4OMMA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant n113s
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
b'MTFVALYDYESRTETDLSFKKGERLQIVNSTEGDWWLAHSLTTGRTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
molecule tags Transferase
source organism Gallus gallus
publication title The role of Gutamine 128 of the SH3 domain of the c-Src tyrosine kinase in 3D domain swapping and amyloid formation
rcsb
total genus 5
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ommA00
3LH5A 2JMAA 5FWBA 2FPEA 1WYXA 4AFUC 1GFCA 2NUZA 2FO0A 1N5ZA 1AZGB 2A37A 2HDAA 2KRNA 1H92A 1ZX6A 1OV3A 3UATA 2J05A 2VKNA 1QWFA 4CC2A 1K0SA 2YDLA 2VVKA 1UGVA 3RNJA 2OI3A 4OMQA 2CREA 2ABLA 2LCSA 1WXUA 3TVTA 3M0UA 1AEYA 2L3QA 1X2KA 2CT4A 3VS5A 4LNPA 3NHNA 1QKWA 2FRWA 2KRSA 1SRLA 2GQIA 1UHFA 2LZ6B 3EG3A 1AWWA 1VA7A 2KXDA 4HVVA 2DYBA 2K79A 1Y0MA 1U06A 1YCSB 3VS1A 4J9DA 4E6RA 1K0XA 2ED0A 3I9QA 2MOXA 3I35A 2D1XA 3ZL7C 2E5KA 1BB9A 3VS7A 1UHCA 2O9VA 3QWXX 2L3PA 4FSSA 2BZ8A 2K6DA 1X27A 1OEBA 2LQWA 2YUPA 3UA6A 3TSWA 3SHWA 1TUCA 1AWJA 2EYXA 2P4RA 2M0YA 3VS3A 1KJWA 2F2XA 1JQQA 4OMPA 1U3OA 1HSQA 2DBMA 4F16A 1GBQA 2KT1A 4RTYA 3KFVA 2JT4A 4RUGA 2JW4A 2J6OA 4RTUA 1E7OA 1X6BA 3TSZA 2DA9A 1GCQC 3CQTA 2CUBA 4IIMA 3EGUA 2LJ3A 5GJVB 3VS0A 1J3TA 2O31A 2C0TA 1CKAA 3I5SA 1ZLMA 5HCKA 4DEYA 2DE0X 1JU5C 2SEMA 1RLPC 2W0ZA 3UA7A 2HBWA 1PHTA 2AKKA 2DL4A 1GCPA 3EG2A 2YUNA 4RTXA 4F17A 1E6GA 1M3CA 2EQIA 2LMJA 3RBBB 1AWOA 1EFNA 1GBRA 2RF0A 1WFWA 2EYZA 2XMFA 2L0AA 2CSIA 1VYUA 1AZEA 2OAWA 1I07A 2FEIA 2BZXA 2O9SA 2RQRA 1VYVA 3I5RA 1UECA 4IIOA 4JPBW 1GL5A 3QWYA 1W70A 1YNZA 2CDTA 2IIMA 1KIKA 2JS2A 2RPNA 1JXOA 1JXMA 3JV3A 3EHQA 2FRYA 4JJBA 5IH2A 1M3BA 3EG0A 1QLYA 3H0IA 3VS2A 2EW3A 1NLPC 2JS0A 2MCNA 2ROLA 1X69A 1OOTA 3H0FA 2OJ2A 4RTVA 2EYYA 2LJ0A 4RTTA 1ZUUA 2BTTA 1T3SA 4J9CA 5EC7A 1LCKA 5IXFA 4WCIA 1MV0B 2EGAA 2DJQA 4AFSC 4RTWA 1YN8A 2ROTA 2B86A 2F2VA 3A98A 2EPDA 2I0NA 3M0TA 2KRMA 3PVQA 1AD5A 2CSQA 1VYTA 3THKA 1YWOA 3UF4A 3NMZC 2PZ1A 4F14A 2K9GA 4AG2C 2RQVA 4AFQC 2C0OA 2QDLA 1UDLA 1XOVA 2D0NA 2LNHB 3NPFA 1NYGA 2YSQA 2K7AA 1G83A 2KGTA 2GGRA 2KYMA 1M8MA 5ECAA 4HVUA 4AG1C 1K4US 5IHNA 2JMCA 1AVZC 4X1VA 1HJDA 2SRCA 1MV3A 2LJ1A 2EKHA 2JXBA 4J9FA 1SHFA 1YP5A 1IO6A 1NEGA 1M3AA 3VS6A 1BU1A 2EBPA 2RQUA 3REBB 1WIEA 1M30A 4LN2A 1YWPA 2RMOA 1RLQC 4Z88A 2EGCA 4LUDA 1KFZA 1ZUKA 1Y57A 1PRLC 1B07A 2CH4A 2J7IA 2F2WA 3R6NA 4J9HA 1X6GA 4OMMA 2DRMA 1I0CA 4OMNA 1WX6A 3REAB 1S1NA 1UJ0A 4AFZC 2DL8A 1PRMC 2DLPA 2HCKA 4CC4B 2DL3A 2PTKA 2W10A 2KXCA 2LP5A 2O2OA 1W6XA 4JJCA 4ORZA 2G6FX 2FG0A 4EIKA 1E6HA 2V1RA 4Z8AA 2JM9A 1MUZA 1SSHA 1X2QA 2KNBB 2L2PA 4LUEA 1A0NB 3NGPA 1V1CA 2AZVA 2ECZA 2X3XD 2DNUA 4ESRA 2EYWA 2D8HA 4CC3A 1UE9A 2MIOA 4KRTA 1U5SA 2CUDA 1NG2A 2YT6A 1K9AA 1SPKA 1NYFA 1KSWA 1K1ZA 3ULRB 1FYNA 2JTEA 3EG1A 1GRIA 1WI7A 1NLOC 1GFDA 1QWEA 1Z9ZA 2YUOA 2O88A 2RQWA 1JO8A 1W1FA 2BZYA 4HCKA 4QT7A 4JZ3A 1ZUYA 1WXTA 4Y92A 2H8HA 4CC7A 2VWFA 4HXJA 4J9IA 3H41A 4GBQA 4HVWA 1NM7A 4RTZA 1T0HA 2ENMA 1B3QA 2X3WD 2FPDA 1T0JA 1GCQA 2CH4W 4D8DA 3M0RA 5FWCA 1UJYA 1PKTA 1UFFA 2KR3A 1PKSA 1UUEA 2EVRA 2KT8A 3VRZA 2DMOA 1TUDA 2JM8A 1SRMA 2M51A 1ARKA 1G2BA 2RQTA 4J9EA 1WA7A 1QKXA 2LX7A 1M27C 3M0SA 3H0HA 1OPKA 1PWTA 2DL7A 2DL5A 2V1QA 3C0CA 3SEMA 1RI9A 3PVLA 4J9GA 2GTJA 3M0QA 1WLPB 4GLMA 2GBQA 2GTOA 4OMLA 1NEBA 1UTIA 3U23A 2ED1A 3IQLA 2J6FA 2HSPA 2EGEA 4A63B 4R0KA 2LQNA 1AOJA 1QCFA 1SEMA 2A28A 1I1JA 2K2MA 2A08A 4K11A 5IHKA 1WXBA 1RUWA 5GJWB 3VRYA 2FPFA 5IXBA 1BK2A 3VS4A 1X43A 4LE9A 2KROA 3FJ5A 5L23A 4M4ZA 2PNIA 4OMOA 3EHRA 2DF6A 4ZNXA 3M0PA 2AKLA 2J6KA 3O5ZA 4JZ4A 2K3BA 1JEGA 2KEAA 2YUQA 1K76A 1H3HA 2L3SA 3PE0A 5I11A 1ZBJA 2DBKA 2HEQA 1UG1A 4Z89A 2KYBA 4D8KA 1HD3A 1BBZA 4J9BA 2J06A 1ZSGA 2AZSA 2CT3A 1PNJA 1FMKA 2C0IA 2RN8A 2D8JA 2DM1A 2KE9A 2NWMA 1H8KA 2A36A 5FW9A 2GNCA 1SHGA 2DILA 3GBQA 5IHIA 2DX1A 2AK5A 1ABQA 1CKBA 1ABOA 4DEXA 2ESWA 1CSKA 2DRKA 2RNAA 4JJDA 1T3LA 1WDXA 1TG0A 1AWXA 1OPLA 1Z9QA 5I22A 2KBTA 2DVJA
chains in the Genus database with same CATH superfamily
3LH5A 2JMAA 1H641 3AHUA 1OX9A 2D9TA 1AZGB 2KRNA 1LPLA 3L1AA 1QWFA 4CC2A 2YDLA 5D6YA 2VVKA 1QCOA 4M7AB 2OI3A 2RJDA 4OB1B 3RNJA 3OMCA 2CP5A 2ABLA 2LCSA 4NOYA 3TVTA 5I21A 2PQWA 1AEYA 2L3QA 2IVWA 2P0QA 3L2ZA 3VS5A 1VQ7A 5CVIA 1FWZA 4LDXA 4J6YA 3QDFA 4L6V5 2GQIA 2LZ6B 3G4SQ 1AWWA 2KXDA 4PL6A 4M77A 4M7AE 2DYBA 2DXUA 2OAUA 2L5QA 2K79A 3ASKA 4F7UB 3MJXA 3QKJA 1YCSB 4XU3A 2ED0A 2PUKB 1VQOT 3I9QA 1YIJQ 3I35A 2D1XA 3ZL7C 2E5KA 2DD5A 1UHCA 3HKSA 2O9VA 1NE8A 3CCVT 4Y91A 1TWBA 3OS0A 5IAYA 2RI2A 3A8GB 1X27A 1PG5B 4M75D 3QYHB 2LQWA 3UA6A 2ZZDA 4M77E 1YITA 1VQKA 3OS2A 3G4ST 2M0YA 1G5VA 4ZGJB 4BI3A 2OTLA 1KJWA 3OW2A 1OU9A 1IXDA 4M78D 4OMPA 1U3OA 1HSQA 2LC4A 3T9NA 1U8RA 3TSZA 4XAXB 3X28B 1WQ7A 1GCQC 4M78G 1DJ7B 4ANJA 2DFUA 2CKKA 3CCUT 1K9MU 2P4TA 3V8KA 2KAFA 1KQSA 3O8VA 1J3TA 3N5BB 1WGSA 4XU0A 2DXCA 5LJ3g 5LJ3f 3OQ5A 1O9SA 5GAN5 2DE0X 1VQ5T 4JS4A 4M75G 3TU4K 2K57A 3UA7A 1OULA 2HBWA 1KC8C 3EH2A 3X26B 3EG2A 3JCMW 2YUNA 3M54A 4RTXA 1B34A 2EQIA 1TS9A 1WFWA 1Q81U 2MWPA 1QVPA 1R0CB 4NL2A 1VYUA 1AZEA 2QGGA 2QASA 2VXFA 1AT1B 1I07A 2FEIA 1ZSZC 2E65A 4C92B 4PJMA 1YJNQ 4JPBW 2A3LA 1D1AA 4BDYA 3M4YA 1M4ZA 2IIMA 1KIKA 3JV3A 1JXMA 3EHQA 5IH2A 2MI6A 2WACA 4CRIA 2K3XA 1VIEA 2EW3A 1NLPC 4KT0E 2R58A 4XTVA 1X69A 4M7DE 1WPYA 2LJ0A 2QEXA 2ZPHB 4B9WA 1T3SA 4J9CA 1N8RU 5EC7A 1O75A 3M56A 5CQYA 4C92A 3HTRA 3MHXA 5GAOr 4B9XA 2AHJB 2DKGA 4IUTA 2DJQA 1B7TA 1S72T 2LT4A 3A5ZB 2P0KA 2EPDA 5A2QE 2ZAEA 3PMIA 1D1CA 5GAOq 1Q86U 1X75C 3M0TA 4PFPA 1QP3A 2FB7A 4OMFB 3THKA 2JZ2A 2YWWA 2F69A 5KCOA 2X9HA 1VQ8T 4AG2C 5HKCA 2OTLT 2CZ1B 1G3SA 1BKBA 2RHUA 5EG2A 2XICA 1RAFB 1R8OB 2V8JA 3M59A 2KGTA 3UWNA 2LDMA 1ACMB 2KQWA 3CD6A 3GP8A 1RACB 4HVUA 3LGLA 5IHNA 3CCSQ 2EIFA 1S72A 1MV3A 2LJ1A 3DLMA 3BY7A 2EKHA 4J9FA 3MEUA 1RAIB 3G7ZA 1W2BP 4JLGA 1K8AR 4NS5A 3VS6A 2M0OA 1WIEA 3JCMd 4LN2A 1RLQC 4JRIA 5GAN8 4FW2A 5KE2A 4LUDA 3RIRA 5LL6S 4JRPA 5GAMd 2QXFA 1QW1A 1XQHA 1X6GA 4OMMA 4OMNA 3REAB 1S1NA 4AFZC 2HCKA 4E7IA 3CC4A 2WSFE 1Y7XA 4DBHA 3P8HA 4E2FB 3RUXA 1W6XA 3S3MA 4ORZA 2G6FX 2FG0A 4EIKA 1E6HA 3CC7Q 5LJ5e 1X2QA 4DQ2A 