4OMEA

X-ray structure of human glutamate carboxypeptidase ii in complex with dccbl, a urea based inhibitor with distal carborane moiety
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
692
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title X-ray structure of human glutamate carboxypeptidase II in complex with DCCBL, a urea based inhibitor with distal carborane moiety
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 262
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4omeA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4omeA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4omeA02
4OC2A 4PXEA 4A38A 1Y9ZA 2JBKA 5HXDA 3KR5A 2AFWA 4P45A 3GLJA 5HVFA 4IAVA 4WJBA 4YN3A 1BAVA 4G1PA 1Z2LA 4UF4A 4ZY1A 3PFEA 2C6PA 4C8AA 4W9YA 1BPMA 2WZNA 4OP4A 3TX8A 3ICUA 3WC7A 3IJ3A 4OKOA 2DEAA 4ZX9A 4R7MA 3BXMA 1F2PA 5K8MA 4K3NA 4NGPA 4EMEA 5IB9A 3KL9A 3KGQA 2PJ7A 2PJ0A 4P4IA 4OC0A 1CBXA 4MCSA 1LCPA 5LYIA 2PIYA 3KHZA 2F8HA 4OC4A 3B3CA 3PBEA 3RAMA 5THWA 1ELLP 1QQ9A 3H8EA 3SI0A 1DE4C 2AFMA 4A39A 2XEFA 3KI9A 1XMBA 5ELYA 4MRIA 2AFOA 3H8GA 3WT4A 1YW4A 2QJ8A 4A37A 3L2NA 2CIJA 3HLPA 2QYVA 1F2OA 1LANA 2ZEDA 3PRTA 4NFRA 5LRGA 4CDJA 2CTBA 5D29A 3VARA 2AFZA 1XFOA 4JZ0A 3PB6X 1YLOA 5JGFA 1PYTB 4TNUA 3KASA 3FVLA 3B3VA 3IWWA 3CDXA 3PB8X 2RFHA 7CPAA 3FECA 4F8ZA 2GU2A 4MXUA 4UIBA 3IEHA 2C6CA 5HVHA 3SJGA 2PJBA 1CG2A 3S9MA 2JBJA 2NSMA 2V8HA 4PXCA 4MHPA 3BHXA 1ZLIA 4C9EA 2F7VA 4C8FA 2PVWA 4DYOA 3PB7X 5HVGA 1XRYA 3I6SA 4KSIA 4C9VA 3IFEA 4C9AA 2OR4A 1OBRA 4UIAA 1IGBA 4A94A 4C86A 1VHEA 1Y0YA 2AFXA 1Z5RA 4C99A 1GYTA 1V6CA 1TF8A 4ZYQA 3B35A 1LAPA 4ZY0A 1LFWA 4P4FA 4Q7AA 2VL1A 3JRUA 4OC3A 2PE3A 4YU9A 4NGTA 4C9UA 4YWYA 4X2TA 1FT7A 3SI2A 4DJLA 4OC1A 2GLFA 2PIZA 2V77A 3CT9A 1ZLHA 1TF9A 3D7DA 2BOAA 1JQGA 3SI1A 4MCRA 4NGRA 5LRJA 1XJOA 2GLJA 6CPAA 4OIWA 4FUUA 3T8WA 3NA6A 2PJ3A 3VTAA 3SJEA 3NFZA 4TJVA 3FF3A 3FH4A 3SJFA 4PXDA 5K8NA 4P6YA 4P4JA 1IY7A 5LRKA 5JH9A 4OMEA 2PVVA 1UWYA 3DGVA 2JEWA 3V7ZA 3WC6A 3B3WA 2ZEOA 3S9LA 2PJCA 5JM6A 4O23A 4ZI6A 3D4UA 1XBUA 3FMCA 1FNOA 2ZENA 3B7IA 3FJUA 3TC8A 3EIFA 4NGSA 4X8IA 4GM5A 4C8TA 4NGMA 2FVGA 3KQZA 2ANPA 3NH5A 4MMOA 4C9RA 1AYEA 3K2KA 2HC9A 1HDQA 2QVPA 4R8FA 2Q4ZA 4CPAA 4LQGA 5F09A 2ZEEA 1VHOA 1BPNA 4AXVA 1R43A 1HDUA 2V8DA 2PJ6A 3IC1A 1RTQA 1CX8A 2PJ4A 4P10A 3HUVA 1VGYA 4IK2A 1NSAA 3KZWA 3PBBA 3ISZA 3S9NA 1HEEA 2HB6A 2O4HA 4NJRA 3DLJA 2CTCA 3MRUA 2ZELA 4UEFA 1Z8LA 4PQAA 1ARMA 2J9AA 2EWBA 4MHNA 3BI1A 3MN8A 2OOTA 2EK9A 5D8NA 4CDKA 3BI0A 1BLLE 2ZEHA 4PXBA 2PRQA 2ZEFA 4C85A 3PEIA 3WABA 4NGNA 2WYRA 3FX6A 2ZEGA 4ZX8A 5K8PA 5I4MA 2BO9A 1YW6A 2PCUA 4PPZA 1R3NA 2ABZA 1ZG7A 4DUKA 4R6TA 4UEZA 1CP6A 1CPSA 2ZEMA 1XF1A 2PJ9A 4MCQA 1PCAA 1TKJA 3RZAA 3B3SA 1YMEA 4P4EA 4H2KA 1QMUA 1Q7LA 4OIDA 3IO1A 4FWUA 3LMSA 3B2YA 1YSJA 4R76A 4FBEA 4F9UA 2POKA 3PB9X 1LAMA 2ZOGA 3I1UA 3NH8A 1H8LA 4MHYA 4Z65A 4NGQA 1AMPA 4MCPA 3VH9A 1M4LA 2EK8A 3V38A 3QNVA 4TJXA 2ZOFA 3GB0A 2IQ6A 4RUHA 3KHXA 2V8GA 4UEEA 4WWVA 2PJ5A 3B3TA 5LYDA 2O53A 3KR4A 3D7FA 5DS0A 5J1QA 3FEEA 2ZEPA 1CPXA 3H8FA 2V8VA 1EE3P 3K9TA 1TXRA 2Q43A 3GUXA 2PJ8A 3NH4A 2CF4A 3SJXA 4C8PA 3PB4X 4KNGE 3D7GA 2C6GA 2AFUA 2PJAA 3RBUA 1WVMA 1ELMP 3CPAA 1ARLA 2G9DA 4JYWA 5CPAA 2AFSA 1TKHA 4P44A 1DTDA 3IIBA 3WC5A 4C8CA 2GREA 4FAIA 5CBMA 3PFOA 1ZG8A 4EFDA 1KWMA 8CPAA 5LYLA 2XEIA 3LWUA 4ZY2A 4BD9A 3VATA 4X3RA 4B6ZA 3ISXA 2XEGA 2BCOA 4P4BA 3KQXA 4NJQA 3D67A 1VIXA 4C8UA 4ONWA 3I74A 3CPXA 4TWEA 1Y7EA 3D68A 2XEJA 1F57A 2IMOA 4OC5A 2IJZA 4IHMA 2I3CA 4F9VA 1LOKA 4EWTA 2Q51A 1Y0RA 4P4DA 5K8OA 1CP7A 4C84A 1TKFA 2PJ2A 2C1CA 3FEDA 2PJ1A 3D66A 5LYFA 1ZG9A 2NYQA 2RB7A 3N5FA 3D7HA 4MHZA
chains in the Genus database with same CATH superfamily
4OC2A 4E2AA 3U1BA 2J8RA 4PXEA 4A38A 3VRQA 4R87A 2AUMA 1BOBA 1Y9ZA 4CGNA 2JBKA 5HXDA 3R9GA 4UFWA 3KR5A 2AFWA 4P45A 3GLJA 4QVTA 4IAVA 4M85A 2PR8A 4WJBA 5HVFA 2CNMA 4XPDB 2KCWA 1BAVA 4G1PA 4RR2B 1Z2LA 4FD4A 4AVBA 2Y1MA 1WWZA 3IU2A 5DWMA 1PU9A 3D3SA 4JXQA 4PK2A 1BXRB 4B5PB 4UF4A 1YVOA 3NOJA 4ZY1A 2FS5A 3PFEA 2REFA 3I9SA 2C6PA 2JEVA 4NSQA 4UBRA 3WR7A 4A95A 2HI6A 4C8AA 4H6ZA 3IWGA 3CXQA 4B12A 1Q5XA 3QB8A 4W9YA 1BPMA 2WZNA 4OP4A 4QC6A 3SXNA 3TX8A 1OZPA 4C9RA 3ICUA 3R9EA 3WC7A 4ZBGA 5AG5A 3IJ3A 4OKOA 2DEAA 4MI4A 4R7MA 3BXMA 1F2PA 2G0BA 4ZX9A 1RXTA 5K8MA 4K3NA 1VHSA 4JD6A 4NGPA 4EMEA 3LACA 1JWQA 5IB9A 3KL9A 2QMLA 3HPHE 3KGQA 4MHDA 