4OMMA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant n113s
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNSTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The role of Gutamine 128 of the SH3 domain of the c-Src tyrosine kinase in 3D domain swapping and amyloid formation
rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 5
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ommA00
1TG0A 1UFFA 2D8HA 2EYXA 2KR3A 3O5ZA 1OPKA 2KRSA 1B07A 1OV3A 2LNHB 1K9AA 2YUQA 2CSQA 1Y57A 2ESWA 2KXCA 1HSQA 4JJCA 1V1CA 2CT3A 2OAWA 4J9BA 4DEYA 4LE9A 2DJQA 1BB9A 2KYMA 1ZSGA 1WA7A 4Z8AA 2GQIA 2BZXA 4Y92A 1AOJA 3SEMA 1BU1A 2CH4A 2E5KA 2A08A 1UJ0A 4OMNA 4OMPA 4WCIA 2W10A 4AFZC 4HVWA 5ECAA 1K0XA 1Z9QA 5FWCA 3ULRB 2QDLA 1ARKA 1K1ZA 2VKNA 3I5RA 4AFSC 2HSPA 2J05A 4K11A 4DEXA 4OMQA 4KRTA 2FEIA 2MIOA 4JZ3A 4GBQA 1XOVA 2ABLA 2DNUA 2K79A 1E6GA 1GCQA 2EGEA 3QWYA 1MUZA 1FMKA 2DBMA 3PE0A 2EW3A 4M4ZA 2LQWA 2AKKA 2IIMA 2NUZA 1PKTA 3JV3A 2ROLA 3GBQA 1IO6A 2F2WA 3A98A 1UECA 4X1VA 4AG2C 2BZ8A 1X6BA 1OEBA 4AFQC 1T0JA 2DX1A 2D0NA 4RUGA 4EIKA 1K4US 3I35A 4OMMA 1X2KA 1KFZA 3H0FA 2DL7A 2YDLA 4J9FA 1GBQA 2L3QA 2J06A 1VYUA 1WYXA 1WLPB 5IHKA 2EYZA 1QKXA 2C0IA 2FRWA 4ESRA 1X69A 2PNIA 3LH5A 2L0AA 4AG1C 1WXUA 3TSZA 4RTTA 2BZYA 1U3OA 2RQVA 3I5SA 3M0TA 2JMCA 2G6FX 2DVJA 2V1RA 1NYFA 2AZVA 2DBKA 2EPDA 2JTEA 3VS2A 2HCKA 4LN2A 1AEYA 2YUOA 1PHTA 2F2VA 1NM7A 2ROTA 4RTUA 2JXBA 1RLPC 2CREA 2SRCA 1JXOA 2LJ1A 1E7OA 1EFNA 1M3CA 2D1XA 4J9IA 2DMOA 5L23A 3SHWA 3KFVA 4A63B 1UG1A 2LX7A 1AWOA 2FPDA 2RQTA 3VS0A 2DYBA 1ZUKA 2JMAA 1AWXA 1T3LA 1UGVA 2YT6A 2GTOA 1H3HA 4HVUA 4ORZA 1TUDA 1SRMA 2DM1A 3NHNA 2RN8A 1JO8A 4ZNXA 1AZGB 1WI7A 2L3SA 3H0IA 2DILA 2CT4A 1QLYA 3ZL7C 2FPEA 4OMLA 1X43A 1YCSB 2J7IA 1MV0B 2K3BA 2KRNA 2AK5A 2LMJA 1UDLA 2KYBA 1AZEA 2KGTA 2JS2A 3H0HA 2MOXA 1YP5A 2FPFA 1Y0MA 3VRZA 1ZX6A 4JPBW 2YUPA 3VS7A 1SRLA 4D8DA 2K9GA 1WDXA 2DA9A 4HVVA 1WIEA 2DL8A 2KT1A 1K0SA 1B3QA 2JT4A 1ABOA 1X2QA 2EYYA 1YWOA 2KXDA 3REAB 1G83A 2J6KA 2P4RA 4AFUC 3NMZC 5EC7A 2XMFA 1NEGA 4CC4B 1W1FA 1QWEA 5FWBA 2LZ6B 1K76A 2LQNA 2V1QA 1YNZA 2X3XD 1QCFA 1AWWA 1J3TA 2O31A 4R0KA 2SEMA 3EG2A 1VYVA 1HD3A 1M30A 1ZUYA 2EQIA 2KROA 2LJ0A 2A37A 3RNJA 4OMOA 2EYWA 2CSIA 3EG3A 1QWFA 1OOTA 3REBB 4RTYA 1PNJA 1I07A 1T0HA 1KIKA 2YSQA 1T3SA 4CC7A 2ENMA 5I11A 1H8KA 1GCPA 1CSKA 1A0NB 2AZSA 2K7AA 2ED0A 2ECZA 3VS6A 2DRMA 2X3WD 2JW4A 1VA7A 2O9SA 2RQUA 1GFDA 2L3PA 1PRMC 1E6HA 1X27A 3NGPA 1NEBA 2GBQA 1HJDA 4LNPA 1ZLMA 2RMOA 1VYTA 1RUWA 2K2MA 3I9QA 4RTZA 4QT7A 2KT8A 2DL3A 2MCNA 1GFCA 2GGRA 1NLOC 2FO0A 1UTIA 4IIOA 1UJYA 1H92A 2DL4A 4LUDA 2DLPA 2CDTA 3UF4A 1U06A 1GCQC 3U23A 4HXJA 4CC3A 2DE0X 3UA6A 1X6GA 2FG0A 4FSSA 1I0CA 3UATA 1CKBA 2BTTA 3VRYA 3M0PA 1NLPC 1AVZC 2D8JA 3PVLA 5GJWB 4F17A 1JQQA 1PKSA 1UHFA 2EVRA 5FW9A 3TSWA 1N5ZA 1UE9A 2PTKA 2W0ZA 1LCKA 2NWMA 4HCKA 3FJ5A 3EHQA 1SHFA 5HCKA 3THKA 2EKHA 2EGCA 1U5SA 2KRMA 4J9HA 4LUEA 3EG1A 1S1NA 1GBRA 4Z89A 2KNBB 1M3AA 1CKAA 2DRKA 1PWTA 1RI9A 2L2PA 2F2XA 3M0QA 2KE9A 2HDAA 1NG2A 4JZ4A 2JM9A 1YWPA 3VS1A 2J6OA 3NPFA 2M0YA 2CUBA 1W70A 1G2BA 3R6NA 2K6DA 3M0UA 1SHGA 5IH2A 2HEQA 4RTXA 1UUEA 4J9GA 3UA7A 3EGUA 1YN8A 2RF0A 4JJDA 2OJ2A 2H8HA 1WFWA 3M0SA 3EHRA 2RQRA 1QKWA 1AD5A 1SPKA 1SEMA 1WXBA 5I22A 1ZBJA 1KSWA 3IQLA 3QWXX 2J6FA 1GL5A 5IXFA 2B86A 1MV3A 2C0OA 1UHCA 2KBTA 3RBBB 2FRYA 2JM8A 2RNAA 2YUNA 1BBZA 1W6XA 1WXTA 1M27C 3PVQA 2O9VA 3VS5A 1M3BA 1Z9ZA 1OPLA 3M0RA 1ABQA 4RTWA 2GNCA 2O2OA 2A28A 4J9DA 1SSHA 5IHIA 5GJVB 4D8KA 2EBPA 4JJBA 5IHNA 3VS3A 1WX6A 2RPNA 4J9CA 3EG0A 4IIMA 1TUCA 2CH4W 1JXMA 2C0TA 2VWFA 1I1JA 4GLMA 1JEGA 2JS0A 2EGAA 2VVKA 2LJ3A 1PRLC 1NYGA 1KJWA 1BK2A 2A36A 4Z88A 4F14A 2GTJA 1AWJA 2ED1A 2M51A 1JU5C 4RTVA 4CC2A 3H41A 2LCSA 3CQTA 2DF6A 3C0CA 5IXBA 2KEAA 1FYNA 2PZ1A 4E6RA 1GRIA 2CUDA 2I0NA 2O88A 2HBWA 1RLQC 4J9EA 4F16A 1ZUUA 2RQWA 2AKLA 2OI3A 1M8MA 2DL5A 2LP5A 3VS4A 3TVTA
chains in the Genus database with same CATH superfamily