4LUEA 1A0NB 3NGPA 2X3XD 3CMEQ 1WNLA 1VQOA 4MDWA 1VQ4T 2EYWA 2HKNA 4M75F 2D8HA 1UE9A 3L2QA 3OYAA 2HQHA 4R55A 3E1SA 2YT6A 1K9AA 1NYFA 3MKDA 3JCMe 2RB6A 2KSSA 3EG1A 4MMLA 3QG1A 1M1KC 1Y96A 2YUOA 2O88A 4QKUA 2OTJT 1UEBA 3NTHA 1ZUYA 4M78A 4C0DC 4PJOD 4XTYA 2VWFA 5FRMA 4GBQA 4HVWA 4M77C 1B3QA 5KH6A 4RCBA 2X3WD 1T0JA 1GCQA 3WXMB 1OI1A 1D0ZA 1VQ4A 1PKTA 4PJOF 4M7DA 1PKSA 2MF2A 1TUDA 2PVGB 1UGPB 3ME9A 1G2BA 3ZBDA 4J9EA 4KUDK 1QKXA 3L2WA 5J3BA 4PJOC 1PWTA 2DL7A 4YTLA 3SEMA 2K5IA 3PVLA 4HCZA 3M0QA 2EFIA 3CC4T 3V8LA 1UTIA 3OSSC 3IQLA 2JTFA 3CCUQ 1Y71A 2LQNA 1SEMA 1LNXA 4C8QE 2A08A 3C4SA 4K11A 3QIIA 1QVFS 1WXBA 1RUWA 5GJWB 5CAIA 2Z0WA 2A7YA 2P84A 1PM3A 2VGMA 1NJIR 4MZMA 3A8LB 4IKFA 4BY6C 4LE9A 3GOXA 3A8MB 1KQ2A 1QQJA 1TU0B 2FZKB 1KD1U 1UGSB 5FLXE 2DF6A 4FSXA 1NPRA 3O5ZA 2KEAA 4FYXB 2L3SA 3PE0A 1V29B 1QVGA 1UG1A 4Z89A 4F7UA 1VQNQ 3WVEB 4D8KA 4L59A 3RERA 2EYQA 1FMKA 5KYUA 3EFOB 6AT1B 2KE9A 2NWMA 4X34A 2RA2A 4QW2A 1YI2Q 2A36A 5FW9A 2DILA 5IHIA 1BCMA 2WSEE 3LX7A 2DX1A 4PJOB 1ABQA 1CKBA 1ABOA 2FYKA 4BDZA 1W2BS 2MPXC 2DRKA 5KYYB 1NPPA 3CCVQ 1EX4A 1LVKA 2RJEA 2GFUA 1Q7YU 2M16A 1MMAA 5I22A 4R56A 1OZ2A 2FPEA 1WYXA 4EPCA 1N5ZA 4BI4A 2JVVA 4C8QF 4E7SA 2OTJA 3META 3MP6A 1RADB 5HY6A 4C0ZA 1ZA1B 1M90C 5GAMe 4M7AA 1K0SA 5LJ5j 2DVEA 1FXXA 4OMQA 2CREA 3GLXA 4BY6B 1VQ9Q 2E3IA 3CCET 5FU7C 3NHNA 3EG3A 2QQBA 3MCAB 3H6ZA 1Q82U 4Q5WA 3DB4A 2NUTA 5GANh 1U06A 4M77F 4XU1A 1YI2T 1VQ6T 4M77D 3J81E 1BIBA 2KMTA 2QA4A 4ELYC 3C94A 1SSFA 4FSSA 2BZ8A 2VB6A 4PJOG 4BE2A 2GQVA 2VXEA 1OEBA 2YUPA 3TSWA 3MO8A 3SHWA 1KD1R 1C1AA 1VIFA 4TVRA 4ZGEB 2QI2A 1YJWQ 3VUZA 1PD1A 3G6EA 2P4RA 3PNWC 5HK0A 2RJCA 1IZ6A 3CXCA 2L8DA 3VS3A 1NJIU 3EH1A 4PLIA 4N4GA 1ZQ1A 1VQ5A 4F16A 4N0AC 1G3WA 5DY9A 4HKEA 8ATCB 1X6BA 5CKHA 4C5IA 3CC2T 5GANf 2KVQG 4FW1A 2QEXT 1WQWA 1VQ7Q 2DAQA 3CQTA 2DPPB 3GNGA 3VJPA 3CCQT 2LJ3A 5GAMj 3DKMA 4XQ3A 2BKDN 1K8AC 3I5SA 3VKIA 2RHZA 1ZLMA 2MWOA 5HCKA 1BI1A 3FRNA 1JU5C 1TUGB 2RHYA 2W0ZA 5GAN6 3G71T 2DXBA 5FU6C 2AKKA 3OYIA 2DL4A 2K2VA 1Q95G 5CKDA 4XTUA 1G3YA 1M3CA 2LMJA 3MEVA 4E7JA 1EFNA 1MGQA 2LX9A 4N0AA 4QQ6A 1GBRA 1I4K1 2L0AA 1WHMA 2OAWA 1YITQ 2EJGA 1VQKQ 4M77B 5GMKh 1M2VB 1M1GA 1UECA 4ME7A 2OTLQ 4C8QC 1YNZA 2NLUA 2HL5C 3EAEA 2RPNA 1JXOA 4JJBA 4C92E 2FRYA 1WHHA 1M3BA 5GMKj 1QLYA 3H0IA 2NYSA 4PJLA 2ROLA 1OOTA 2OJ2A 4RTVA 2XD0A 1ZUUA 2BTTA 4PJOE 5IXFA 4WCIA 4C92F 2EGAA 3E9GA 4RTWA 2JUFA 2ROTA 3M9QA 1JRIA 1VUBA 4HA8A 5LJ3e 4PFZA 4IUQA 2I0NA 4FYVB 2KRMA 3PVQA 2H3JA 1VYTA 4OF1A 3X24B 1YHQA 2Y90A 5GAMh 3NMZC 2PZ1A 1Y96B 3SD4A 3RKWA 4AFQC 2C0OA 4J5YA 4FCYA 3OS1A 5GANe 1NYGA 2YSQA 1G83A 3CCJT 3BE3A 3PFSA 2KYMA 1M90R 2E64A 3SWNA 3BDUA 1Q86R 2JMCA 2SRCA 5C6SA 4BE1A 1RABB 3LLRA 2JXBA 3DB3A 1YP5A 1IO6A 2HSEB 2QEXQ 4J6WA 2L89A 3JB9D 2IPOB 2RQUA 1M30A 3P8BB 3Q1JA 1ZUKA 1Y57A 4J83A 2CH4A 3LWHA 1RL2A 2LNVA 3EFOA 1I0CA 5DM7R 1WX6A 4A4HA 1VQPT 4EMKA 3AT1B 1PRMC 1RAEB 4CC4B 2YRCA 1JJ2A 4DA4A 2LP5A 2CYZB 4JJCA 4FT2A 4FIBA 2DZ9A 2RHXA 2QQAA 2K4YA 2ZCFB 3QDRB 4JLIA 4E7HA 1V76A 2KNBB 2L2PA 2QK0A 3NTKA 2ECZA 3CPWS 3VUBA 3CCSA 4ESRA 1S72Q 1XTDA 5GAN4 2LRQA 3MEAA 3L2UA 3M4GA 2MIOA 1U5SA 5GANd 4M75A 1VQPQ 1OYXA 1KSWA 1K1ZA 4RG2A 1FYNA 4Y28E 5CKBA 1GRIA 1VQ9T 2KK4A 2ZPIB 2RQWA 4HCKA 3QSUA 1VQMQ 4A54A 1Q86C 2H8HA 2XI9A 1N6AA 3BFMA 3SWNB 4RG8A 3H41A 1G8XA 1NM7A 4M7DD 3CD6T 1T0HA 3CCLA 2LVMA 2QYZA 3OA6A 4D8DA 5FWCA 1UJYA 5KYWB 1UFFA 2KR3A 2ZPBB 1YJ9A 2KDSA 2KT8A 3EGXA 4RCCA 5FU7B 3VRZA 1N8RC 2DMOA 1U1TA 2JJ9A 2CP2A 2DTOA 2M51A 2EQKA 2I2LA 1ARKA 2RQTA 2E5QA 3CC7A 2CZ0B 3OS5A 3NTIA 1RI9A 2CP7A 5KE3A 1M5Q1 4M7DC 3L42A 3OYFA 2DZCA 4J9GA 2E41A 1PSEA 2EJ9A 3CCJQ 3EFSA 3I55A 4CI0C 4OP0A 2HSPA 4R0KA 4C5GA 1AOJA 3I55T 2CP6A 2A28A 1I1JA 2K2MA 3VYHB 1VQLT 3VU3C 3JB9H 3FLGA 5IHKA 3JCMg 3VYGA 3VV0A 5KYXB 1VQMT 4JRKA 2YHTA 3JCMQ 1KC8U 3RKXA 1X01A 2IG0A 5FRNA 2R5MA 5I2MA 3JCMb 5L23A 5AYFA 1WJQA 4OMOA 1YJ9T 4EDUA 2ZGWA 4FU6A 3RMSA 2O4XA 2PU9B 4ZNXA 4C0GA 2J6KA 3QYGB 3HP9A 2YUQA 1TOVA 4FYYB 1U1SA 3EFRA 1HD3A 1ZSGA 2DJZA 2E6NA 5CKFA 2RN8A 1YIJT 3A8HB 3X25B 4AT1B 2GNCA 5GAOm 1Q82C 3HRTA 1WJRA 2X4WA 3PMTA 4BI8B 2ZPGB 3G71Q 1N9SA 3QZ5B 3CCUA 2RNAA 2ZPEB 1T3LA 1WDXA 5GMKl 3QPHA 1H3ZA 1BI2A 1BI0A 2DVJA 2M9UA 1BI3A 5FWBA 1M90U 3CMAQ 4AFUC 2FO0A 2KY9A 2E3HA 2A37A 2HDAA 3M57A 4LD9K 1H92A 3UATA 2J05A 2VKNA 2QA4T 1NJIC 3J80E 1M1FA 3OB9A 3CBPA 3SDZA 1WXUA 3LW5E 3M0UA 2K5LA 2DTHA 1MMNA 1X2KA 5CR2A 4KUIA 5AT1B 1VQLA 4LNPA 2JOYA 1QKWA 3OYCA 1SRLA 1VA7A 2GCXA 1LOJA 1QP2A 3L2VA 3CMET 1K0XA 2D6FA 3HSBA 1BB9A 3VS7A 3RDVA 1PCXA 2VGNA 2BE9B 5FROA 5GAOp 2EJFA 4N4HA 1R77A 4KULA 2CP3A 3EG9A 1TUCA 1AWJA 1WHGA 2EYXA 3CCMT 5C0MA 1JB0E 2AT1B 4PLLA 3L2RA 2GF7A 2F2XA 3PGGA 1MHNA 3S3OA 1RAAB 1GBQA 2KT1A 5GMKm 4RTYA 3KFVA 5DLQE 3UT1A 4RUGA 4E7LA 3CPWP 2JW4A 2J6OA 4RTUA 3BDLA 5GAMg 4JRQA 3OW2P 2EQUA 1VQ9A 2DA9A 1Q7YC 2MK5A 1VOMA 2LCCA 2EQMA 3EGUA 5D6WA 5GJVB 3VS0A 2O31A 3TQ7P 4C8QB 3G6ET 2C0TA 3UDCA 2R5AA 1VQKT 4C8QD 2MMPA 5KYUB 2QA4Q 1RLPC 3OBWA 1KQSP 4NL3A 2RJFA 4JS5A 3HL8A 4JJNK 2O01E 1GCPA 4II1A 1RI0A 2YLCA 1E6GA 2RF0A 3QO3A 2EYZA 2XMFA 2CSIA 2H3EB 1YJWA 4GY5A 4A4KA 3V7CA 2BZXA 3JSCA 3G6EQ 2JN0A 2O9SA 1VYVA 3SB2A 2DYIA 3I5RA 4IIOA 2ZPFB 1BYMA 1W70A 4A4EA 2HD0A 2CDTA 1VQ5Q 4HT8A 1PD0A 4ATOA 2HQXA 3EG0A 2RI5A 1M1KU 4C5EA 4C92D 4E7KA 3CCQQ 1HYOA 2E70A 4KGZB 3WVDB 5I2SA 4MMKA 2HL3A 4PK4A 4J6XA 1Q81C 5GMKi 4MZTA 3CCMQ 1LCKA 1NBEB 2PVDB 1X6OA 4PNOA 5GAMf 2HZYA 3M53A 1UGQB 2DEQA 1YN8A 2QTVA 5GAOl 2F2VA 3A98A 1QVGP 3S6WA 3LWIA 1KD1C 1LJOA 3EGDA 3CEYA 2DXTA 2JNGA 2O4XB 1YBYA 1RAHB 1AD5A 4J7FA 1K73C 3HFNA 2K9GA 5J26A 1JJ2P 2RQVA 3V8JA 4BB7A 4O6JA 2QDLA 1UDLA 2BIVA 2LQ8A 3NPFA 2K7AA 4ELZC 4FYWB 3OYKA 2GGRA 2MYSA 2F1LA 5ECAA 4AG1C 1K4US 4QVDA 1C6VX 4OVAA 1AVZC 2PUOB 4X1VA 5CQXA 1KG1A 2COWA 2E12A 3JCMX 3QXEB 2CZ6B 4C5HA 3EGXB 1SHFA 4BD3A 5D7UA 3JB9F 4V2SA 3QJ6A 1M3AA 2YRVA 2NUPA 2EBPA 4EMGA 2P0PA 3I56A 3CCEQ 3OYEA 4ZGDB 2CP0A 5LJ5g 3M58A 1KFZA 1PRLC 1I81A 1B07A 2J7IA 4M7AD 3R6OA 2F2WA 4DOWA 3CCRA 3ZEHA 4M75E 3R6NA 4J9HA 1KQ1A 2YXYA 2DRMA 1D0YA 1M8VA 1F1BB 5KYWA 2DL3A 2C06A 2X4XA 1I5LA 2W10A 3EGDB 2G3RA 2VASA 1YHQQ 3HPWA 2KXCA 3INZA 4IUUA 