4A33A 1RO5A 4MFLA 2PJ7A 2H5MA 2WUUA 3SR3A 3LD2A 4H89A 4CRZB 1NXJA 2PJ0A 3BUXB 4P4IA 4OC0A 1CBXA 4H6UA 4MCSA 4MFPA 5AG6A 1Q2YA 2OU2A 5H84A 2X0SA 1LCPA 1CJWA 5F1YA 5G21A 3H4QA 5F13A 1N71A 1S7NA 5LYIA 1BO4A 2PIYA 3KHZA 2F8HA 3T90A 2HROA 2FT0A 4KVXA 2CNSA 2FIWA 4OC4A 3B3CA 3D2PA 3PBEA 3RAMA 5THWA 1ELLP 1QQ9A 3H8EA 3SI0A 4NCZA 3TOAA 3G8WA 1DE4C 3BUOB 1JDBC 2J8NA 3TO6A 2D4OA 3VWDA 1CS0B 5IR2A 2AFMA 4A39A 5KTDA 2XEFA 3KI9A 4MJXA 4YN3A 1XMBA 3BUWB 5ELYA 4MRIA 2N3AB 3VRNA 2AFOA 3D8PA 3H8GA 3WT4A 1YW4A 2XPLA 2JLMA 2QJ8A 3CXSA 3ZZIA 4A37A 3L2NA 2CIJA 3TLAA 5C82A 2R1IA 3HLPA 2QYVA 3O8ZA 1F2OA 1LANA 1XIXA 4BTFA 2ZEDA 3PRTA 3BUMB 4JXRA 4KSAA 4NFRA 3EZBA 5LRGA 2EZCA 1YVHA 2CTBA 1J4JA 4CYOA 5D29A 1VBGA 3VARA 2AFZA 4CDJA 4F0YA 1XFOA 3JVNA 4JZ0A 1QSOA 3PB6X 4XNHB 4B11A 1YLOA 4Y49B 5A28A 5AG4A 3OB2B 5JGFA 4XPLA 3HMJG 1PYTB 4FD6A 4TNUA 4U9YA 3TE4A 2DPSA 2QIRA 2Z3KA 2YNDA 2EO8A 3KASA 3IWWA 3B3VA 3FVLA 3S6FA 3CDXA 3PB8X 2RFHA 1EZBA 7CPAA 3FECA 1B87A 1NSLA 4C2ZA 2IL4A 2P6GA 5GCNA 4F8ZA 2C5QA 2GU2A 3EZEA 3FRMA 3EFAA 4MXUA 4UIBA 3G3SA 2Q4YA 3W91A 3PP9A 3IEHA 3FNCA 2B5GB 2C6CA 3VWEA 4AB7A 5HVHA 4K30A 3JTKA 3SJGA 3TO9A 2PJBA 1CG2A 3S9MA 1ZYMA 2JBJA 2NSMA 2V8HA 4PXCA 1ON0A 1NMTA 2Z10A 4MHPA 3BHXA 1ZLIA 4AG9A 4C9EA 4L8AA 2D0OA 2ZW6A 1FBVA 4E94A 2REEA 2F7VA 2EZBA 2YNEA 4C8FA 4MY3A 4CGMA 2Y0MA 3OWCA 3EY5A 3LODA 1VBHA 2PVWA 4DYOA 2P0WA 1TIQA 1WK4A 3H5ZA 4CYPA 3PB7X 5HVGA 1XRYA 1S7FA 4C7IA 4CGOA 3I6SA 2XPNA 1M44A 2Z3MA 4MHZA 4UCNA 2OH1A 2VZZA 4A2ZA 3CZXA 4AG7A 4KSIA 4HNYB 4C9VA 3IFEA 1M4DA 2VXKA 2G3TA 1C3OB 2OR4A 2MP0A 4C9AA 2HQYA 3PT1A 1OBRA 1IGBA 1FY7A 3DSBA 2CNTA 1IYLA 3NE8A 4UIAA 4A94A 4C86A 5AG7A 1VHEA 1Y0YA 2AFXA 5G1ZA 3R96A 1Z5RA 4I49A 2PSWA 4MJ8A 4C99A 5J8FA 1GYTA 1V6CA 1TF8A 3OAKA 1QSTA 4UA3A 3TT2A 4ZYQA 3TLBA 3B35A 1LAPA 2BEIA 2PQ8A 4R3LA 4ZY0A 1LFWA 4BMHA 4P4FA 4BPUB 1X10A 1AUGA 2YJVA 4Q7AA 2VL1A 3JRUA 2B4JC 4OC3A 3K9UA 2PE3A 4YU9A 2FM4A 4NGTA 2B5GA 4U9ZA 3G23A 4C9UA 3VRPA 4YWYA 5IX3A 4Q36A 4X2TA 3I3GA 1FT7A 5J3XA 2OZGA 4IIYA 3NE7A 3BJ7A 3SI2A 2DF5A 4DJLA 2YJTA 4OC1A 2GLFA 2PIZA 4CYNA 1EO0A 4MBUA 2B3VA 2V77A 2FIAA 3GYAA 2PDOA 3CT9A 1XEBA 1IU8A 3OP0A 1TF9A 1ZLHA 2OLSA 4BPXB 3D7DA 2BOAA 1JQGA 2ODFA 3SI1A 4MCRA 2X7BA 1M6VB 2CXAA 2UV8G 3GY9A 2B58A 4A4BA 4NGRA 5LRJA 1XJOA 4EYSA 1QSNA 2YNCA 2GLJA 6CPAA 2D4PA 4OIWA 3GKRA 5F46A 1EZAA 5F48A 4HPSA 5HKWA 3W6SA 4E8OA 3R1KA 1KC7A 3SHPA 4B13A 2R98A 4FUUA 4HNXB 3NA6A 2OZHA 2PJ3A 4MY0A 1IICA 2YGWA 3SJEA 1KUYA 1LRZA 3SXOA 3VTAA 3NFZA 4CAVA 4LX9A 4TJVA 4CGLA 3FF3A 3VROA 1Z8TA 5HH1A 4KOSA 3FH4A 3SJFA 1M4IA 4F6AA 4PXDA 2Z3OA 3KKWA 4P6YA 5I0CA 5K8NA 3TO7A 2ZXVA 2FCKA 1CM0A 1PUAA 1WJTA 3PGPA 2NMTA 4M6HA 5AGEA 4P4JA 1IY7A 3T9YA 4YFJA 2HWGA 3MGDA 4FD7A 5LRKA 4KLWA 5JH9A 4COBA 4OMEA 2R8VA 4UCPA 4X5KA 2PVVA 1UWYA 3F5BA 4PSWA 3DGVA 2BL1A 2JEWA 3V7ZA 3WC6A 3RYOA 3B3WA 4J0NA 4E5SA 2ZEOA 3S9LA 2I00A 2PJCA 2Q7SA 3IGRA 2GANA 2Q04A 4B5OA 5JM6A 1S60A 4CZ1A 4O23A 1YGHA 4JVOA 1Y9WA 2D0PA 1Y7RA 4ZI6A 3D4UA 1XBUA 2P6EA 3FMCA 4R3KA 4EVYA 3PFVA 5BY0A 1FNOA 2ZENA 3B7IA 3FJUA 3TC8A 4OADA 3EIFA 4NGSA 2B3UA 4X8IA 4GM5A 3TTHA 4C8TA 4NGMA 2FVGA 3KQZA 4MFQA 2ANPA 3NH5A 4MMOA 4C68A 2R82A 3CXPA 2P6FA 1AYEA 3DR6A 3K2KA 4PSXA 2HC9A 1HDQA 2QVPA 3P2HA 4R8FA 2Q4ZA 3EXNA 2WPWA 4UFVA 1NE9A 3ZJ0A 1Q2DA 3FXTA 4A31A 4CPAA 4ONUA 4LQGA 5F09A 1YLEA 2AJ6A 2ZEEA 2ZW5A 3TLYA 1VHOA 3S6GA 1BPNA 4AXVA 1IB1E 1R43A 1HDUA 3TLGB 5G22A 1P0HA 1Z9UA 2V8DA 1I21A 2G3AA 2PJ6A 3IC1A 4HKFA 1KBLA 2FE7A 5EBVA 1DIKA 1RTQA 1CX8A 4M6IA 2PJ4A 2ZW7A 2RC4A 4LUAA 4A4CA 4P10A 1YK3A 3RO0A 3HUVA 4UCMA 3S6HA 4QBJA 1P4NA 1VGYA 4NEXA 4IK2A 4QB9A 1NSAA 5HKZA 3VGOA 2JDCA 3ISZA 3KZWA 3PBBA 5F47A 3S9NA 1HEEA 3T5MA 2DLAA 1UFHA 2HB6A 1KUXA 2FSRA 3FYNA 1SQHA 2O4HA 3W6XA 1YVKA 2Q7BA 1KZFA 2OB0A 3TOBA 5ISVA 5KTCA 3FIXA 4NJRA 4UWIA 3DLJA 1XOVA 1MJ9A 3BJ8A 1YR0A 2CTCA 3MRUA 1XE4A 2ZELA 4UEFA 1Z8LA 1QSRA 4LQ6A 2DIKA 2J8MA 4INJA 4PQAA 3TCVA 1GGOA 3TLZA 3F8KA 5G20A 1IOIA 5JYBA 1ARMA 2J9AA 2EWBA 4MHNA 2B4DB 4E0AA 3BI1A 3N7ZA 3MN8A 2OOTA 2EK9A 4YGOA 5D8NA 4CDKA 3BI0A 3F0AA 1BLLE 2ZEHA 3TYXA 4PXBA 2PRQA 1MK4A 2ZEFA 4A32A 4C85A 3PEIA 2ATRA 3WABA 4NGNA 3NFQA 1I1DA 2WYRA 2ZEGA 1QSMA 3FX6A 4ZX8A 5K8PA 5I4MA 3T07A 2CBLA 2BO9A 1YW6A 1VI4A 3C26A 2PCUA 3D2MA 4PPZA 5HKYA 4B14A 2VZYA 4BINA 2B0AA 3R9FA 2XPOA 1R3NA 4XNHC 4Q38A 1Q2CA 3P2FA 2PCNA 2EVNA 2ABZA 3TLGA 1ZG7A 