5IAYA 2JTMA 2YLBA 2KR3A 4C92E 2Y90A 2VB6A 2CP7A 3RKWA 2IVWA 3BFMA 2ESWA 4AT1B 2KXCA 1HSQA 1OQKA 4M77A 3M55A 1SSFA 1WA7A 2MMPA 4Z8AA 4M78D 1I8FA 2GQIA 2K3XA 4C92A 2HL3A 1UJ0A 1K73U 1YFNA 4HVWA 2HKQB 2LQKA 1H3ZA 4OMQA 4KRTA 4XU0A 4GBQA 1XOVA 3ASKA 3L1AA 1E6GA 3VUBA 1QVFA 5A0GA 1MUZA 1FMKA 1V76A 3PE0A 2EW3A 3PTAA 3OMCA 5CK9A 5I21A 1PKTA 3GBQA 2CZ6B 3G71Q 2QGFB 3OYYA 1VQ9Q 2EFIA 4C8QG 4AFQC 2HD0A 3HPWA 2D0NA 4PJMA 4OMMA 2E1HA 1TTHB 1X75C 2XDPA 3T9NA 5GAOq 2YDLA 3MHXA 3CCJQ 1JB0E 2JUFA 2DZCA 1Q7YU 1QKXA 1KD1C 4M7AC 3DKMA 1VQOQ 2FRWA 4C5EA 4X9DA 1X69A 2PNIA 3CCLT 3LH5A 2L0AA 4JS4A 4AG1C 3TSZA 2OTLQ 1N8RR 4M77G 3M0TA 2DXTA 2JMCA 2G6FX 3ZFJA 4LDYA 1QVPA 3PMIA 2AZVA 3CCEA 5HK3A 2JTEA 3VS2A 5GAN3 3BY7A 2HCKA 2YUOA 2F69A 1PHTA 3C94A 5J26A 1NM7A 2ROTA 4RTUA 3OYDA 4C92C 3EFRA 1KK7A 2CP3A 3UDCA 1JXOA 2LJ1A 3CC7Q 1BIAA 1WHGA 4C8QE 1M3CA 2DMOA 5CKHA 3OYLA 1D0ZA 2RQTA 1TWBA 2DYBA 2YT6A 1AWXA 3EGXB 4PJJA 4BDYA 5I2MA 1PM3A 4ORZA 1IGQA 3FJPA 3NHNA 3M53A 2E65A 4KBMB 4OB0B 4ZNXA 3GOXA 1WI7A 2KY9A 2L3SA 3M54A 1YBYA 3A5ZB 1QP2A 1X43A 1MV0B 4J5YA 2KRNA 3QJ6A 2NUPA 2LMJA 1AZEA 3X25B 4XU3A 3CMET 3X20B 1QMCA 2FPFA 2F5TX 5LJ3h 1D09B 5GANd 2YUPA 1SRLA 2ZAEA 2ZCFB 1WDXA 5GAOm 1QVFS 4HVVA 2E10A 4OGCA 2RJCA 2EYYA 3KBGA 4XAXB 3REAB 2J6KA 4AFUC 4PL6A 1NEGA 4CC4B 1PG5B 4M7DG 2IG0A 3LH0A 1Q7YC 1QWEA 4XTUA 2ZPFB 1K76A 2V1QA 1YNZA 1YIJQ 4R0KA 5C0MA 1M4ZA 3ER0A 3CC7A 1VQ8A 1PC0A 1VYVA 1HD3A 2HSEB 3CCUT 1RAEB 3H9NA 3NTKA 5LJ5g 2EQIA 2LJ0A 1VQLQ 1QVFP 2CS7A 2CSIA 4RCBA 3LGFA 3A1PA 3MCAB 4LDUA 2X4XA 3CMAA 2CKKA 1OOTA 1C1AA 1I07A 4FSXA 3CBMA 5LJ5f 1N9RA 3OYHA 1FWZA 4CC7A 3CCST 1XQHA 3J7AF 1G3WA 1H8KA 3A8HB 1A0NB 2K7AA 1WHHA 2CZ0B 1IZ6A 2RQUA 4MMKA 2F1LA 3CBPA 3QYHB 4C0ZA 3UPUA 3OB9A 1E6HA 1K73C 3QG1A 5CR2A 3JCMJ 1W2BP 2PUOB 2PUKB 2QTXA 4FW2A 2HAXA 4LXCA 1ZLMA 3CCMA 2LCCA 1JBMA 2K2MA 3I9QA 4C92G 4QT7A 2CP2A 3SWNB 4M78E 4BI4A 4DBHA 1GFCA 1NLOC 1UTIA 4J7IA 5CKFA 1UJYA 3OW2A 2DL4A 4II1A 2CDTA 1U06A 3OYNA 4L6V5 5EG2A 2DE0X 4E7SA 2FG0A 2QEXT 3MEAA 4FSSA 2OX7A 1UGRB 3SD4A 1D0YA 1VOMA 1I0CA 1RAIB 2D9TA 1WHLA 4DBRA 1SKUB 1WHKA 2E4HA 1AVZC 3CCRQ 5GJWB 3CMAQ 1S72Q 4IUQA 1RAHB 4N4GA 2W0ZA 4ZGDB 3FB9A 1LCKA 2IPOB 4C8QA 4HCKA 3EHQA 5HCKA 4DA4A 3QKJA 1IREB 3LYIA 1M9SA 2LX9A 2RJEA 3EG1A 4Z89A 2KNBB 3I55A 2DFUA 2K5FA 2DRKA 5KH6A 1PWTA 2PU9B 3UT1A 3EH2A 2J6OA 3NPFA 1W70A 5CKEA 4HCZA 1W2BA 5GAMj 2R58A 4F7UF 3ME9A 5M9OA 1VQLT 1QVGS 2O4XA 3V8KA 4L59A 4A4KA 3GNFB 2RQRA 4L5GA 2K57A 1SPKA 5I22A 2RHZA 1MHNA 3IQLA 3QUIA 1NJIU 1LVKA 2CP6A 1VQKT 2EJFA 3JCMc 4EMKB 3LWIA 3PIOA 1PSEA 2XDDA 3RBBB 1VUBA 3HHTB 4PFOA 3CXCS 1YJ9A 1W6XA 1U8RA 1YCYA 3M56A 3VS5A 3F70A 3PIPA 2GNCA 2WSEE 3PGGA 3CCRA 2VC8A 2OTLT 4J9DA 1TU0B 5IHIA 1S72A 5GJVB 2JZ2A 4M7DD 3M9QA 4C92D 2X4JA 5IHNA 3VS3A 5KCOA 1JXMA 2C0TA 1VQ4A 3A8LB 2EGAA 2DTIA 3DB3A 2DD5A 4MZMA 2VVKA 2M16A 1KC8C 1PRLC 2DJZA 1NYGA 2P84A 4R55A 1WJQA 2GTJA 2M1HA 5LJ3j 1AWJA 4CRIA 2ZPGB 1BCOA 4CC2A 4MDWA 2HZYA 3C0CA 1FMVA 2PZ1A 3R6OA 1GRIA 2HBWA 1X6OA 1RLQC 5CIUA 4F16A 4C8QF 1M1FA 3HTRA 4C92B 3NFCA 2DL5A 1N8RC 1UGSB 3MP1A 2EKOA 1VQ5Q 3FEOA 3G6EA 5GAN5 2YUQA 4P5NA 1KQSS 5CAIA 1IRXA 2M0OA 4A4HA 5FRMA 2RK1A 3OYMA 3HRTA 4J9BA 5IN1A 1WHJA 4LE9A 2DJQA 1BB9A 3L2VA 1WPYA 1YITQ 2KYMA 1ZSGA 2JOYA 4IUPA 3CD6Q 2BZXA 2COWA 4LDXA 3QYGB 3SEMA 1BU1A 5LJ5d 2A08A 5FU6C 4WCIA 2AIRB 5ECAA 3CPWP 4M75E 3ULRB 1VQNT 1ARKA 1K1ZA 2AT1B 2RJDA 2HSPA 2J05A 3QJYA 3CCLQ 3CC2T 2EJ9A 4PJOE 2DNUA 2K79A 4HCBA 1GCQA 4C5HA 2EQMA 2CGHA 4XTZA 4M4ZA 4QVZA 4KGZB 4M75A 3QZ5B 2V26A 3RIRA 2K2VA 2NUZA 5CVIA 2ROLA 1QP3A 1UECA 4X1VA 1VQOA 2JNGA 1N9SA 1X6BA 1B34A 2OTJA 3I35A 3JCMe 1X2KA 2QA4A 3OW2S 1R0BG 3RKXA 1VQ9T 4FYWB 4KH1B 1Y96B 1WLPB 1M2OA 1PD1A 4Q5WA 9ATCB 2C0IA 2COYA 3O8VA 3H8ZA 5KCHA 3A8OB 2QXFA 4ESRA 3EAEA 1M90U 1MGQA 4XTWA 2LT4A 3M4GA 2BZYA 3BW1A 1U3OA 2YHTA 3CC4T 2EYQA 2VGMA 2DVJA 2LVMA 2WSFE 1R77A 2VXEA 4TVRA 3JB9H 3GNGA 3QZ9B 4M78C 1NYFA 2DBKA 2EPDA 1AT1B 2PVDB 3RERA 1YI2Q 2GQVA 4LN2A 4J8OA 2F2VA 4FW1A 3CXCP 1K8AC 1M5Q1 1EFNA 5KYYA 2M02A 1K9MU 2JN0A 4RKUE 4J9IA 1YJNA 2DXCA 2HL5C 4IURA 2FPDA 3VS0A 1QW1A 1AHJB 4M77E 2Y4YA 1BI3A 1KC8R 3G7ZA 2GTOA 1H3HA 1EZZB 4HVUA 4YTLA 4HT8A 2DM1A 2RN8A 1OU9A 3H0IA 2MI6A 1QLYA 2PQWA 1D3BB 4KULA 5GANg 3BDLA 4NS5A 2KYBA 3HFOA 2DIQA 3H0HA 5GAMf 4JPBW 2NUPB 4ZTFA 2B8AA 3J81E 2DA9A 4C0DB 5J3BA 1WIEA 1K0SA 1B3QA 4GY5A 1VQLA 3G1JA 5D6WA 1RADB 2ZGWA 3NMZC 5FU7C 1TS9A 2LZ6B 2LQNA 2HQHA 1J3TA 2O31A 3E9GA 1VQMT 1HYOA 3OYJA 2DIGA 2VXFA 2QTVA 1OZ2A 3EG3A 4QQGA 5GMKm 1VQKQ 1PNJA 4M77F 5D7UA 4BY6C 4XTXA 3CCRT 2XD0A 3G6ET 5J39A 2YSQA 4M75D 2DEUA 1K73R 2ENMA 2FZCB 3QDFA 3OYFA 4A4FA 4KUIA 4FT4A 3QBYA 3VUZA 2AZSA 3C4SA 1YJWQ 2ECZA 3VS6A 2DRMA 