2X4JA 2FVUA 1M9SA 2E4HA 3S3NA 2DEUA 2VV5A 2COYA 2V1RA 4Z8AA 1MUZA 2HQEA 3JCMV 2LTOA 4PKCC 2DO3A 1R0BG 1V1CA 2AZVA 1D09B 4M78C 4KGVB 1QVFP 3MP8A 3QJYA 4OB2B 5GAN3 2QDYB 2JTMA 1SPKA 5LJ5f 3RR6A 1VQ8A 1GFDA 1QWEA 2CZ7B 2RI3A 2BZYA 4QT7A 3CXCS 2HMAA 4JZ3A 1WXTA 3OBYA 4XTZA 5LJ3d 4LDVA 4X9DA 4VUBA 1PSFA 4HCBA 3JB9G 4J9IA 2QG9B 3MPUB 3JRZA 4DBFA 2XU8A 2FPDA 2QQRA 2FZGB 3CC2A 1UUEA 4EMKB 4F7UG 2XG8D 2JM8A 2L3RA 3TREA 4QVZA 4C8QA 2DERA 1WA7A 4ZN1A 2Y4YA 2LX7A 1M27C 5CIUA 3M0SA 3H0HA 1TXQA 3QBYA 2OX7A 1OU8A 4GLMA 1TTHB 1VQPA 2E1HA 4LXCA 2J6FA 4A63B 2EGEA 3CPWA 3A8OB 1QCFA 5J39A 3HRSA 1HK9A 2XKOC 1VQ6A 1HXDA 2FPFA 1VQMA 2EKOA 5IXBA 3EG9B 1XNIA 3VS4A 1X43A 4BE0A 2KROA 3FJ5A 5DLOA 3CCLQ 1GXIE 3M5AA 4B6MA 2DK3A 1YJ9Q 3E19A 3ER0A 2AKLA 4C8QG 2K3BA 1JEGA 1PC0A 5CKEA 3A1PA 1C0MA 1K76A 2XDBA 3G4SA 1ZBJA 2HEQA 5D6XA 2FL7A 2J06A 2CT3A 1PNJA 2A0FB 2C0IA 1IRXA 2D8JA 4XU2A 3LH0A 3GF5A 4OB0B 3V7RA 2DM1A 1YIJA 1H8KA 5FU6B 3GBQA 3CCJA 3JCMh 3I55Q 4KH0B 3F70A 4DEXA 2ESWA 4M75B 1CSKA 3PIPA 3KUFA 4JJDA 1ZA2B 1TG0A 3QHSA 2F5KA 3JCMf 1FMWA 1UB4A 2M02A 1Z9QA 4MDXA 3OYLA 1SF9A 1GFCA 2NUZA 1KHIA 2XIDA 4HT9A 2V8KA 3E9FA 4LDWA 4EMHA 4DBQA 1ZX6A 1OV3A 3CCRT 4BUGA 3MP1A 1TH7A 1JJ2S 4E7ZA 1OZ3A 1UGVA 2RHIA 1EZZB 8AT1B 3JB9I 3I56T 3OYDA 2CT4A 4M75C 4UC4A 1N27A 2FRWA 4AMCA 2KRSA 1K9MR 1UHFA 4HVVA 1ZHIA 1Y0MA 3VS1A 3OYMA 4J9DA 4E6RA 4JUVA 2DD4A 2VYTA 1OX8A 2MOXA 3QWXX 2L3PA 4C0DB 5CCAA 3JCMc 1SG5A 3MEWA 3G71A 2K3YA 5LJ5d 5LJ3h 4C92C 3OSVA 2K6DA 4QQDA 3CXCP 2BE7D 1QMCA 4M77G 2MAMA 4A4GA 2XHCA 4N4IA 4XK8E 2XK0A 9ATCB 3HHTB 3CMAA 1YJNA 4F7UF 7AT1B 1AHJB 2E6ZA 4BACA 2QAZA 2DETA 1JQQA 1FMVA 2DBMA 2JT4A 1M2OA 2YRDA 1E7OA 4A53A 4M7DB 3CBOA 2VC8A 4PFOA 3OYJA 4A4FA 1VQLQ 5A0LA 2CUBA 4IIMA 1KQSS 3C95A 2R57A 4L5GA 5GMKe 1WJSA 1CKAA 1YITT 3ZFJA 1ZSZA 5IT9E 4DEYA 1M1KR 2SEMA 3KXTA 1PHTA 4M7AF 4ZN3A 4HCCA 5CO7A 3SFMA 3DLLA 4F17A 5HK3A 5KCHA 4M7AG 3RBBB 3X20B 3OW2S 1AWOA 1WHLA 1Y07A 4F7UE 3LGFA 2EQJA 3H8ZA 2DTIA 1VQNT 1Q81R 2RQRA 1GL5A 1TSFA 3QWYA 4PJJA 3CD6Q 3E2UA 1Q82R 1SKUB 2JS2A 3FEOA 3LYIA 5KYYA 2EWNA 3VS2A 3JB9J 3G1JA 2JS0A 4XTXA 3OMGA 3M55A 2MCNA 1NZ9A 3H0FA 4M7DG 2EYYA 4RTTA 1QCNA 3QZ9B 1UGRB 1W4SA 5GANg 1MNEA 5A0DA 1QVFA 1MV0B 1RAGB 4AFSC 3V7SA 3JCMJ 2B86A 3OYYA 2V26A 2WSCE 1N8RR 4JDSA 2Y4XA 3CC4Q 2CSQA 2V8IA 1YWOA 4FM4B 2LT1A 4XTWA 3UF4A 1K9MC 1P92A 3RKYA 4F14A 1YHQT 4QQGA 2HAXA 1XOVA 2D0NA 2RO0A 2LNHB 2LQKA 2B8AA 5L8RE 4C92G 2CGHA 3FJPA 1BCOA 1M8MA 3CMEA 2QQ9A 1HJDA 1VQOQ 1N9RA 1WHKA 5A0GA 2YLBA 4DBRA 1BIAA 3CCQA 4M78E 2XDPA 4C0FA 3RESA 1NEGA 5LJ3j 1BU1A 3REBB 3CCMA 1YWPA 2RMOA 4Z88A 5KYXA 2EGCA 5KYNA 4GLKA 1WHJA 2NUTB 4M78B 3PT9A 4OGEA 4EMKC 2HKQB 5GANj 3CBMA 4X9CA 1UJ0A 2X4YA 2DL8A 2DLPA 1G3TA 3H9NA 3GNFB 4KH1B 5GAOn 1VQ4Q 2X51A 1FX7A 2PTKA 2RH2A 2QGFB 1YFNA 2O2OA 4RMOA 1IB8A 2NUPB 3PTAA 5CK9A 2K5FA 3OYBA 5LJ5h 4ZTFA 2ATCB 2JM9A 1ZSZB 2HNIA 3OY9A 1SSHA 4M7AC 2RM4A 1XJWB 2DNUA 2RD1A 3BW1A 3FIFA 4WTOB 4CC3A 4DOVA 2M1HA 1IHWA 4KRTA 2CUDA 1NG2A 3J7AF 2QQSA 3ULRB 3OYNA 2JTEA 3FC3A 3I56Q 1WI7A 1NLOC 3CCEA 1Z9ZA 1OQKA 4M78F 1JO8A 4IURA 1MMDA 1W1FA 1KK7A 1M2VA 4MZPA 3TEEA 1KHCA 3URGA 4Y92A 4J7IA 4CC7A 2X35A 4HXJA 4D6WA 3QUIA 3CCRQ 4WF2A 2DIGA 3CCLT 4RTZA 2ENMA 1IGQA 4M7DF 4PJOA 2CH4W 3M0RA 3OYHA 4E47A 3FDRA 1D3BB 1YCYA 2EVRA 1KC8R 4LDUA 1I8FA 3JCMP 2HBPA 1SRMA 1EIFA 4ZTJA 3C12A 4KBMB 4LD6A 4FL6A 1VQNA 2FHDA 4FT4A 3CMAT 1OPKA 4QVCA 1D0XA 2DL5A 2V1QA 3C0CA 3CCST 1YI2A 2GFAA 2GTJA 1WLPB 2GBQA 2GTOA 3JAME 4OMLA 2RK2A 3UPUA 1NEBA 3U23A 4O5VA 2XDDA 3GIBA 2ED1A 4PJNA 3CCVA 1D3BA 1VQ7T 1VQ8Q 2AIRB 2D0QB 5M9OA 3VRYA 3RMQA 3NFCA 2LCLA 1BK2A 1I5OB 4F04B 2OTJQ 1K73U 2RK1A 2F5TX 4M4ZA 1K8AU 2PNIA 3OYGA 3GPLA 5GAN7 3HRUA 4P5NA 3CC2Q 3CPFA 3SWNC 1IHVA 3EHRA 2E10A 1IGUA 3M0PA 1W2BA 4JZ4A 3PIOA 2PVOB 3D7SB 4J8OA 1H3HA 2QTXA 4Z02A 1MMGA 2COZA 4IUPA 5I11A 2DBKA 1YJNT 3CC7T 2KYBA 2DIQA 1BBZA 2KI7A 1Q7YR 1MNDA 4J9BA 1QVGS 2AZSA 2VUBA 2FZCB 1YJWT 3FB9A 3P8DA 1WZOA 2BUDA 1SHGA 1IREB 1D1BA 5GAN2 4RKUE 2AK5A 2EAYA 3TCJA 2CS7A 1JBMA 1B34B 1K73R 5IN1A 4KGXB 1ZBXA 3HFOA 1AWXA 1OPLA 4OGCA 4IUVA 3KBGA 4OB3B 4LDYA 2KBTA 1VQ6Q
chains in the Genus database with same CATH topology
3LH5A 2JMAA 5FWBA 2FPEA 1WYXA 4AFUC 1GFCA 2NUZA 2FO0A 1N5ZA 1AZGB 2A37A 2HDAA 2KRNA 1H92A 1ZX6A 1OV3A 3UATA 2J05A 2VKNA 1QWFA 4CC2A 1K0SA 2YDLA 2VVKA 1UGVA 3RNJA 2OI3A 4OMQA 2CREA 2ABLA 2LCSA 1WXUA 3TVTA 3M0UA 1AEYA 2L3QA 1X2KA 2CT4A 3VS5A 4LNPA 3NHNA 1QKWA 2FRWA 2KRSA 1SRLA 2GQIA 1UHFA 2LZ6B 3EG3A 1AWWA 1VA7A 2KXDA 4HVVA 2DYBA 2K79A 1Y0MA 1U06A 1YCSB 3VS1A 4J9DA 4E6RA 1K0XA 2ED0A 3I9QA 2MOXA 3I35A 2D1XA 3ZL7C 2E5KA 1BB9A 3VS7A 1UHCA 2O9VA 3QWXX 2L3PA 4FSSA 2BZ8A 2K6DA 1X27A 1OEBA 2LQWA 2YUPA 3UA6A 3TSWA 3SHWA 1TUCA 1AWJA 2EYXA 2P4RA 2M0YA 3VS3A 1KJWA 2F2XA 1JQQA 4OMPA 1U3OA 1HSQA 2DBMA 4F16A 1GBQA 2KT1A 4RTYA 3KFVA 2JT4A 4RUGA 2JW4A 2J6OA 4RTUA 1E7OA 1X6BA 3TSZA 2DA9A 1GCQC 3CQTA 2CUBA 4IIMA 3EGUA 2LJ3A 5GJVB 3VS0A 1J3TA 2O31A 2C0TA 1CKAA 3I5SA 1ZLMA 5HCKA 4DEYA 2DE0X 1JU5C 2SEMA 1RLPC 2W0ZA 3UA7A 2HBWA 1PHTA 2AKKA 2DL4A 1GCPA 3EG2A 2YUNA 4RTXA 4F17A 1E6GA 1M3CA 2EQIA 2LMJA 3RBBB 1AWOA 1EFNA 1GBRA 2RF0A 1WFWA 2EYZA 2XMFA 2L0AA 2CSIA 1VYUA 1AZEA 2OAWA 1I07A 2FEIA 2BZXA 2O9SA 2RQRA 1VYVA 3I5RA 1UECA 4IIOA 4JPBW 1GL5A 3QWYA 1W70A 1YNZA 2CDTA 2IIMA 1KIKA 2JS2A 2RPNA 1JXOA 1JXMA 3JV3A 3EHQA 2FRYA 4JJBA 5IH2A 1M3BA 3EG0A 1QLYA 3H0IA 3VS2A 2EW3A 1NLPC 2JS0A 2MCNA 2ROLA 1X69A 1OOTA 3H0FA 2OJ2A 4RTVA 2EYYA 2LJ0A 4RTTA 1ZUUA 2BTTA 1T3SA 4J9CA 5EC7A 1LCKA 5IXFA 4WCIA 1MV0B 2EGAA 2DJQA 4AFSC 4RTWA 1YN8A 2ROTA 2B86A 2F2VA 3A98A 2EPDA 2I0NA 3M0TA 2KRMA 3PVQA 1AD5A 2CSQA 1VYTA 3THKA 1YWOA 3UF4A 3NMZC 2PZ1A 4F14A 2K9GA 4AG2C 2RQVA 4AFQC 2C0OA 2QDLA 1UDLA 1XOVA 2D0NA 2LNHB 3NPFA 1NYGA 2YSQA 2K7AA 1G83A 2KGTA 2GGRA 2KYMA 1M8MA 5ECAA 4HVUA 4AG1C 1K4US 5IHNA 2JMCA 1AVZC 4X1VA 1HJDA 2SRCA 1MV3A 2LJ1A 2EKHA 2JXBA 4J9FA 1SHFA 1YP5A 1IO6A 1NEGA 1M3AA 3VS6A 1BU1A 2EBPA 2RQUA 3REBB 1WIEA 1M30A 4LN2A 1YWPA 2RMOA 1RLQC 4Z88A 2EGCA 4LUDA 1KFZA 1ZUKA 1Y57A 1PRLC 1B07A 2CH4A 2J7IA 2F2WA 3R6NA 4J9HA 1X6GA 4OMMA 2DRMA 1I0CA 4OMNA 1WX6A 3REAB 