4OMFG

The f420-reducing [nife]-hydrogenase complex from methanothermobacter marburgensis, the first x-ray structure of a group 3 family member
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
231
structure length
231
Chain Sequence
AKPRIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKELGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The F420-Reducing [NiFe]-Hydrogenase Complex from Methanothermobacter marburgensis, the First X-ray Structure of a Group 3 Family Member.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords F420-reducing hydrogenase, subunit gamma
total genus 72
structure length 231
sequence length 231
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00037 Fer4 4Fe-4S binding domain
G PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4omfG02
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4omfG01
4IUBS 1IQZA 2VPYB 3ZE9A 1FXRA 3AYZB 2C3UA 3MM8A 1BQXA 4XDDA 5A4FS 2PMZD 4UEWA 4KO2S 1CLFA 2VKRA 1FRIA 2GMHA 1FRXA 1H98A 1FDAA 1Y4ZB 4XDCA 2UZAA 1UBJS 2ZVSA 3MM7A 1KEKA 4IUDS 4KL8S 1UBRS 1FDDA 3IR7B 1UBOS 1WUJS 1Y5LB 2FJBB 1WUKS 3GYXB 3H3XA 1JNZB 5A4IS 4KO4S 4U9HS 3MMCA 2FDNA 2FJEB 3EUNA 4TTTS 3PNIA 1E3DA 3OR2B 5CHCB 1FRJA 1FRFS 2XSJB 5JSYA 1FDNA 1GT8A 1GTHA 3ZE6A 5ADUS 2Y0SD 3IR5B 5JT1A 1F5CA 2C3PA 1FERA 1YQ9A 4OV1A 4KO1S 1A6LA 1BWEA 1UBUS 2O01C 2FD2A 1KQGB 2GMJA 2PA8D 3MM6B 3CUSA 4UQPA 1H7XA 2VPXB 1DURA 5CH7B 2C3YA 4ID8A 1GAOA 1SIWB 3ZE7A 1Q16B 6FD1A 2V2KA 7FDRA 1Y5IB 1FRKA 4L6V3 1UBHS 4C3OB 4YDDB 5JSHA 1UBMS 4UCQA 1G6BA 1VJWA 2FGOA 3MM5A 2VPZB 3EGWB 1WUHS 7FD1A 1DFDA 3OR1A 4RKUC 2WSEC 3MYRA 1C4CA 1FXDA 1HFEL 2WB1D 2C42A 1AXQA 1FRLA 1PC5A 3MMAB 3OR1B 5BYQA 4U9IS 4UE2A 2VPWB 3IR6B 1Y5NB 5E7OB 3USES 4UD2A 4UCXA 4KT0C 1SJ1A 5L8RC 5JSUA 1IR0A 3EXYA 2WSCC 2FJDB 1CC1S 1UBLS 3UQYS 1RGVA 1WTFA 1H0HB 1R27B 1B0TA 5BYSA 4AYBD 4UD6A 4URHA 4KN9S 1FF2A 2Z8QA 4UPEA 4UQLA 1KQFB 1K0TA 1F5BA 2FJAB 2V4JB 1WUIS 3HKZD 1JNRB 1YQWA 4XK8C 1FTCA 3LW5C 3ZEAA 1PC4A 3MMCB 3USCS 3CURA 1XERA 4OMFG 2IVFB 1H7WA 5BYRA 3MM9B 4UE3S 2XSJA 1BLUA 3MM6A 4CI0B 3MMBB 3MM8B 3MM9A 1UBKS 3MMAA 2FRVA 5A4MS 1C4AA 2WPNA 3RGWS 1FD2A 1DAXA 5JRDS 5JSKA 1BD6A 1FRMA 4DHVA 1H2RS 1UBTS 4KO3S 1FCAA 5FD1A 4UPVA 4IUCS 3C8YA 1B0VA 1FEHA 1H2AS 1FRVA 4UEQA 1G3OA 4GD3Q 1SIZA 2WAQD 1WULS 2V4JA 4UCWA 3MM7B 3MM5B 5D51S 2C3OA 1GTEA 1FDBA 1FRHA 1B0PA 3OR2A 4Y28C 1YRQA 3AYXB 2C3MA 1ROFA 1JB0C 4UE6A 2WSFC 3MMBA 1F2GA 2PDAA 3ZE8A 6FDRA 1D3WA 1BC6A
chains in the Genus database with same CATH superfamily
1FFXA 1U28A 5DBOA 1TD9A 1X3LA 4QQ8A 5DYYA 4XM1A 1BQMB 1Q1ZA 3IP1A 3ZHTA 2ROPA 5GVRA 4CN9A 3EBLA 2HHSA 1NSKL 3E81A 5GPBA 4ECQA 1NONA 4FFLA 2GKSA 5LKRA 2C29D 5IYZB 2JWNA 4DLBA 3HD2A 2ZRFA 3NS7B 2HYIB 4DU7A 3ENWA 1FA9A 4X4UA 4AIRA 1N92A 3DKPA 1ZICA 2AGPA 5T3UA 4KH0A 4OKIA 5JISA 2XNJA 3F8WA 4J29A 2IBMA 3IRWP 3GOQA 2ZSBA 4QFBA 4UPDA 2Y77A 4HDQB 3OE7D 1PQWA 5CX1A 5L6LB 1U4BA 2UXBB 2VJNA 2H4ZA 3CEPB 3L4BA 5LR6A 4DV0B 4U95A 1BMFD 2EATA 3I6YA 2JB9A 3EWNA 1N2OA 4Z4QA 5HK9A 3BH7B 4PF1A 1II8A 1E0SA 3TRDA 3ZK9A 3H86A 1UBFA 2HQGA 4PWDA 4D9MA 1W26A 2FTRA 2HLHA 2OO7A 3F98A 6GPBA 4N9WA 4TMTA 4CMKA 2DHRA 2QAIA 5HQLA 1P44A 3TQCA 4XDYA 5IV4A 1F2TB 2OENG 3FOCA 1ZGAA 2F1OA 4X1IA 5ALTA 5ETJA 1EE1A 4TS4A 3LO3A 3E5NA 3M7IA 5JXGA 1H85A 3FWHA 2RU9A 2PIIA 1BW9A 4W1QA 1ONPA 2DNYA 1HT2E 1DC8A 3D4NA 5DGTA 3GMSA 3CVYA 5AOVA 2BOVA 1XNJA 4NK5A 3G7SA 2BOPA 2WZBA 4R3UC 5ECYA 4ZT6A 1QCZA 5DH9A 3BXXA 1KMHB 4ECEA 2DNKA 1F0NA 1RMTA 1NRKA 3K31A 2X3YA 5IJWA 4CCAA 3PGMA 1GL7A 3WJ2A 3I73A 3D0KA 1NQWA 4HEA9 1N4DA 2IVZA 4NJEB 3JS5A 5J3JA 4QRIA 3UIEA 3O4VA 4EYQA 3JR3A 2NUPB 2HVZA 4K5QA 5H7XA 1P60A 3AVQA 2XYQA 4UJ3A 4DPUA 1DT5A 3PUIA 3HSYA 1Y9ZA 1WC3A 2IPMA 3GA5A 4JJ4A 3OIYA 4CIAA 4ZN3A 2DWQA 2L9NA 1WD6A 2ROGA 4QPPA 2Q9BA 2B56A 3RVBA 2WUWE 1KQGA 4ZTZB 1HTWA 3OCCA 1FRXA 1FXLA 1UWBA 4YRQA 4A82A 1F5AA 5JJLA 4V38A 4JLNA 4A36A 3V7WA 1MJNA 1W49A 4QA9A 5B1IA 4QO8A 5ETMA 1U5BA 4U7WA 1NBWB 1PZMA 3ZEIA 5BMVB 2HFUA 3HCBA 1UM8A 5E95A 2ZB4A 1EFVA 3EMDA 5DOVA 4TTAA 1XEFA 2WOMA 4LRBA 4N8NA 1VYAA 4NK4A 2F3PA 1MG0A 1TZKA 3WGNA 1T9BA 3IS3A 3E18A 1UAAA 3IS9B 1T95A 3MA0A 4URXR 2EF1A 1WACA 5JXWA 2O8DB 2EFCB 3G2LA 1E58A 1OKKA 2O8BB 4LPSA 4PX9A 3WSWA 3ZWPA 2JSXA 1ZN8A 3GIWA 4RTJA 5BT9A 1G2PA 4HWGA 1P9LA 2BP7A 3B1VA 1V4BA 3KWFA 2Q66A 3DBLB 1GTL1 2LQBA 3ZDDA 3OD1A 4RKRA 5ICMA 1RWKB 3RIEA 4Q82A 5BWCA 5EXTA 3GI1A 1EP4B 1AK2A 1SZPA 2PGNA 2VO1A 1EDDA 4A0SA 2IXDA 3E15A 1NW6A 1P1JA 3A8TA 1SXHA 2QM3A 2QN9A 4M4SA 4IG0B 4GKAA 4X9XA 4CLLA 3HQ4O 1PS0A 4KKVA 2GZAA 5E8JA 3I39X 5LOVF 4UBJA 1LRJA 1W2GA 2R6CA 4AVYA 4F4ZA 4KQGA 3SZRA 2RHWA 4Y6LA 1QVAA 2VDWA 2YDXA 3IIKA 3GNTA 3TTUA 5HRUA 4F93B 2B6AB 4FCCA 1I3LA 1UAYA 3MMSA 3TNDA 1KZ7B 3RSLA 3V7NA 3R6LB 5FWAA 2JBHA 5JS7A 4ZGGA 3UKJA 3K5HA 2IEYA 4NG4A 5KNLA 1CY6A 3KXIA 5EWGA 1XDZA 4PR0A 5B1DA 2XGSA 2ID4A 3TR6A 2QX4A 5AW6A 2GR9A 2DUWA 3AB4B 4PYQA 1JX6A 1DHTA 3EYWA 4DX8H 2CJFA 2PMKA 4RPKA 4HQOA 4CF7A 4E98A 3ZW8A 2NTEA 4UTZA 4GIBA 2HHLA 3MUFA 5DRTA 4JP8A 4IFYA 4R31A 4EOGA 3EPPA 4IAOA 3RARA 1G5PA 2D3OR 5ALDA 4B4VA 2M5YA 5NULA 3RUEA 3LP2A 