4E7KA 5DY9A 3CC2Q 2O9SA 4BE1A 2L3PA 2EIFA 3EFOB 2XDBA 4FYXB 1NEBA 2QQ9A 1D3BA 2FZKB 1Q81U 3FC3A 4LNPA 2RMOA 2GF7A 2E12A 3JCMb 1LPLA 4UC4A 4RTZA 2XI9A 2P0QA 1OX9A 4C0DC 4IIOA 4MDXA 1H92A 2LCLA 2DLPA 2LQ8A 1QCOA 3MO8A 4AMCA 1GCQC 1VQ5T 4WF2A 4PFZA 4CC3A 2EAYA 3UA6A 4B9XA 5GAN2 4XU1A 5L8RE 2A3LA 1VQ7Q 4M7DB 3EG9A 3M5AA 2E3IA 3CPWS 3UATA 1CKBA 4LD6A 3VRYA 3L2RA 1VQ6A 1JQQA 1YJWT 3A8GB 4NOYA 3TSWA 4ZGEB 1MMAA 3FJ5A 1U1TA 2EQKA 5KYYB 4PK4A 4C8QC 4C8QD 5GAMh 3CCVQ 1S1NA 3CC7T 1GBRA 2BKDN 3JRZA 1CKAA 1RI9A 1TH7A 2F2XA 2JVVA 1KD1R 1ZSZC 2JM9A 4C5GA 3QXEB 3L2ZA 2ZPIB 1VQNQ 4CI0C 4M78F 1SHGA 4PFPA 5GAOr 2XG8D 2KMTA 5IH2A 2HEQA 4RTXA 1MNEA 3EGUA 3TREA 2XU8A 3I55T 2H8HA 2QG9B 1VQ6T 2V8KA 3M0SA 4ZTJA 2MK5A 4N4IA 1AD5A 4M77C 4ME7A 3X24B 1D1AA 1ZBJA 3M4YA 1KSWA 4M78G 4X9CA 1MV3A 2E5QA 2C0OA 1UHCA 5CKBA 2HKNA 4O5VA 4EDUA 2FRYA 1HXDA 3S3OA 1WQWA 1W4SA 3OYKA 2DXBA 3WVEB 5D6YA 4WTOB 1Z9ZA 1M90C 1OPLA 1VIEA 4RTWA 2X9HA 5A0DA 2O2OA 2A28A 3I56A 4E7ZA 2EBPA 3MEVA 2L5QA 3L42A 1IB8A 4B9WA 1XNIA 4EMHA 3QPHA 3MKDA 1UGQB 2O01E 2OTLA 4JUVA 2LJ3A 3HP9A 1HK9A 2RHXA 1BK2A 2EWNA 2RI5A 1KQ1A 2DKGA 3GP8A 3H41A 3CQTA 3JCMd 1P92A 5HK0A 5IXBA 2KEAA 2M9UA 4KGXB 4E6RA 1ZSZB 8ATCB 2FHDA 1JJ2P 2DO3A 1VQPT 1M8VA 3ZBDA 2AKLA 4DBQA 1M2VB 3G4SA 2LP5A 1YHQT 2DAQA 3SFMA 3TVTA 2HQEA 3OS5A 1TG0A 1UFFA 5LL6S 2D8HA 5FU6B 3O5ZA 1KQSA 4X34A 4C0FA 1OPKA 1JJ2A 1B07A 2CZ1B 4BACA 3CCLA 2ZZDA 2QQAA 3GF5A 1RAFB 2P0PA 4JJCA 2CT3A 2OAWA 4DEYA 4ZN3A 3E19A 2P4TA 5GMKl 1O9SA 4HKEA 2QI2A 4Y92A 3CCQT 2E5KA 4OMNA 4B6MA 4JJNK 4N4HA 4OMPA 1Z9QA 5IT9E 1G3YA 4DEXA 2YXYA 2FEIA 3AHUA 2ABLA 8AT1B 1D1CA 2EGEA 3QWYA 4M7AF 2DBMA 4F04B 5GMKh 3TCJA 3OA6A 3CBOA 4M75C 2E41A 3C12A 3JV3A 1IO6A 1IGUA 2QYZA 3RMSA 1KD1U 1LJOA 2BZ8A 5KYXA 3P8HA 3JCMg 1Q81C 4F7UB 4Z02A 3OY9A 1T0JA 2DX1A 2CZ7B 4RUGA 2RHUA 1YJ9Q 3CCMQ 1EX4A 1KFZA 2DL7A 2YRDA 5GANf 2KAFA 3OSSC 1QCNA 1VIFA 2WACA 2L3QA 2RHIA 1BKBA 1WYXA 2H3JA 5IHKA 3CCMT 4M78B 1QVGP 1ZQ1A 3QHSA 4IUTA 3QDRB 1BCMA 2DPPB 3S3MA 3VYGA 1O75A 4KH0B 4J7FA 1ACMB 4FYVB 1YITT 4E7IA 2G3RA 5GAOn 4RTTA 2A0FB 1YJNQ 1Q86R 2E3HA 3LWHA 4N0AC 4M78A 4FM4B 2JXBA 1RLPC 4QQ6A 1E7OA 4BI3A 2RD1A 2D1XA 1OYXA 4KGVB 3SHWA 3KFVA 1RAAB 1MNDA 1UG1A 2LX7A 1AWOA 4XQ3A 2QQSA 1NBEB 4PJLA 1ZUKA 3J80E 1RL2A 4OB3B 2JMAA 1UGVA 4PJOB 3NTIA 3CCSA 4BE0A 5HY6A 2BE9B 3FIFA 4EMGA 1SRMA 1JO8A 3AT1B 3CC4Q 4FIBA 4M75B 4A4EA 2CT4A 5GAN4 4OMFB 3ZL7C 2FPEA 4OMLA 5LJ3e 3OYGA 2J7IA 3OYIA 2AK5A 3I56T 1UDLA 4ATOA 3E2UA 2LRQA 5CO7A 1YP5A 3JCMW 1ZX6A 2QAZA 4EMKA 3VS7A 5GMKi 4D8DA 2E70A 2MAMA 5KE2A 2JT4A 1X2QA 1YWOA 4OGEA 3I56Q 2PVOB 4BI8B 2HMAA 4M77D 4DBFA 4DOWA 5EC7A 2XMFA 4JLIA 2V8JA 2BE7D 3VKIA 1YI2A 1W1FA 1BI2A 5CQYA 4DQ2A 3X28B 4LDWA 1N27A 2X3XD 3CCQQ 1AWWA 1KG1A 3EG2A 3RR6A 1G8XA 1M30A 4M75G 1UB4A 1SG5A 3V8JA 2KROA 1PSFA 3FDRA 4NL3A 2A37A 3OS1A 4OMOA 2EYWA 3V7RA 1YHQA 2NUTB 1QWFA 2R57A 4XTVA 5FU7B 3REBB 1UGPB 1T0HA 4QQDA 1T3SA 5GAMe 3OBWA 5I11A 3S3NA 4PJOC 1CSKA 4E7JA 2MYSA 2YRCA 2ED0A 3QSUA 5GAN8 2JW4A 5AYFA 2E6NA 1VQMQ 3CCEQ 1VQ4T 3G6EQ 5GAN7 2L3RA 3JSCA 2KI7A 1PRMC 1ZHIA 4QKUA 2CYZB 3NGPA 2JTFA 5A2QE 2BIVA 3PMTA 4XTYA 4V2SA 5LJ5h 1VYTA 1K9MC 4BUGA 1BYMA 4EMKC 5FLXE 1FMWA 2GGRA 2FO0A 1JRIA 3G4ST 2LNVA 4J6YA 1OU8A 2KK4A 4LUDA 3UF4A 4PJOF 3JB9G 2K5IA 5KYNA 3JCMP 5GMKj 3CCET 2BTTA 1IHWA 2KDSA 1NLPC 3VV0A 2D8JA 3PVLA 1PKSA 5FW9A 1VQ5A 1UE9A 2PTKA 5C6SA 2VYTA 1U5SA 3OBYA 3PNWC 4QW2A 2KRMA 1M1KU 2K4YA 1KQSP 3OYCA 1KHIA 1YJWA 1LNXA 3GLXA 1NG2A 2ZPBB 3LLRA 4E2FB 3JB9J 1YWPA 3VS1A 3CC2A 4PJOA 2M0YA 3WXMB 5I2SA 1G2BA 3OQ5A 3R6NA 4M7AE 2O4XB 1PCXA 1MMDA 2HNIA 2XICA 4J9GA 2X51A 3UA7A 4KT0E 4JJDA 2OJ2A 1EIFA 3X26B 2GFUA 1TUGB 1IXDA 3P8BB 1YIJT 4N0AA 2C06A 3M59A 4ZN1A 3FLGA 4OB1B 1SEMA 1WXBA 1C6VX 2PVGB 1QQJA 3QWXX 3JB9I 2J6FA 5AT1B 2OTJT 3MJXA 1KC8U 1BI1A 5IXFA 2DTOA 2VUBA 1WHMA 2KBTA 5KYWB 3JAME 3PT9A 6AT1B 4J6WA 1BBZA 4HA8A 5GAMg 1M27C 3PVQA 2O9VA 3S6WA 3EGDB 3M0RA 1Q82C 3JCMQ 2COZA 1SSHA 1VQ7T 4D8KA 4M7DC 4JJBA 2ZPEB 4J9CA 4JRPA 1TUCA 1YIJA 1Y96A 3L2QA 4FT2A 1I1JA 1D0XA 1VQ8Q 2ATCB 4GLMA 3ZEHA 2JJ9A 4J6XA 1I4K1 3NTHA 1NJIC 4D6WA 2L8DA 4ELYC 3G4SQ 4Z88A 5GMKe 2ED1A 2M51A 1JU5C 4BD3A 4RTVA 3META 4PLIA 4XU2A 1UEBA 4OVAA 5CKDA 3JCMV 3VU3C 4ELZC 2XK0A 4J83A 2CUDA 2E6ZA 2I0NA 4PNOA 2O88A 5CQXA 5HKCA 4C92F 3HL8A 1ZUUA 1VQ7A 2R5AA 2NYSA 