1S1NA 1UJ0A 4AFZC 2DL8A 1PRMC 2DLPA 2HCKA 4CC4B 2DL3A 2PTKA 2W10A 2KXCA 2LP5A 2O2OA 1W6XA 4JJCA 4ORZA 2G6FX 2FG0A 4EIKA 1E6HA 2V1RA 4Z8AA 2JM9A 1MUZA 1SSHA 1X2QA 2KNBB 2L2PA 4LUEA 1A0NB 3NGPA 1V1CA 2AZVA 2ECZA 2X3XD 2DNUA 4ESRA 2EYWA 2D8HA 4CC3A 1UE9A 2MIOA 4KRTA 1U5SA 2CUDA 1NG2A 2YT6A 1K9AA 1SPKA 1NYFA 1KSWA 1K1ZA 3ULRB 1FYNA 2JTEA 3EG1A 1GRIA 1WI7A 1NLOC 1GFDA 1QWEA 1Z9ZA 2YUOA 2O88A 2RQWA 1JO8A 1W1FA 2BZYA 4HCKA 4QT7A 4JZ3A 1ZUYA 1WXTA 4Y92A 2H8HA 4CC7A 2VWFA 4HXJA 4J9IA 3H41A 4GBQA 4HVWA 1NM7A 4RTZA 1T0HA 2ENMA 1B3QA 2X3WD 2FPDA 1T0JA 1GCQA 2CH4W 4D8DA 3M0RA 5FWCA 1UJYA 1PKTA 1UFFA 2KR3A 1PKSA 1UUEA 2EVRA 2KT8A 3VRZA 2DMOA 1TUDA 2JM8A 1SRMA 2M51A 1ARKA 1G2BA 2RQTA 4J9EA 1WA7A 1QKXA 2LX7A 1M27C 3M0SA 3H0HA 1OPKA 1PWTA 2DL7A 2DL5A 2V1QA 3C0CA 3SEMA 1RI9A 3PVLA 4J9GA 2GTJA 3M0QA 1WLPB 4GLMA 2GBQA 2GTOA 4OMLA 1NEBA 1UTIA 3U23A 2ED1A 3IQLA 2J6FA 2HSPA 2EGEA 4A63B 4R0KA 2LQNA 1AOJA 1QCFA 1SEMA 2A28A 1I1JA 2K2MA 2A08A 4K11A 5IHKA 1WXBA 1RUWA 5GJWB 3VRYA 2FPFA 5IXBA 1BK2A 3VS4A 1X43A 4LE9A 2KROA 3FJ5A 5L23A 4M4ZA 2PNIA 4OMOA 3EHRA 2DF6A 4ZNXA 3M0PA 2AKLA 2J6KA 3O5ZA 4JZ4A 2K3BA 1JEGA 2KEAA 2YUQA 1K76A 1H3HA 2L3SA 3PE0A 5I11A 1ZBJA 2DBKA 2HEQA 1UG1A 4Z89A 2KYBA 4D8KA 1HD3A 1BBZA 4J9BA 2J06A 1ZSGA 2AZSA 2CT3A 1PNJA 1FMKA 2C0IA 2RN8A 2D8JA 2DM1A 2KE9A 2NWMA 1H8KA 2A36A 5FW9A 2GNCA 1SHGA 2DILA 3GBQA 5IHIA 2DX1A 2AK5A 1ABQA 1CKBA 1ABOA 4DEXA 2ESWA 1CSKA 2DRKA 2RNAA 4JJDA 1T3LA 1WDXA 1TG0A 1AWXA 1OPLA 1Z9QA 5I22A 2KBTA 2DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH5 A;  2JMA A;  5FWB A;  2FPE A;  1WYX A;  4AFU C;  1GFC A;  2NUZ A;  2FO0 A;  1N5Z A;  1AZG B;  2A37 A;  2HDA A;  2KRN A;  1H92 A;  1ZX6 A;  1OV3 A;  3UAT A;  2J05 A;  2VKN A;  1QWF A;  4CC2 A;  1K0S A;  2YDL A;  2VVK A;  1UGV A;  3RNJ A;  2OI3 A;  4OMQ A;  2CRE A;  2ABL A;  2LCS A;  1WXU A;  3TVT A;  3M0U A;  1AEY A;  2L3Q A;  1X2K A;  2CT4 A;  3VS5 A;  4LNP A;  3NHN A;  1QKW A;  2FRW A;  2KRS A;  1SRL A;  2GQI A;  1UHF A;  2LZ6 B;  3EG3 A;  1AWW A;  1VA7 A;  2KXD A;  4HVV A;  2DYB A;  2K79 A;  1Y0M A;  1U06 A;  1YCS B;  3VS1 A;  4J9D A;  4E6R A;  1K0X A;  2ED0 A;  3I9Q A;  2MOX A;  3I35 A;  2D1X A;  3ZL7 C;  2E5K A;  1BB9 A;  3VS7 A;  1UHC A;  2O9V A;  3QWX X;  2L3P A;  4FSS A;  2BZ8 A;  2K6D A;  1X27 A;  1OEB A;  2LQW A;  2YUP A;  3UA6 A;  3TSW A;  3SHW A;  1TUC A;  1AWJ A;  2EYX A;  2P4R A;  2M0Y A;  3VS3 A;  1KJW A;  2F2X A;  1JQQ A;  4OMP A;  1U3O A;  1HSQ A;  2DBM A;  4F16 A;  1GBQ A;  2KT1 A;  4RTY A;  3KFV A;  2JT4 A;  4RUG A;  2JW4 A;  2J6O A;  4RTU A;  1E7O A;  1X6B A;  3TSZ A;  2DA9 A;  1GCQ C;  3CQT A;  2CUB A;  4IIM A;  3EGU A;  2LJ3 A;  5GJV B;  3VS0 A;  1J3T A;  2O31 A;  2C0T A;  1CKA A;  3I5S A;  1ZLM A;  5HCK A;  4DEY A;  2DE0 X;  1JU5 C;  2SEM A;  1RLP C;  2W0Z A;  3UA7 A;  2HBW A;  1PHT A;  2AKK A;  2DL4 A;  1GCP A;  3EG2 A;  2YUN A;  4RTX A;  4F17 A;  1E6G A;  1M3C A;  2EQI A;  2LMJ A;  3RBB B;  1AWO A;  1EFN A;  1GBR A;  2RF0 A;  1WFW A;  2EYZ A;  2XMF A;  2L0A A;  2CSI A;  1VYU A;  1AZE A;  2OAW A;  1I07 A;  2FEI A;  2BZX A;  2O9S A;  2RQR A;  1VYV A;  3I5R A;  1UEC A;  4IIO A;  4JPB W;  1GL5 A;  3QWY A;  1W70 A;  1YNZ A;  2CDT A;  2IIM A;  1KIK A;  2JS2 A;  2RPN A;  1JXO A;  1JXM A;  3JV3 A;  3EHQ A;  2FRY A;  4JJB A;  5IH2 A;  1M3B A;  3EG0 A;  1QLY A;  3H0I A;  3VS2 A;  2EW3 A;  1NLP C;  2JS0 A;  2MCN A;  2ROL A;  1X69 A;  1OOT A;  3H0F A;  2OJ2 A;  4RTV A;  2EYY A;  2LJ0 A;  4RTT A;  1ZUU A;  2BTT A;  1T3S A;  4J9C A;  5EC7 A;  1LCK A;  5IXF A;  4WCI A;  1MV0 B;  2EGA A;  2DJQ A;  4AFS C;  4RTW A;  1YN8 A;  2ROT A;  2B86 A;  2F2V A;  3A98 A;  2EPD A;  2I0N A;  3M0T A;  2KRM A;  3PVQ A;  1AD5 A;  2CSQ A;  1VYT A;  3THK A;  1YWO A;  3UF4 A;  3NMZ C;  2PZ1 A;  4F14 A;  2K9G A;  4AG2 C;  2RQV A;  4AFQ C;  2C0O A;  2QDL A;  1UDL A;  1XOV A;  2D0N A;  2LNH B;  3NPF A;  1NYG A;  2YSQ A;  2K7A A;  1G83 A;  2KGT A;  2GGR A;  2KYM A;  1M8M A;  5ECA A;  4HVU A;  4AG1 C;  1K4U S;  5IHN A;  2JMC A;  1AVZ C;  4X1V A;  1HJD A;  2SRC A;  1MV3 A;  2LJ1 A;  2EKH A;  2JXB A;  4J9F A;  1SHF A;  1YP5 A;  1IO6 A;  1NEG A;  1M3A A;  3VS6 A;  1BU1 A;  2EBP A;  2RQU A;  3REB B;  1WIE A;  1M30 A;  4LN2 A;  1YWP A;  2RMO A;  1RLQ C;  4Z88 A;  2EGC A;  4LUD A;  1KFZ A;  1ZUK A;  1Y57 A;  1PRL C;  1B07 A;  2CH4 A;  2J7I A;  2F2W A;  3R6N A;  4J9H A;  1X6G A;  4OMM A;  2DRM A;  1I0C A;  4OMN A;  1WX6 A;  3REA B;  1S1N A;  1UJ0 A;  4AFZ C;  2DL8 A;  1PRM C;  2DLP A;  2HCK A;  4CC4 B;  2DL3 A;  2PTK A;  2W10 A;  2KXC A;  2LP5 A;  2O2O A;  1W6X A;  4JJC A;  4ORZ A;  2G6F X;  2FG0 A;  4EIK A;  1E6H A;  2V1R A;  4Z8A A;  2JM9 A;  1MUZ A;  1SSH A;  1X2Q A;  2KNB B;  2L2P A;  4LUE A;  1A0N B;  3NGP A;  1V1C A;  2AZV A;  2ECZ A;  2X3X D;  2DNU A;  4ESR A;  2EYW A;  2D8H A;  4CC3 A;  1UE9 A;  2MIO A;  4KRT A;  1U5S A;  2CUD A;  1NG2 A;  2YT6 A;  1K9A A;  1SPK A;  1NYF A;  1KSW A;  1K1Z A;  3ULR B;  1FYN A;  2JTE A;  3EG1 A;  1GRI A;  1WI7 A;  1NLO C;  1GFD A;  1QWE A;  1Z9Z A;  2YUO A;  2O88 A;  2RQW A;  1JO8 A;  1W1F A;  2BZY A;  4HCK A;  4QT7 A;  4JZ3 A;  1ZUY A;  1WXT A;  4Y92 A;  2H8H A;  4CC7 A;  2VWF A;  4HXJ A;  4J9I A;  3H41 A;  4GBQ A;  4HVW A;  1NM7 A;  4RTZ A;  1T0H A;  2ENM A;  1B3Q A;  2X3W D;  2FPD A;  1T0J A;  1GCQ A;  2CH4 W;  4D8D A;  3M0R A;  5FWC A;  1UJY A;  1PKT A;  1UFF A;  2KR3 A;  1PKS A;  1UUE A;  2EVR A;  2KT8 A;  3VRZ A;  2DMO A;  1TUD A;  2JM8 A;  1SRM A;  2M51 A;  1ARK A;  1G2B A;  2RQT A;  4J9E A;  1WA7 A;  1QKX A;  2LX7 A;  1M27 C;  3M0S A;  3H0H A;  1OPK A;  1PWT A;  2DL7 A;  2DL5 A;  2V1Q A;  3C0C A;  3SEM A;  1RI9 A;  3PVL A;  4J9G A;  2GTJ A;  3M0Q A;  1WLP B;  4GLM A;  2GBQ A;  2GTO A;  4OML A;  1NEB A;  1UTI A;  3U23 A;  2ED1 A;  3IQL A;  2J6F A;  2HSP A;  2EGE A;  4A63 B;  4R0K A;  2LQN A;  1AOJ A;  1QCF A;  1SEM A;  2A28 A;  1I1J A;  2K2M A;  2A08 A;  4K11 A;  5IHK A;  1WXB A;  1RUW A;  5GJW B;  3VRY A;  2FPF A;  5IXB A;  1BK2 A;  3VS4 A;  1X43 A;  4LE9 A;  2KRO A;  3FJ5 A;  5L23 A;  4M4Z A;  2PNI A;  4OMO A;  3EHR A;  2DF6 A;  4ZNX A;  3M0P A;  2AKL A;  2J6K A;  3O5Z A;  4JZ4 A;  2K3B A;  1JEG A;  2KEA A;  2YUQ A;  1K76 A;  1H3H A;  2L3S A;  3PE0 A;  5I11 A;  1ZBJ A;  2DBK A;  2HEQ A;  1UG1 A;  4Z89 A;  2KYB A;  4D8K A;  1HD3 A;  1BBZ A;  4J9B A;  2J06 A;  1ZSG A;  2AZS A;  2CT3 A;  1PNJ A;  1FMK A;  2C0I A;  2RN8 A;  2D8J A;  2DM1 A;  2KE9 A;  2NWM A;  1H8K A;  2A36 A;  5FW9 A;  2GNC A;  1SHG A;  2DIL A;  3GBQ A;  5IHI A;  2DX1 A;  2AK5 A;  1ABQ A;  1CKB A;  1ABO A;  4DEX A;  2ESW A;  1CSK A;  2DRK A;  2RNA A;  4JJD A;  1T3L A;  1WDX A;  1TG0 A;  1AWX A;  1OPL A;  1Z9Q A;  5I22 A;  2KBT A;  2DVJ A; 