4AJEA 2RI1A 1YJUA 1PQPA 1GNQA 2IA5A 3TBHA 3OJEA 3K0SA 2CQDA 4PG6A 1FFHA 1NRJB 4H1WA 4BQSA 1ULSA 2E21A 3GG1A 1RJEA 3MI7X 3E6AA 2P69A 5TXGA 1XZKA 4DV4J 3GDWA 4E07A 1T8TA 3VNUA 4B4DA 1MFZA 5J1TB 3LF0A 2PMEA 3CF6R 4FMCF 5MFZA 3VAMA 1E4EB 1FP4A 4Q16A 3SR0A 1T2DA 4B9MA 5IXJA 3G9UA 2A7QA 1SBTA 4HVAA 3PQDA 3WA6A 3AEKA 3FUXA 2ZUFA 4G5YA 2X40A 4J9MA 4WBNB 2EZUA 3LLSA 2GJ8A 2Z5VA 2GRAA 3OESA 5HCNA 1R6YA 3SD7A 3ORFA 1J2VA 1A9TA 2XAUA 4ANDA 1L8LA 4ZVUB 5KYWB 1C4AA 4RWXA 4WI1A 1VI2A 3KQQA 1GTEA 3AJ2A 4OZLA 4RUKA 3RYTC 3HJHA 4YCSA 3B9RA 4RVHA 5IFKA 5BV7A 2E5LB 2CRLA 2PFFB 1U2PA 2QMXA 3JQQA 4DBQA 3T1AA 5DP2A 1IM5A 3I3SR 3SVTA 2DPLA 4AW9A 3HPRA 4LMBA 2AR9A 4GBGA 2YZKA 1P5FA 5YASA 4Y2UA 4A0GA 1H5NA 1QX4A 2NIPA 3NHSA 3CE8A 3DRSA 3NEPX 4BVBA 2PUBA 4LBIA 4XQGA 4GE3A 1BDIA 4F71A 1KVTA 4IH7A 1WXEA 4PG8A 3DCYA 3J7A1 4WFKA 1FSFA 3VYSB 5KSZA 1YDMA 2RDJA 3V42A 4JLBA 5E1DA 3W78A 5HOQA 2CSXA 1L7QA 1Y80A 2J1LA 2UXCJ 2VFVA 4KRGA 4OMDA 1LPOA 1RRCA 4R84A 5D86A 3D28A 2E5FA 3KQVA 3GVPA 3ZI4A 3JW8A 1KVKA 5CM2Z 3T7DA 1NMEB 1PJ6A 2ATVA 1K1EA 3C3CA 1I80A 4PGHA 1YS7A 5KOHB 3LGAA 4WPGA 1DCMA 1FJCA 3C1AA 2FPMA 3ZYZA 1AUQA 4KZKA 2V50A 2G9RA 7MHTA 4H27A 3O3MB 1N78A 1PYDA 4P74A 4ABYA 1G60A 2H1IA 2BSXA 2PUTA 1Y0BA 1CUHA 5KHLB 1SI9A 5CJPA 1XFDA 1DBIA 1IOWA 5KAMA 3P9QA 3GA7A 2HIGA 5LQMA 3W9BA 4R1OA 2W4MA 1NUPA 3QIAA 1OR8A 4YO7A 4XVCA 2QPAA 2O2HA 3QTBA 4M46A 3OR1A 1OSCA 2PLAA 2UVQA 3V4MA 1OC4A 1JLFA 3NHMA 2XOKD 2J6CA 3UB4A 1E3SA 3BC1A 2XO7A 1Z35A 4KT0C 2E4UA 3KZNA 2XT0A 3QHQA 3J7YI 1QGUA 4PQFA 2WJWA 3E9QA 3JYNA 1IPHA 4R51A 3SC2B 2J6HA 2C59A 5DHTA 1F5BA 1UPAA 2KYXA 1KC1A 2EFNA 1AQJA 3QWIA 4JHXA 3N2EA 4FB5A 5EJ5A 4BBYA 2REBA 1KSGA 3PNPA 2Y0EA 3ODPA 1ZOPA 4EJSB 3TW8A 3NYQA 3WK9A 2KS6A 3FD8A 3H5RA 5AW3A 4MIOA 2JHCA 3D02A 4HR7A 1TMMA 3FSGD 2OCLA 4DR3F 2ROEA 1FD8A 4RTSA 4BS2A 1TDJA 1T3NA 3ZHXA 4O44B 1FO1A 4N39A 2NV6A 3KZOA 3PJGA 3PPIA 3WYNA 4UTXA 3ZWKA 3MFHA 2W6QA 3O8BA 5DDPC 1HLGA 4EG5A 3OTOF 4G0VA 1FKAF 3I0SB 3FF1A 1UWKA 4YQYA 3KTAA 2XZDB 2IIHA 2M32A 3QUCA 1EYZA 3KQKA 1NM5C 1DELA 3PW4A 1S9GB 5T14A 4ZDNA 4OK3A 1SIWB 1ZCAA 3ILOA 3A12A 3V4PB 2VDUE 3A4YA 1TU0B 3LP0B 5TJ9A 1T9GR 4WZAE 3ETGA 1XZCA 2OMOA 2X3GA 1IM8A 4I5FA 1BROA 4MZDA 1KHVA 1QH8B 1BX1A 4RSRA 3CMQA 1OROA 1QLWA 5FLYA 1WPXA 2R47A 2WV7A 5KAKA 4WFIA 1GL6A 2VC0A 1JLEB 1JIXA 1KLMB 4RU9A 1KAGA 1FRHA 5E9AA 5L8VA 3VDRA 2M0GB 1Y10A 1FIUA 1N5QA 4HHEA 1IY0A 4YNBA 1NN0A 2QZSA 1UP6A 2WMYA 1UKZA 1JNXX 1LTQA 1P0MA 4MV3A 2J07A 4K6HA 5IANA 4LSNB 3BMCB 4I6AA 4RUHA 2RF2B 4UZBA 1QRDA 4D0NA 1IWPB 4GLJA 1CZRA 3H7IA 1H9BA 2Y1EA 4QU5A 1ZIDA 3GGPA 3NIFB 1ZAVA 3N01A 2VQDA 3DLEA 2A30A 1B6GA 4P83A 4QNRA 4P4NA 4TPKA 2V54A 4RW7B 2C5LA 4INJA 3QE3A 5KJFA 4TMZA 1KONA 3O8OB 1FRNA 2ST1A 3EHEA 4DWOA 3T3NA 3VGVA 4I36A 1HNZB 2ORED 1LFAA 4NMWA 1PLKA 3HHEA 5BYRA 1E3LA 5KDOA 4FUTA 4EG3A 4JP3A 1SC4B 1TQHA 4FNIA 2AHOA 1GA6A 2ONJA 1E62A 2CNOA 3H83A 3SZ3A 3WJ7A 1IUKA 3AYXB 4PUOB 5AE3A 4V0OA 3RTDA 4FGLA 7ADHA 1FJEB 1REQA 4D9CA 3VC2A 1C2PA 4RIGA 1KP9A 1SJ4P 1BQXA 1QXSA 1P6TA 4M9SA 3X1ZA 1LNSA 3S70A 1JB1A 4EFLA 5DLEA 4C1NA 4OJKA 1YRUA 3I92A 2JJ1D 5EUMA 1M67A 3CKKA 3QMWA 5LUAA 3HJUA 2FJVA 1HW8A 2XDQA 4XVHA 1IM4A 5D6GA 4Y2AA 3EZGA 4BE4A 2ZWOA 4BUZA 3TAQA 3SE7A 3SCIE 3I6BA 2HYDA 1OXKB 4PX3A 1FTRA 1B8UA 1KMQA 4N54A 2FOLA 1TFWA 4YT2A 1Q1AA 3ZTRA 4G0YA 1OTYA 2YWKA 1TL7C 1J23A 4XJSA 1VJ5A 1HBMA 3G6KA 1PWXA 3HN6A 1U6FA 3RVJA 4FN5A 4PLZA 4IV5A 3PYLA 2FPKA 3LLUA 3ZZOA 3D7RA 3GF4A 1OYOA 4UAJA 3CCES 2J5RA 4LZPA 1L5YA 5JAMA 3LZCA 1E79D 4ZHRA 2QZJA 2NSLA 4ZI3A 1EK5A 2W2PA 5AE1A 4GXQA 4OGLA 2BJ8A 3GV7B 1NM2A 4MB0A 3X1MA 5HZKA 3UAWA 2O3SA 3QPCA 3KJIA 1H65A 1KKHA 3DE4X 2MQOA 2IYUA 2FXVA 3IR5B 4WZQA 1RWKA 1DKOA 3K8ZA 3AD9C 4HY3A 5G0RB 3W5ZA 4I46A 2FEPA 5F3DA 3GW8A 2WHPB 4HP8A 5J2UF 1EUCB 1JQEA 2EKYA 2OQVA 2WJGA 4G56A 1TM7E 2UZ4A 4EENA 4RBNA 4J6EA 4A4DA 3N3BC 1XD2A 2EOAA 1Y3FE 2OZLA 4N03A 3IRXA 4QLAA 3BQ2A 1E1RD 4FPXA 3SQMA 1QHHA 4TTIA 5AK0A 4C8YA 4D96A 3A11A 2KH9A 1KFJB 4LXTA 3SS8A 3W2TA 3K70D 1SU8A 4NLYA 2IOHA 3OCJA 4HB0A 2PT5A 2DHEA 2IEIA 1X0PA 2CLIB 4AX4A 4XWKA 1V3SA 2VPZA 3R0ZA 3QFWA 1MCZA 3VISA 2G8NA 5G1OA 3ZW7A 3H5VA 2Z4PA 3U7GA 3QSIA 4D4JA 1BMTA 5JG7A 1TT5B 1EVZA 2FJBB 1VMEA 3Q8RB 4JR1A 3V6DA 3ORQA 4FZ3A 5H81A 4H7PA 1PFQA 2APJA 3MFQA 3ECAA 5AKJA 3UJ9A 3W7AA 4R0NA 1HDOA 4PEVA 4WIIA 3KVRA 5REQA 3IVGA 4KKXB 2J3KA 3W5AA 4R0JA 3GYBA 1HQUA 3DBRB 4REQB 1SGWA 1BE0A 2V67A 3BPSA 3HCWA 4PYKA 4A8TA 2RAQA 1MMLA 5DWQA 4PXBA 1R8QA 4O1HA 3HLUA 2ZWMA 4JXXA 1U7XA 2HCBA 1S2MA 3Q9NA 4FPIA 5AXNA 4OD0A 5KEIA 3MAHA 3P9KA 3OSNA 4JL8A 4CEJB 4QXOA 5FOTA 4NBWA 1R2QA 2GZ3A 2H11A 2QLFA 4ELTA 3K70B 1FRVA 2HVDA 4K8RB 2O57A 1RAOA 3NATA 5FNVA 4OHPA 2WYHA 1SJ9A 1TFYA 1UR5A 1PV2A 5ERXA 4C2AA 1MOSA 1E7WA 2AV6A 2DNPA 3R2CJ 5EMKA 3RJMA 1RAAB 1YAJA 2JHAA 4BLUA 1XHLA 2WUEA 3H3XA 2V0NA 4DXHA 2RIJA 3M4NA 1AZSA 2YJ6A 1X15A 3W6UA 3M8SA 5E3JA 5THWA 2FUNB 2I8AA 3GILA 5AXDA 3F67A 5KT5A 4HVTA 1CCWA 2O66A 1M2GA 3JD3A 5F2EA 2U2FA 3NP5A 1JWBB 3FX2A 1BC5A 2CLKB 2J6TA 4B43A 4ZVKA 4EL0A 2XE7A 4Q9DA 3U3DA 1XLTC 4GS5A 5AVTA 1SU4A 2Y71A 3REFA 2PMWA 3E9MA 2LW7A 3NH9A 2ZUWA 