4DUKA 5EC4A 4R6TA 4MFZA 4UEZA 3GIUA 1Z4EA 1CP6A 4H1HA 1CPSA 2ZEMA 3K4IA 1XF1A 2PJ9A 2VQYA 4GPLB 4MCQA 4KOXA 5DWNA 1PCAA 4CS0B 4DNCA 2EBJA 2A4NA 4KLVA 5A27A 1TKJA 3RZAA 3B3SA 1ZO0A 2ZPAA 4IUSA 1YMEA 4PV6A 4P4EA 4KSFA 1Y9KA 2JDDA 5J8CA 5F9MA 4H2KA 1XF8A 1QMUA 2AUNA 4II9A 1Q7LA 4OIDA 2WSAA 3IO1A 4FWUA 2GE3A 3LMSA 3B2YA 1M1DA 1YSJA 1Z8XA 2VEZA 2Z11A 4PK3A 3T05A 4R76A 4FBEA 4L89A 2Z3PA 4F9UA 4NF1A 1XMTA 2POKA 3PB9X 1LAMA 4KOTA 2ZOGA 3I1UA 3NH8A 1H8LA 4CAWA 2BUEA 5C88A 2GFQA 4MHYA 3HPGG 4NGQA 1AMPA 4Z65A 2Q0YA 2B4DA 2F5IA 4MI1A 4MCPA 4NXYA 4FD5A 1S5KA 2EUIA 3A9LA 5F49A 3VH9A 1C30B 1M4LA 3EC4A 2CY2A 5JPHA 2EK8A 3V38A 4C2XA 3QNVA 4TJXA 2ZOFA 3GB0A 4CO9A 2IQ6A 1YQEA 1S3ZA 4CAFA 4C2YA 5FD8A 1R57A 2YNCC 4R9MA 4RI1A 3QAHA 5E96A 4MFKA 1L0CA 4YRHA 4RUHA 3TLCA 1IIDA 3KHXA 4M6GA 2V8GA 4AVCA 4UEEA 4KOYA 1IOFA 4WWVA 4CYQA 2PJ5A 3B3TA 2I79A 5LYDA 2O53A 3KR4A 3D7FA 1V0CA 4KVOE 4HNWB 5DS0A 1T36B 5J1QA 3FEEA 2ZEPA 1CPXA 2VI7A 3H8FA 3QAYA 1A2ZA 3UY5A 1A9XB 4COGA 2V8VA 3BLNA 1EE3P 4KORA 3K9TA 3GJZA 1TXRA 1K4JA 2Q43A 2PJ8A 3GUXA 3NH4A 4BBHA 2CF4A 1IYKA 4CAEA 4XPDC 1CE8B 3SJXA 4C8PA 5K99A 3EO4A 3PB4X 2PR1A 3PZJA 4KNGE 3C8OA 3D7GA 2OZUA 5BWAB 2WPXA 2C6GA 2AFUA 2PJAA 3RBUA 1WVMA 1ELMP 3CPAA 1ARLA 2ARHA 2G9DA 4JYWA 2Q44A 4M8DA 1ZRSA 2HV2A 2Z0ZA 2AFSA 2C27A 5CPAA 2GIVA 2QECA 1TKHA 4KZTA 4P44A 1S7KA 4QUSA 2Y1NA 4B5PA 1JDEA 3JUWA 1DTDA 3IIBA 3WC5A 3KRVA 4C8CA 2EZAA 4KOUA 4C7HA 1S7LA 2GREA 2O28A 4UFXA 5KTAA 3U88C 2K5TA 5AXIA 4FAIA 2Q4VA 3TFYA 5IV0A 5CBMA 2HUZA 4CAXA 3PFOA 1ZG8A 5CNPA 1KWMA 4EFDA 8CPAA 4IIXA 1YX0A 4MFJA 3F9KC 1MJBA 2XEIA 3LWUA 5LYLA 2VKZG 4ZY2A 5JVLA 4BD9A 2B4BA 4RN7A 2XPPA 3VRRA 1I12A 4R57A 4U5YA 3T8WA 1U6MA 3VATA 1R61A 1VKCA 3RNZA 1M4GA 4X3RA 3E0KA 4GXHA 4B6ZA 3TLEA 1YREA 3ZNIA 4JWPA 4AVAA 1X12A 2Z3LA 3R95A 3ISXA 2XEGA 1GHEA 3DNSA 3PLFB 2E28A 1Z9EA 3EZAA 3T0TA 2BCOA 2GP4A 2FL4A 4ZGYB 4P4BA 1ZL0A 3KQXA 4NJQA 3D67A 3V8IA 1VIXA 4C8UA 4ONWA 4OLLA 2AE6A 5FVJA 1MJAA 4KOWA 4F0XA 3CPXA 4A30A 3I74A 4TWEA 4KS9A 4KVME 1Y7EA 3FB3A 3D68A 1NBWA 2XEJA 2PRBA 3FBUA 1B6BA 4CRYB 1F57A 2BSWA 5EMIA 2IMOA 4OC5A 3S6KA 2IJZA 2DXQA 4IHMA 2VBQA 4UWJA 4RS2A 1B47A 2I3CA 2PC1A 4B10A 4M3SA 4F9VA 3OB1B 4OAEA 3DR8A 1Z8WA 3IWEA 1J3LA 4GS4A 3BUNB 4ORFA 1KEEB 1LOKA 4JJXA 4EWTA 2Q51A 5HMNA 1Y0RA 4P4DA 4J3GA 5K8OA 1CP7A 1KUVA 4KOVA 4XPKA 4C84A 1TKFA 3IU1A 4Y49C 4KUBA 5IB0A 2PJ2A 5H86A 4BPWB 2Z3NA 2C1CA 3FEDA 4CGPA 2PJ1A 3D66A 3B8GA 5F5XA 5LYFA 4KUAA 1Z4RA 1ZG9A 2NYQA 2RB7A 3DDDA 3N5FA 2ZW4A 4IF5A 4JLYA 3D7HA 2DPTA 2FXFA 5JQ4A 2R7HA
chains in the Genus database with same CATH topology
4OC2A 4PXEA 4A38A 1Y9ZA 2JBKA 5HXDA 3KR5A 2AFWA 4P45A 3GLJA 5HVFA 4IAVA 4WJBA 4YN3A 1BAVA 4G1PA 1Z2LA 4UF4A 4ZY1A 3PFEA 2C6PA 4C8AA 4W9YA 1BPMA 2WZNA 4OP4A 3TX8A 3ICUA 3WC7A 3IJ3A 4OKOA 2DEAA 4ZX9A 4R7MA 3BXMA 1F2PA 5K8MA 4K3NA 4NGPA 4EMEA 5IB9A 3KL9A 3KGQA 2PJ7A 2PJ0A 4P4IA 4OC0A 1CBXA 4MCSA 1LCPA 5LYIA 2PIYA 3KHZA 2F8HA 4OC4A 3B3CA 3PBEA 3RAMA 5THWA 1ELLP 1QQ9A 3H8EA 3SI0A 1DE4C 2AFMA 4A39A 2XEFA 3KI9A 1XMBA 5ELYA 4MRIA 2AFOA 3H8GA 3WT4A 1YW4A 2QJ8A 4A37A 3L2NA 2CIJA 3HLPA 2QYVA 1F2OA 1LANA 2ZEDA 3PRTA 4NFRA 5LRGA 4CDJA 2CTBA 5D29A 3VARA 2AFZA 1XFOA 4JZ0A 3PB6X 1YLOA 5JGFA 1PYTB 4TNUA 3KASA 3FVLA 3B3VA 3IWWA 3CDXA 3PB8X 2RFHA 7CPAA 3FECA 4F8ZA 2C5QA 2GU2A 4MXUA 4UIBA 3IEHA 2C6CA 5HVHA 3SJGA 2PJBA 1CG2A 3S9MA 2JBJA 2NSMA 2V8HA 4PXCA 4MHPA 3BHXA 1ZLIA 4C9EA 2F7VA 4C8FA 2PVWA 4DYOA 3PB7X 5HVGA 1XRYA 3I6SA 4KSIA 4C9VA 3IFEA 4C9AA 2OR4A 1OBRA 4UIAA 1IGBA 4A94A 4C86A 1VHEA 1Y0YA 2AFXA 1Z5RA 4C99A 1GYTA 1V6CA 1TF8A 4ZYQA 3B35A 1LAPA 4ZY0A 1LFWA 4P4FA 4Q7AA 2VL1A 3JRUA 4OC3A 2PE3A 4YU9A 4NGTA 4C9UA 4YWYA 4X2TA 1FT7A 3SI2A 4DJLA 4OC1A 2GLFA 2PIZA 2V77A 3CT9A 1ZLHA 1TF9A 3D7DA 2BOAA 1JQGA 3SI1A 4MCRA 4NGRA 5LRJA 1XJOA 2GLJA 6CPAA 5IR2A 4OIWA 4FUUA 3T8WA 3NA6A 2PJ3A 3VTAA 3SJEA 3NFZA 4TJVA 3FF3A 3FH4A 3SJFA 4PXDA 5K8NA 4P6YA 4P4JA 1IY7A 5LRKA 5JH9A 4OMEA 2PVVA 1UWYA 3DGVA 2JEWA 3V7ZA 3WC6A 3B3WA 2ZEOA 3S9LA 2PJCA 5JM6A 4O23A 4ZI6A 3D4UA 1XBUA 3FMCA 1FNOA 2ZENA 3B7IA 3FJUA 3TC8A 3EIFA 4NGSA 4X8IA 4GM5A 4C8TA 4NGMA 2FVGA 3KQZA 2ANPA 3NH5A 4MMOA 4C9RA 1AYEA 3K2KA 2HC9A 1HDQA 2QVPA 4R8FA 2Q4ZA 4CPAA 4LQGA 5F09A 2ZEEA 1VHOA 1BPNA 4AXVA 1R43A 1HDUA 2V8DA 2PJ6A 3IC1A 1RTQA 1CX8A 2PJ4A 4P10A 3HUVA 1VGYA 4IK2A 1NSAA 3KZWA 3PBBA 3ISZA 3S9NA 1HEEA 2HB6A 2O4HA 4NJRA 3DLJA 