#chains in the Genus database with same CATH topology
 3LH5 A;  2JMA A;  1H64 1;  3AHU A;  1OX9 A;  2D9T A;  1AZG B;  2KRN A;  1LPL A;  3L1A A;  1QWF A;  4CC2 A;  2YDL A;  5D6Y A;  2VVK A;  1QCO A;  4M7A B;  2OI3 A;  2RJD A;  4OB1 B;  3RNJ A;  3OMC A;  2CP5 A;  2ABL A;  2LCS A;  4NOY A;  3TVT A;  5I21 A;  2PQW A;  1AEY A;  2L3Q A;  2IVW A;  2P0Q A;  3L2Z A;  3VS5 A;  1VQ7 A;  5CVI A;  1FWZ A;  4LDX A;  4J6Y A;  3QDF A;  4L6V 5;  2GQI A;  2LZ6 B;  3G4S Q;  1AWW A;  2KXD A;  4PL6 A;  4M77 A;  4M7A E;  2DYB A;  2DXU A;  2OAU A;  2L5Q A;  2K79 A;  3ASK A;  4F7U B;  3MJX A;  3QKJ A;  1YCS B;  4XU3 A;  2ED0 A;  2PUK B;  1VQO T;  3I9Q A;  1YIJ Q;  3I35 A;  2D1X A;  3ZL7 C;  2E5K A;  2DD5 A;  1UHC A;  3HKS A;  2O9V A;  1NE8 A;  3CCV T;  4Y91 A;  1TWB A;  3OS0 A;  5IAY A;  2RI2 A;  3A8G B;  1X27 A;  1PG5 B;  4M75 D;  3QYH B;  2LQW A;  3UA6 A;  2ZZD A;  4M77 E;  1YIT A;  1VQK A;  3OS2 A;  3G4S T;  2M0Y A;  1G5V A;  4ZGJ B;  4BI3 A;  2OTL A;  1KJW A;  3OW2 A;  1OU9 A;  1IXD A;  4M78 D;  4OMP A;  1U3O A;  1HSQ A;  2LC4 A;  3T9N A;  1U8R A;  3TSZ A;  4XAX B;  3X28 B;  1WQ7 A;  1GCQ C;  4M78 G;  1DJ7 B;  4ANJ A;  2DFU A;  2CKK A;  3CCU T;  1K9M U;  2P4T A;  3V8K A;  2KAF A;  1KQS A;  3O8V A;  1J3T A;  3N5B B;  1WGS A;  4XU0 A;  2DXC A;  5LJ3 g;  5LJ3 f;  3OQ5 A;  1O9S A;  5GAN 5;  2DE0 X;  1VQ5 T;  4JS4 A;  4M75 G;  3TU4 K;  2K57 A;  3UA7 A;  1OUL A;  2HBW A;  1KC8 C;  3EH2 A;  3X26 B;  3EG2 A;  3JCM W;  2YUN A;  3M54 A;  4RTX A;  1B34 A;  2EQI A;  1TS9 A;  1WFW A;  1Q81 U;  2MWP A;  1QVP A;  1R0C B;  4NL2 A;  1VYU A;  1AZE A;  2QGG A;  2QAS A;  2VXF A;  1AT1 B;  1I07 A;  2FEI A;  1ZSZ C;  2E65 A;  4C92 B;  4PJM A;  1YJN Q;  4JPB W;  2A3L A;  1D1A A;  4BDY A;  3M4Y A;  1M4Z A;  2IIM A;  1KIK A;  3JV3 A;  1JXM A;  3EHQ A;  5IH2 A;  2MI6 A;  2WAC A;  4CRI A;  2K3X A;  1VIE A;  2EW3 A;  1NLP C;  4KT0 E;  2R58 A;  4XTV A;  1X69 A;  4M7D E;  1WPY A;  2LJ0 A;  2QEX A;  2ZPH B;  4B9W A;  1T3S A;  4J9C A;  1N8R U;  5EC7 A;  1O75 A;  3M56 A;  5CQY A;  4C92 A;  3HTR A;  3MHX A;  5GAO r;  4B9X A;  2AHJ B;  2DKG A;  4IUT A;  2DJQ A;  1B7T A;  1S72 T;  2LT4 A;  3A5Z B;  2P0K A;  2EPD A;  5A2Q E;  2ZAE A;  3PMI A;  1D1C A;  5GAO q;  1Q86 U;  1X75 C;  3M0T A;  4PFP A;  1QP3 A;  2FB7 A;  4OMF B;  3THK A;  2JZ2 A;  2YWW A;  2F69 A;  5KCO A;  2X9H A;  1VQ8 T;  4AG2 C;  5HKC A;  2OTL T;  2CZ1 B;  1G3S A;  1BKB A;  2RHU A;  5EG2 A;  2XIC A;  1RAF B;  1R8O B;  2V8J A;  3M59 A;  2KGT A;  3UWN A;  2LDM A;  1ACM B;  2KQW A;  3CD6 A;  3GP8 A;  1RAC B;  4HVU A;  3LGL A;  5IHN A;  3CCS Q;  2EIF A;  1S72 A;  1MV3 A;  2LJ1 A;  3DLM A;  3BY7 A;  2EKH A;  4J9F A;  3MEU A;  1RAI B;  3G7Z A;  1W2B P;  4JLG A;  1K8A R;  4NS5 A;  3VS6 A;  2M0O A;  1WIE A;  3JCM d;  4LN2 A;  1RLQ C;  4JRI A;  5GAN 8;  4FW2 A;  5KE2 A;  4LUD A;  3RIR A;  5LL6 S;  4JRP A;  5GAM d;  2QXF A;  1QW1 A;  1XQH A;  1X6G A;  4OMM A;  4OMN A;  3REA B;  1S1N A;  4AFZ C;  2HCK A;  4E7I A;  3CC4 A;  2WSF E;  1Y7X A;  4DBH A;  3P8H A;  4E2F B;  3RUX A;  1W6X A;  3S3M A;  4ORZ A;  2G6F X;  2FG0 A;  4EIK A;  1E6H A;  3CC7 Q;  5LJ5 e;  1X2Q A;  4DQ2 A;  4LUE A;  1A0N B;  3NGP A;  2X3X D;  3CME Q;  1WNL A;  1VQO A;  4MDW A;  1VQ4 T;  2EYW A;  2HKN A;  4M75 F;  2D8H A;  1UE9 A;  3L2Q A;  3OYA A;  2HQH A;  4R55 A;  3E1S A;  2YT6 A;  1K9A A;  1NYF A;  3MKD A;  3JCM e;  2RB6 A;  2KSS A;  3EG1 A;  4MML A;  3QG1 A;  1M1K C;  1Y96 A;  2YUO A;  2O88 A;  4QKU A;  2OTJ T;  1UEB A;  3NTH A;  1ZUY A;  4M78 A;  4C0D C;  4PJO D;  4XTY A;  2VWF A;  5FRM A;  4GBQ A;  4HVW A;  4M77 C;  1B3Q A;  5KH6 A;  4RCB A;  2X3W D;  1T0J A;  1GCQ A;  3WXM B;  1OI1 A;  1D0Z A;  1VQ4 A;  1PKT A;  4PJO F;  4M7D A;  1PKS A;  2MF2 A;  1TUD A;  2PVG B;  1UGP B;  3ME9 A;  1G2B A;  3ZBD A;  4J9E A;  4KUD K;  1QKX A;  3L2W A;  5J3B A;  4PJO C;  1PWT A;  2DL7 A;  4YTL A;  3SEM A;  2K5I A;  3PVL A;  4HCZ A;  3M0Q A;  2EFI A;  3CC4 T;  3V8L A;  1UTI A;  3OSS C;  3IQL A;  2JTF A;  3CCU Q;  1Y71 A;  2LQN A;  1SEM A;  1LNX A;  4C8Q E;  2A08 A;  3C4S A;  4K11 A;  3QII A;  1QVF S;  1WXB A;  1RUW A;  5GJW B;  5CAI A;  2Z0W A;  2A7Y A;  2P84 A;  1PM3 A;  2VGM A;  1NJI R;  4MZM A;  3A8L B;  4IKF A;  4BY6 C;  4LE9 A;  3GOX A;  3A8M B;  1KQ2 A;  1QQJ A;  1TU0 B;  2FZK B;  1KD1 U;  1UGS B;  5FLX E;  2DF6 A;  4FSX A;  1NPR A;  3O5Z A;  2KEA A;  4FYX B;  2L3S A;  3PE0 A;  1V29 B;  1QVG A;  1UG1 A;  4Z89 A;  4F7U A;  1VQN Q;  3WVE B;  4D8K A;  4L59 A;  3RER A;  2EYQ A;  1FMK A;  5KYU A;  3EFO B;  6AT1 B;  2KE9 A;  2NWM A;  4X34 A;  2RA2 A;  4QW2 A;  1YI2 Q;  2A36 A;  5FW9 A;  2DIL A;  5IHI A;  1BCM A;  2WSE E;  3LX7 A;  2DX1 A;  4PJO B;  1ABQ A;  1CKB A;  1ABO A;  2FYK A;  4BDZ A;  1W2B S;  2MPX C;  2DRK A;  5KYY B;  1NPP A;  3CCV Q;  1EX4 A;  1LVK A;  2RJE A;  2GFU A;  1Q7Y U;  2M16 A;  1MMA A;  5I22 A;  4R56 A;  1OZ2 A;  2FPE A;  1WYX A;  4EPC A;  1N5Z A;  4BI4 A;  2JVV A;  4C8Q F;  4E7S A;  2OTJ A;  3MET A;  3MP6 A;  1RAD B;  5HY6 A;  4C0Z A;  1ZA1 B;  1M90 C;  5GAM e;  4M7A A;  1K0S A;  5LJ5 j;  2DVE A;  1FXX A;  4OMQ A;  2CRE A;  3GLX A;  4BY6 B;  1VQ9 Q;  2E3I A;  3CCE T;  5FU7 C;  3NHN A;  3EG3 A;  2QQB A;  3MCA B;  3H6Z A;  1Q82 U;  4Q5W A;  3DB4 A;  2NUT A;  5GAN h;  1U06 A;  4M77 F;  4XU1 A;  1YI2 T;  1VQ6 T;  4M77 D;  3J81 E;  1BIB A;  2KMT A;  2QA4 A;  4ELY C;  3C94 A;  1SSF A;  4FSS A;  2BZ8 A;  2VB6 A;  4PJO G;  4BE2 A;  2GQV A;  2VXE A;  