4AMVA 2XUDA 3KSBC 4MMOA 2JL1A 4D3GA 4OV6B 3ORSA 3U17A 1XN1A 1RXSA 4HH4A 3I64A 4YT5A 1PIEA 8ADHA 5FLXU 1E9CA 2BFWA 3EDQB 1QMPA 3OT4A 3IAXA 3KYDB 3ENNA 3RUBL 3U3KA 3I62A 1HARA 1X7ZB 4NNJA 3ITDA 4MUYA 3UH0A 4G1PA 2V68A 3KQMA 1XHEA 2IP1A 1WUJS 2ZYDA 4K0RA 2FZ5A 1SCAA 1Q4RA 2ZCVA 3HXKA 4JUFA 4Z0PA 4RCYA 3V4SA 1UVJA 3C7TA 3PENA 1I2CA 2ABYA 1LB1B 5J58A 1O6ZA 4CV1A 4FR0A 3H05A 3CB4A 3L5OA 2IK8A 1BNCA 3SQGA 1Y1RA 3SFVA 4PX5A 4QEKA 4F1WA 4M1ZA 1A82A 2CJYA 1IUPA 5FPKA 5AVWA 1NC1A 4NZOA 2VF8A 1TTPB 4IDGA 4B7AA 1YRLA 2ZQZA 4YAOA 3DFFA 3K0EA 3MM6A 2ZJPQ 3PNLA 5FL7D 2WSIA 5A4MS 2FOIA 4LE0A 3EOBI 4I2VA 5EJ7A 4IQGA 1LU9A 5DQIA 4X6LA 2D7DA 3G5MA 1X1TA 4FGUA 3QJGA 3IP0A 4I5DA 1OF1A 5K3EA 4EFAC 5HKBA 1T05A 2FSPA 3ED1A 3PJFA 1PG5B 4AC9A 3T3MB 1N9KA 3DVLA 2J59A 4AKTA 1T8UA 1GQSA 4TT3A 2W8ZA 5E38A 4UUOA 5CCBA 3T7SA 1DLIA 2B4TO 2QN8A 5K8NA 5IAJA 3FAZA 4BKQA 4QTTB 4W7HA 1KJ8A 3Q0TA 4WNIA 3CCLS 3JQGA 1PK9A 4FYXB 4IQXA 2IS2A 2FTKE 5DGHA 4BV2A 4TVAB 1V9OA 3OFEA 3MURP 1VCOA 3UMBA 1EB0A 1JW9B 4ZEVA 2QGFB 3LRTA 4LZAA 5ANRB 4ZT7A 2H00A 4JYAB 2B1QA 1GN8A 2XMQA 4DZDA 3RUFA 4YPVA 2K2WA 1C9JA 2ZOFA 3EXCX 1TJ4A 4L4SA 2CEAA 2VJMA 2F67A 4A8YA 3D2BA 3FYUA 4URVR 2H29A 2XB8A 4RTRA 2HBRA 5GZ3A 3NM4A 3HHNB 4DBLC 4UTNA 3KQHA 5AFSA 1GEGA 1H2RS 2CQ1A 1TL3A 3CJKA 4ALLA 1ZI8A 4WA7A 3VR6A 1ZNWA 3VVBA 1U3DA 2NUUG 4MLCA 3IP5A 2ZE8A 4G9GA 1N8SA 3GEDA 2C2ZB 3BB5A 4EYOA 1QIKA 3T1HB 1IAVA 2OHGA 1JR4A 4NE9C 5C7OO 2I6WA 2XHZA 4R7GA 3WWYA 2XLKA 2EFVA 2FHMA 4BNIA 3LGHA 1UKAA 2BFFB 2DPGA 4NRTA 4GMXA 1HA3A 1TRKA 2E1MC 2BCJQ 1GP2A 1R6TA 2NVBA 3QFFA 2JVOA 2O20A 1SQ6A 3GCWA 2GCGA 3IC5A 1WSAA 3MB5A 3HKDA 2JVRA 1IPFA 5JZBA 1PR0A 2NSCA 1R3DA 1RAIB 2IF2A 2AJLI 3WDSA 3ME5A 1U9IC 3NYIA 3P9XA 2HHPA 4JV1A 5IWAF 3PWKA 3HBAA 5CJJA 3I0ZA 4NAHA 5EZYF 3DEJA 3JQ8A 4RA6A 4B79A 2R4UA 1P5JA 3U1NA 4YMHA 5K3FA 1GR1A 3A9VA 3T7EA 1QG0A 1EZZA 1D2EA 4CLEA 4AMYA 2KHDA 3FIUA 4R68A 3JU3A 4BZPA 1QKJA 4L51A 1J2YA 2YJGA 5KFYA 5DHUA 3K0BA 3VOAA 1AMNA 3NPMA 1WOOA 1UJ4A 4U2DA 1OB5A 2XMTA 1ZJJA 2XNKA 1MPTA 2IYGA 1O6FA 3SQLA 2QPOA 5HVNA 2Z9DA 4KE8A 1AA9A 4DJBA 2Y0BB 4HAXA 4RNCA 2ZRDA 1T1JA 3DMJA 5JDCC 2EV9A 5E4TA 4IVRA 1P91A 4EGCB 4J3NA 1K8RA 1W4AA 3IWXA 5DIZA 5M04A 4QQBA 3GONA 2IYWA 5LZ8A 3UE2A 3M9WA 4R8RA 3TSZA 1XRSB 1NUUA 1BUXA 1AA6A 4L8GA 1JXMA 5F78A 4KIFA 4C8OA 4USHA 1I32A 1KBZA 1QBGA 4ND5A 2PXHA 1XB2A 4Y65A 5A6WA 5ENDA 5JNWA 3O1IC 4GOJA 3A6HA 1VB3A 3W9HA 1XCMA 4KX5A 4OZ5A 1Y00A 2QP3A 2BJ9A 5CVDA 4F3CA 2V2QA 1S1WA 3NX4A 1PJCA 2W48A 1RXYA 2F3JA 2F4VF 3PEVA 1NHUA 3IQXA 4F4IA 3HGQA 2OV4A 1E8DA 3SC2A 4WUVA 3AAWB 3MOIA 2XD9A 2FZWA 3OLWA 4QC2A 2BWJA 2YCLA 3MMZA 5ABPA 4EJSC 3ZWMA 1Q7BA 2HCFA 5IAGA 1AJEA 521PA 4TYAA 3TP2A 3P26A 2A4KA 3WXBA 2OWDA 3LP6A 2CVHA 1VBYA 5DTJA 2R3VA 1E1CA 5CA1B 1GPKA 1WHWA 4J0IA 2JDJA 3VVLA 3AY3A 3CF0A 4DV2F 1B16A 2DKOA 2HZ7A 5IULC 2UZ3A 2FMUA 1X9MA 1WMEA 1Y9AA 4BV8A 1TFUA 5EUBA 1V5WA 1P0QA 2GZOA 4FTWA 4CQLA 2E4ZA 3GEHA 5M7EA 3KKPA 3R3HA 4MUEA 1CRQA 2MSLA 3FBTA 5CEJA 1YVRA 1O95D 3PKZA 1RRFA 2GVDA 5DK6A 3TG2A 4ZJUA 2ZD1A 1N75A 1BCRA 2PRZA 3W5HA 3AHPA 1JU4A 2W4DA 2R4FA 3PHCA 3RC3A 5KC8A 2AN5A 4PC1A 1P3Y1 4LBVA 2PXXA 4DR6J 1TW3A 2X6TA 3C6MA 4BZXA 2DNMA 1B8PA 3UG7A 4DWVA 1HR0F 1D6SA 3V4IB 1HL7A 4TN5A 5A1JA 4LJ9A 5JRZA 2HRZA 3LPAA 4F06A 3NMUF 4KR7A 3SEZA 5EE1A 1RVV1 3GFPA 3BAFA 3O3LA 4ZTBA 1J39A 1JJFA 4X24A 5J2PB 3UA4A 4GL2A 4EO6A 4JI4F 1G9TA 2J9XB 1XPUA 5JY1A 4NCJA 1H22A 2WHPA 3DOKA 2C1ZA 4KXXA 4V19J 4PYDA 3DEIA 2FF7A 3PFGA 4NBRA 2QRKA 2K7KA 3QATA 1W7WA 2WJVA 2VQ6A 1F6DA 5ELLA 1P5HA 2JOQA 1UJNA 1SCUA 4I50B 1SWWA 4YB8A 2WVAA 3H3JA 1NJ6A 2DEIA 2DPIA 1MHPA 2X5JO 5H9FK 1E79A 1T5TA 1WKLA 3WNCA 4QUHA 4DVJA 3WLQA 3C3EA 3I2JA 4XXHA 2X8WA 1OBOA 3A27A 4D1YA 2AU0A 3JWGA 3UUWA 1CJUA 5CDHA 1ICEA 1DJLA 5AKXA 2JC0A 3M6WA 4N7TA 3M9MB 2BAGA 4GPZA 3QEBZ 4GPEA 4Q8EA 1Z47A 4O4GA 3ICVA 3R6LA 4DHWA 3FRIA 3F2IA 3G85A 4F8EA 5DHPA 5G4DA 4R7ZA 4YFUA 5DLGA 1QVGR 3W3AD 3OJXA 3QU9A 2E9RX 1RKUA 4FD3A 2C2EA 1EX9A 2LDIA 1WR8A 3TUZC 3KXDA 2XNDD 1T3OA 1M66A 1FSZA 3HKBB 4E5KA 8AT1B 1LV5A 4HDSA 4FBMA 5A5GA 2QW1A 3ZX5A 4BFSA 3QMVA 3BKWA 3KQWA 3RV3A 2F4FA 4DA8A 1A9XB 3MHTA 3ZY3A 1E61A 1EI9A 4URSA 2FEKA 1PG5A 3K9BA 2BW0A 2QJ3A 4WYLA 5AJTA 5I3QA 5FPHA 1LSOA 1VE6A 3TGPA 4U7TB 2O0MA 3IB6A 5GVSA 3OAAA 1QVFR 2CLSA 2OGWA 1RQRA 4TKMA 2AJ1A 4WNCA 4MW1A 3DFUA 4H6WA 3T19A 3S2EA 1XZEA 2GHWA 2BFEB 1RWPA 1ZH6A 3L6RA 4NA3A 3HDJA 3OQ6A 4RNNA 2GIRA 3NOCA 4MV1A 2QFIA 5KHOC 3SIPA 4WK1A 4TWBA 3TSCA 4TXHA 2PYIA 5B3AA 1NLMA 3M81A 3WWZA 3M2VB 3VAJA 2F7SA 2VWHA 1U1EA 5A4JA 5HS4A 2YV3A 3A04A 3B1JA 3EPIA 2FPIA 4FS8A 5D4LA 5J1PA 2JD0A 2G70A 2QMOA 3D4PA 5H16A 3GPDG 4RWWA 2M8DB 3OFGA 2PKYX 4GEKA 1KP6A 3MRXA 1E99A 1U3CA 1J07A 1OTXA 3SYNA 2R1VA 4DJFC 3G96A 4CFSA 2JLXA 1V5IA 3EPJA 1JYSA 2F4NA 1DY3A 3L95X 4CIVA 3V32A 4YRDA 3PG5A 2YJNA 4JJEA 4ZOLF 2XRFA 2Z4TA 2WWGA 1T2CA 2RQCA 4ENQA 2HQCA 1TYDE 3Q6MA 4FLEA 4B31A 2D2XA 1A95A 4KV9A 2FP4A 5BSUA 2HRDA 2B25A 5JRDS 3NNDA 1G8GA 3I42A 4D46A 1XMOF 2D5IA 1BHO1 2BHSA 2DAPA 1PV1A 4BVHA 3RJZA 1UDAA 3SHOA 3PZPA 1R6BX 1C50A 3EIHA 3A58B 3FYTA 1C7JA 2DH5A 3EG9B 1PJ2A 1WW8A 4A6EA 