2CTCA 3MRUA 2ZELA 4UEFA 1Z8LA 4PQAA 1ARMA 2J9AA 2EWBA 4MHNA 3BI1A 3MN8A 2OOTA 2EK9A 5D8NA 4CDKA 3BI0A 1BLLE 2ZEHA 4PXBA 2PRQA 2ZEFA 4C85A 3PEIA 3WABA 4NGNA 2WYRA 3FX6A 2ZEGA 4ZX8A 5K8PA 5I4MA 2BO9A 1YW6A 2PCUA 4PPZA 1R3NA 2ABZA 1ZG7A 4DUKA 4R6TA 4UEZA 1CP6A 1CPSA 2ZEMA 1XF1A 2PJ9A 4MCQA 1PCAA 1TKJA 3RZAA 3B3SA 1YMEA 4P4EA 4H2KA 1QMUA 1Q7LA 4OIDA 3IO1A 4FWUA 3LMSA 3B2YA 1YSJA 4R76A 4FBEA 4F9UA 2POKA 3PB9X 1LAMA 2ZOGA 3I1UA 3NH8A 1H8LA 4MHYA 4Z65A 4NGQA 1AMPA 4MCPA 3VH9A 1M4LA 2EK8A 3V38A 3QNVA 4TJXA 2ZOFA 3GB0A 2IQ6A 4RUHA 3KHXA 2V8GA 4UEEA 4WWVA 2PJ5A 3B3TA 5LYDA 2O53A 3KR4A 3D7FA 5DS0A 5J1QA 3FEEA 2ZEPA 1CPXA 3H8FA 2V8VA 1EE3P 3K9TA 1TXRA 2Q43A 3GUXA 2PJ8A 3NH4A 2CF4A 3SJXA 4C8PA 3PB4X 4KNGE 3D7GA 2C6GA 2AFUA 2PJAA 3RBUA 1WVMA 1ELMP 3CPAA 1ARLA 2G9DA 4JYWA 5CPAA 2AFSA 1TKHA 4P44A 1DTDA 3IIBA 3WC5A 4C8CA 2GREA 4FAIA 5CBMA 3PFOA 1ZG8A 4EFDA 1KWMA 8CPAA 5LYLA 2XEIA 3LWUA 4ZY2A 4BD9A 3VATA 4X3RA 4B6ZA 3ISXA 2XEGA 2BCOA 2GP4A 4P4BA 3KQXA 4NJQA 3D67A 1VIXA 4C8UA 4ONWA 3I74A 3CPXA 4TWEA 1Y7EA 3D68A 2XEJA 1F57A 2IMOA 4OC5A 2IJZA 4IHMA 2I3CA 4F9VA 1LOKA 4EWTA 2Q51A 1Y0RA 4P4DA 5K8OA 1CP7A 4C84A 1TKFA 2PJ2A 2C1CA 3FEDA 2PJ1A 3D66A 5LYFA 1ZG9A 2NYQA 2RB7A 3N5FA 3D7HA 4MHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC2 A;  4PXE A;  4A38 A;  1Y9Z A;  2JBK A;  5HXD A;  3KR5 A;  2AFW A;  4P45 A;  3GLJ A;  5HVF A;  4IAV A;  4WJB A;  4YN3 A;  1BAV A;  4G1P A;  1Z2L A;  4UF4 A;  4ZY1 A;  3PFE A;  2C6P A;  4C8A A;  4W9Y A;  1BPM A;  2WZN A;  4OP4 A;  3TX8 A;  3ICU A;  3WC7 A;  3IJ3 A;  4OKO A;  2DEA A;  4ZX9 A;  4R7M A;  3BXM A;  1F2P A;  5K8M A;  4K3N A;  4NGP A;  4EME A;  5IB9 A;  3KL9 A;  3KGQ A;  2PJ7 A;  2PJ0 A;  4P4I A;  4OC0 A;  1CBX A;  4MCS A;  1LCP A;  5LYI A;  2PIY A;  3KHZ A;  2F8H A;  4OC4 A;  3B3C A;  3PBE A;  3RAM A;  5THW A;  1ELL P;  1QQ9 A;  3H8E A;  3SI0 A;  1DE4 C;  2AFM A;  4A39 A;  2XEF A;  3KI9 A;  1XMB A;  5ELY A;  4MRI A;  2AFO A;  3H8G A;  3WT4 A;  1YW4 A;  2QJ8 A;  4A37 A;  3L2N A;  2CIJ A;  3HLP A;  2QYV A;  1F2O A;  1LAN A;  2ZED A;  3PRT A;  4NFR A;  5LRG A;  4CDJ A;  2CTB A;  5D29 A;  3VAR A;  2AFZ A;  1XFO A;  4JZ0 A;  3PB6 X;  1YLO A;  5JGF A;  1PYT B;  4TNU A;  3KAS A;  3FVL A;  3B3V A;  3IWW A;  3CDX A;  3PB8 X;  2RFH A;  7CPA A;  3FEC A;  4F8Z A;  2GU2 A;  4MXU A;  4UIB A;  3IEH A;  2C6C A;  5HVH A;  3SJG A;  2PJB A;  1CG2 A;  3S9M A;  2JBJ A;  2NSM A;  2V8H A;  4PXC A;  4MHP A;  3BHX A;  1ZLI A;  4C9E A;  2F7V A;  4C8F A;  2PVW A;  4DYO A;  3PB7 X;  5HVG A;  1XRY A;  3I6S A;  4KSI A;  4C9V A;  3IFE A;  4C9A A;  2OR4 A;  1OBR A;  4UIA A;  1IGB A;  4A94 A;  4C86 A;  1VHE A;  1Y0Y A;  2AFX A;  1Z5R A;  4C99 A;  1GYT A;  1V6C A;  1TF8 A;  4ZYQ A;  3B35 A;  1LAP A;  4ZY0 A;  1LFW A;  4P4F A;  4Q7A A;  2VL1 A;  3JRU A;  4OC3 A;  2PE3 A;  4YU9 A;  4NGT A;  4C9U A;  4YWY A;  4X2T A;  1FT7 A;  3SI2 A;  4DJL A;  4OC1 A;  2GLF A;  2PIZ A;  2V77 A;  3CT9 A;  1ZLH A;  1TF9 A;  3D7D A;  2BOA A;  1JQG A;  3SI1 A;  4MCR A;  4NGR A;  5LRJ A;  1XJO A;  2GLJ A;  6CPA A;  4OIW A;  4FUU A;  3T8W A;  3NA6 A;  2PJ3 A;  3VTA A;  3SJE A;  3NFZ A;  4TJV A;  3FF3 A;  3FH4 A;  3SJF A;  4PXD A;  5K8N A;  4P6Y A;  4P4J A;  1IY7 A;  5LRK A;  5JH9 A;  4OME A;  2PVV A;  1UWY A;  3DGV A;  2JEW A;  3V7Z A;  3WC6 A;  3B3W A;  2ZEO A;  3S9L A;  2PJC A;  5JM6 A;  4O23 A;  4ZI6 A;  3D4U A;  1XBU A;  3FMC A;  1FNO A;  2ZEN A;  3B7I A;  3FJU A;  3TC8 A;  3EIF A;  4NGS A;  4X8I A;  4GM5 A;  4C8T A;  4NGM A;  2FVG A;  3KQZ A;  2ANP A;  3NH5 A;  4MMO A;  4C9R A;  1AYE A;  3K2K A;  2HC9 A;  1HDQ A;  2QVP A;  4R8F A;  2Q4Z A;  4CPA A;  4LQG A;  5F09 A;  2ZEE A;  1VHO A;  1BPN A;  4AXV A;  1R43 A;  1HDU A;  2V8D A;  2PJ6 A;  3IC1 A;  1RTQ A;  1CX8 A;  2PJ4 A;  4P10 A;  3HUV A;  1VGY A;  4IK2 A;  1NSA A;  3KZW A;  3PBB A;  3ISZ A;  3S9N A;  1HEE A;  2HB6 A;  2O4H A;  4NJR A;  3DLJ A;  2CTC A;  3MRU A;  2ZEL A;  4UEF A;  1Z8L A;  4PQA A;  1ARM A;  2J9A A;  2EWB A;  4MHN A;  3BI1 A;  3MN8 A;  2OOT A;  2EK9 A;  5D8N A;  4CDK A;  3BI0 A;  1BLL E;  2ZEH A;  4PXB A;  2PRQ A;  2ZEF A;  4C85 A;  3PEI A;  3WAB A;  4NGN A;  2WYR A;  3FX6 A;  2ZEG A;  4ZX8 A;  5K8P A;  5I4M A;  2BO9 A;  1YW6 A;  2PCU A;  4PPZ A;  1R3N A;  2ABZ A;  1ZG7 A;  4DUK A;  4R6T A;  4UEZ A;  1CP6 A;  1CPS A;  2ZEM A;  1XF1 A;  2PJ9 