1OEB A;  2YUP A;  3TSW A;  3MO8 A;  3SHW A;  1KD1 R;  1C1A A;  1VIF A;  4TVR A;  4ZGE B;  2QI2 A;  1YJW Q;  3VUZ A;  1PD1 A;  3G6E A;  2P4R A;  3PNW C;  5HK0 A;  2RJC A;  1IZ6 A;  3CXC A;  2L8D A;  3VS3 A;  1NJI U;  3EH1 A;  4PLI A;  4N4G A;  1ZQ1 A;  1VQ5 A;  4F16 A;  4N0A C;  1G3W A;  5DY9 A;  4HKE A;  8ATC B;  1X6B A;  5CKH A;  4C5I A;  3CC2 T;  5GAN f;  2KVQ G;  4FW1 A;  2QEX T;  1WQW A;  1VQ7 Q;  2DAQ A;  3CQT A;  2DPP B;  3GNG A;  3VJP A;  3CCQ T;  2LJ3 A;  5GAM j;  3DKM A;  4XQ3 A;  2BKD N;  1K8A C;  3I5S A;  3VKI A;  2RHZ A;  1ZLM A;  2MWO A;  5HCK A;  1BI1 A;  3FRN A;  1JU5 C;  1TUG B;  2RHY A;  2W0Z A;  5GAN 6;  3G71 T;  2DXB A;  5FU6 C;  2AKK A;  3OYI A;  2DL4 A;  2K2V A;  1Q95 G;  5CKD A;  4XTU A;  1G3Y A;  1M3C A;  2LMJ A;  3MEV A;  4E7J A;  1EFN A;  1MGQ A;  2LX9 A;  4N0A A;  4QQ6 A;  1GBR A;  1I4K 1;  2L0A A;  1WHM A;  2OAW A;  1YIT Q;  2EJG A;  1VQK Q;  4M77 B;  5GMK h;  1M2V B;  1M1G A;  1UEC A;  4ME7 A;  2OTL Q;  4C8Q C;  1YNZ A;  2NLU A;  2HL5 C;  3EAE A;  2RPN A;  1JXO A;  4JJB A;  4C92 E;  2FRY A;  1WHH A;  1M3B A;  5GMK j;  1QLY A;  3H0I A;  2NYS A;  4PJL A;  2ROL A;  1OOT A;  2OJ2 A;  4RTV A;  2XD0 A;  1ZUU A;  2BTT A;  4PJO E;  5IXF A;  4WCI A;  4C92 F;  2EGA A;  3E9G A;  4RTW A;  2JUF A;  2ROT A;  3M9Q A;  1JRI A;  1VUB A;  4HA8 A;  5LJ3 e;  4PFZ A;  4IUQ A;  2I0N A;  4FYV B;  2KRM A;  3PVQ A;  2H3J A;  1VYT A;  4OF1 A;  3X24 B;  1YHQ A;  2Y90 A;  5GAM h;  3NMZ C;  2PZ1 A;  1Y96 B;  3SD4 A;  3RKW A;  4AFQ C;  2C0O A;  4J5Y A;  4FCY A;  3OS1 A;  5GAN e;  1NYG A;  2YSQ A;  1G83 A;  3CCJ T;  3BE3 A;  3PFS A;  2KYM A;  1M90 R;  2E64 A;  3SWN A;  3BDU A;  1Q86 R;  2JMC A;  2SRC A;  5C6S A;  4BE1 A;  1RAB B;  3LLR A;  2JXB A;  3DB3 A;  1YP5 A;  1IO6 A;  2HSE B;  2QEX Q;  4J6W A;  2L89 A;  3JB9 D;  2IPO B;  2RQU A;  1M30 A;  3P8B B;  3Q1J A;  1ZUK A;  1Y57 A;  4J83 A;  2CH4 A;  3LWH A;  1RL2 A;  2LNV A;  3EFO A;  1I0C A;  5DM7 R;  1WX6 A;  4A4H A;  1VQP T;  4EMK A;  3AT1 B;  1PRM C;  1RAE B;  4CC4 B;  2YRC A;  1JJ2 A;  4DA4 A;  2LP5 A;  2CYZ B;  4JJC A;  4FT2 A;  4FIB A;  2DZ9 A;  2RHX A;  2QQA A;  2K4Y A;  2ZCF B;  3QDR B;  4JLI A;  4E7H A;  1V76 A;  2KNB B;  2L2P A;  2QK0 A;  3NTK A;  2ECZ A;  3CPW S;  3VUB A;  3CCS A;  4ESR A;  1S72 Q;  1XTD A;  5GAN 4;  2LRQ A;  3MEA A;  3L2U A;  3M4G A;  2MIO A;  1U5S A;  5GAN d;  4M75 A;  1VQP Q;  1OYX A;  1KSW A;  1K1Z A;  4RG2 A;  1FYN A;  4Y28 E;  5CKB A;  1GRI A;  1VQ9 T;  2KK4 A;  2ZPI B;  2RQW A;  4HCK A;  3QSU A;  1VQM Q;  4A54 A;  1Q86 C;  2H8H A;  2XI9 A;  1N6A A;  3BFM A;  3SWN B;  4RG8 A;  3H41 A;  1G8X A;  1NM7 A;  4M7D D;  3CD6 T;  1T0H A;  3CCL A;  2LVM A;  2QYZ A;  3OA6 A;  4D8D A;  5FWC A;  1UJY A;  5KYW B;  1UFF A;  2KR3 A;  2ZPB B;  1YJ9 A;  2KDS A;  2KT8 A;  3EGX A;  4RCC A;  5FU7 B;  3VRZ A;  1N8R C;  2DMO A;  1U1T A;  2JJ9 A;  2CP2 A;  2DTO A;  2M51 A;  2EQK A;  2I2L A;  1ARK A;  2RQT A;  2E5Q A;  3CC7 A;  2CZ0 B;  3OS5 A;  3NTI A;  1RI9 A;  2CP7 A;  5KE3 A;  1M5Q 1;  4M7D C;  3L42 A;  3OYF A;  2DZC A;  4J9G A;  2E41 A;  1PSE A;  2EJ9 A;  3CCJ Q;  3EFS A;  3I55 A;  4CI0 C;  4OP0 A;  2HSP A;  4R0K A;  4C5G A;  1AOJ A;  3I55 T;  2CP6 A;  2A28 A;  1I1J A;  2K2M A;  3VYH B;  1VQL T;  3VU3 C;  3JB9 H;  3FLG A;  5IHK A;  3JCM g;  3VYG A;  3VV0 A;  5KYX B;  1VQM T;  4JRK A;  2YHT A;  3JCM Q;  1KC8 U;  3RKX A;  1X01 A;  2IG0 A;  5FRN A;  2R5M A;  5I2M A;  3JCM b;  5L23 A;  5AYF A;  1WJQ A;  4OMO A;  1YJ9 T;  4EDU A;  2ZGW A;  4FU6 A;  3RMS A;  2O4X A;  2PU9 B;  4ZNX A;  4C0G A;  2J6K A;  3QYG B;  3HP9 A;  2YUQ A;  1TOV A;  4FYY B;  1U1S A;  3EFR A;  1HD3 A;  1ZSG A;  2DJZ A;  2E6N A;  5CKF A;  2RN8 A;  1YIJ T;  3A8H B;  3X25 B;  4AT1 B;  2GNC A;  5GAO m;  1Q82 C;  3HRT A;  1WJR A;  2X4W A;  3PMT A;  4BI8 B;  2ZPG B;  3G71 Q;  1N9S A;  3QZ5 B;  3CCU A;  2RNA A;  2ZPE B;  1T3L A;  1WDX A;  5GMK l;  3QPH A;  1H3Z A;  1BI2 A;  1BI0 A;  2DVJ A;  2M9U A;  1BI3 A;  5FWB A;  1M90 U;  3CMA Q;  4AFU C;  2FO0 A;  2KY9 A;  2E3H A;  2A37 A;  2HDA A;  3M57 A;  4LD9 K;  1H92 A;  3UAT A;  2J05 A;  2VKN A;  2QA4 T;  1NJI C;  3J80 E;  1M1F A;  3OB9 A;  3CBP A;  3SDZ A;  1WXU A;  3LW5 E;  3M0U A;  2K5L A;  2DTH A;  1MMN A;  1X2K A;  5CR2 A;  4KUI A;  5AT1 B;  1VQL A;  4LNP A;  2JOY A;  1QKW A;  3OYC A;  1SRL A;  1VA7 A;  2GCX A;  1LOJ A;  1QP2 A;  3L2V A;  3CME T;  1K0X A;  2D6F A;  3HSB A;  1BB9 A;  3VS7 A;  3RDV A;  1PCX A;  2VGN A;  2BE9 B;  5FRO A;  5GAO p;  2EJF A;  4N4H A;  1R77 A;  4KUL A;  2CP3 A;  3EG9 A;  1TUC A;  1AWJ A;  1WHG A;  2EYX A;  3CCM T;  5C0M A;  1JB0 E;  2AT1 B;  4PLL A;  3L2R A;  2GF7 A;  2F2X A;  3PGG A;  1MHN A;  3S3O A;  1RAA B;  1GBQ A;  2KT1 A;  5GMK m;  4RTY A;  3KFV A;  5DLQ E;  3UT1 A;  4RUG A;  4E7L A;  3CPW P;  2JW4 A;  2J6O A;  4RTU A;  3BDL A;  5GAM g;  4JRQ A;  3OW2 P;  2EQU A;  1VQ9 A;  2DA9 A;  1Q7Y C;  2MK5 A;  1VOM A;  2LCC A;  2EQM A;  3EGU A;  5D6W A;  5GJV B;  3VS0 A;  2O31 A;  3TQ7 P;  4C8Q B;  3G6E T;  2C0T A;  3UDC A;  2R5A A;  1VQK T;  4C8Q D;  2MMP A;  5KYU B;  2QA4 Q;  1RLP C;  3OBW A;  1KQS P;  4NL3 A;  2RJF A;  4JS5 A;  3HL8 A;  4JJN K;  2O01 E;  1GCP A;  4II1 A;  1RI0 A;  2YLC A;  1E6G A;  2RF0 A;  3QO3 A;  2EYZ A;  2XMF A;  2CSI A;  2H3E B;  1YJW A;  4GY5 A;  4A4K A;  3V7C A;  2BZX A;  3JSC A;  3G6E Q;  2JN0 A;  2O9S A;  1VYV A;  3SB2 A;  2DYI A;  3I5R A;  4IIO A;  2ZPF B;  1BYM A;  1W70 A;  4A4E A;  2HD0 A;  2CDT A;  1VQ5 Q;  4HT8 A;  1PD0 A;  4ATO A;  2HQX A;  3EG0 A;  2RI5 A;  1M1K U;  4C5E A;  4C92 D;  4E7K A;  3CCQ Q;  1HYO A;  2E70 A;  4KGZ B;  3WVD B;  5I2S A;  4MMK A;  2HL3 A;  4PK4 A;  4J6X A;  1Q81 C;  5GMK i;  4MZT A;  3CCM Q;  1LCK A;  1NBE B;  2PVD B;  1X6O A;  4PNO A;  5GAM f;  2HZY A;  3M53 A;  1UGQ B;  2DEQ A;  1YN8 A;  2QTV A;  5GAO l;  2F2V A;  3A98 A;  1QVG P;  3S6W A;  3LWI A;  1KD1 C;  1LJO A;  3EGD A;  3CEY A;  2DXT A;  2JNG A;  2O4X B;  1YBY A;  1RAH B;  1AD5 A;  4J7F A;  1K73 C;  3HFN A;  2K9G A;  5J26 A;  1JJ2 P;  2RQV A;  3V8J A;  4BB7 A;  4O6J A;  2QDL A;  1UDL A;  2BIV A;  