3D64A 1I1NA 1N5JA 4ZHSA 1EM8A 2Z2ZA 4X4QA 1GY8A 4J7AA 2PQ0A 3HVKA 1XZPA 2HS0A 5FO0A 2DTXA 2RMKA 5BR8F 5E2QA 1JLCB 2NSBA 3GV5B 1P7ZA 2C58A 4KKOA 2VFUA 1FL9A 4LS3A 3SNHA 1RYSA 4MAAA 1ECFA 3OCVA 3U4MA 4E2FA 2OXEA 4TRMA 3FNQA 3TEFA 4D92A 1GR0A 5JSUA 3ANMA 4P9SA 1NIPA 4OB6A 1TK5A 4USUA 1A71A 3S1TA 2CVZA 3ZDAA 1OQ3A 2GO1A 1XXHA 4GLLA 3MJRA 1LTKA 3D1OA 4CLHA 3RZAA 1XNQF 4HYYA 3HY3A 5HVFA 1BXKA 3I96A 4YX9A 4B83A 1T29A 3R7WB 2HUNA 2OCBA 4XEHA 3HNPA 1J8YF 4AWBA 1I10A 4UUXA 3EY9A 5KFVA 1L3BA 1CZKA 2JATA 4KNYA 2NR0A 5AWFC 4IFVA 1GNTA 1RCXB 1Z4PX 4BXOB 2QIFA 5FXMA 2C5SA 3ZTSA 4E0DA 5E33A 4KYUA 3OZXA 3D3EA 5I7OA 4UDXX 5HZGA 2IFTA 1UBUS 2D3WA 4FFOA 1KMMA 3KT8A 4ZAXA 5JV5A 4OX9F 4IDHA 1PNVA 2JIDA 4NPAA 4WLVA 1G5QA 3T95A 4JC5A 4FVMA 3AUSA 3TPZA 4AZWA 5DJ5A 3EMKA 3HUUA 3LPCA 1MX3A 2IRXA 1XALA 4NSNA 1CZUA 1AUOA 4IY1A 4BWJA 3UFXB 2EX1A 4EA8A 5IKPA 2GO7A 4QZVB 3S1SA 2TECE 1A69A 5KVQA 2VC2B 5L39A 4OM8A 3DC2A 2I7XA 2IZOA 4HI2A 2H31A 1ZQ1A 5KFPA 9MHTA 3JARB 2DH7A 4MP3A 2A0UA 2PUFA 1ZCJA 2JLZA 5B1YA 2GCOB 2RILA 4D26A 5IJ0A 4E5MA 3WYEA 5I3CA 3D0OA 5JEEA 4IBOA 2YQ5A 3MXHP 4YCCA 3BDVA 4G0XA 2OYRA 4UEJA 4JITA 2FG6C 4CKWA 2XGGA 3QXXA 3OQPA 2CY0A 4WP8A 4HB2A 3ZC4A 4WV3A 5F33A 1CUWA 3QE4A 4M5HA 1T9WA 3ZHBA 4HN4B 1WXGA 4DN9A 3Q0EA 2VZ8A 1ACMA 2VJBA 4WBNF 2ZCJA 2WVFA 1NW4A 3L49A 3MTDA 5C24B 4P7BA 2Q43A 4BNJA 4RZSA 3IBWA 2I54A 3BD6A 1H5QA 1RYRA 3B6KA 4DSFA 1HMYA 2EBGA 4AJ2A 4NX2A 1I0LA 4ZDWA 4WCVA 1RQXA 4QDZA 1PWZA 5I47A 2Z0GA 4RAQA 821PA 2EHDA 3WGLA 5EJIA 1B15A 5I9IA 4E7OA 2OP1A 3V1NA 7AT1B 2X41A 3M9NB 2O52A 2IXTA 1W59A 3DBHB 3OM1A 3WYCA 3ZXUB 1XQIA 3S81A 2XCLA 1RT7A 1YI0A 3NZEA 1HEUA 2Y1IA 3PDHA 4B84A 3OBIA 4JROA 1MLDA 4C6TA 4LF6J 4C22A 5F51A 3D4OA 2J0UB 4BEVA 4BFVA 2DB1A 5EXEA 4QL3A 5HTOA 3MCOA 3U44A 5LMUJ 3UXEA 4ZVHA 4JI1B 2B99A 3HNRA 2FHOB 1U1MA 3OX2A 4M8KA 2ZH4A 1N0VC 5AT1B 4NMMA 4S24A 3S1AB 1EPUA 5D3QA 1S49A 1DKLA 1NAHA 4A8OA 2GERA 4NWIA 4RTOA 2KJWA 1HE1C 3IVXA 4ZU3A 4KEAA 2YN2A 2FJPA 3L0DA 4MQLA 3AFIA 2H1VA 2AHRA 1AYEA 2MLYA 5CCLA 2GQ2A 3TQEA 3DB1A 1ZCFA 2OP0A 2DPHA 1ND6A 1O6BA 4OHYA 4MWOA 3ZD8A 1XO1A 2WYVA 3IHWA 3RIXA 3SNKA 2R1ZA 1YB1A 5HROA 3S2GA 3PHEA 4MK4A 2QORA 4OYOA 1NKVA 1NYLA 4N8EA 2FMTA 4KI0A 1HWIA 1YJWS 5JVDB 2DO0A 4Y98A 4JZKA 1DARA 2IF0A 2MYUA 4Q3NA 2ZP1A 3M2RA 1ZOIA 3LVFO 3V6HA 3G86A 4PLFA 5JYCA 2H85A 1RHRA 3EVZA 1MN6A 1W48A 5DJBA 1WX1A 3RYCB 3Q12A 3Q23A 3CWJA 3U7QA 1QBKC 1BFDA 3CN9A 2WOJA 1U3WA 1V11A 2IEGA 4NONA 1H74A 2FSIA 1EHIA 1LBIA 4WEOA 5FWXB 1W4ZA 2PD3A 5LDDC 1U99A 1QTMA 1G6Q1 1H1LB 3DVAB 3GRCA 3JVUA 3VAIA 1UW9A 2OQRA 1SHKA 2H48A 4YEAA 4QTXA 3IDAA 2DFKB 3EMTA 3AG5A 1B0TA 4L72A 2I1VB 4ANEA 1W1IA 5H02A 3SHTA 1TFRA 2PIDA 3EYZA 3ZV6A 2IXAA 1CE8A 1FXSA 1IYZA 4TQGA 5E9JA 4ECWA 3WGOA 2HW3A 4XIFA 3W8GA 1WL8A 3W34A 1CJTA 3CCMS 3CTMA 3FYUC 1JKHA 1QDUB 1LDBA 3CRRA 1EWVA 3CDAA 4D0LB 4LC9A 2QV6A 1M10A 1SBIA 3CX8A 1KFBB 3TGLA 1SB6A 1RT5A 2IC3A 1VRUB 3NG8A 1YDHA 2Z2IA 1DG1G 1QIFA 1E92A 3DNMA 3QUAA 4LF2A 3PC4A 3D67A 2AZMA 4GR9A 3F7OA 3VNBA 3G87A 1MW9X 2BLNA 4B73A 2PGDA 4U1RA 4HFMA 3ZDBA 2A3NA 1GAOA 1OH8A 3HYSA 1F17A 2C0QA 2ALZA 1QGAA 1VFNA 4IGFA 1WWKA 1W1UA 3T6KA 3S40A 3IELA 3JQGB 4UVDA 2E4VA 3OT9A 4A2PA 3WGJA 2OQ2A 4U4AA 1DC4A 3PYMA 1XZHA 3SXUA 4DV1B 4QDKA 1YQWA 2CNWD 4C0QC 3W9SA 1ECLA 2KQUA 3AVUA 3L7AA 1G5FA 1VZ3A 3HE3A 1Y5NA 3RH0A 2YNIB 2BF7A 4U7PB 3U4AA 1ZBTA 4YCJA 3BR9A 2D4HA 4ZMBA 4EABA 1LX6A 3MQ4A 2PX8A 2NSYA 4DEXA 1J5EJ 3GN1A 5HQ8A 3T94A 3NHFA 4X1YB 4IOMA 2KLBA 3CX4A 1ABFA 1OLOA 4MUMA 1GTHA 3VSAA 1JIVA 4CW7A 3S5UA 4V1CA 2XTJA 3NRJA 3PACA 3RSCA 1XNGA 3I2IA 2FB9A 3CFYA 3NDJA 4ZZ3A 1NK6A 4GHWA 4Y1GA 2H4FA 4GNRA 2PLNA 4UVGA 2WM3A 3OSUA 2HIHA 4MSUA 4FZ5A 4O08A 3T5PA 4OX9Y 1WOPA 1ZZFA 4F12A 5SYNA 1Q0PA 5EE0A 1I3MA 4LXGA 2UUCJ 2GNOA 5JVDA 4NV0A 4UTVA 1T4MA 4LIRA 4YJ2A 1XPOA 4NU5A 3WWDA 3IL2A 2ATIA 3I9MA 4IXTA 4B2PA 5EHZA 2WIJA 5B30A 3WZMA 1G3MA 1AT1A 3CZRA 5FNZA 3HI9A 2DWCA 3SY8A 3BULA 2ZTVA 4U6PA 1HI1A 3HP1A 1BH2A 2BGLA 4LE1A 3E22A 1YI1A 2C2KB 4EPTA 1J2TA 4WFZA 5KNBH 3EMVA 2QROA 4PPNA 2DGUA 3DRYA 2YNHA 3QTTA 3LBIA 3FZBA 5KTPA 3R0VA 1USWA 1YOBA 1U45A 1KO4A 5CT5A 2G1UA 4FQ8A 3G8AA 5KT2A 4F3QA 5FRDA 2DFTA 4O3FA 1PJZA 2VHTA 5GZ6A 2AX1A 2ADOA 5F1OA 3Q3JB 1DAIA 2B36A 4O3NA 3MD3A 4MKVA 3DG9A 2M70A 4ED5A 3SPXA 1VIDA 3KAKA 2RQMA 2YWRA 5AM2A 3DLEB 4ZLJA 3IKLA 1O9HA 4RFVA 4HMPA 4QLBA 2C07A 3PNSA 3FSIA 2YZGA 4CLXA 2DGSA 4G41A 1SM4A 4I0WA 4CI0B 4ZJYA 3ZXIA 3GFQA 2VFSA 4ITVA 2DY1A 4DJTA 1TMJA 2ACEA 3OY2A 1TKTA 2ZAOA 4KXQA 1VQMS 4MYDA 1V6AA 4Y6QA 1P62B 1V47A 3K5MA 5ADVA 4B47A 3GUCA 2XZLA 1KTQA 1TP7A 3TK1A 4JC4A 4Q34A 3E70C 3G0BA 3CRQA 4O25A 3AHDA 2MDAA 3TUIC 3DA8A 4AL5A 3AEUB 4RQBA 4CLKA 4ZT3A 3BBBA 4G81A 3NHJA 1YZ3A 3JYPA 1I13A 4M9XA 4J9VA 3F7TA 3KUHA 4GWKA 1SCJB 1VC6A 3ZGYA 3ZVMA 1JSLA 2J6SA 2DGQA 2K1RB 2KRBA 3WB1A 2P2DA 4HDAA 1O57A 1GCUA 4K4WA 1S1WB 4OCZA 3ONWA 3GCZA 1JKJA 4HNQA 2QTLA 3WMWA 4GOLD 5H1SV 4QBGB 4LFBB 4ZPBA 2NMVA 1VK8A 4DPOA 3KEOA 5JNTA 5KFNA 2I2FA 2F8EX 3CRZA 3O8RA 2MSSA 3DZGA 2GO8A 4EHIA 1IXYA 1PZHA 1L8XA 2G6TA 4KREA 5K3DA 3DBOB 4R0VA 1Y4DE 2B8TA 4UOQA 1X7HA 3L7LA 2ERYA 2AXNA 1KC8T 