3MP6A 3VS4A 1TSFA 5FROA 3WVDB 1VQ6Q 3VJPA 2QEXA 2DXUA 1U1SA 2EYXA 2QK0A 4RCCA 1JJ2S 3GPLA 1D1BA 2KRSA 1OV3A 2LNHB 1K9AA 3M57A 4M77B 2CSQA 1Y57A 4EPCA 4PLLA 4XK8E 2DYIA 1V1CA 1B7TA 3MPUB 2FYKA 3OYBA 4Y91A 1AOJA 2CH4A 2W10A 3BDUA 4AFZC 1K0XA 5FWCA 2QDLA 1PD0A 2VKNA 1KQ2A 3EGDA 1NZ9A 3I5RA 4AFSC 4K11A 1G5VA 2WSCE 2MIOA 1Q81R 4JZ3A 4PJOG 3JB9F 3N5BB 2F5KA 4Y28E 3HRUA 4HT9A 5KYWA 2HQXA 2LQWA 2EQJA 2RH2A 1Y07A 2AKKA 2IIMA 2MWOA 5GANj 5DM7R 5LJ5j 3RUXA 2F2WA 3A98A 2XHCA 3HRSA 4AG2C 1XJWB 1QVGA 3UWNA 1OEBA 1Y71A 4EIKA 4FU6A 1K4US 3RESA 1WGSA 3HFNA 5D6XA 3H0FA 4LDVA 4J9FA 3CMEQ 1GBQA 2DD4A 2DEQA 2YLCA 2J06A 4M7AA 1VYUA 4C5IA 2EYZA 1RACB 4E47A 4QVDA 2FB7A 3MP8A 2GCXA 2Z0WA 1K8AU 4IUVA 2OTJQ 3HSBA 3EH1A 2FZGB 3CPFA 1WXUA 5GANe 2RA2A 2RQVA 3I5SA 3CCJA 3DB4A 3JCMf 2V1RA 4IKFA 2NLUA 4RMOA 5LJ3d 1YJ9T 1I81A 1AEYA 2K5LA 1BI0A 3LW5E 4M75F 2CREA 2SRCA 2NUTA 3RDVA 1G3TA 2KVQG 1G3SA 3M58A 2QDYB 2QQRA 3SWNA 1XTDA 5A0LA 5L23A 3EFOA 1LOJA 4OF1A 3OS0A 4A63B 3G71T 2H3EB 1Y7XA 2YWWA 2FVUA 1ZA1B 3OSVA 1NJIR 1Q95G 1T3LA 3BE3A 1TUDA 3QIIA 3TU4K 3D7SB 1AZGB 1NPPA 2MWPA 2DILA 1I5OB 4DOVA 1YCSB 2MPXC 2X4WA 2K3BA 1Q82U 1N6AA 3SDZA 2KGTA 5FRNA 1TOVA 1OULA 2AHJB 2JS2A 2XKOC 3DLLA 2MOXA 2LT1A 1Y0MA 4ANJA 4M7AD 3VRZA 5LJ5e 4A54A 2RB6A 2ZPHB 1I5LA 3CCVA 2K9GA 1GXIE 2L89A 1M90R 2DL8A 2KT1A 1R0CB 1VQ8T 1ABOA 3CCUA 3OYAA 4C8QB 3OS2A 4F7UG 2RM4A 1YHQQ 2KXDA 1G83A 2P4RA 5GAMd 1WJRA 4JS5A 1VQPQ 4BY6B 4KUDK 2A7YA 5FWBA 3CXCA 4F7UE 1M1KC 4A53A 1QCFA 1NE8A 2SEMA 1IHVA 1ZUYA 2I2LA 1YITA 4LD9K 3KXTA 2E64A 3C95A 1C0MA 3RNJA 4JRQA 3EG9B 2D6FA 4FCYA 2V8IA 1N8RU 4GLKA 1SF9A 4RTYA 3CCSQ 3LX7A 3CCVT 1KIKA 1F1BB 1K8AR 4PJNA 2LC4A 1GCPA 4BE2A 2QASA 3V8LA 1OX8A 2X3WD 5KYUA 2QEXQ 3DLMA 1VA7A 2RK2A 1VQKA 1GFDA 1OI1A 4NL2A 2RI2A 2VASA 1X27A 2EQUA 2QA4T 3JCMh 1VQ9A 1TXQA 1KHCA 2GBQA 4FYYB 1HJDA 5DLOA 3L2UA 4BDZA 2VV5A 2GFAA 2X4YA 3V7SA 1BIBA 1RUWA 3CCUQ 3TEEA 3L2WA 2VGNA 2KT8A 2DL3A 2MCNA 1OZ3A 5GAN6 4M7AG 2MF2A 2OAUA 3MEUA 1VQPA 1YJNT 2Y4XA 3EGXA 3U23A 1ZBXA 4HXJA 3CCQA 3TQ7P 3CC4A 2DVEA 1RABB 1X6GA 4JLGA 3CPWA 3OYEA 3JB9D 4VUBA 5GANh 3E9FA 2DZ9A 3MEWA 1M1GA 3M0PA 4ZGJB 3URGA 4F17A 2EVRA 1UHFA 1N5ZA 3H6ZA 2RI3A 1Q7YR 3PFSA 2DK3A 2NWMA 3Q1JA 1MMNA 1YI2T 3V7CA 3OMGA 1SHFA 2RO0A 1M1KR 3THKA 2EKHA 1R8OB 2BUDA 2EGCA 4J9HA 4LUEA 4JRIA 1M3AA 3CMEA 2L2PA 3RKYA 2P0KA 3M0QA 2KE9A 1Q86U 2HDAA 3GIBA 2EJGA 4JZ4A 4E7HA 7AT1B 4M7DF 1MMGA 4M7AB 4R56A 2CUBA 3CD6T 2K6DA 1FXXA 3M0UA 2R5MA 3HKSA 1W2BS 1Q82R 1V29B 1ZA2B 3SB2A 1UUEA 4OP0A 1YN8A 4FL6A 2RF0A 5CCAA 2CP5A 4O6JA 3LGLA 1WFWA 3P8DA 3EHRA 2CP0A 3I55Q 1QKWA 2YRVA 2X35A 4JRKA 4C0GA 4A4GA 1X01A 3A8MB 1GL5A 1VQNA 2B86A 1WJSA 3JCMX 2FL7A 2QGGA 2KQWA 5KYXB 3SWNC 1S72T 5LJ3g 4RG8A 3FRNA 1B34B 1RI0A 1WQ7A 2D0QB 4IUUA 2JM8A 3E1SA 2DETA 2RNAA 2YUNA 1WXTA 3CMAT 1H641 1M3BA 3CD6A 2DERA 5LJ3f 1ABQA 5GAOl 4BB7A 3VYHB 2QQBA 4F7UA 1VQMA 4RG2A 1VQOT 4OB2B 2LTOA 3CCJT 2RHYA 1WX6A 2RPNA 3EG0A 4M7DA 4IIMA 5KE3A 1K9MR 2CH4W 1WZOA 1RAGB 2VWFA 1DJ7B 4MMLA 1JEGA 2JS0A 1WNLA 4MZTA 4PJOD 2HBPA 1KJWA 2A36A 4F14A 2KSSA 4M7DE 5DLQE 2LCSA 2DF6A 4QVCA 2XIDA 3G71A 3OW2P 1FYNA 2DTHA 2K3YA 3CEYA 4MZPA 4E7LA 4PKCC 1M2VA 2RJFA 4HCCA 5GAOp 1VQ4Q 4J9EA 3KUFA 1NPRA 3QO3A 2RQWA 2QA4Q 3RMQA 2OI3A 1M8MA 2LDMA 3EFSA 1ZSZA 4JDSA 5KYUB 3INZA 1Q86C 1FX7A
chains in the Genus database with same CATH topology
1TG0A 1UFFA 2D8HA 2EYXA 2KR3A 3O5ZA 1OPKA 2KRSA 1B07A 1OV3A 2LNHB 1K9AA 2YUQA 2CSQA 1Y57A 2ESWA 2KXCA 1HSQA 4JJCA 1V1CA 2CT3A 2OAWA 4J9BA 4DEYA 4LE9A 2DJQA 1BB9A 2KYMA 1ZSGA 1WA7A 4Z8AA 2GQIA 2BZXA 4Y92A 1AOJA 3SEMA 1BU1A 2CH4A 2E5KA 2A08A 1UJ0A 4OMNA 4OMPA 4WCIA 2W10A 4AFZC 4HVWA 5ECAA 1K0XA 1Z9QA 5FWCA 3ULRB 2QDLA 1ARKA 1K1ZA 2VKNA 3I5RA 4AFSC 2HSPA 2J05A 4K11A 4DEXA 4OMQA 4KRTA 2FEIA 2MIOA 4JZ3A 4GBQA 1XOVA 2ABLA 2DNUA 2K79A 1E6GA 1GCQA 2EGEA 3QWYA 1MUZA 1FMKA 2DBMA 3PE0A 2EW3A 4M4ZA 2LQWA 2AKKA 2IIMA 2NUZA 1PKTA 3JV3A 2ROLA 3GBQA 1IO6A 2F2WA 3A98A 1UECA 4X1VA 4AG2C 2BZ8A 1X6BA 1OEBA 4AFQC 1T0JA 2DX1A 2D0NA 4RUGA 4EIKA 1K4US 3I35A 4OMMA 1X2KA 1KFZA 3H0FA 2DL7A 2YDLA 4J9FA 1GBQA 2L3QA 2J06A 1VYUA 1WYXA 1WLPB 5IHKA 2EYZA 1QKXA 2C0IA 2FRWA 4ESRA 1X69A 2PNIA 3LH5A 2L0AA 4AG1C 1WXUA 3TSZA 4RTTA 2BZYA 1U3OA 2RQVA 3I5SA 3M0TA 2JMCA 2G6FX 2DVJA 2V1RA 1NYFA 2AZVA 2DBKA 2EPDA 2JTEA 3VS2A 2HCKA 4LN2A 1AEYA 