2LQ8 A;  3NPF A;  2K7A A;  4ELZ C;  4FYW B;  3OYK A;  2GGR A;  2MYS A;  2F1L A;  5ECA A;  4AG1 C;  1K4U S;  4QVD A;  1C6V X;  4OVA A;  1AVZ C;  2PUO B;  4X1V A;  5CQX A;  1KG1 A;  2COW A;  2E12 A;  3JCM X;  3QXE B;  2CZ6 B;  4C5H A;  3EGX B;  1SHF A;  4BD3 A;  5D7U A;  3JB9 F;  4V2S A;  3QJ6 A;  1M3A A;  2YRV A;  2NUP A;  2EBP A;  4EMG A;  2P0P A;  3I56 A;  3CCE Q;  3OYE A;  4ZGD B;  2CP0 A;  5LJ5 g;  3M58 A;  1KFZ A;  1PRL C;  1I81 A;  1B07 A;  2J7I A;  4M7A D;  3R6O A;  2F2W A;  4DOW A;  3CCR A;  3ZEH A;  4M75 E;  3R6N A;  4J9H A;  1KQ1 A;  2YXY A;  2DRM A;  1D0Y A;  1M8V A;  1F1B B;  5KYW A;  2DL3 A;  2C06 A;  2X4X A;  1I5L A;  2W10 A;  3EGD B;  2G3R A;  2VAS A;  1YHQ Q;  3HPW A;  2KXC A;  3INZ A;  4IUU A;  2X4J A;  2FVU A;  1M9S A;  2E4H A;  3S3N A;  2DEU A;  2VV5 A;  2COY A;  2V1R A;  4Z8A A;  1MUZ A;  2HQE A;  3JCM V;  2LTO A;  4PKC C;  2DO3 A;  1R0B G;  1V1C A;  2AZV A;  1D09 B;  4M78 C;  4KGV B;  1QVF P;  3MP8 A;  3QJY A;  4OB2 B;  5GAN 3;  2QDY B;  2JTM A;  1SPK A;  5LJ5 f;  3RR6 A;  1VQ8 A;  1GFD A;  1QWE A;  2CZ7 B;  2RI3 A;  2BZY A;  4QT7 A;  3CXC S;  2HMA A;  4JZ3 A;  1WXT A;  3OBY A;  4XTZ A;  5LJ3 d;  4LDV A;  4X9D A;  4VUB A;  1PSF A;  4HCB A;  3JB9 G;  4J9I A;  2QG9 B;  3MPU B;  3JRZ A;  4DBF A;  2XU8 A;  2FPD A;  2QQR A;  2FZG B;  3CC2 A;  1UUE A;  4EMK B;  4F7U G;  2XG8 D;  2JM8 A;  2L3R A;  3TRE A;  4QVZ A;  4C8Q A;  2DER A;  1WA7 A;  4ZN1 A;  2Y4Y A;  2LX7 A;  1M27 C;  5CIU A;  3M0S A;  3H0H A;  1TXQ A;  3QBY A;  2OX7 A;  1OU8 A;  4GLM A;  1TTH B;  1VQP A;  2E1H A;  4LXC A;  2J6F A;  4A63 B;  2EGE A;  3CPW A;  3A8O B;  1QCF A;  5J39 A;  3HRS A;  1HK9 A;  2XKO C;  1VQ6 A;  1HXD A;  2FPF A;  1VQM A;  2EKO A;  5IXB A;  3EG9 B;  1XNI A;  3VS4 A;  1X43 A;  4BE0 A;  2KRO A;  3FJ5 A;  5DLO A;  3CCL Q;  1GXI E;  3M5A A;  4B6M A;  2DK3 A;  1YJ9 Q;  3E19 A;  3ER0 A;  2AKL A;  4C8Q G;  2K3B A;  1JEG A;  1PC0 A;  5CKE A;  3A1P A;  1C0M A;  1K76 A;  2XDB A;  3G4S A;  1ZBJ A;  2HEQ A;  5D6X A;  2FL7 A;  2J06 A;  2CT3 A;  1PNJ A;  2A0F B;  2C0I A;  1IRX A;  2D8J A;  4XU2 A;  3LH0 A;  3GF5 A;  4OB0 B;  3V7R A;  2DM1 A;  1YIJ A;  1H8K A;  5FU6 B;  3GBQ A;  3CCJ A;  3JCM h;  3I55 Q;  4KH0 B;  3F70 A;  4DEX A;  2ESW A;  4M75 B;  1CSK A;  3PIP A;  3KUF A;  4JJD A;  1ZA2 B;  1TG0 A;  3QHS A;  2F5K A;  3JCM f;  1FMW A;  1UB4 A;  2M02 A;  1Z9Q A;  4MDX A;  3OYL A;  1SF9 A;  1GFC A;  2NUZ A;  1KHI A;  2XID A;  4HT9 A;  2V8K A;  3E9F A;  4LDW A;  4EMH A;  4DBQ A;  1ZX6 A;  1OV3 A;  3CCR T;  4BUG A;  3MP1 A;  1TH7 A;  1JJ2 S;  4E7Z A;  1OZ3 A;  1UGV A;  2RHI A;  1EZZ B;  8AT1 B;  3JB9 I;  3I56 T;  3OYD A;  2CT4 A;  4M75 C;  4UC4 A;  1N27 A;  2FRW A;  4AMC A;  2KRS A;  1K9M R;  1UHF A;  4HVV A;  1ZHI A;  1Y0M A;  3VS1 A;  3OYM A;  4J9D A;  4E6R A;  4JUV A;  2DD4 A;  2VYT A;  1OX8 A;  2MOX A;  3QWX X;  2L3P A;  4C0D B;  5CCA A;  3JCM c;  1SG5 A;  3MEW A;  3G71 A;  2K3Y A;  5LJ5 d;  5LJ3 h;  4C92 C;  3OSV A;  2K6D A;  4QQD A;  3CXC P;  2BE7 D;  1QMC A;  4M77 G;  2MAM A;  4A4G A;  2XHC A;  4N4I A;  4XK8 E;  2XK0 A;  9ATC B;  3HHT B;  3CMA A;  1YJN A;  4F7U F;  7AT1 B;  1AHJ B;  2E6Z A;  4BAC A;  2QAZ A;  2DET A;  1JQQ A;  1FMV A;  2DBM A;  2JT4 A;  1M2O A;  2YRD A;  1E7O A;  4A53 A;  4M7D B;  3CBO A;  2VC8 A;  4PFO A;  3OYJ A;  4A4F A;  1VQL Q;  5A0L A;  2CUB A;  4IIM A;  1KQS S;  3C95 A;  2R57 A;  4L5G A;  5GMK e;  1WJS A;  1CKA A;  1YIT T;  3ZFJ A;  1ZSZ A;  5IT9 E;  4DEY A;  1M1K R;  2SEM A;  3KXT A;  1PHT A;  4M7A F;  4ZN3 A;  4HCC A;  5CO7 A;  3SFM A;  3DLL A;  4F17 A;  5HK3 A;  5KCH A;  4M7A G;  3RBB B;  3X20 B;  3OW2 S;  1AWO A;  1WHL A;  1Y07 A;  4F7U E;  3LGF A;  2EQJ A;  3H8Z A;  2DTI A;  1VQN T;  1Q81 R;  2RQR A;  1GL5 A;  1TSF A;  3QWY A;  4PJJ A;  3CD6 Q;  3E2U A;  1Q82 R;  1SKU B;  2JS2 A;  3FEO A;  3LYI A;  5KYY A;  2EWN A;  3VS2 A;  3JB9 J;  3G1J A;  2JS0 A;  4XTX A;  3OMG A;  3M55 A;  2MCN A;  1NZ9 A;  3H0F A;  4M7D G;  2EYY A;  4RTT A;  1QCN A;  3QZ9 B;  1UGR B;  1W4S A;  5GAN g;  1MNE A;  5A0D A;  1QVF A;  1MV0 B;  1RAG B;  4AFS C;  3V7S A;  3JCM J;  2B86 A;  3OYY A;  2V26 A;  2WSC E;  1N8R R;  4JDS A;  2Y4X A;  3CC4 Q;  2CSQ A;  2V8I A;  1YWO A;  4FM4 B;  2LT1 A;  4XTW A;  3UF4 A;  1K9M C;  1P92 A;  3RKY A;  4F14 A;  1YHQ T;  4QQG A;  2HAX A;  1XOV A;  2D0N A;  2RO0 A;  2LNH B;  2LQK A;  2B8A A;  5L8R E;  4C92 G;  2CGH A;  3FJP A;  1BCO A;  1M8M A;  3CME A;  2QQ9 A;  1HJD A;  1VQO Q;  1N9R A;  1WHK A;  5A0G A;  2YLB A;  4DBR A;  1BIA A;  3CCQ A;  4M78 E;  2XDP A;  4C0F A;  3RES A;  1NEG A;  5LJ3 j;  1BU1 A;  3REB B;  3CCM A;  1YWP A;  2RMO A;  4Z88 A;  5KYX A;  2EGC A;  5KYN A;  4GLK A;  1WHJ A;  2NUT B;  4M78 B;  3PT9 A;  4OGE A;  4EMK C;  2HKQ B;  5GAN j;  3CBM A;  4X9C A;  1UJ0 A;  2X4Y A;  2DL8 A;  2DLP A;  1G3T A;  3H9N A;  3GNF B;  4KH1 B;  5GAO n;  1VQ4 Q;  2X51 A;  1FX7 A;  2PTK A;  2RH2 A;  2QGF B;  1YFN A;  2O2O A;  4RMO A;  1IB8 A;  2NUP B;  3PTA A;  5CK9 A;  2K5F A;  3OYB A;  5LJ5 h;  4ZTF A;  2ATC B;  2JM9 A;  1ZSZ B;  2HNI A;  3OY9 A;  1SSH A;  4M7A C;  2RM4 A;  1XJW B;  2DNU A;  2RD1 A;  3BW1 A;  3FIF A;  4WTO B;  4CC3 A;  4DOV A;  2M1H A;  1IHW A;  4KRT A;  2CUD A;  1NG2 A;  3J7A F;  2QQS A;  3ULR B;  3OYN A;  2JTE A;  3FC3 A;  3I56 Q;  1WI7 A;  1NLO C;  3CCE A;  1Z9Z A;  1OQK A;  4M78 F;  1JO8 A;  4IUR A;  1MMD A;  1W1F A;  1KK7 A;  1M2V A;  4MZP A;  3TEE A;  1KHC A;  3URG A;  4Y92 A;  4J7I A;  4CC7 A;  2X35 A;  4HXJ A;  4D6W A;  3QUI A;  3CCR Q;  4WF2 A;  2DIG A;  3CCL T;  4RTZ A;  2ENM A;  1IGQ A;  4M7D F;  4PJO A;  2CH4 W;  3M0R A;  3OYH A;  4E47 A;  3FDR A;  1D3B B;  1YCY A;  2EVR A;  1KC8 R;  4LDU A;  1I8F A;  3JCM P;  2HBP A;  1SRM A;  1EIF A;  4ZTJ A;  3C12 A;  4KBM B;  4LD6 A;  4FL6 A;  1VQN A;  2FHD A;  4FT4 A;  3CMA T;  1OPK A;  4QVC A;  1D0X A;  2DL5 A;  2V1Q A;  3C0C A;  3CCS T;  1YI2 A;  2GFA A;  2GTJ A;  1WLP B;  2GBQ A;  2GTO A;  3JAM E;  4OML A;  2RK2 A;  3UPU A;  1NEB A;  3U23 A;  4O5V A;  2XDD A;  3GIB A;  2ED1 A;  4PJN A;  3CCV A;  1D3B A;  1VQ7 T;  1VQ8 Q;  2AIR B;  2D0Q B;  5M9O A;  3VRY A;  3RMQ A;  3NFC A;  2LCL A;  1BK2 A;  1I5O B;  4F04 B;  2OTJ Q;  1K73 U;  2RK1 A;  2F5T X;  4M4Z A;  1K8A U;  2PNI A;  3OYG A;  3GPL A;  5GAN 7;  3HRU A;  4P5N A;  3CC2 Q;  3CPF A;  3SWN C;  1IHV A;  3EHR A;  2E10 A;  1IGU A;  3M0P A;  1W2B A;  4JZ4 A;  3PIO A;  2PVO B;  3D7S B;  4J8O A;  1H3H A;  2QTX A;  4Z02 A;  1MMG A;  2COZ A;  4IUP A;  5I11 A;  2DBK A;  1YJN T;  3CC7 T;  2KYB A;  2DIQ A;  1BBZ A;  2KI7 A;  1Q7Y R;  1MND A;  4J9B A;  1QVG S;  2AZS A;  2VUB A;  2FZC B;  1YJW T;  3FB9 A;  3P8D A;  1WZO A;  2BUD A;  1SHG A;  1IRE B;  1D1B A;  5GAN 2;  4RKU E;  2AK5 A;  2EAY A;  3TCJ A;  2CS7 A;  1JBM A;  1B34 B;  1K73 R;  5IN1 A;  4KGX B;  1ZBX A;  3HFO A;  1AWX A;  1OPL A;  4OGC A;  4IUV A;  3KBG A;  4OB3 B;  4LDY A;  2KBT A;  1VQ6 Q; 