2ZSIA 3GJ3A 5K0LA 3GFTA 3K9LA 4N6OA 1YXMA 2VFTA 4MQFA 2POKA 5LLDA 2QW0X 5TC4A 4KCGA 2BACA 3FPFA 2QE7D 3TQRA 1RFGE 2FZ4A 3WHKA 1FX0A 5AVUA 4FFMA 4XCVA 4KJZA 4O2RA 1G8AA 4CKCA 3UMCA 1XD2B 1XRRA 4BX3A 1KOGA 1PL6A 1XR7A 5IRCD 1GPAA 3AVWA 1L5ZA 3FDZB 1U1KA 5EINA 4L7QA 4Q47A 4E2FB 1QONA 1N5KA 4JLKA 2QL5B 2VDHA 4JIMA 2A5JA 3O7MA 3HG7A 1C0LA 2PSEA 2W11A 2V4UA 2BZ2A 2C1EA 5P8WA 4IIDA 4IZOA 1J5XA 5LU9A 5EVJA 5B3JA 5A9SA 5IC4A 3N74A 1OOEA 1M2NA 2AKAB 3KYJB 3AH6A 5KTRA 1FYVA 1SUQA 3UDEA 1VMKA 1Y3BE 5IDXA 1BCSB 2NUAB 3L1HA 1WC0A 1USUA 2P9EA 1JQLB 1SPBP 3U7EB 2C5AA 1UK7A 2CJWB 1HR0J 1LVGA 4BX9A 4R2HA 2OB1A 4DSTA 4FIDA 3LX5A 1YITS 1UQTA 1XKLA 4FR5A 1WOMA 1F7UA 2JKZA 5A4IS 1XMIA 4HCJA 2ZBQA 1QSLA 3TECE 1T9KA 1B70B 1PLJA 5SV2A 5L1LA 5DLFA 3F9RA 1ZEMA 3E8SA 1EEXB 3ETNA 1NUHA 4O2BF 1NVAA 5T8KA 1RA7A 2TMKA 3TKYA 1ZH4A 4Y30A 1YG0A 4OAOA 3I4LA 4F9TA 4LQ4A 2VVTA 4F3NA 1Q7LB 3LX6A 3C3MA 2JFKA 1BXRA 5D5HA 3FFWA 3AFNA 2VZ9A 4XFKA 1X87A 1GADO 2H17A 2QRVA 3OE4A 1CB0A 4AZ3A 2IW3A 1XRJA 3GLFE 4E5SA 4GVLA 1U5AA 1UOEA 4LOAA 4M0DA 1FFBA 1N7HA 1L8QA 1AKVA 4GPBA 3BXZA 1N7IA 1S57A 3TSAA 1D2NA 4PO1A 2V3CC 5KFKA 1T3TA 3AHIA 2QA4G 4BGIA 3M2UB 3G2OA 1QSYA 1ZIXA 2RGXA 5EIXA 4ZQEA 4HNHA 3THWA 4HGRA 4RH1A 3ZWQA 1Z4LA 5CMLA 2J5XA 2CMKA 4M36A 4ZVPB 5FPYA 1I7PA 4B3RJ 3G2KA 4PV7A 3LCJA 2MKHA 1EX1A 4ML3A 4B9EA 3IO1A 5HP1B 2AFRA 1CUCA 4IM7A 2CUTA 2R1VB 3UV6A 1ZAKA 3WB2A 1ZRNA 2NXNA 1NFQA 3O90A 3VDNB 3BIWA 5BYAA 3Q0AA 1SBYA 3JRWA 4MX8A 1P8GA 1K7FB 1QE1A 4YRSA 1AV7A 1Z16A 1G5IA 1R00A 3QJ5A 3I0RA 5AJXA 2VB6A 3M6MD 3PL1A 4YRFA 2IHJA 3SF8A 4AJHA 2DLNA 2L9WA 4IWXA 1GKUB 4ESEA 4ZPAA 1TZ2A 2Z3ZA 1LEHA 4GI5A 2C8KA 1NDKA 3VVMA 1KOFA 3L1IA 2VG6B 4DCJB 1VC2A 2EJWA 4W9MC 3PFFA 3HSDA 4CTJA 3MEDA 1VFJA 2ZJ3A 4IIEA 3D7LA 2V5UA 4QVKA 1I6WA 2Q0HA 5CYGA 4OYRA 5AI0A 3DNPA 1T6YA 1A7JA 1USGA 4BNDA 3R5XA 5A4FS 4ZZ1A 3LKZA 3GUHA 3V55A 4MA4A 1J9GA 1XCPA 1H72C 3SM3A 1GZ7A 3QVGB 2XUQA 5IJ0B 1CRPA 1NI4B 3F41A 3QF4B 4RL4A 2NO0A 4LYAA 4K6GA 3K32A 2WVCA 4ND8A 4QYZK 3U4DA 5JWRA 1VP9A 4WXEA 4CCYB 4INAA 1MPXA 3ZXXA 3QFSA 2ZZMA 4K87A 4YUWA 4G1EB 2C84A 1WXQA 4RUAA 4LNAA 2WRMA 5LWHA 1FVQA 1BX3A 1CC1S 5H9WA 1H0HB 2WU3A 3PRHA 1U0BB 4LJ6A 1RJFA 3C4QA 2MGZA 1CY4A 1REQB 5EXSA 2EKLA 1IBLJ 2IHYA 2O1SA 4Y9RA 4OX9J 2AH5A 3QWPA 4RKFA 2Q3CA 2ZVPX 2QMYA 2XUIA 2QXYA 4GOMD 1GL3A 4USMA 3B1ZA 2C3MA 2Q6LA 4YALA 5MF6A 2PDAA 5EIFA 1DV1A 1JG2A 5KFFA 4BECA 1LH0A 4L27A 1KYVA 4P4UA 1L0BA 1MWQA 1UBRS 1NLZA 1P31A 3DP9A 5J2NA 4C97A 1XVTA 5ALPA 1W88A 5DGCA 3RIMA 2GJ9A 3IFEA 1W4LA 1M1UA 2VF7A 4IV8A 1KE2A 1PFGA 5A04A 4TL7A 3RASA 1Z37A 2PD4A 1OX6A 4E5PA 2PGXA 4DCUA 1DFHA 4YI5A 3JXOA 4RVFA 2YMMA 5CFZA 2CLCX 2QF7A 2YBDA 2ZVQX 4QHYA 3TO8A 1SC1A 3HKDB 3UJNA 5B55A 3GFGA 1J5PA 3LQFA 2ZSAA 2N9UA 3R75A 4PLCA 1SOUA 2EJTA 5BNZA 3DAPA 2W6OA 1KKMA 3QKSB 1RKJA 4GRDA 3HCDA 1CJUC 3N7AA 1FQJA 3ICWA 2FZLA 2L41A 1GN9A 1ZUNA 2ZXFA 5HDQA 3DV2A 4Q01A 1I0IA 2W37A 1TT5A 4KN6A 3C66A 1EQUA 1RT5B 1RAHB 4TZ0A 3ZTOA 3DKKA 2GVDB 1M0EA 3AF0A 4KO4S 2YXBA 2FH5B 3LCRA 4J1NA 4RV4A 2EDAA 2AGVA 1PO6A 1WJ9A 4TZ6A 2IRYA 2WF7A 3GRAA 4H3VA 3K6SA 2O01C 4BTVA 3MXOA 5EWLB 4F50A 1YCHA 2VRBA 2NNLD 1Y5LA 5F12A 1FX2A 1EJ6A 4UCQA 4Y2GA 5AM1A 1EUZA 2P27A 4MI3A 5AUQA 3T5DA 1T8WA 3RR2A 3C15B 3KMQA 4TQSA 5BXQC 3B54A 4RZIA 1IULA 3B53X 1R5OA 2CFIA 5LMUB 1SVDA 1QK5A 3KQUA 5BR4A 2M52A 1YOVB 4DPXA 4RA9B 1IOLA 1JZTA 3FLBA 4HQ0A 2IS6A 1RXVA 1MT3A 4O6VA 2VJLA 2HGSA 4EEYA 5G3YA 3U4QB 4HKTA 2I8CA 1UL1X 1GTSA 4I7FB 5JOQA 1CPYA 1EAMA 2OD2A 3AJAA 5C1PA 5I8PA 3TXYA 1XE3A 2H3EA 2ZE7A 5B36A 1AUDA 2MTBA 3NHPA 2OYSA 4MVJI 2PEZA 3RGGA 4HWPA 2DX7A 4MI9A 1ZL2A 4IHJB 4DCGA 3QU2A 3I34X 3RYFA 3HFVA 1WP4A 4LV6A 5JJBA 3EPHA 3VZQA 4Q9LA 1Y42X 3NAIA 3AGPA 2OE2A 1WC4A 2XDAA 4MWGA 1D03A 5BNIA 4K1XA 4XLTA 4HN9A 3UAGA 1FRFS 1SULA 3JVEA 2W2QP 1CJMA 1UDRA 5DLDA 4HL6A 5IMSA 1EFPB 4BKMA 2R751 3NGRA 1YDEA 4G0MA 2YKNA 5CG2A 3SS9X 1OWNA 3H16A 3EJMA 1IJFA 4TRRA 2WD8A 3CMAS 2CQCA 2PYZA 2E37A 5B7PA 3AO0B 1ZUD1 4FJ0A 3K20A 5A4DA 4QUEA 3SYTA 5F7XA 4Y2TA 2QRQA 4JIGA 2YIVX 1FDRA 3B1KA 2GBCA 2RJZA 3N6RA 2HLTA 1Y7HA 2XMMA 2XEXA 2VDQB 3CO9A 2QC3A 3PYDA 3AEQB 4C8KA 4YMEA 2BEVA 2Z95A 4EKGA 3KJFA 3UWTA 3HDHA 2V1UA 3RTEA 3FYSA 1SVMA 3OSPA 4JI8F 3G0CA 2DGXA 3PIIA 1XZNA 5EN1A 3DTTA 1FDSA 3T61A 2WQ7A 1JHXA 5DN9A 1BA3A 4CLPA 5C52B 4DXLA 3LSTA 4D81A 1RI5A 4IG9A 3S2YA 2HA6A 3MERA 3JQPA 3IP8A 3DOLA 4ROTA 2QV0A 3UT6A 1UKBA 2ERXA 3RRHA 4AQYJ 3GB0A 1EFRD 2P9BA 1EH5A 1E89A 2HO5A 3I53A 4FHDA 2KL8A 3GEBA 4Y6GB 1YCDA 5FIUA 2BANB 1O89A 2VAWA 2HEGA 1QYIA 3BHNA 5C3MA 2OG1A 4CT0A 4RMNA 4Z1OA 4LBPA 4KOAA 4XVRA 1OKKD 4A5OA 1MGPA 1UEJA 3LGSA 3INRA 1MEEA 1RLJA 1VI6A 2WKRA 3GJSA 4TLBA 3S2SA 4EI8A 5BVGA 1G9XA 1KERA 3H4MA 1IXSB 1ULBA 2GM9A 1RWWA 3QO9B 2C8JA 1U0FA 4BAUA 2ZT6A 3LXUX 1RWOB 3E8MA 4M1YA 1VKJA 2YOGA 2ZBRA 4NCIA 3VHRA 3M2TA 4ES1A 2QTCA 1NI4A 1HBOB 3GT7A 2HRRA 1IXZA 1KHHA 2WJHA 3LVBA 1OREA 3K0JA 5HIMA 5IKMA 1GCIA 1L4KA 5TPWB 3HYTA 4W5RA 1OO0B 4ARZA 1H2HA 4ER3A 2MR5A 4MVJA 1N0UA 4FGKA 1X7DA 4RA9A 4JLDA 1UL3A 4X8MA 1SJFA 1VHWA 4LPKA 1SAYA 5T7BA 1TZ0A 2CHVA 1FB5A 2NNWB 4DUZB 2HVHA 1CNEA 3OCZA 3RWOA 2GGSA 