2YUOA 1PHTA 2F2VA 1NM7A 2ROTA 4RTUA 2JXBA 1RLPC 2CREA 2SRCA 1JXOA 2LJ1A 1E7OA 1EFNA 1M3CA 2D1XA 4J9IA 2DMOA 5L23A 3SHWA 3KFVA 4A63B 1UG1A 2LX7A 1AWOA 2FPDA 2RQTA 3VS0A 2DYBA 1ZUKA 2JMAA 1AWXA 1T3LA 1UGVA 2YT6A 2GTOA 1H3HA 4HVUA 4ORZA 1TUDA 1SRMA 2DM1A 3NHNA 2RN8A 1JO8A 4ZNXA 1AZGB 1WI7A 2L3SA 3H0IA 2DILA 2CT4A 1QLYA 3ZL7C 2FPEA 4OMLA 1X43A 1YCSB 2J7IA 1MV0B 2K3BA 2KRNA 2AK5A 2LMJA 1UDLA 2KYBA 1AZEA 2KGTA 2JS2A 3H0HA 2MOXA 1YP5A 2FPFA 1Y0MA 3VRZA 1ZX6A 4JPBW 2YUPA 3VS7A 1SRLA 4D8DA 2K9GA 1WDXA 2DA9A 4HVVA 1WIEA 2DL8A 2KT1A 1K0SA 1B3QA 2JT4A 1ABOA 1X2QA 2EYYA 1YWOA 2KXDA 3REAB 1G83A 2J6KA 2P4RA 4AFUC 3NMZC 5EC7A 2XMFA 1NEGA 4CC4B 1W1FA 1QWEA 5FWBA 2LZ6B 1K76A 2LQNA 2V1QA 1YNZA 2X3XD 1QCFA 1AWWA 1J3TA 2O31A 4R0KA 2SEMA 3EG2A 1VYVA 1HD3A 1M30A 1ZUYA 2EQIA 2KROA 2LJ0A 2A37A 3RNJA 4OMOA 2EYWA 2CSIA 3EG3A 1QWFA 1OOTA 3REBB 4RTYA 1PNJA 1I07A 1T0HA 1KIKA 2YSQA 1T3SA 4CC7A 2ENMA 5I11A 1H8KA 1GCPA 1CSKA 1A0NB 2AZSA 2K7AA 2ED0A 2ECZA 3VS6A 2DRMA 2X3WD 2JW4A 1VA7A 2O9SA 2RQUA 1GFDA 2L3PA 1PRMC 1E6HA 1X27A 3NGPA 1NEBA 2GBQA 1HJDA 4LNPA 1ZLMA 2RMOA 1VYTA 1RUWA 2K2MA 3I9QA 4RTZA 4QT7A 2KT8A 2DL3A 2MCNA 1GFCA 2GGRA 1NLOC 2FO0A 1UTIA 4IIOA 1UJYA 1H92A 2DL4A 4LUDA 2DLPA 2CDTA 3UF4A 1U06A 1GCQC 3U23A 4HXJA 4CC3A 2DE0X 3UA6A 1X6GA 2FG0A 4FSSA 1I0CA 3UATA 1CKBA 2BTTA 3VRYA 3M0PA 1NLPC 1AVZC 2D8JA 3PVLA 5GJWB 4F17A 1JQQA 1PKSA 1UHFA 2EVRA 5FW9A 3TSWA 1N5ZA 1UE9A 2PTKA 2W0ZA 1LCKA 2NWMA 4HCKA 3FJ5A 3EHQA 1SHFA 5HCKA 3THKA 2EKHA 2EGCA 1U5SA 2KRMA 4J9HA 4LUEA 3EG1A 1S1NA 1GBRA 4Z89A 2KNBB 1M3AA 1CKAA 2DRKA 1PWTA 1RI9A 2L2PA 2F2XA 3M0QA 2KE9A 2HDAA 1NG2A 4JZ4A 2JM9A 1YWPA 3VS1A 2J6OA 3NPFA 2M0YA 2CUBA 1W70A 1G2BA 3R6NA 2K6DA 3M0UA 1SHGA 5IH2A 2HEQA 4RTXA 1UUEA 4J9GA 3UA7A 3EGUA 1YN8A 2RF0A 4JJDA 2OJ2A 2H8HA 1WFWA 3M0SA 3EHRA 2RQRA 1QKWA 1AD5A 1SPKA 1SEMA 1WXBA 5I22A 1ZBJA 1KSWA 3IQLA 3QWXX 2J6FA 1GL5A 5IXFA 2B86A 1MV3A 2C0OA 1UHCA 2KBTA 3RBBB 2FRYA 2JM8A 2RNAA 2YUNA 1BBZA 1W6XA 1WXTA 1M27C 3PVQA 2O9VA 3VS5A 1M3BA 1Z9ZA 1OPLA 3M0RA 1ABQA 4RTWA 2GNCA 2O2OA 2A28A 4J9DA 1SSHA 5IHIA 5GJVB 4D8KA 2EBPA 4JJBA 5IHNA 3VS3A 1WX6A 2RPNA 4J9CA 3EG0A 4IIMA 1TUCA 2CH4W 1JXMA 2C0TA 2VWFA 1I1JA 4GLMA 1JEGA 2JS0A 2EGAA 2VVKA 2LJ3A 1PRLC 1NYGA 1KJWA 1BK2A 2A36A 4Z88A 4F14A 2GTJA 1AWJA 2ED1A 2M51A 1JU5C 4RTVA 4CC2A 3H41A 2LCSA 3CQTA 2DF6A 3C0CA 5IXBA 2KEAA 1FYNA 2PZ1A 4E6RA 1GRIA 2CUDA 2I0NA 2O88A 2HBWA 1RLQC 4J9EA 4F16A 1ZUUA 2RQWA 2AKLA 2OI3A 1M8MA 2DL5A 2LP5A 3VS4A 3TVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TG0 A;  1UFF A;  2D8H A;  2EYX A;  2KR3 A;  3O5Z A;  1OPK A;  2KRS A;  1B07 A;  1OV3 A;  2LNH B;  1K9A A;  2YUQ A;  2CSQ A;  1Y57 A;  2ESW A;  2KXC A;  1HSQ A;  4JJC A;  1V1C A;  2CT3 A;  2OAW A;  4J9B A;  4DEY A;  4LE9 A;  2DJQ A;  1BB9 A;  2KYM A;  1ZSG A;  1WA7 A;  4Z8A A;  2GQI A;  2BZX A;  4Y92 A;  1AOJ A;  3SEM A;  1BU1 A;  2CH4 A;  2E5K A;  2A08 A;  1UJ0 A;  4OMN A;  4OMP A;  4WCI A;  2W10 A;  4AFZ C;  4HVW A;  5ECA A;  1K0X A;  1Z9Q A;  5FWC A;  3ULR B;  2QDL A;  1ARK A;  1K1Z A;  2VKN A;  3I5R A;  4AFS C;  2HSP A;  2J05 A;  4K11 A;  4DEX A;  4OMQ A;  4KRT A;  2FEI A;  2MIO A;  4JZ3 A;  4GBQ A;  1XOV A;  2ABL A;  2DNU A;  2K79 A;  1E6G A;  1GCQ A;  2EGE A;  3QWY A;  1MUZ A;  1FMK A;  2DBM A;  3PE0 A;  2EW3 A;  4M4Z A;  2LQW A;  2AKK A;  2IIM A;  2NUZ A;  1PKT A;  3JV3 A;  2ROL A;  3GBQ A;  1IO6 A;  2F2W A;  3A98 A;  1UEC A;  4X1V A;  4AG2 C;  2BZ8 A;  1X6B A;  1OEB A;  4AFQ C;  1T0J A;  2DX1 A;  2D0N A;  4RUG A;  4EIK A;  1K4U S;  3I35 A;  4OMM A;  1X2K A;  1KFZ A;  3H0F A;  2DL7 A;  2YDL A;  4J9F A;  1GBQ A;  2L3Q A;  2J06 A;  1VYU A;  1WYX A;  1WLP B;  5IHK A;  2EYZ A;  1QKX A;  2C0I A;  2FRW A;  4ESR A;  1X69 A;  2PNI A;  3LH5 A;  2L0A A;  4AG1 C;  1WXU A;  3TSZ A;  4RTT A;  2BZY A;  1U3O A;  2RQV A;  3I5S A;  3M0T A;  2JMC A;  2G6F X;  2DVJ A;  2V1R A;  1NYF A;  2AZV A;  2DBK A;  2EPD A;  2JTE A;  3VS2 A;  2HCK A;  4LN2 A;  1AEY A;  2YUO A;  1PHT A;  2F2V A;  1NM7 A;  2ROT A;  4RTU A;  2JXB A;  1RLP C;  2CRE A;  2SRC A;  1JXO A;  2LJ1 A;  1E7O A;  1EFN A;  1M3C A;  2D1X A;  4J9I A;  2DMO A;  5L23 A;  3SHW A;  3KFV A;  4A63 B;  1UG1 A;  2LX7 A;  1AWO A;  2FPD A;  2RQT A;  3VS0 A;  2DYB A;  1ZUK A;  2JMA A;  1AWX A;  1T3L A;  1UGV A;  2YT6 A;  2GTO