A;  4MCQ A;  1PCA A;  1TKJ A;  3RZA A;  3B3S A;  1YME A;  4P4E A;  4H2K A;  1QMU A;  1Q7L A;  4OID A;  3IO1 A;  4FWU A;  3LMS A;  3B2Y A;  1YSJ A;  4R76 A;  4FBE A;  4F9U A;  2POK A;  3PB9 X;  1LAM A;  2ZOG A;  3I1U A;  3NH8 A;  1H8L A;  4MHY A;  4Z65 A;  4NGQ A;  1AMP A;  4MCP A;  3VH9 A;  1M4L A;  2EK8 A;  3V38 A;  3QNV A;  4TJX A;  2ZOF A;  3GB0 A;  2IQ6 A;  4RUH A;  3KHX A;  2V8G A;  4UEE A;  4WWV A;  2PJ5 A;  3B3T A;  5LYD A;  2O53 A;  3KR4 A;  3D7F A;  5DS0 A;  5J1Q A;  3FEE A;  2ZEP A;  1CPX A;  3H8F A;  2V8V A;  1EE3 P;  3K9T A;  1TXR A;  2Q43 A;  3GUX A;  2PJ8 A;  3NH4 A;  2CF4 A;  3SJX A;  4C8P A;  3PB4 X;  4KNG E;  3D7G A;  2C6G A;  2AFU A;  2PJA A;  3RBU A;  1WVM A;  1ELM P;  3CPA A;  1ARL A;  2G9D A;  4JYW A;  5CPA A;  2AFS A;  1TKH A;  4P44 A;  1DTD A;  3IIB A;  3WC5 A;  4C8C A;  2GRE A;  4FAI A;  5CBM A;  3PFO A;  1ZG8 A;  4EFD A;  1KWM A;  8CPA A;  5LYL A;  2XEI A;  3LWU A;  4ZY2 A;  4BD9 A;  3VAT A;  4X3R A;  4B6Z A;  3ISX A;  2XEG A;  2BCO A;  4P4B A;  3KQX A;  4NJQ A;  3D67 A;  1VIX A;  4C8U A;  4ONW A;  3I74 A;  3CPX A;  4TWE A;  1Y7E A;  3D68 A;  2XEJ A;  1F57 A;  2IMO A;  4OC5 A;  2IJZ A;  4IHM A;  2I3C A;  4F9V A;  1LOK A;  4EWT A;  2Q51 A;  1Y0R A;  4P4D A;  5K8O A;  1CP7 A;  4C84 A;  1TKF A;  2PJ2 A;  2C1C A;  3FED A;  2PJ1 A;  3D66 A;  5LYF A;  1ZG9 A;  2NYQ A;  2RB7 A;  3N5F A;  3D7H A;  4MHZ A; 
#chains in the Genus database with same CATH topology
 4OC2 A;  4E2A A;  3U1B A;  2J8R A;  4PXE A;  4A38 A;  3VRQ A;  4R87 A;  2AUM A;  1BOB A;  1Y9Z A;  4CGN A;  2JBK A;  5HXD A;  3R9G A;  4UFW A;  3KR5 A;  2AFW A;  4P45 A;  3GLJ A;  4QVT A;  4IAV A;  4M85 A;  2PR8 A;  4WJB A;  5HVF A;  2CNM A;  4XPD B;  2KCW A;  1BAV A;  4G1P A;  4RR2 B;  1Z2L A;  4FD4 A;  4AVB A;  2Y1M A;  1WWZ A;  3IU2 A;  5DWM A;  1PU9 A;  3D3S A;  4JXQ A;  4PK2 A;  1BXR B;  4B5P B;  4UF4 A;  1YVO A;  3NOJ A;  4ZY1 A;  2FS5 A;  3PFE A;  2REF A;  3I9S A;  2C6P A;  2JEV A;  4NSQ A;  4UBR A;  3WR7 A;  4A95 A;  2HI6 A;  4C8A A;  4H6Z A;  3IWG A;  3CXQ A;  4B12 A;  1Q5X A;  3QB8 A;  4W9Y A;  1BPM A;  2WZN A;  4OP4 A;  4QC6 A;  3SXN A;  3TX8 A;  1OZP A;  4C9R A;  3ICU A;  3R9E A;  3WC7 A;  4ZBG A;  5AG5 A;  3IJ3 A;  4OKO A;  2DEA A;  4MI4 A;  4R7M A;  3BXM A;  1F2P A;  2G0B A;  4ZX9 A;  1RXT A;  5K8M A;  4K3N A;  1VHS A;  4JD6 A;  4NGP A;  4EME A;  3LAC A;  1JWQ A;  5IB9 A;  3KL9 A;  2QML A;  3HPH E;  3KGQ A;  4MHD A;  4A33 A;  1RO5 A;  4MFL A;  2PJ7 A;  2H5M A;  2WUU A;  3SR3 A;  3LD2 A;  4H89 A;  4CRZ B;  1NXJ A;  2PJ0 A;  3BUX B;  4P4I A;  4OC0 A;  1CBX A;  4H6U A;  4MCS A;  4MFP A;  5AG6 A;  1Q2Y A;  2OU2 A;  5H84 A;  2X0S A;  1LCP A;  1CJW A;  5F1Y A;  5G21 A;  3H4Q A;  5F13 A;  1N71 A;  1S7N A;  5LYI A;  1BO4 A;  2PIY A;  3KHZ A;  2F8H A;  3T90 A;  2HRO A;  2FT0 A;  4KVX A;  2CNS A;  2FIW A;  4OC4 A;  3B3C A;  3D2P A;  3PBE A;  3RAM A;  5THW A;  1ELL P;  1QQ9 A;  3H8E A;  3SI0 A;  4NCZ A;  3TOA A;  3G8W A;  1DE4 C;  3BUO B;  1JDB C;  2J8N A;  3TO6 A;  2D4O A;  3VWD A;  1CS0 B;  5IR2 A;  2AFM A;  4A39 A;  5KTD A;  2XEF A;  3KI9 A;  4MJX A;  4YN3 A;  1XMB A;  3BUW B;  5ELY A;  4MRI A;  2N3A B;  3VRN A;  2AFO A;  3D8P A;  3H8G A;  3WT4 A;  1YW4 A;  2XPL A;  2JLM A;  2QJ8 A;  3CXS A;  3ZZI A;  4A37 A;  3L2N A;  2CIJ A;  3TLA A;  5C82 A;  2R1I A;  3HLP A;  2QYV A;  3O8Z A;  1F2O A;  1LAN A;  1XIX A;  4BTF A;  2ZED A;  3PRT A;  3BUM B;  4JXR A;  4KSA A;  4NFR A;  3EZB A;  5LRG A;  2EZC A;  1YVH A;  2CTB A;  1J4J A;  4CYO A;  5D29 A;  1VBG A;  3VAR A;  2AFZ A;  4CDJ A;  4F0Y A;  1XFO A;  3JVN A;  4JZ0 A;  1QSO A;  3PB6 X;  4XNH B;  4B11 A;  1YLO A;  4Y49 B;  5A28 A;  5AG4 A;  3OB2 B;  5JGF A;  4XPL A;  3HMJ G;  1PYT B;  4FD6 A;  4TNU A;  4U9Y A;  3TE4 A;  2DPS A;  2QIR A;  2Z3K A;  2YND A;  2EO8 A;  3KAS A;  3IWW A;  3B3V A;  3FVL A;  3S6F A;  3CDX A;  3PB8 X;  2RFH A;  1EZB A;  7CPA A;  3FEC A;  1B87 A;  1NSL A;  4C2Z A;  2IL4 A;  2P6G A;  5GCN A;  4F8Z A;  2C5Q A;  2GU2 A;  3EZE A;  3FRM A;  3EFA A;  4MXU A;  4UIB A;  3G3S A;  2Q4Y A;  3W91 A;  3PP9 A;  3IEH A;  3FNC A;  2B5G B;  2C6C A;  3VWE A;  4AB7 A;  5HVH A;  4K30 A;  3JTK A;  3SJG A;  3TO9 A;  2PJB A;  1CG2 A;  3S9M A;  1ZYM A;  2JBJ A;  2NSM A;  2V8H A;  4PXC A;  1ON0 A;  1NMT A;  2Z10 A;  4MHP A;  3BHX A;  1ZLI A;  4AG9 A;  4C9E