4BMSA 2FVXA 2GS9A 2YV1A 3K5LA 3DC7A 1YRYE 2HQIA 2Q6TA 1U1DA 2R6DA 3LT4A 1J0DA 3BKFA 3G8YA 2PO4A 4RBTA 2VSNA 4YR3A 5I3PA 3S0JA 3HXLA 3G23A 3RYFB 2H7VA 3FMPB 5EVCA 4MQBA 4B7ZA 1YL7A 4K9OA 3EXFB 4LHWA 2KT3A 3EC1A 1KNZA 4L02A 1PE0A 1H8HA 3HJTA 2J7KA 3RC7A 2V65A 3E48A 5TB5A 5JFOA 3UPFA 1OI4A 3PO4A 3G2MA 4DS5A 2XY5A 1NJFA 4KRWA 2XWXA 2P3QA 1DP4A 2NZXA 4QQRA 2I6TA 5D1HA 3OPYA 5DM0A 1TQ6A 3WGUA 3EFOA 1JMKC 2H06A 3V1LA 3K71B 5CVVA 4NNPA 1CUDA 3SEAA 4DRXB 2WHQA 3MOSA 1RAEB 1O6CA 3FZ2A 1YQQA 4KQJA 2ZYGA 2C20A 3ZNOA 1Y82A 3LC1O 2Q6CA 2FQQB 4GRIA 2LQ9A 4GGPA 4E32A 2W7OA 1KI2A 2A5GA 3E9YA 4LHZA 3IIEA 2OPQA 2QTHA 4JUCA 1EP9A 3KV1A 1M6EX 4JVNA 3O91A 4CM7A 3HDGA 3TFQA 4AE5A 1IR1A 4KBYA 1RXCA 5FI5A 2PCLA 1AUSL 4LDNA 5GJVC 1G21A 1UZLA 1TK8A 2IBOA 4UZEA 2YHSA 5J2NB 3DL4A 4DLTA 2HU2A 2RK3A 1JECA 1EAYA 3U56A 4NASA 4BQNA 2AN1A 5AI8A 3WMGA 1N5TA 4ZLPA 2V69A 2ZUVA 4U8VA 3V1UA 1Q0ZA 5FWXA 1CR2A 2AZXA 4QSHA 3MAGA 2O0HA 3RYIA 1TV6B 3W3AA 1JLBB 4V0NA 5C25B 1A98A 3RAQA 5BUZA 4YRZA 5AUNB 4E1BA 3ETLA 2ZH1A 2VXCA 1WIWA 5AW2A 2MKCA 5LBTA 1ZXBA 1N25A 1LXJA 1DKUA 3B8HA 1H7XA 4WK2B 1JJBA 3EXHA 3E61A 1IZZA 2A0FB 2GBFA 1AC5A 3WICA 4CUZA 4B45A 4L5BA 5HS6A 3T4XA 1ZITA 3WQPA 3UJ6A 3OCWA 4E11A 5J1EA 1MROB 1QNFA 4UUAA 3L0ZA 1YSJA 5IWAJ 1R0ZA 2FX3A 1VPEA 4Q3EA 2IY5B 2CCKA 1NG9A 5F5XA 5DI9A 2G4VA 1ZGZA 1CFJA 4F4AA 4K5SA 1XWIA 2PK3A 3V6MA 3FSYA 1ISPA 2HJHA 5IASA 3KXPA 5DCYA 4M94A 1KI6B 1ZU4A 1EKXA 3IVAA 5JQGA 4QGGA 2G4LA 3OA0A 5K99A 3DYAB 4FU0A 4PHGA 2FI1A 1IIRA 4P35A 1U7PA 2IYQA 3C1TA 4D41A 1P7CA 1KU0A 4G4SP 1IM6A 2PMBA 2XBLA 1C0KA 2QUIA 3GEEA 4HXGA 5J9FA 5TQ0B 5BN1A 4ZHQF 4D45A 1JK9B 4ED8A 3V3KA 1WUUA 1JYEA 3ZNPA 1E2BA 4RSMA 5HQJA 3GP3A 3QF7A 3FWZA 3QX9A 1J0EA 1NZAA 2VEDA 5F8IA 2XZTA 1UPPA 1HZZC 3NJRA 3CT9A 3VJRA 3DTVA 3QVSA 3EIWA 4NE9A 1K27A 3HR8A 3OUYA 1RHKA 3RG6A 2GYWA 3T99A 4DNPA 2QMWA 2J9FB 4H4OA 4YAFA 1AN0A 2W1BA 1SL2A 3QY0A 3FVWA 5JANA 3ZBTA 2YYSA 1MVOA 3MRTA 5DU2A 3BZQA 4NS1A 1S2GA 3G71S 3TTSA 1DX9A 1N48A 2BKXA 4PNPA 5B4UA 2PT9A 3GG0A 1HYGA 4RGYA 2N4CA 3ZWXA 2QT0A 1TKZB 4NAUA 1JLKA 3ITEA 3A3NB 4QD3A 3AFGA 5A3RA 2FWRA 2V4JA 2C7BA 3LUKA 4MWCA 3E3MA 4ZVOB 4PM4A 4W1RA 4ZVOA 1Y8RA 4J9QA 1DTEA 5IDYA 2HHQA 2I1QA 1E6VB 4CMIA 2PV0A 1L7AA 4FZVA 1XN4A 3BWCA 2ZYHA 1CJVB 3C8DA 4BV3A 3IBCB 3ROXA 3LY5A 4MPDA 2NZ8A 1GZ6A 1K68A 1HNZJ 4D9BA 1Q84A 3QM1A 2QQFA 3HZOA 1Y9DA 1MJ5A 4FOOA 3UHPA 2V6GA 3PRJA 3HHLC 4PG5A 2GQQA 4F9FA 1YUMA 2CLEB 2FJUA 1WLSA 5IVIA 2L3MA 4E30A 2HL6A 1GHTA 1XJ0A 3PC3A 1VJTA 1EGAA 1C9MA 3O84A 4FVTA 1U8WA 2RHDA 3UH1A 3BO4A 2OD6A 5B2FA 4EJFA 4YONB 3LS2A 2PH7A 2VYFA 1XK7A 2CA9A 1FYFA 2VYVD 1S72S 2MY7A 1FEEA 1CERA 1SKBA 3QZ7A 2WM9B 2Z5GA 3IDSA 3V33A 1ORTA 1C1DB 2Z8YA 2HJGA 4JJ7A 1QYVA 3KK2A 1HUQA 3BXPA 4R6XA 1C1BB 5I4KA 4FKMA 2BJ7A 3B9PA 4QECA 2L0XA 1TPYA 3F6PA 1GKIA 4ECAA 1IFXA 3VPCA 1R7IA 3OCXA 1Y1TA 4IYJA 4ZT5A 4Y0VA 3RANA 4YT8A 3C7CB 4KHMA 5D84A 4RCVA 2RRNA 3K05A 5HK8A 3NL0A 3NIWA 2LWIA 3SSMA 1RRGA 2BZSA 3NBFA 2XKJE 4I4BA 3MD0A 3FNBA 4OLHA 2A14A 1CVJA 5KG5A 3CG4A 2VJKA 2JLCA 3K6RA 1R15A 2ZJFA 1EK2A 2GLTA 5IKOA 2B78A 4C88A 3I4HX 1KETA 2B69A 2RGWA 3CW2A 3EVNA 3UK2A 1S1VA 4Q1CA 3ZH2A 4L57A 1VS3A 3E2EA 3WRVA 4MQ4A 1XRNA 5TR9A 4I4LA 2DOKA 2JFXA 2DR2A 3G1TA 2DLCX 4LQ3A 3FDJA 4BB9A 5B7NA 3OR2B 4BLQA 3PX3A 4LJKA 2C00A 1PD1A 4XEUA 3B6MA 4FEAA 2OLJA 3BJRA 3GO4A 1IVYA 4WIQA 2P1ZA 1O5IA 4UU7A 5E7JA 2QQEA 5GGYA 1G8HA 4TQRA 4R41A 3HYRA 3FNRA 1RU3A 3DDCA 3Q8KA 4CLSA 1F2VA 4IRMA 2VJQA 4TQAA 1BYIA 3OPKA 5IBCA 3CNLA 3ITNA 2O6HA 1R6DA 4D8UA 3F7NA 3IMCA 3BS9A 1A1VA 3RNOA 3AKDA 2UUOA 3SIPB 3HVJA 1SNYA 4XIGS 1X80A 1HMPA 4IXMA 2OZLB 3I9V9 2CVIA 4EECA 4GKKJ 2D2VA 4QFMA 2H2FA 1XC9A 1RXUA 4REOA 4W1PA 5D3ZA 4ZCMA 5JXIA 5JDIA 1F2GA 3DEZA 4LTNA 1DV2A 4DR1J 4ZEOA 4LY3A 1F2DA 4MRNA 1FDDA 3RQIA 2Q2QA 1E98A 1XUOA 3MJVA 4U2BA 2XD4A 4A48A 3DFMA 4QBUA 5DXAA 5FTMA 3OP1A 3X3HA 1Z5ZA 1WG5A 1N5YB 4D0SA 1DX6A 2CV0A 4UQGA 2GAOA 1K44A 2IGBA 3E9CA 1L4EA 4DR3B 2MZQA 3KZMA 3BWVA 4DNFA 2OSBA 4YRNA 4TV8F 3JQ8B 4RA6B 3RFFA 4LVOP 1OFIA 3U3JA 4FDLA 2WY2D 2HTEA 1WOYA 3QWFA 4A27A 2JCSA 3IRXB 1L1FA 4IKAA 4LRUA 1NWCA 4D6YA 2JRLA 4K9QA 3T1YF 3JQ9C 2X8AA 2GSWA 2H9AA 4OYMA 3SE0A 3AI1A 3WR5A 3DMJB 1I4DD 1QUFA 1ZMBA 3A4NA 3H13A 5ED4A 1ZUWA 1A9OA 2GJIA 1ZYQA 1FU8A 2L19A 4UXIA 2WZQA 5BYBA 4IIFA 4DIFA 2Y1RI 4EY7A 1GMVA 4MZXA 2WYUA 1Z0DA 3TVTA 4G24A 2JFWA 1ISSA 1SOMA 4NCKA 1FRIA 2I2YA 4DFPA 2ZDGA 1N57A 4MGYR 4EGQA 2GDZA 1X4CA 3U27A 1TM3E 2WP0A 5KVSA 3I87A 1UAGA 1T2VA 2LLZA 2G0TA 4WXYB 2NV2B 1JSZA 3N0XA 2PKCA 1T5SA 2FR1A 5G2OA 4CQ1A 2GNPA 1KVUA 4NA2A 1VPVA 1TUBA 4S2EA 4KQCA 2WWXA 1Q5VA 3VNQA 2MKSA 2P2CB 1UTAA 4LIPD 3N2GA 1TJ5A 1S77D 4ESOA 2OORA 3V8MA 3HHDA 1GA4A 4GL4A 3UN1A 1PTJA 3EX7C 2FGKA 2WFLB 3TCNA 3KHKA 4XQEA 3H1EA 3I1FA 3F1KA 2AF4C 4RPFA 4B7UA 5E3QA 3K1AA 1EE9A 1B3BA 2Q9UA 2VNHA 5IYZA 4WNAA 1K7CA 4UATA 3T3HA 5KDDA 4RORA 3PQEA 1AB8A 4LGYA 1VIXA 1KVJA 2RDIA 2BTQB 1TEHA 3GPLA 2IS1A 3OZSA 4YO8A 3ZK7A 3LC2O 1HL3A 2XBMA 3UMFA 1AOXA 3DZIA 2BMVA 3B3JA 2P3SA 2OP5A 1UOPA 3BOSA 3GFRA 1FZTA 4FBTA 1V95A 5FFFA 2O0LA 1U2QA 4TVKA 2GN1A 5KTQA 1VQKS 5JO9A 4UEKA 5JRJA 4IH4A 