A;  1H3H A;  4HVU A;  4ORZ A;  1TUD A;  1SRM A;  2DM1 A;  3NHN A;  2RN8 A;  1JO8 A;  4ZNX A;  1AZG B;  1WI7 A;  2L3S A;  3H0I A;  2DIL A;  2CT4 A;  1QLY A;  3ZL7 C;  2FPE A;  4OML A;  1X43 A;  1YCS B;  2J7I A;  1MV0 B;  2K3B A;  2KRN A;  2AK5 A;  2LMJ A;  1UDL A;  2KYB A;  1AZE A;  2KGT A;  2JS2 A;  3H0H A;  2MOX A;  1YP5 A;  2FPF A;  1Y0M A;  3VRZ A;  1ZX6 A;  4JPB W;  2YUP A;  3VS7 A;  1SRL A;  4D8D A;  2K9G A;  1WDX A;  2DA9 A;  4HVV A;  1WIE A;  2DL8 A;  2KT1 A;  1K0S A;  1B3Q A;  2JT4 A;  1ABO A;  1X2Q A;  2EYY A;  1YWO A;  2KXD A;  3REA B;  1G83 A;  2J6K A;  2P4R A;  4AFU C;  3NMZ C;  5EC7 A;  2XMF A;  1NEG A;  4CC4 B;  1W1F A;  1QWE A;  5FWB A;  2LZ6 B;  1K76 A;  2LQN A;  2V1Q A;  1YNZ A;  2X3X D;  1QCF A;  1AWW A;  1J3T A;  2O31 A;  4R0K A;  2SEM A;  3EG2 A;  1VYV A;  1HD3 A;  1M30 A;  1ZUY A;  2EQI A;  2KRO A;  2LJ0 A;  2A37 A;  3RNJ A;  4OMO A;  2EYW A;  2CSI A;  3EG3 A;  1QWF A;  1OOT A;  3REB B;  4RTY A;  1PNJ A;  1I07 A;  1T0H A;  1KIK A;  2YSQ A;  1T3S A;  4CC7 A;  2ENM A;  5I11 A;  1H8K A;  1GCP A;  1CSK A;  1A0N B;  2AZS A;  2K7A A;  2ED0 A;  2ECZ A;  3VS6 A;  2DRM A;  2X3W D;  2JW4 A;  1VA7 A;  2O9S A;  2RQU A;  1GFD A;  2L3P A;  1PRM C;  1E6H A;  1X27 A;  3NGP A;  1NEB A;  2GBQ A;  1HJD A;  4LNP A;  1ZLM A;  2RMO A;  1VYT A;  1RUW A;  2K2M A;  3I9Q A;  4RTZ A;  4QT7 A;  2KT8 A;  2DL3 A;  2MCN A;  1GFC A;  2GGR A;  1NLO C;  2FO0 A;  1UTI A;  4IIO A;  1UJY A;  1H92 A;  2DL4 A;  4LUD A;  2DLP A;  2CDT A;  3UF4 A;  1U06 A;  1GCQ C;  3U23 A;  4HXJ A;  4CC3 A;  2DE0 X;  3UA6 A;  1X6G A;  2FG0 A;  4FSS A;  1I0C A;  3UAT A;  1CKB A;  2BTT A;  3VRY A;  3M0P A;  1NLP C;  1AVZ C;  2D8J A;  3PVL A;  5GJW B;  4F17 A;  1JQQ A;  1PKS A;  1UHF A;  2EVR A;  5FW9 A;  3TSW A;  1N5Z A;  1UE9 A;  2PTK A;  2W0Z A;  1LCK A;  2NWM A;  4HCK A;  3FJ5 A;  3EHQ A;  1SHF A;  5HCK A;  3THK A;  2EKH A;  2EGC A;  1U5S A;  2KRM A;  4J9H A;  4LUE A;  3EG1 A;  1S1N A;  1GBR A;  4Z89 A;  2KNB B;  1M3A A;  1CKA A;  2DRK A;  1PWT A;  1RI9 A;  2L2P A;  2F2X A;  3M0Q A;  2KE9 A;  2HDA A;  1NG2 A;  4JZ4 A;  2JM9 A;  1YWP A;  3VS1 A;  2J6O A;  3NPF A;  2M0Y A;  2CUB A;  1W70 A;  1G2B A;  3R6N A;  2K6D A;  3M0U A;  1SHG A;  5IH2 A;  2HEQ A;  4RTX A;  1UUE A;  4J9G A;  3UA7 A;  3EGU A;  1YN8 A;  2RF0 A;  4JJD A;  2OJ2 A;  2H8H A;  1WFW A;  3M0S A;  3EHR A;  2RQR A;  1QKW A;  1AD5 A;  1SPK A;  1SEM A;  1WXB A;  5I22 A;  1ZBJ A;  1KSW A;  3IQL A;  3QWX X;  2J6F A;  1GL5 A;  5IXF A;  2B86 A;  1MV3 A;  2C0O A;  1UHC A;  2KBT A;  3RBB B;  2FRY A;  2JM8 A;  2RNA A;  2YUN A;  1BBZ A;  1W6X A;  1WXT A;  1M27 C;  3PVQ A;  2O9V A;  3VS5 A;  1M3B A;  1Z9Z A;  1OPL A;  3M0R A;  1ABQ A;  4RTW A;  2GNC A;  2O2O A;  2A28 A;  4J9D A;  1SSH A;  5IHI A;  5GJV B;  4D8K A;  2EBP A;  4JJB A;  5IHN A;  3VS3 A;  1WX6 A;  2RPN A;  4J9C A;  3EG0 A;  4IIM A;  1TUC A;  2CH4 W;  1JXM A;  2C0T A;  2VWF A;  1I1J A;  4GLM A;  1JEG A;  2JS0 A;  2EGA A;  2VVK A;  2LJ3 A;  1PRL C;  1NYG A;  1KJW A;  1BK2 A;  2A36 A;  4Z88 A;  4F14 A;  2GTJ A;  1AWJ A;  2ED1 A;  2M51 A;  1JU5 C;  4RTV A;  4CC2 A;  3H41 A;  2LCS A;  3CQT A;  2DF6 A;  3C0C A;  5IXB A;  2KEA A;  1FYN A;  2PZ1 A;  4E6R A;  1GRI A;  2CUD A;  2I0N A;  2O88 A;  2HBW A;  1RLQ C;  4J9E A;  4F16 A;  1ZUU A;  2RQW A;  2AKL A;  2OI3 A;  1M8M A;  2DL5 A;  2LP5 A;  3VS4 A;  3TVT A; 
#chains in the Genus database with same CATH topology
 5IAY A;  2JTM A;  2YLB A;  2KR3 A;  4C92 E;  2Y90 A;  2VB6 A;  2CP7 A;  3RKW A;  2IVW A;  3BFM A;  2ESW A;  4AT1 B;  2KXC A;  1HSQ A;  1OQK A;  4M77 A;  3M55 A;  1SSF A;  1WA7 A;  2MMP A;  4Z8A A;  4M78 D;  1I8F A;  2GQI A;  2K3X A;  4C92 A;  2HL3 A;  1UJ0 A;  1K73 U;  1YFN A;  4HVW A;  2HKQ B;  2LQK A;  1H3Z A;  4OMQ A;  4KRT A;  4XU0 A;  4GBQ A;  1XOV A;  3ASK A;  3L1A A;  1E6G A;  3VUB A;  1QVF A;  5A0G A;  1MUZ A;  1FMK A;  1V76 A;  3PE0 A;  2EW3 A;  3PTA A;  3OMC A;  5CK9 A;  5I21 A;  1PKT A;  3GBQ A;  2CZ6 B;  3G71 Q;  2QGF B;  3OYY A;  1VQ9 Q;  2EFI A;  4C8Q G;  4AFQ C;  2HD0 A;  3HPW A;  2D0N A;  4PJM A;  4OMM A;  2E1H A;  1TTH B;  1X75 C;  2XDP A;  3T9N A;  5GAO q;  2YDL A;  3MHX A;  3CCJ Q;  1JB0 E;  2JUF A;  2DZC A;  1Q7Y U;  1QKX A;  1KD1 C;  4M7A C;  3DKM A;  1VQO Q;  2FRW A;  4C5E A;  4X9D