A;  4L8A A;  2D0O A;  2ZW6 A;  1FBV A;  4E94 A;  2REE A;  2F7V A;  2EZB A;  2YNE A;  4C8F A;  4MY3 A;  4CGM A;  2Y0M A;  3OWC A;  3EY5 A;  3LOD A;  1VBH A;  2PVW A;  4DYO A;  2P0W A;  1TIQ A;  1WK4 A;  3H5Z A;  4CYP A;  3PB7 X;  5HVG A;  1XRY A;  1S7F A;  4C7I A;  4CGO A;  3I6S A;  2XPN A;  1M44 A;  2Z3M A;  4MHZ A;  4UCN A;  2OH1 A;  2VZZ A;  4A2Z A;  3CZX A;  4AG7 A;  4KSI A;  4HNY B;  4C9V A;  3IFE A;  1M4D A;  2VXK A;  2G3T A;  1C3O B;  2OR4 A;  2MP0 A;  4C9A A;  2HQY A;  3PT1 A;  1OBR A;  1IGB A;  1FY7 A;  3DSB A;  2CNT A;  1IYL A;  3NE8 A;  4UIA A;  4A94 A;  4C86 A;  5AG7 A;  1VHE A;  1Y0Y A;  2AFX A;  5G1Z A;  3R96 A;  1Z5R A;  4I49 A;  2PSW A;  4MJ8 A;  4C99 A;  5J8F A;  1GYT A;  1V6C A;  1TF8 A;  3OAK A;  1QST A;  4UA3 A;  3TT2 A;  4ZYQ A;  3TLB A;  3B35 A;  1LAP A;  2BEI A;  2PQ8 A;  4R3L A;  4ZY0 A;  1LFW A;  4BMH A;  4P4F A;  4BPU B;  1X10 A;  1AUG A;  2YJV A;  4Q7A A;  2VL1 A;  3JRU A;  2B4J C;  4OC3 A;  3K9U A;  2PE3 A;  4YU9 A;  2FM4 A;  4NGT A;  2B5G A;  4U9Z A;  3G23 A;  4C9U A;  3VRP A;  4YWY A;  5IX3 A;  4Q36 A;  4X2T A;  3I3G A;  1FT7 A;  5J3X A;  2OZG A;  4IIY A;  3NE7 A;  3BJ7 A;  3SI2 A;  2DF5 A;  4DJL A;  2YJT A;  4OC1 A;  2GLF A;  2PIZ A;  4CYN A;  1EO0 A;  4MBU A;  2B3V A;  2V77 A;  2FIA A;  3GYA A;  2PDO A;  3CT9 A;  1XEB A;  1IU8 A;  3OP0 A;  1TF9 A;  1ZLH A;  2OLS A;  4BPX B;  3D7D A;  2BOA A;  1JQG A;  2ODF A;  3SI1 A;  4MCR A;  2X7B A;  1M6V B;  2CXA A;  2UV8 G;  3GY9 A;  2B58 A;  4A4B A;  4NGR A;  5LRJ A;  1XJO A;  4EYS A;  1QSN A;  2YNC A;  2GLJ A;  6CPA A;  2D4P A;  4OIW A;  3GKR A;  5F46 A;  1EZA A;  5F48 A;  4HPS A;  5HKW A;  3W6S A;  4E8O A;  3R1K A;  1KC7 A;  3SHP A;  4B13 A;  2R98 A;  4FUU A;  4HNX B;  3NA6 A;  2OZH A;  2PJ3 A;  4MY0 A;  1IIC A;  2YGW A;  3SJE A;  1KUY A;  1LRZ A;  3SXO A;  3VTA A;  3NFZ A;  4CAV A;  4LX9 A;  4TJV A;  4CGL A;  3FF3 A;  3VRO A;  1Z8T A;  5HH1 A;  4KOS A;  3FH4 A;  3SJF A;  1M4I A;  4F6A A;  4PXD A;  2Z3O A;  3KKW A;  4P6Y A;  5I0C A;  5K8N A;  3TO7 A;  2ZXV A;  2FCK A;  1CM0 A;  1PUA A;  1WJT A;  3PGP A;  2NMT A;  4M6H A;  5AGE A;  4P4J A;  1IY7 A;  3T9Y A;  4YFJ A;  2HWG A;  3MGD A;  4FD7 A;  5LRK A;  4KLW A;  5JH9 A;  4COB A;  4OME A;  2R8V A;  4UCP A;  4X5K A;  2PVV A;  1UWY A;  3F5B A;  4PSW A;  3DGV A;  2BL1 A;  2JEW A;  3V7Z A;  3WC6 A;  3RYO A;  3B3W A;  4J0N A;  4E5S A;  2ZEO A;  3S9L A;  2I00 A;  2PJC A;  2Q7S A;  3IGR A;  2GAN A;  2Q04 A;  4B5O A;  5JM6 A;  1S60 A;  4CZ1 A;  4O23 A;  1YGH A;  4JVO A;  1Y9W A;  2D0P A;  1Y7R A;  4ZI6 A;  3D4U A;  1XBU A;  2P6E A;  3FMC A;  4R3K A;  4EVY A;  3PFV A;  5BY0 A;  1FNO A;  2ZEN A;  3B7I A;  3FJU A;  3TC8 A;  4OAD A;  3EIF A;  4NGS A;  2B3U A;  4X8I A;  4GM5 A;  3TTH A;  4C8T A;  4NGM A;  2FVG A;  3KQZ A;  4MFQ A;  2ANP A;  3NH5 A;  4MMO A;  4C68 A;  2R82 A;  3CXP A;  2P6F A;  1AYE A;  3DR6 A;  3K2K A;  4PSX A;  2HC9 A;  1HDQ A;  2QVP A;  3P2H A;  4R8F A;  2Q4Z A;  3EXN A;  2WPW A;  4UFV A;  1NE9 A;  3ZJ0 A;  1Q2D A;  3FXT A;  4A31 A;  4CPA A;  4ONU A;  4LQG A;  5F09 A;  1YLE A;  2AJ6 A;  2ZEE A;  2ZW5 A;  3TLY A;  1VHO A;  3S6G A;  1BPN A;  4AXV A;  1IB1 E;  1R43 A;  1HDU A;  3TLG B;  5G22 A;  1P0H A;  1Z9U A;  2V8D A;  1I21 A;  2G3A A;  2PJ6 A;  3IC1 A;  4HKF A;  1KBL A;  2FE7 A;  5EBV A;  1DIK A;  1RTQ A;  1CX8 A;  4M6I A;  2PJ4 A;  2ZW7 A;  2RC4 A;  4LUA A;  4A4C A;  4P10 A;  1YK3 A;  3RO0 A;  3HUV A;  4UCM A;  3S6H A;  4QBJ A;  1P4N A;  1VGY A;  4NEX A;  4IK2 A;  4QB9 A;  1NSA A;  5HKZ A;  3VGO A;  2JDC A;  3ISZ A;  3KZW A;  3PBB A;  5F47 A;  3S9N A;  1HEE A;  3T5M A;  2DLA A;  1UFH A;  2HB6 A;  1KUX A;  2FSR A;  3FYN A;  1SQH A;  2O4H A;  3W6X A;  1YVK A;  2Q7B A;  1KZF A;  2OB0 A;  3TOB A;  5ISV A;  5KTC A;  3FIX A;  4NJR A;  4UWI A;  3DLJ A;  1XOV A;  1MJ9 A;  3BJ8 A;  1YR0 A;  2CTC A;  3MRU A;  1XE4 A;  2ZEL A;  4UEF A;  1Z8L A;  1QSR A;  4LQ6 A;  2DIK A;  2J8M A;  4INJ A;  4PQA A;  3TCV A;  1GGO A;  3TLZ A;  3F8K A;  5G20 A;  1IOI A;  5JYB A;  1ARM A;  2J9A A;  2EWB A;  4MHN A;  2B4D B;  4E0A A;  3BI1 A;  3N7Z A;  3MN8 A;  2OOT A;  2EK9 A;  4YGO A;  5D8N A;  4CDK A;  3BI0 A;  3F0A A;  1BLL E;  2ZEH A;  3TYX A;  4PXB A;  2PRQ A;  1MK4 A;  2ZEF A;  4A32 A;  4C85 A;  3PEI A;  2ATR A;  3WAB A;  4NGN A;  3NFQ A;  1I1D A;  2WYR A;  2ZEG A;  1QSM A;  