4RIHA 2J8SA 4CRWB 1HYEA 2COKA 5KYTA 3G49A 4LOHA 1YRHA 2PLWA 4UJ5A 1G1AA 2RAVA 5J23A 1H73A 3N07A 4GT1A 4MW4A 1M1KT 4ER0A 3FTDA 4TLCA 3GNLA 3JYTB 2Z6VA 1ZU5A 5G1PA 2HQDA 3PRKE 1YFZA 1OYEA 2Z9BA 1BMDA 2PANA 3R8YA 1JG4A 1JA9A 3ONDA 3AODA 1ACLA 3PG9A 3WK6A 1PJLA 2XMGA 1V5GA 4LW8A 5ICSA 3DF9A 4EKIA 2QTFA 2CVQA 1RHJB 3N2KB 3CVJA 3G9TA 1SV5B 4Y1EA 4QOSA 2XHEA 1AQUA 1GPH1 4LF7B 2XUZA 2W0MA 1JILA 4KP7A 3W5UA 1G7RA 3M82A 1XP5A 4UVIA 4S12A 2VPWA 2ASEA 2ECFA 3AHGA 1NB7A 4BNZA 3QOWA 1UFKA 4TWJA 1NQAO 1ZHFA 3TD2A 1T1SA 4YMSA 1H98A 4I6GA 4ECXA 1VBKA 4C5CA 2B3TB 3L9ZA 3U0VA 1C8BA 5ES3A 3FGVA 1Z82A 3X1XA 1YB4A 3NWGA 4PRKA 3TZ6A 1UWCA 2WMOB 1P39A 3O21A 1SO8A 3ZNUA 4ES3A 4O2LA 3W9IA 3L05A 1JEDA 5FCDA 2FVPA 3H5IA 1LBQA 1IKYA 3PDIB 1QZ3A 1TF2A 2QSZA 5E4YA 2CMDA 1E3IA 3FGPA 2EQAA 1XTTA 4J0GA 1PT5A 2G9NA 4LF6B 3OSZA 3KWMA 1EWTA 1SOAA 1ID1A 1QO0D 1LPSA 4EG7A 5GM2A 1KH2A 3KPUA 2QSUA 2C83A 5CLIA 3BJEA 3DJYA 1OAKA 5IDWA 4NCHA 4X85A 1XR6A 4PAAA 4J1SA 2FE4A 4D4MA 2C2YA 1HDXA 3ELBA 3EZ7A 4Y00A 1TMOA 4CFZA 2CSUA 3GLVA 1DKMA 5LD2B 4NXNJ 1WB5A 5K8JB 4PVCA 1M2FA 3NCQA 4NZZA 4GGOA 3OQOA 1UJMA 4EHNA 1RWNA 2Q5IA 1JLCA 3JYLA 2CCJA 4PYAA 2WWWA 3UAZA 3RS0A 1R64A 2PZJA 1FPMA 1Y3CE 2FLKA 3ELWA 1EGQA 5C7YA 2W98A 4ZA2A 1UANA 1G5RA 4OGWA 4BNGA 1PDWA 3ONNA 3UGKA 3WOVA 3K9HA 1R1DA 4KGVA 3E7XA 1CRLA 1UBHS 1J27A 5HR5A 2GHQA 4ER5A 3MM5A 2JGRA 2G7MC 1HFEL 4JJFA 3OJSA 2FUG6 1XLVA 1X9SA 3DHYA 1W88B 2FDXA 3H6GA 4XJTA 3HZHA 3FBCA 1B2RA 1HIYA 2GVZB 4YHHB 4TSRA 4RGBA 1AE1A 1N8KA 4BO0A 4WZZA 1U31A 2XYVA 2K2PA 3ROMA 1FS5A 5I9NA 4BOYA 1UBKS 4MVCA 3ZBPA 5CDFA 1TL3B 1Y7PA 3GY0A 5JYBA 4JOQA 2YFKA 4BP1A 3GLSA 4AQYF 4G67A 2YASA 4X65J 3R4CA 3D6HB 2EF0A 1CJCA 3UHAA 4DT1A 5F3RA 4FI3F 3C6TB 1JXEA 1OA0A 1M8PA 1GEHA 4WRRA 2VXOA 3RAFC 4ZC1A 1ILWA 2XADA 1L5FA 4RAOA 4B85A 3DLBA 2PKQO 2ZJRQ 5A6SB 3CC4S 1D2GA 2EVWX 5MGNA 2YJ4A 3OKAA 2AR7A 3RAPR 2QYTA 1LC3A 2V2KA 1T5LA 4CKEA 3IBGA 3VPHA 2HRBA 3MGKA 4DPYA 1FK8A 3EZ9A 1YJBA 1MA0A 2HRYA 3I6ZA 5I7WA 3CM0A 3R3UA 1LQTA 3DO5A 2YWFA 1JJ2R 4PQRA 3FVRA 4BTEA 1IBMF 3ZW9A 2BFDB 2GLXA 3PD7A 2DT8A 3R6TA 1FWKA 1FKOA 5EHGA 4WJZA 1Q1GA 5LM3A 1T9TA 1UDCA 5DWVA 4C6SA 3D3QA 3CX6A 4K7JA 1PFUA 4CYUB 3HB7A 4K46A 2RGCA 1ZHOA 1L8OA 1FZQA 1ODFA 3DLGA 1XA4A 2R6FA 2ZEJA 3VGSA 4I0WB 2WZDA 4ZICA 1HK7A 1MABA 2OXTA 3Q9SA 1D5CA 2LQJA 4J9SA 4OXYA 1JHYA 4LY9A 4EHFA 2FUKA 3PV0A 3GVXA 1JFRA 3PX4A 5TMEA 2BMFA 5F5NA 3KD2A 3KPYA 3FTQA 2X42A 3MB8A 5KQRA 2QX8A 1Z7WA 3B36A 2FUEA 3ROPA 4RV5A 3KK1A 1F8FA 2Z30B 1RTJB 3L43A 4K26A 2HD4A 3N8KA 4JLWA 3RROA 5CFLA 2GJFA 2O6LA 2GXAA 3IGFA 4MW7A 1KJ9A 2Q8NA 1QIHA 1N8RT 5TGTA 4DCPA 3VF0B 2G1HA 5A0YB 2YY3A 1G6KA 4LUBA 1U28C 3DHVA 2JI4A 1JQKA 3DOOA 1X5OA 1TL5A 2A9FA 2FPOA 2WE7A 4FNAA 2QJTA 1P5RA 2P9JA 2OO5A 4DV0J 2JF0A 2R84A 5CT8A 5DBEX 4RR5A 1NC3A 1HYQA 1NRXA 4OB8A 3N6XA 5LA6F 1EMDA 4MS4B 4ZVVA 2QY9A 1I4OA 4G6VB 4JI4J 3KJFB 4Z99A 4KAIA 2XMVA 1Z2PX 1YR6A 1QOQB 2BY4A 5A3SA 3FA2A 2HNBA 1SK8A 4NBTA 2IBSA 1AD2A 4JVMA 3BT7A 1VLVA 1IVNA 3ZI7A 4NOMA 3OQNA 1QQTA 5TQVA 1U1RA 1YCGA 4RW6B 1IU9A 4G0OA 1C3EA 3FMBA 4IVNA 5E3PA 1QKKA 2PH1A 5AJUA 1DRKA 4GW3A 3O03A 3FMIA 1J8MF 3G4SS 4L50A 3PJWA 4DBVO 2BM8A 1CUVA 1TAHA 2BUNA 1DURA 2C3YA 4BNXA 4IILA 2V7XA 8ATCB 1DUSA 3EC7A 3TTTA 2UZ0A 1RAGB 1PVOA 1N36F 1XZDA 3R5KA 1AT1B 5A71A 1WC5A 1KGDA 3DDZX 1SKRA 2AX0A 3ZQ6A 3I01M 3P2JA 3PXCX 1TYAE 3DMPA 4ZQIA 1SCKA 4Y7CA 4KPYA 5CBPA 2Y2VA 1RYFA 5EZYB 3Q2OA 2BMAA 4ZT2A 3H1GA 5HQ3B 1W34A 4TNOA 4NYZA 2CD9A 3NVDA 4GO1A 2GIFA 4TV9F 5A8RA 4DQSA 1GH8A 4AN1A 5AOBA 1P0PA 3K0HA 2EFJA 2CDCA 2EFOA 2Q4OA 2XMCA 3PJEA 2Z3WA 3O4GA 1Z5UA 2JH8A 3MPUB 3C87A 4XB2A 1A76A 2Y6VA 3AUYA 3VAZA 3DOKB 3ECCA 3D4BA 1YS1X 3LDAA 2C2GA 2C4UA 3PGKA 2MY8A 2AD5A 2O2DA 4BO9A 1YKGA 5IEJA 2OO5C 3DAHA 4LJYA 2PM8A 3DKVA 3GC6A 3GPIA 1CQWA 1G17A 5AM3A 5GONB 4OHUA 4RK0A 5DM70 3A3OB 4HAYA 3K94A 1HPZB 3G88A 4MKXA 1TMKA 2NN3C 4ED3A 3PL5A 4W8HA 4A10A 2BDTA 2OEMA 4OQDA 1Y37A 3OUYB 1JDTA 4ZVGA 4LHVA 4QARA 2VA9A 1PAUB 1XR3A 1NZJA 4YOEA 5KYUA 1OY1A 5F7OA 3PCRB 1ADYA 3OQJA 3D0RA 1SH0A 2L2QA 2VQ3A 4OG2A 1ZD3A 4XK8C 4EUFA 1IAQA 2IAJA 4TMKA 3F2VA 1V6SA 3EVGA 4HX9A 4CR8A 4K0KB 5CYQB 1ATZA 1QAIA 2OCKA 4Y2CA 1QMGA 3ANSA 3HFJA 3MLEA 3T35A 3QITA 1ZVMA 3ISND 5KU7A 1EVLA 4HQKA 4QBFA 3DYIA 2F9DA 4ITUA 1NVGA 2DKOB 2NQTA 4FFBA 4YJ3A 4M5LA 4KFUA 4YJ3B 2EBHX 1LXNA 3TZHA 5EX0A 4RQUA 3Q22A 1GVHA 2ZYWX 4GKJF 3OF2A 4JZYA 5LSLA 3KT3A 3ZS9A 4X20A 5JSYA 3LANA 3EWIA 1FQWA 1MRSA 5B58T 1XVUA 4MV7A 2QKYA 2RH4A 1HWJA 3EGDA 2OORC 1U1IA 5DYWA 2WMNB 3BZBA 4X6XA 2V74B 3TM5A 3M8ZA 5IKEA 4TYQA 1QM5A 1Z6AA 3OZGA 1TAGA 1IMJA 1YK1A 4OBXA 4MVJP 4UCXA 3K0CA 1SJ1A 3OLXA 3INNA 1ZX1A 1LXCA 4FDVA 3WQRA 2H0AA 5DNUA 5THXA 4MMYB 2DK2A 2CBGA 2CXQA 4ENWA 2IVFB 4IFTA 2MSTA 2CZGA 2IW1A 5FEMA 3ROFA 3HM9A 2WQZA 5IMBA 3L7BA 2P4EA 4X54A 5C42B 4JL5A 1V4NA 2BGMA 4DR1B 2GZDA 1KZ4A 1XZQA 1D8AA 4HWTA 1PZNA 1TF5A 1XMPA 3R5JB 3ROTA 2M6SA 3KK2B 1KJQA 1PR1A 1GEEA 1MRZA 2D59A 3DEFA 4RH0A 1XDBA 2FSFA 3RRKA 4H0FA 2ILTA 2PT0A 1JI0A 2EBWA 3TPCA 4LSZB 4MWBA 1CUAA 4K6FA 1J21A 1J20A 1U11A 4QFDA 4FX5A 4XDHA 2A5LA 1MAHA 2V7GA 5ARCA 4IOJA 1Y5RA 1F5SA 