A;  1X69 A;  2PNI A;  3CCL T;  3LH5 A;  2L0A A;  4JS4 A;  4AG1 C;  3TSZ A;  2OTL Q;  1N8R R;  4M77 G;  3M0T A;  2DXT A;  2JMC A;  2G6F X;  3ZFJ A;  4LDY A;  1QVP A;  3PMI A;  2AZV A;  3CCE A;  5HK3 A;  2JTE A;  3VS2 A;  5GAN 3;  3BY7 A;  2HCK A;  2YUO A;  2F69 A;  1PHT A;  3C94 A;  5J26 A;  1NM7 A;  2ROT A;  4RTU A;  3OYD A;  4C92 C;  3EFR A;  1KK7 A;  2CP3 A;  3UDC A;  1JXO A;  2LJ1 A;  3CC7 Q;  1BIA A;  1WHG A;  4C8Q E;  1M3C A;  2DMO A;  5CKH A;  3OYL A;  1D0Z A;  2RQT A;  1TWB A;  2DYB A;  2YT6 A;  1AWX A;  3EGX B;  4PJJ A;  4BDY A;  5I2M A;  1PM3 A;  4ORZ A;  1IGQ A;  3FJP A;  3NHN A;  3M53 A;  2E65 A;  4KBM B;  4OB0 B;  4ZNX A;  3GOX A;  1WI7 A;  2KY9 A;  2L3S A;  3M54 A;  1YBY A;  3A5Z B;  1QP2 A;  1X43 A;  1MV0 B;  4J5Y A;  2KRN A;  3QJ6 A;  2NUP A;  2LMJ A;  1AZE A;  3X25 B;  4XU3 A;  3CME T;  3X20 B;  1QMC A;  2FPF A;  2F5T X;  5LJ3 h;  1D09 B;  5GAN d;  2YUP A;  1SRL A;  2ZAE A;  2ZCF B;  1WDX A;  5GAO m;  1QVF S;  4HVV A;  2E10 A;  4OGC A;  2RJC A;  2EYY A;  3KBG A;  4XAX B;  3REA B;  2J6K A;  4AFU C;  4PL6 A;  1NEG A;  4CC4 B;  1PG5 B;  4M7D G;  2IG0 A;  3LH0 A;  1Q7Y C;  1QWE A;  4XTU A;  2ZPF B;  1K76 A;  2V1Q A;  1YNZ A;  1YIJ Q;  4R0K A;  5C0M A;  1M4Z A;  3ER0 A;  3CC7 A;  1VQ8 A;  1PC0 A;  1VYV A;  1HD3 A;  2HSE B;  3CCU T;  1RAE B;  3H9N A;  3NTK A;  5LJ5 g;  2EQI A;  2LJ0 A;  1VQL Q;  1QVF P;  2CS7 A;  2CSI A;  4RCB A;  3LGF A;  3A1P A;  3MCA B;  4LDU A;  2X4X A;  3CMA A;  2CKK A;  1OOT A;  1C1A A;  1I07 A;  4FSX A;  3CBM A;  5LJ5 f;  1N9R A;  3OYH A;  1FWZ A;  4CC7 A;  3CCS T;  1XQH A;  3J7A F;  1G3W A;  1H8K A;  3A8H B;  1A0N B;  2K7A A;  1WHH A;  2CZ0 B;  1IZ6 A;  2RQU A;  4MMK A;  2F1L A;  3CBP A;  3QYH B;  4C0Z A;  3UPU A;  3OB9 A;  1E6H A;  1K73 C;  3QG1 A;  5CR2 A;  3JCM J;  1W2B P;  2PUO B;  2PUK B;  2QTX A;  4FW2 A;  2HAX A;  4LXC A;  1ZLM A;  3CCM A;  2LCC A;  1JBM A;  2K2M A;  3I9Q A;  4C92 G;  4QT7 A;  2CP2 A;  3SWN B;  4M78 E;  4BI4 A;  4DBH A;  1GFC A;  1NLO C;  1UTI A;  4J7I A;  5CKF A;  1UJY A;  3OW2 A;  2DL4 A;  4II1 A;  2CDT A;  1U06 A;  3OYN A;  4L6V 5;  5EG2 A;  2DE0 X;  4E7S A;  2FG0 A;  2QEX T;  3MEA A;  4FSS A;  2OX7 A;  1UGR B;  3SD4 A;  1D0Y A;  1VOM A;  1I0C A;  1RAI B;  2D9T A;  1WHL A;  4DBR A;  1SKU B;  1WHK A;  2E4H A;  1AVZ C;  3CCR Q;  5GJW B;  3CMA Q;  1S72 Q;  4IUQ A;  1RAH B;  4N4G A;  2W0Z A;  4ZGD B;  3FB9 A;  1LCK A;  2IPO B;  4C8Q A;  4HCK A;  3EHQ A;  5HCK A;  4DA4 A;  3QKJ A;  1IRE B;  3LYI A;  1M9S A;  2LX9 A;  2RJE A;  3EG1 A;  4Z89 A;  2KNB B;  3I55 A;  2DFU A;  2K5F A;  2DRK A;  5KH6 A;  1PWT A;  2PU9 B;  3UT1 A;  3EH2 A;  2J6O A;  3NPF A;  1W70 A;  5CKE A;  4HCZ A;  1W2B A;  5GAM j;  2R58 A;  4F7U F;  3ME9 A;  5M9O A;  1VQL T;  1QVG S;  2O4X A;  3V8K A;  4L59 A;  4A4K A;  3GNF B;  2RQR A;  4L5G A;  2K57 A;  1SPK A;  5I22 A;  2RHZ A;  1MHN A;  3IQL A;  3QUI A;  1NJI U;  1LVK A;  2CP6 A;  1VQK T;  2EJF A;  3JCM c;  4EMK B;  3LWI A;  3PIO A;  1PSE A;  2XDD A;  3RBB B;  1VUB A;  3HHT B;  4PFO A;  3CXC S;  1YJ9 A;  1W6X A;  1U8R A;  1YCY A;  3M56 A;  3VS5 A;  3F70 A;  3PIP A;  2GNC A;  2WSE E;  3PGG A;  3CCR A;  2VC8 A;  2OTL T;  4J9D A;  1TU0 B;  5IHI A;  1S72 A;  5GJV B;  2JZ2 A;  4M7D D;  3M9Q A;  4C92 D;  2X4J A;  5IHN A;  3VS3 A;  5KCO A;  1JXM A;  2C0T A;  1VQ4 A;  3A8L B;  2EGA A;  2DTI A;  3DB3 A;  2DD5 A;  4MZM A;  2VVK A;  2M16 A;  1KC8 C;  1PRL C;  2DJZ A;  1NYG A;  2P84 A;  4R55 A;  1WJQ A;  2GTJ A;  2M1H A;  5LJ3 j;  1AWJ A;  4CRI A;  2ZPG B;  1BCO A;  4CC2 A;  4MDW A;  2HZY A;  3C0C A;  1FMV A;  2PZ1 A;  3R6O A;  1GRI A;  2HBW A;  1X6O A;  1RLQ C;  5CIU A;  4F16 A;  4C8Q F;  1M1F A;  3HTR A;  4C92 B;  3NFC A;  2DL5 A;  1N8R C;  1UGS B;  3MP1 A;  2EKO A;  1VQ5 Q;  3FEO A;  3G6E A;  5GAN 5;  2YUQ A;  4P5N A;  1KQS S;  5CAI A;  1IRX A;  2M0O A;  4A4H A;  5FRM A;  2RK1 A;  3OYM A;  3HRT A;  4J9B A;  5IN1 A;  1WHJ A;  4LE9 A;  2DJQ A;  1BB9 A;  3L2V A;  1WPY A;  1YIT Q;  2KYM A;  1ZSG A;  2JOY A;  4IUP A;  3CD6 Q;  2BZX A;  2COW A;  4LDX A;  3QYG B;  3SEM A;  1BU1 A;  5LJ5 d;  2A08 A;  5FU6 C;  4WCI A;  2AIR B;  5ECA A;  3CPW P;  4M75 E;  3ULR B;  1VQN T;  1ARK A;  1K1Z A;  2AT1 B;  2RJD A;  2HSP A;  2J05 A;  3QJY A;  3CCL Q;  3CC2 T;  2EJ9 A;  4PJO E;  2DNU