3FX6 A;  4ZX8 A;  5K8P A;  5I4M A;  3T07 A;  2CBL A;  2BO9 A;  1YW6 A;  1VI4 A;  3C26 A;  2PCU A;  3D2M A;  4PPZ A;  5HKY A;  4B14 A;  2VZY A;  4BIN A;  2B0A A;  3R9F A;  2XPO A;  1R3N A;  4XNH C;  4Q38 A;  1Q2C A;  3P2F A;  2PCN A;  2EVN A;  2ABZ A;  3TLG A;  1ZG7 A;  4DUK A;  5EC4 A;  4R6T A;  4MFZ A;  4UEZ A;  3GIU A;  1Z4E A;  1CP6 A;  4H1H A;  1CPS A;  2ZEM A;  3K4I A;  1XF1 A;  2PJ9 A;  2VQY A;  4GPL B;  4MCQ A;  4KOX A;  5DWN A;  1PCA A;  4CS0 B;  4DNC A;  2EBJ A;  2A4N A;  4KLV A;  5A27 A;  1TKJ A;  3RZA A;  3B3S A;  1ZO0 A;  2ZPA A;  4IUS A;  1YME A;  4PV6 A;  4P4E A;  4KSF A;  1Y9K A;  2JDD A;  5J8C A;  5F9M A;  4H2K A;  1XF8 A;  1QMU A;  2AUN A;  4II9 A;  1Q7L A;  4OID A;  2WSA A;  3IO1 A;  4FWU A;  2GE3 A;  3LMS A;  3B2Y A;  1M1D A;  1YSJ A;  1Z8X A;  2VEZ A;  2Z11 A;  4PK3 A;  3T05 A;  4R76 A;  4FBE A;  4L89 A;  2Z3P A;  4F9U A;  4NF1 A;  1XMT A;  2POK A;  3PB9 X;  1LAM A;  4KOT A;  2ZOG A;  3I1U A;  3NH8 A;  1H8L A;  4CAW A;  2BUE A;  5C88 A;  2GFQ A;  4MHY A;  3HPG G;  4NGQ A;  1AMP A;  4Z65 A;  2Q0Y A;  2B4D A;  2F5I A;  4MI1 A;  4MCP A;  4NXY A;  4FD5 A;  1S5K A;  2EUI A;  3A9L A;  5F49 A;  3VH9 A;  1C30 B;  1M4L A;  3EC4 A;  2CY2 A;  5JPH A;  2EK8 A;  3V38 A;  4C2X A;  3QNV A;  4TJX A;  2ZOF A;  3GB0 A;  4CO9 A;  2IQ6 A;  1YQE A;  1S3Z A;  4CAF A;  4C2Y A;  5FD8 A;  1R57 A;  2YNC C;  4R9M A;  4RI1 A;  3QAH A;  5E96 A;  4MFK A;  1L0C A;  4YRH A;  4RUH A;  3TLC A;  1IID A;  3KHX A;  4M6G A;  2V8G A;  4AVC A;  4UEE A;  4KOY A;  1IOF A;  4WWV A;  4CYQ A;  2PJ5 A;  3B3T A;  2I79 A;  5LYD A;  2O53 A;  3KR4 A;  3D7F A;  1V0C A;  4KVO E;  4HNW B;  5DS0 A;  1T36 B;  5J1Q A;  3FEE A;  2ZEP A;  1CPX A;  2VI7 A;  3H8F A;  3QAY A;  1A2Z A;  3UY5 A;  1A9X B;  4COG A;  2V8V A;  3BLN A;  1EE3 P;  4KOR A;  3K9T A;  3GJZ A;  1TXR A;  1K4J A;  2Q43 A;  2PJ8 A;  3GUX A;  3NH4 A;  4BBH A;  2CF4 A;  1IYK A;  4CAE A;  4XPD C;  1CE8 B;  3SJX A;  4C8P A;  5K99 A;  3EO4 A;  3PB4 X;  2PR1 A;  3PZJ A;  4KNG E;  3C8O A;  3D7G A;  2OZU A;  5BWA B;  2WPX A;  2C6G A;  2AFU A;  2PJA A;  3RBU A;  1WVM A;  1ELM P;  3CPA A;  1ARL A;  2ARH A;  2G9D A;  4JYW A;  2Q44 A;  4M8D A;  1ZRS A;  2HV2 A;  2Z0Z A;  2AFS A;  2C27 A;  5CPA A;  2GIV A;  2QEC A;  1TKH A;  4KZT A;  4P44 A;  1S7K A;  4QUS A;  2Y1N A;  4B5P A;  1JDE A;  3JUW A;  1DTD A;  3IIB A;  3WC5 A;  3KRV A;  4C8C A;  2EZA A;  4KOU A;  4C7H A;  1S7L A;  2GRE A;  2O28 A;  4UFX A;  5KTA A;  3U88 C;  2K5T A;  5AXI A;  4FAI A;  2Q4V A;  3TFY A;  5IV0 A;  5CBM A;  2HUZ A;  4CAX A;  3PFO A;  1ZG8 A;  5CNP A;  1KWM A;  4EFD A;  8CPA A;  4IIX A;  1YX0 A;  4MFJ A;  3F9K C;  1MJB A;  2XEI A;  3LWU A;  5LYL A;  2VKZ G;  4ZY2 A;  5JVL A;  4BD9 A;  2B4B A;  4RN7 A;  2XPP A;  3VRR A;  1I12 A;  4R57 A;  4U5Y A;  3T8W A;  1U6M A;  3VAT A;  1R61 A;  1VKC A;  3RNZ A;  1M4G A;  4X3R A;  3E0K A;  4GXH A;  4B6Z A;  3TLE A;  1YRE A;  3ZNI A;  4JWP A;  4AVA A;  1X12 A;  2Z3L A;  3R95 A;  3ISX A;  2XEG A;  1GHE A;  3DNS A;  3PLF B;  2E28 A;  1Z9E A;  3EZA A;  3T0T A;  2BCO A;  2GP4 A;  2FL4 A;  4ZGY B;  4P4B A;  1ZL0 A;  3KQX A;  4NJQ A;  3D67 A;  3V8I A;  1VIX A;  4C8U A;  4ONW A;  4OLL A;  2AE6 A;  5FVJ A;  1MJA A;  4KOW A;  4F0X A;  3CPX A;  4A30 A;  3I74 A;  4TWE A;  4KS9 A;  4KVM E;  1Y7E A;  3FB3 A;  3D68 A;  1NBW A;  2XEJ A;  2PRB A;  3FBU A;  1B6B A;  4CRY B;  1F57 A;  2BSW A;  5EMI A;  2IMO A;  4OC5 A;  3S6K A;  2IJZ A;  2DXQ A;  4IHM A;  2VBQ A;  4UWJ A;  4RS2 A;  1B47 A;  2I3C A;  2PC1 A;  4B10 A;  4M3S A;  4F9V A;  3OB1 B;  4OAE A;  3DR8 A;  1Z8W A;  3IWE A;  1J3L A;  4GS4 A;  3BUN B;  4ORF A;  1KEE B;  1LOK A;  4JJX A;  4EWT A;  2Q51 A;  5HMN A;  1Y0R A;  4P4D A;  4J3G A;  5K8O A;  1CP7 A;  1KUV A;  4KOV A;  4XPK A;  4C84 A;  1TKF A;  3IU1 A;  4Y49 C;  4KUB A;  5IB0 A;  2PJ2 A;  5H86 A;  4BPW B;  2Z3N A;  2C1C A;  3FED A;  4CGP A;  2PJ1 A;  3D66 A;  3B8G A;  5F5X A;  5LYF A;  4KUA A;  1Z4R A;  1ZG9 A;  2NYQ A;  2RB7 A;  3DDD A;  3N5F A;  2ZW4 A;  4IF5 A;  4JLY A;  3D7H A;  2DPT A;  2FXF A;  5JQ4 A;  2R7H A; 
#chains in the Genus database with same CATH homology