3V8RA 5CXQA 4JJZA 2J32A 4TLQA 1AZLA 1TKCA 3H5LA 2REQA 3N5KA 4W5JA 3AD8C 4Z49A 4P7VA 1Y6JA 4N3BA 2B2XA 5JDIC 2HI0A 3ZHQA 1CULB 2EPIA 3NCRA 4ID5B 2K3IA 5FTNA 3H4VA 4Y2QA 3GEMA 3BE4A 2FCRA 1OXXK 4IO1A 4YP6A 5L7WA 1YC5A 4NENB 3OO1A 4LSGA 1Z56C 4A3SA 3TL3A 3SX0A 4DGSA 2A9JA 3GU0A 4EKYA 3IILA 4EEKA 3V81B 3MMBB 3D54A 1K47A 4ETZA 4N8SA 1Y6ZA 3I4CA 4HVZA 2N4DA 2FW0A 1SVIA 2VLIA 4WP9A 5JH7F 3GLIE 3GCDA 2PBLA 2OY0A 1BO6A 4RK7A 4UNNA 3QFCA 4EF4A 3CLSC 4MB2A 2W6JD 2V4ZA 4LQLA 4E3WA 3A1UA 2ZIUB 4ED9A 1S6UA 3MBKA 3O6QA 3R9XB 4F2SA 1VPLA 1NU6A 4F1KA 4EA7A 4PHTA 4Q7QA 3AR4A 1X9GA 4K40A 3ACBA 4Z4HA 2B2CA 1C9YA 3KPVA 2CVPA 1C0TB 3PEHA 1CXZA 2HGNA 1UEUA 3WKCA 2ODWA 1Q92A 3TQIA 5JLJA 1LDNA 5MN5A 3H18A 3DOUA 4ZVUA 4JBHA 4MCIA 3DZCA 2FHJD 1SUPA 2JIPA 2ID7A 1K6IA 3M4JA 1QU2A 4CLDA 4QELA 4WKPA 4IGKA 1EM6A 2I3ZA 4HQLA 2EKDA 4LF8B 4P0PB 2YINC 4Q1VA 3QKSA 2Z58B 2NPOA 3U80A 5CVJA 1XYVA 3CF4G 1NULA 4TV9B 4LXQA 2HBQB 2VNJA 4U0KA 5A2GA 4ZQCB 1KN6A 2AI2A 3QVVA 4N48A 4QZVA 3WDOA 2J7UA 5HM8A 5CLJA 2P68A 2CXEA 4GKKF 2FLLA 2BFCB 2ILYA 3MGCA 1HI9A 1OB2A 2UVDA 2OL4A 3Q85A 3UF0A 4MJLA 1NJ5A 1JHRA 1RZRD 2AC2A 1Z22A 5ALJA 4L4YA 1XTKA 4CYMA 5FR2A 5LQCA 3WYDA 4CLFA 4HXYA 1O0BA 3NHKA 4LR8A 1CDOA 3DI6A 2VPIA 3P9IA 3O8NA 1BQNB 3N8NA 4CLUA 4DLGA 2JK1A 1WD7A 4RVGA 3LWMA 2OJ3A 1UCNA 3EXHC 3F47A 2W9BA 4FIZA 2J9RA 1PRYA 3GLIA 2H57A 4KO8A 2BR0A 4F26A 1AS2A 3RFUA 2WTNA 3EDQA 2UYYA 3C8ZA 3PLAE 2YNHB 2OAEA 1IKXA 4WHMA 1MIOA 4EX7A 4WTOA 1M2JA 2OHFA 1KLNA 4FF3A 4IF4A 4RF3A 1DHRA 4XH9B 1ZA1B 4S1VA 4HK4A 3A9WA 3JQAB 3UK1A 4IDCA 5CZVA 2CG8A 1J0AA 4HWOA 1EQAA 3TIIA 1NMQA 4Q3AA 4ZO8A 2PSHA 3GDFA 2G80A 1L7NA 1W5SA 1PX2A 1B0PA 1FP2A 2BEWB 4UARA 4H0NA 1VDMA 4YDQA 4ZO9A 4RJJA 2Z1NA 1EG2A 1ZGJA 3V7YA 1JR3D 1QE5A 2NT3A 3EXG2 4AAYA 4GZ6A 5FO1A 4AO8A 3OLBA 5CM8B 1TVEA 1Q7CA 3GYXB 5AXMA 1RRPA 4OXQA 3VV2A 4EO4A 1HHQA 2VUTA 2BGIA 4ZEWA 5BSWA 1A77A 5HOEA 5CFOA 1ZSNA 4ZA1A 1FU7A 1GPMA 2ZAGA 3EEBA 1I94B 2ZIGA 1MB0A 3ZX4A 3AP3A 4XQ0A 5H3LA 3D5TA 3HB9A 4CQMA 3ZCRA 4RPGA 2EWVA 1VMAA 1YZYA 3WTCA 1HT3A 3KLGB 2HV8A 5KNCH 2YRWA 4M37A 4NDNE 2R0QC 1GQFA 3AERA 2UDPA 1TOAA 2MSNA 3ELUA 5AHRA 2OPQB 2UVPB 2YKPA 4R1NA 4C2MA 1BS9A 1RP1A 2PQ6A 4JWTA 2O5EA 2SKCA 3TSYA 2CZQA 3CG0A 2K4MA 4NFLA 3I8OA 3QLHB 4NEHB 1Y3HA 1IE3A 4BWYA 2HEKA 2AC7A 4PFKA 2V59A 2QR2A 5AI5A 2Y3YA 4RKQA 2HREA 2HAFA 3KB6A 1KZ9A 1PR4A 3FLEA 4NJMA 1GAJA 4NJMB 1C1XB 2MYNA 3VR4D 3FROA 4BC1A 4FOLA 2BBTA 2P79A 2XKBA 4JOCA 2QVXX 1VGYA 4J03A 3FN4A 2V8PA 1CK4A 4BC9A 2ZXUA 3F9CA 2H65B 2XYPA 3N8IA 5L3SA 1C3LA 1TADA 5DDOC 1SKSA 2IOFA 4F2PA 1KEEA 3ET6B 3WV5A 2Y3IA 4Y2XA 3HSGA 2GKOA 1S7IA 2A6OA 3IHLA 3R7SB 3H9JA 4OZJA 4C4XA 5AESA 1OIAA 3WNBA 1U8FO 1UFOA 1OX4A 4DCCA 5EGSA 2J7WA 2CNLB 4Z9XA 2G0NA 3L4SO 9ATCB 4PZEA 3V6KA 4JI5F 4RY8A 4G84A 2Y99A 3I72A 3T9EA 1RWPB 3L8FA 4EG8A 4DSKA 2HX1A 2YTCA 5HLFB 3RT7A 1D9AA 2O9JA 2BJ3A 4TY9A 3NJ4A 3LECA 3FRJA 2LQ8A 2H4XA 1GAQA 4Z9YA 4DZZA 1S9EA 1G7CA 2DG2A 4JNKA 9GPBA 3U48A 2Y1LA 2NGRA 2EKQA 1T10A 1D7OA 5LQRA 3HZEA 1OFHA 3T9FA 4EY3A 3JWIA 3KKOA 3MEQA 1Z2EA 1XTIA 1ODIA 2FUG1 3NYRA 1K5GA 3I9FA 4Q3LA 2NXUA 4OZ1A 2ZIAA 3CD7A 1ULAA 1UMCA 4MCHA 3SHWA 4LF9F 2WHRA 2XXJA 1YHQS 1O5TA 3GLRA 1JEOA 3HBJA 1YVPA 4R25A 3G8DA 5DSZA 4JP5A 5AVRA 4XE5A 2VUGA 5LWQA 1VKZA 4R1UA 4DIEA 1N6QA 2QZPA 1G64A 1KH3A 4DEYA 2AN4A 2XLIA 1SPBS 1XNHA 1ZJ6A 5IQ6A 5CHEA 4NZMA 2AMCB 3TIXB 1XQYA 2R2TA 4Q1EA 4DM7A 2I22A 1F2TA 1E6MA 1EDOA 4W7SA 4PO3X 3F73A 2JIRA 4WX2B 3RD5A 4FGSA 1NVVR 4ETXA 3QUSA 5KOJB 1E5TA 4PBSA 4K4VA 2HTFA 3QGHA 4FYYA 3O1HB 1VQ1A 4I5GA 1JG7A 4FCWA 1U3UA 2IZ5A 5DQGA 4ENUA 4LFCB 3PDUA 1RHUB 5JT1A 1K9SA 4X62B 3KVYA 1MEOA 2FSVC 4H4CA 3TA0A 4MT1A 2HSEB 3HP6A 1MSWD 1JU3A 1N7JA 5J2TF 1W5BA 1Q16B 3AY0A 1RXEA 4HYKA 1ONNA 4Z9AA 3MZ0A 3IMGA 3GD7A 3JD1A 3WFJA 3D0HE 2CNKA 3JSBA 3R41A 1IOZA 1RPJA 2WFLA 3IUNA 3FPJA 3ZCPA 4DEVA 1MGOA 2EJVA 3IPLA 4ZYXA 1E63A 3RHZA 2RB7A 2ZH5A 5J2UA 1AZSB 4Z4EA 5CYMA 2OHOA 2LDXA 2HBRB 4BMPB 1EUDA 1QFZA 3M89A 4RTQA 2FPWA 1GIAA 4AYTA 3UN3A 4DL7A 4JUBA 3AOCA 3EVWA 1XLUA 5C4GB 2Q3JA 4P52A 3TOQA 1NI3A 1QS0A 2FKAA 2JARA 5H9VA 2DNGA 2A9PA 3IEMA 5D0RA 4X66J 4ZCSA 5EXXA 1KJWA 3JYQA 2V7QA 1PT6A 1AS3A 5DI3A 3SZLA 1W8DA 4ALNA 4YJGB 3STWA 1MW7A 4PGMA 1HE5A 3TZYA 1O9BA 1XZFA 3G6XA 2Q3MA 5CEFA 4PZVA 5JSHA 3EA4A 3H04A 1WMFA 4PONA 5BW5A 2M98A 4KKOB 3TWOA 3D3WA 3RVNA 4X4RA 2C98A 3HXTA 2Q1UA 2PKQP 1YMUA 2FJDB 2BGJA 3T3GA 3KJZA 3BH0A 1E3TA 2OFWA 2DGOA 4ENVA 3DOJA 2VD3A 1R7RA 4RFLA 3AEZA 3DGEC 5F8GA 1RTDB 1T9DA 1CP2A 1R5NA 1P1HA 2WIDA 5FX2A 2YVAA 4DSJA 3CO5A 2XJ4A 5DX0A 2HA4A 3TZZA 3UQZA 4KHPJ 2CGEA 5IN4A 1AB6A 4TLEA 5ELMA 1VSVA 4P4SB 3V5NA 3V8NA 4BVLA 5CIQA 2C2WA 3I2HA 1O1YA 5CTJA 4EMUA 5IFLA 2W2LA 4BB6A 3WLHA 4HZGA 5H8WA 3KLNA 3ZE1B 1Q0UA 3IM8A 4NYMR 1RT6B 3IKTA 5CA0A 3HO8A 3LCMA 3ZHUA 4B3HA 1P18A 5HHTA 1F6WA 5CP8A 2LP4A 1NJ8A 4EJSA 1R0AB 5J5CA 3I28A 4UREA 3SK0A 4OSOA 3D1LA 2IUFA 3L8ZA 4WJBA 4C4SA 4NU8X 1CJKB 2J85A 3FM9A 2D74B 4LRCA 3O2IA 3VX3A 3QVTA 2F3RA 2BHNA 2FRDC 2ADCA 3NUQA 1SIZA 1LWFB 3QGPA 1IBMB 4MTCA 1A0OB 2PGJA 3KTAB 1H0SA 3DMFA 3P4UA 4U7DA 4YCAA 5JPCA 3GBSA 2YIDA 2MSKA 5H83A 1NHVA