  5LRK A;  2F8H A;  3CT9 A;  3IJ3 A;  4TJX A;  4FUU A;  1XFO A;  2HB6 A;  4ZX9 A;  2CIJ A;  3KHX A;  4NGR A;  2ZOF A;  1IY7 A;  2WZN A;  1CP7 A;  2PJ3 A;  1CPX A;  1ELL P;  4JYW A;  1ZG8 A;  3B3V A;  4FBE A;  1XMB A;  4A39 A;  3ISX A;  5LYF A;  3KL9 A;  4KSI A;  4YN3 A;  1TKJ A;  1UWY A;  1GYT A;  2G9D A;  3D7F A;  3IO1 A;  3TX8 A;  3LMS A;  4TWE A;  3KAS A;  2ABZ A;  3LWU A;  3D7G A;  2V8H A;  2ZEN A;  3KHZ A;  1ZLH A;  1DE4 C;  4ZY0 A;  1Y9Z A;  1XJO A;  4NGQ A;  3D68 A;  1QMU A;  2O4H A;  3B3T A;  4ZI6 A;  2PJ9 A;  1Q7L A;  1F2O A;  3HUV A;  3I74 A;  5LYI A;  2ZEE A;  4TJV A;  1TF9 A;  3VH9 A;  2PJ7 A;  2HC9 A;  1R3N A;  2PVW A;  1V6C A;  2BO9 A;  1CG2 A;  3B35 A;  5I4M A;  2J9A A;  4P4F A;  2C1C A;  1H8L A;  4A94 A;  3WAB A;  3B7I A;  1YW4 A;  3H8G A;  3B3W A;  4KNG E;  2XEG A;  2GLJ A;  3KQZ A;  4UEZ A;  4C86 A;  1Z5R A;  3KGQ A;  1TKF A;  3NH5 A;  5IB9 A;  3SJF A;  1ZG7 A;  2GU2 A;  3DGV A;  2V8G A;  3SI2 A;  3EIF A;  2QJ8 A;  3SJE A;  3RBU A;  1DTD A;  3NA6 A;  4O23 A;  1LAM A;  4MCS A;  1ZG9 A;  2JEW A;  5JM6 A;  2PJ1 A;  1XRY A;  2PJA A;  1YW6 A;  2AFM A;  1BAV A;  4P10 A;  3D4U A;  3FVL A;  4P4B A;  2ZOG A;  2ZEM A;  4YWY A;  2XEJ A;  4OKO A;  4EFD A;  3PB4 X;  5IR2 A;  2JBK A;  4R76 A;  5HXD A;  3MN8 A;  5HVG A;  3KR4 A;  4C84 A;  2PVV A;  2CTB A;  3WC6 A;  2C6P A;  2NYQ A;  4C8T A;  4ZY2 A;  3B3S A;  5F09 A;  1FNO A;  5K8P A;  4C8P A;  2PJB A;  2V8V A;  2QYV A;  3KI9 A;  1HDQ A;  5HVF A;  1Y0Y A;  1CBX A;  4RUH A;  3I1U A;  1OBR A;  4EWT A;  4MXU A;  4WWV A;  3WT4 A;  1PCA A;  4MCR A;  1LFW A;  2BCO A;  1CPS A;  3IFE A;  3PFO A;  3MRU A;  4UEF A;  4C85 A;  1TXR A;  4R6T A;  4ZYQ A;  4MHP A;  3K9T A;  2V8D A;  3IWW A;  4P4E A;  2FVG A;  1AYE A;  5D8N A;  3CPA A;  2PJC A;  3FX6 A;  4A37 A;  4C8A A;  4MHN A;  3S9M A;  3FMC A;  3N5F A;  2PCU A;  4ZX8 A;  3SJX A;  2XEI A;  4DUK A;  4C8C A;  1KWM A;  4OME A;  2IMO A;  3QNV A;  5K8N A;  2POK A;  1YSJ A;  2AFU A;  3H8E A;  3TC8 A;  1M4L A;  3NH4 A;  3PB8 X;  1WVM A;  4NJQ A;  3VAR A;  1QQ9 A;  2VL1 A;  4C9U A;  3RZA A;  1VHO A;  1LCP A;  2I3C A;  3DLJ A;  3T8W A;  2AFZ A;  4YU9 A;  3IC1 A;  4MHZ A;  2PJ2 A;  4PPZ A;  2V77 A;  4GM5 A;  1XBU A;  3FEC A;  3CDX A;  2AFW A;  4JZ0 A;  4MCP A;  3BHX A;  4A38 A;  1HEE A;  4C99 A;  4PXD A;  5CPA A;  4ZY1 A;  3PFE A;  4PXB A;  4TNU A;  2AFO A;  2O53 A;  1TKH A;  4Q7A A;  2CTC A;  2Q43 A;  2BOA A;  4DJL A;  4OC4 A;  1LAP A;  4PXE A;  4UEE A;  2PRQ A;  2IQ6 A;  4OIW A;  2ZEH A;  4LQG A;  4CPA A;  3GLJ A;  4IHM A;  3WC7 A;  5DS0 A;  2OOT A;  3K2K A;  3D67 A;  4BD9 A;  2C5Q A;  4CDJ A;  5JH9 A;  1YLO A;  3KR5 A;  4NJR A;  4NFR A;  4MCQ A;  3V7Z A;  4W9Y A;  2PJ4 A;  3RAM A;  3IIB A;  4ONW A;  3D66 A;  3D7H A;  4UF4 A;  3WC5 A;  2ZEL A;  5JGF A;  3PBE A;  3VTA A;  3IEH A;  3NH8 A;  3S9N A;  4FWU A;  3VAT A;  1ELM P;  2ZEP A;  3D7D A;  4X2T A;  2C6G A;  4X8I A;  2ZEO A;  2DEA A;  2PJ6 A;  3SI1 A;  3KQX A;  3PB6 X;  3FF3 A;  4C8F A;  4Z65 A;  2QVP A;  4IAV A;  1R43 A;  4P4D A;  4R8F A;  5LYD A;  2JBJ A;  3HLP A;  1Z8L A;  2ANP A;  3PB7 X;  2Q4Z A;  1Y0R A;  1BPM A;  1Y7E A;  4DYO A;  3GB0 A;  4F9U A;  4OC5 A;  1ZLI A;  4MMO A;  2AFS A;  1ARM A;  3S9L A;  3L2N A;  5CBM A;  2PJ5 A;  4R7M A;  4NGM A;  3FJU A;  4C8U A;  5K8M A;  3PB9 X;  3SI0 A;  4WJB A;  1VGY A;  2GLF A;  3CPX A;  2AFX A;  1CX8 A;  2RB7 A;  3PEI A;  4AXV A;  4X3R A;  3FED A;  2Q51 A;  1FT7 A;  4C9A A;  1JQG A;  5HVH A;  2OR4 A;  3SJG A;  2PJ8 A;  2XEF A;  1YME A;  1F57 A;  4H2K A;  1ARL A;  2GP4 A;  4OP4 A;  4P4I A;  2ZEF A;  3FH4 A;  4NGT A;  1AMP A;  3ISZ A;  4P45 A;  3BI0 A;  3BXM A;  4G1P A;  5LRG A;  4NGP A;  5ELY A;  3NFZ A;  4OC1 A;  5D29 A;  6CPA A;  2IJZ A;  4P6Y A;  4NGS A;  3H8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...