 4OC2 A;  4PXE A;  4A38 A;  1Y9Z A;  2JBK A;  5HXD A;  3KR5 A;  2AFW A;  4P45 A;  3GLJ A;  5HVF A;  4IAV A;  4WJB A;  4YN3 A;  1BAV A;  4G1P A;  1Z2L A;  4UF4 A;  4ZY1 A;  3PFE A;  2C6P A;  4C8A A;  4W9Y A;  1BPM A;  2WZN A;  4OP4 A;  3TX8 A;  3ICU A;  3WC7 A;  3IJ3 A;  4OKO A;  2DEA A;  4ZX9 A;  4R7M A;  3BXM A;  1F2P A;  5K8M A;  4K3N A;  4NGP A;  4EME A;  5IB9 A;  3KL9 A;  3KGQ A;  2PJ7 A;  2PJ0 A;  4P4I A;  4OC0 A;  1CBX A;  4MCS A;  1LCP A;  5LYI A;  2PIY A;  3KHZ A;  2F8H A;  4OC4 A;  3B3C A;  3PBE A;  3RAM A;  5THW A;  1ELL P;  1QQ9 A;  3H8E A;  3SI0 A;  1DE4 C;  2AFM A;  4A39 A;  2XEF A;  3KI9 A;  1XMB A;  5ELY A;  4MRI A;  2AFO A;  3H8G A;  3WT4 A;  1YW4 A;  2QJ8 A;  4A37 A;  3L2N A;  2CIJ A;  3HLP A;  2QYV A;  1F2O A;  1LAN A;  2ZED A;  3PRT A;  4NFR A;  5LRG A;  4CDJ A;  2CTB A;  5D29 A;  3VAR A;  2AFZ A;  1XFO A;  4JZ0 A;  3PB6 X;  1YLO A;  5JGF A;  1PYT B;  4TNU A;  3KAS A;  3FVL A;  3B3V A;  3IWW A;  3CDX A;  3PB8 X;  2RFH A;  7CPA A;  3FEC A;  4F8Z A;  2C5Q A;  2GU2 A;  4MXU A;  4UIB A;  3IEH A;  2C6C A;  5HVH A;  3SJG A;  2PJB A;  1CG2 A;  3S9M A;  2JBJ A;  2NSM A;  2V8H A;  4PXC A;  4MHP A;  3BHX A;  1ZLI A;  4C9E A;  2F7V A;  4C8F A;  2PVW A;  4DYO A;  3PB7 X;  5HVG A;  1XRY A;  3I6S A;  4KSI A;  4C9V A;  3IFE A;  4C9A A;  2OR4 A;  1OBR A;  4UIA A;  1IGB A;  4A94 A;  4C86 A;  1VHE A;  1Y0Y A;  2AFX A;  1Z5R A;  4C99 A;  1GYT A;  1V6C A;  1TF8 A;  4ZYQ A;  3B35 A;  1LAP A;  4ZY0 A;  1LFW A;  4P4F A;  4Q7A A;  2VL1 A;  3JRU A;  4OC3 A;  2PE3 A;  4YU9 A;  4NGT A;  4C9U A;  4YWY A;  4X2T A;  1FT7 A;  3SI2 A;  4DJL A;  4OC1 A;  2GLF A;  2PIZ A;  2V77 A;  3CT9 A;  1ZLH A;  1TF9 A;  3D7D A;  2BOA A;  1JQG A;  3SI1 A;  4MCR A;  4NGR A;  5LRJ A;  1XJO A;  2GLJ A;  6CPA A;  5IR2 A;  4OIW A;  4FUU A;  3T8W A;  3NA6 A;  2PJ3 A;  3VTA A;  3SJE A;  3NFZ A;  4TJV A;  3FF3 A;  3FH4 A;  3SJF A;  4PXD A;  5K8N A;  4P6Y A;  4P4J A;  1IY7 A;  5LRK A;  5JH9 A;  4OME A;  2PVV A;  1UWY A;  3DGV A;  2JEW A;  3V7Z A;  3WC6 A;  3B3W A;  2ZEO A;  3S9L A;  2PJC A;  5JM6 A;  4O23 A;  4ZI6 A;  3D4U A;  1XBU A;  3FMC A;  1FNO A;  2ZEN A;  3B7I A;  3FJU A;  3TC8 A;  3EIF A;  4NGS A;  4X8I A;  4GM5 A;  4C8T A;  4NGM A;  2FVG A;  3KQZ A;  2ANP A;  3NH5 A;  4MMO A;  4C9R A;  1AYE A;  3K2K A;  2HC9 A;  1HDQ A;  2QVP A;  4R8F A;  2Q4Z A;  4CPA A;  4LQG A;  5F09 A;  2ZEE A;  1VHO A;  1BPN A;  4AXV A;  1R43 A;  1HDU A;  2V8D A;  2PJ6 A;  3IC1 A;  1RTQ A;  1CX8 A;  2PJ4 A;  4P10 A;  3HUV A;  1VGY A;  4IK2 A;  1NSA A;  3KZW A;  3PBB A;  3ISZ A;  3S9N A;  1HEE A;  2HB6 A;  2O4H A;  4NJR A;  3DLJ A;  2CTC A;  3MRU A;  2ZEL A;  4UEF A;  1Z8L A;  4PQA A;  1ARM A;  2J9A A;  2EWB A;  4MHN A;  3BI1 A;  3MN8 A;  2OOT A;  2EK9 A;  5D8N A;  4CDK A;  3BI0 A;  1BLL E;  2ZEH A;  4PXB A;  2PRQ A;  2ZEF A;  4C85 A;  3PEI A;  3WAB A;  4NGN A;  2WYR A;  3FX6 A;  2ZEG A;  4ZX8 A;  5K8P A;  5I4M A;  2BO9 A;  1YW6 A;  2PCU A;  4PPZ A;  1R3N A;  2ABZ A;  1ZG7 A;  4DUK A;  4R6T A;  4UEZ A;  1CP6 A;  1CPS A;  2ZEM A;  1XF1 A;  2PJ9 A;  4MCQ A;  1PCA A;  1TKJ A;  3RZA A;  3B3S A;  1YME A;  4P4E A;  4H2K A;  1QMU A;  1Q7L A;  4OID A;  3IO1 A;  4FWU A;  3LMS A;  3B2Y A;  1YSJ A;  4R76 A;  4FBE A;  4F9U A;  2POK A;  3PB9 X;  1LAM A;  2ZOG A;  3I1U A;  3NH8 A;  1H8L A;  4MHY A;  4Z65 A;  4NGQ A;  1AMP A;  4MCP A;  3VH9 A;  1M4L A;  2EK8 A;  3V38 A;  3QNV A;  4TJX A;  2ZOF A;  3GB0 A;  2IQ6 A;  4RUH A;  3KHX A;  2V8G A;  4UEE A;  4WWV A;  2PJ5 A;  3B3T A;  5LYD A;  2O53 A;  3KR4 A;  3D7F A;  5DS0 A;  5J1Q A;  3FEE A;  2ZEP A;  1CPX A;  3H8F A;  2V8V A;  1EE3 P;  3K9T A;  1TXR A;  2Q43 A;  3GUX A;  2PJ8 A;  3NH4 A;  2CF4 A;  3SJX A;  4C8P A;  3PB4 X;  4KNG E;  3D7G A;  2C6G A;  2AFU A;  2PJA A;  3RBU A;  1WVM A;  1ELM P;  3CPA A;  1ARL A;  2G9D A;  4JYW A;  5CPA A;  2AFS A;  1TKH A;  4P44 A;  1DTD A;  3IIB A;  3WC5 A;  4C8C A;  2GRE A;  4FAI A;  5CBM A;  3PFO A;  1ZG8 A;  4EFD A;  1KWM A;  8CPA A;  5LYL A;  2XEI A;  3LWU A;  4ZY2 A;  4BD9 A;  3VAT A;  4X3R A;  4B6Z A;  3ISX A;  2XEG A;  2BCO A;  2GP4 A;  4P4B A;  3KQX A;  4NJQ A;  3D67 A;  1VIX A;  4C8U A;  4ONW A;  3I74 A;  3CPX A;  4TWE A;  1Y7E A;  3D68 A;  2XEJ A;  1F57 A;  2IMO A;  4OC5 A;  2IJZ A;  4IHM A;  2I3C A;  4F9V A;  1LOK A;  4EWT A;  2Q51 A;  1Y0R A;  4P4D A;  5K8O A;  1CP7 A;  4C84 A;  1TKF A;  2PJ2 A;  2C1C A;  3FED A;  2PJ1 A;  3D66 A;  5LYF A;  1ZG9 A;  2NYQ A;  2RB7 A;  3N5F A;  3D7H A;  4MHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...