#chains in the Genus database with same CATH homology
 3LH5 A;  2JMA A;  5FWB A;  2FPE A;  1WYX A;  4AFU C;  1GFC A;  2NUZ A;  2FO0 A;  1N5Z A;  1AZG B;  2A37 A;  2HDA A;  2KRN A;  1H92 A;  1ZX6 A;  1OV3 A;  3UAT A;  2J05 A;  2VKN A;  1QWF A;  4CC2 A;  1K0S A;  2YDL A;  2VVK A;  1UGV A;  3RNJ A;  2OI3 A;  4OMQ A;  2CRE A;  2ABL A;  2LCS A;  1WXU A;  3TVT A;  3M0U A;  1AEY A;  2L3Q A;  1X2K A;  2CT4 A;  3VS5 A;  4LNP A;  3NHN A;  1QKW A;  2FRW A;  2KRS A;  1SRL A;  2GQI A;  1UHF A;  2LZ6 B;  3EG3 A;  1AWW A;  1VA7 A;  2KXD A;  4HVV A;  2DYB A;  2K79 A;  1Y0M A;  1U06 A;  1YCS B;  3VS1 A;  4J9D A;  4E6R A;  1K0X A;  2ED0 A;  3I9Q A;  2MOX A;  3I35 A;  2D1X A;  3ZL7 C;  2E5K A;  1BB9 A;  3VS7 A;  1UHC A;  2O9V A;  3QWX X;  2L3P A;  4FSS A;  2BZ8 A;  2K6D A;  1X27 A;  1OEB A;  2LQW A;  2YUP A;  3UA6 A;  3TSW A;  3SHW A;  1TUC A;  1AWJ A;  2EYX A;  2P4R A;  2M0Y A;  3VS3 A;  1KJW A;  2F2X A;  1JQQ A;  4OMP A;  1U3O A;  1HSQ A;  2DBM A;  4F16 A;  1GBQ A;  2KT1 A;  4RTY A;  3KFV A;  2JT4 A;  4RUG A;  2JW4 A;  2J6O A;  4RTU A;  1E7O A;  1X6B A;  3TSZ A;  2DA9 A;  1GCQ C;  3CQT A;  2CUB A;  4IIM A;  3EGU A;  2LJ3 A;  5GJV B;  3VS0 A;  1J3T A;  2O31 A;  2C0T A;  1CKA A;  3I5S A;  1ZLM A;  5HCK A;  4DEY A;  2DE0 X;  1JU5 C;  2SEM A;  1RLP C;  2W0Z A;  3UA7 A;  2HBW A;  1PHT A;  2AKK A;  2DL4 A;  1GCP A;  3EG2 A;  2YUN A;  4RTX A;  4F17 A;  1E6G A;  1M3C A;  2EQI A;  2LMJ A;  3RBB B;  1AWO A;  1EFN A;  1GBR A;  2RF0 A;  1WFW A;  2EYZ A;  2XMF A;  2L0A A;  2CSI A;  1VYU A;  1AZE A;  2OAW A;  1I07 A;  2FEI A;  2BZX A;  2O9S A;  2RQR A;  1VYV A;  3I5R A;  1UEC A;  4IIO A;  4JPB W;  1GL5 A;  3QWY A;  1W70 A;  1YNZ A;  2CDT A;  2IIM A;  1KIK A;  2JS2 A;  2RPN A;  1JXO A;  1JXM A;  3JV3 A;  3EHQ A;  2FRY A;  4JJB A;  5IH2 A;  1M3B A;  3EG0 A;  1QLY A;  3H0I A;  3VS2 A;  2EW3 A;  1NLP C;  2JS0 A;  2MCN A;  2ROL A;  1X69 A;  1OOT A;  3H0F A;  2OJ2 A;  4RTV A;  2EYY A;  2LJ0 A;  4RTT A;  1ZUU A;  2BTT A;  1T3S A;  4J9C A;  5EC7 A;  1LCK A;  5IXF A;  4WCI A;  1MV0 B;  2EGA A;  2DJQ A;  4AFS C;  4RTW A;  1YN8 A;  2ROT A;  2B86 A;  2F2V A;  3A98 A;  2EPD A;  2I0N A;  3M0T A;  2KRM A;  3PVQ A;  1AD5 A;  2CSQ A;  1VYT A;  3THK A;  1YWO A;  3UF4 A;  3NMZ C;  2PZ1 A;  4F14 A;  2K9G A;  4AG2 C;  2RQV A;  4AFQ C;  2C0O A;  2QDL A;  1UDL A;  1XOV A;  2D0N A;  2LNH B;  3NPF A;  1NYG A;  2YSQ A;  2K7A A;  1G83 A;  2KGT A;  2GGR A;  2KYM A;  1M8M A;  5ECA A;  4HVU A;  4AG1 C;  1K4U S;  5IHN A;  2JMC A;  1AVZ C;  4X1V A;  1HJD A;  2SRC A;  1MV3 A;  2LJ1 A;  2EKH A;  2JXB A;  4J9F A;  1SHF A;  1YP5 A;  1IO6 A;  1NEG A;  1M3A A;  3VS6 A;  1BU1 A;  2EBP A;  2RQU A;  3REB B;  1WIE A;  1M30 A;  4LN2 A;  1YWP A;  2RMO A;  1RLQ C;  4Z88 A;  2EGC A;  4LUD A;  1KFZ A;  1ZUK A;  1Y57 A;  1PRL C;  1B07 A;  2CH4 A;  2J7I A;  2F2W A;  3R6N A;  4J9H A;  1X6G A;  4OMM A;  2DRM A;  1I0C A;  4OMN A;  1WX6 A;  3REA B;  1S1N A;  1UJ0 A;  4AFZ C;  2DL8 A;  1PRM C;  2DLP A;  2HCK A;  4CC4 B;  2DL3 A;  2PTK A;  2W10 A;  2KXC A;  2LP5 A;  2O2O A;  1W6X A;  4JJC A;  4ORZ A;  2G6F X;  2FG0 A;  4EIK A;  1E6H A;  2V1R A;  4Z8A A;  2JM9 A;  1MUZ A;  1SSH A;  1X2Q A;  2KNB B;  2L2P A;  4LUE A;  1A0N B;  3NGP A;  1V1C A;  2AZV A;  2ECZ A;  2X3X D;  2DNU A;  4ESR A;  2EYW A;  2D8H A;  4CC3 A;  1UE9 A;  2MIO A;  4KRT A;  1U5S A;  2CUD A;  1NG2 A;  2YT6 A;  1K9A A;  1SPK A;  1NYF A;  1KSW A;  1K1Z A;  3ULR B;  1FYN A;  2JTE A;  3EG1 A;  1GRI A;  1WI7 A;  1NLO C;  1GFD A;  1QWE A;  1Z9Z A;  2YUO A;  2O88 A;  2RQW A;  1JO8 A;  1W1F A;  2BZY A;  4HCK A;  4QT7 A;  4JZ3 A;  1ZUY A;  1WXT A;  4Y92 A;  2H8H A;  4CC7 A;  2VWF A;  4HXJ A;  4J9I A;  3H41 A;  4GBQ A;  4HVW A;  1NM7 A;  4RTZ A;  1T0H A;  2ENM A;  1B3Q A;  2X3W D;  2FPD A;  1T0J A;  1GCQ A;  2CH4 W;  4D8D A;  3M0R A;  5FWC A;  1UJY A;  1PKT A;  1UFF A;  2KR3 A;  1PKS A;  1UUE A;  2EVR A;  2KT8 A;  3VRZ A;  2DMO A;  1TUD A;  2JM8 A;  1SRM A;  2M51 A;  1ARK A;  1G2B A;  2RQT A;  4J9E A;  1WA7 A;  1QKX A;  2LX7 A;  1M27 C;  3M0S A;  3H0H A;  1OPK A;  1PWT A;  2DL7 A;  2DL5 A;  2V1Q A;  3C0C A;  3SEM A;  1RI9 A;  3PVL A;  4J9G A;  2GTJ A;  3M0Q A;  1WLP B;  4GLM A;  2GBQ A;  2GTO A;  4OML A;  1NEB A;  1UTI A;  3U23 A;  2ED1 A;  3IQL A;  2J6F A;  2HSP A;  2EGE A;  4A63 B;  4R0K A;  2LQN A;  1AOJ A;  1QCF A;  1SEM A;  2A28 A;  1I1J A;  2K2M A;  2A08 A;  4K11 A;  5IHK A;  1WXB A;  1RUW A;  5GJW B;  3VRY A;  2FPF A;  5IXB A;  1BK2 A;  3VS4 A;  1X43 A;  4LE9 A;  2KRO A;  3FJ5 A;  5L23 A;  4M4Z A;  2PNI A;  4OMO A;  3EHR A;  2DF6 A;  4ZNX A;  3M0P A;  2AKL A;  2J6K A;  3O5Z A;  4JZ4 A;  2K3B A;  1JEG A;  2KEA A;  2YUQ A;  1K76 A;  1H3H A;  2L3S A;  3PE0 A;  5I11 A;  1ZBJ A;  2DBK A;  2HEQ A;  1UG1 A;  4Z89 A;  2KYB A;  4D8K A;  1HD3 A;  1BBZ A;  4J9B A;  2J06 A;  1ZSG A;  2AZS A;  2CT3 A;  1PNJ A;  1FMK A;  2C0I A;  2RN8 A;  2D8J A;  2DM1 A;  2KE9 A;  2NWM A;  1H8K A;  2A36 A;  5FW9 A;  2GNC A;  1SHG A;  2DIL A;  3GBQ A;  5IHI A;  2DX1 A;  2AK5 A;  1ABQ A;  1CKB A;  1ABO A;  4DEX A;  2ESW A;  1CSK A;  2DRK A;  2RNA A;  4JJD A;  1T3L A;  1WDX A;  1TG0 A;  1AWX A;  1OPL A;  1Z9Q A;  5I22 A;  2KBT A;  2DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...