A;  2K79 A;  4HCB A;  1GCQ A;  4C5H A;  2EQM A;  2CGH A;  4XTZ A;  4M4Z A;  4QVZ A;  4KGZ B;  4M75 A;  3QZ5 B;  2V26 A;  3RIR A;  2K2V A;  2NUZ A;  5CVI A;  2ROL A;  1QP3 A;  1UEC A;  4X1V A;  1VQO A;  2JNG A;  1N9S A;  1X6B A;  1B34 A;  2OTJ A;  3I35 A;  3JCM e;  1X2K A;  2QA4 A;  3OW2 S;  1R0B G;  3RKX A;  1VQ9 T;  4FYW B;  4KH1 B;  1Y96 B;  1WLP B;  1M2O A;  1PD1 A;  4Q5W A;  9ATC B;  2C0I A;  2COY A;  3O8V A;  3H8Z A;  5KCH A;  3A8O B;  2QXF A;  4ESR A;  3EAE A;  1M90 U;  1MGQ A;  4XTW A;  2LT4 A;  3M4G A;  2BZY A;  3BW1 A;  1U3O A;  2YHT A;  3CC4 T;  2EYQ A;  2VGM A;  2DVJ A;  2LVM A;  2WSF E;  1R77 A;  2VXE A;  4TVR A;  3JB9 H;  3GNG A;  3QZ9 B;  4M78 C;  1NYF A;  2DBK A;  2EPD A;  1AT1 B;  2PVD B;  3RER A;  1YI2 Q;  2GQV A;  4LN2 A;  4J8O A;  2F2V A;  4FW1 A;  3CXC P;  1K8A C;  1M5Q 1;  1EFN A;  5KYY A;  2M02 A;  1K9M U;  2JN0 A;  4RKU E;  4J9I A;  1YJN A;  2DXC A;  2HL5 C;  4IUR A;  2FPD A;  3VS0 A;  1QW1 A;  1AHJ B;  4M77 E;  2Y4Y A;  1BI3 A;  1KC8 R;  3G7Z A;  2GTO A;  1H3H A;  1EZZ B;  4HVU A;  4YTL A;  4HT8 A;  2DM1 A;  2RN8 A;  1OU9 A;  3H0I A;  2MI6 A;  1QLY A;  2PQW A;  1D3B B;  4KUL A;  5GAN g;  3BDL A;  4NS5 A;  2KYB A;  3HFO A;  2DIQ A;  3H0H A;  5GAM f;  4JPB W;  2NUP B;  4ZTF A;  2B8A A;  3J81 E;  2DA9 A;  4C0D B;  5J3B A;  1WIE A;  1K0S A;  1B3Q A;  4GY5 A;  1VQL A;  3G1J A;  5D6W A;  1RAD B;  2ZGW A;  3NMZ C;  5FU7 C;  1TS9 A;  2LZ6 B;  2LQN A;  2HQH A;  1J3T A;  2O31 A;  3E9G A;  1VQM T;  1HYO A;  3OYJ A;  2DIG A;  2VXF A;  2QTV A;  1OZ2 A;  3EG3 A;  4QQG A;  5GMK m;  1VQK Q;  1PNJ A;  4M77 F;  5D7U A;  4BY6 C;  4XTX A;  3CCR T;  2XD0 A;  3G6E T;  5J39 A;  2YSQ A;  4M75 D;  2DEU A;  1K73 R;  2ENM A;  2FZC B;  3QDF A;  3OYF A;  4A4F A;  4KUI A;  4FT4 A;  3QBY A;  3VUZ A;  2AZS A;  3C4S A;  1YJW Q;  2ECZ A;  3VS6 A;  2DRM A;  4E7K A;  5DY9 A;  3CC2 Q;  2O9S A;  4BE1 A;  2L3P A;  2EIF A;  3EFO B;  2XDB A;  4FYX B;  1NEB A;  2QQ9 A;  1D3B A;  2FZK B;  1Q81 U;  3FC3 A;  4LNP A;  2RMO A;  2GF7 A;  2E12 A;  3JCM b;  1LPL A;  4UC4 A;  4RTZ A;  2XI9 A;  2P0Q A;  1OX9 A;  4C0D C;  4IIO A;  4MDX A;  1H92 A;  2LCL A;  2DLP A;  2LQ8 A;  1QCO A;  3MO8 A;  4AMC A;  1GCQ C;  1VQ5 T;  4WF2 A;  4PFZ A;  4CC3 A;  2EAY A;  3UA6 A;  4B9X A;  5GAN 2;  4XU1 A;  5L8R E;  2A3L A;  1VQ7 Q;  4M7D B;  3EG9 A;  3M5A A;  2E3I A;  3CPW S;  3UAT A;  1CKB A;  4LD6 A;  3VRY A;  3L2R A;  1VQ6 A;  1JQQ A;  1YJW T;  3A8G B;  4NOY A;  3TSW A;  4ZGE B;  1MMA A;  3FJ5 A;  1U1T A;  2EQK A;  5KYY B;  4PK4 A;  4C8Q C;  4C8Q D;  5GAM h;  3CCV Q;  1S1N A;  3CC7 T;  1GBR A;  2BKD N;  3JRZ A;  1CKA A;  1RI9 A;  1TH7 A;  2F2X A;  2JVV A;  1KD1 R;  1ZSZ C;  2JM9 A;  4C5G A;  3QXE B;  3L2Z A;  2ZPI B;  1VQN Q;  4CI0 C;  4M78 F;  1SHG A;  4PFP A;  5GAO r;  2XG8 D;  2KMT A;  5IH2 A;  2HEQ A;  4RTX A;  1MNE A;  3EGU A;  3TRE A;  2XU8 A;  3I55 T;  2H8H A;  2QG9 B;  1VQ6 T;  2V8K A;  3M0S A;  4ZTJ A;  2MK5 A;  4N4I A;  1AD5 A;  4M77 C;  4ME7 A;  3X24 B;  1D1A A;  1ZBJ A;  3M4Y A;  1KSW A;  4M78 G;  4X9C A;  1MV3 A;  2E5Q A;  2C0O A;  1UHC A;  5CKB A;  2HKN A;  4O5V A;  4EDU A;  2FRY A;  1HXD A;  3S3O A;  1WQW A;  1W4S A;  3OYK A;  2DXB A;  3WVE B;  5D6Y A;  4WTO B;  1Z9Z A;  1M90 C;  1OPL A;  1VIE A;  4RTW A;  2X9H A;  5A0D A;  2O2O A;  2A28 A;  3I56 A;  4E7Z A;  2EBP A;  3MEV A;  2L5Q A;  3L42 A;  1IB8 A;  4B9W A;  1XNI A;  4EMH A;  3QPH A;  3MKD A;  1UGQ B;  2O01 E;  2OTL A;  4JUV A;  2LJ3 A;  3HP9 A;  1HK9 A;  2RHX A;  1BK2 A;  2EWN A;  2RI5 A;  1KQ1 A;  2DKG A;  3GP8 A;  3H41 A;  3CQT A;  3JCM d;  1P92 A;  5HK0 A;  5IXB A;  2KEA A;  2M9U A;  4KGX B;  4E6R A;  1ZSZ B;  8ATC B;  2FHD A;  1JJ2 P;  2DO3 A;  1VQP T;  1M8V A;  3ZBD A;  2AKL A;  4DBQ A;  1M2V B;  3G4S A;  2LP5 A;  1YHQ T;  2DAQ A;  3SFM A;  3TVT A;  2HQE A;  3OS5 A;  1TG0 A;  1UFF A;  5LL6 S;  2D8H A;  5FU6 B;  3O5Z A;  1KQS A;  4X34 A;  4C0F A;  1OPK A;  1JJ2 A;  1B07 A;  2CZ1 B;  4BAC A;  3CCL A;  2ZZD A;  2QQA A;  3GF5 A;  1RAF B;  2P0P A;  4JJC A;  2CT3 A;  2OAW A;  4DEY A;  4ZN3 A;  3E19 A;  2P4T A;  5GMK l;  1O9S A;  4HKE A;  2QI2 A;  4Y92 A;  3CCQ T;  2E5K A;  4OMN A;  4B6M A;  4JJN K;  4N4H A;  4OMP A;  1Z9Q A;  5IT9 E;  1G3Y A;  4DEX A;  2YXY A;  2FEI A;  3AHU A;  2ABL A;  8AT1 B;  1D1C A;  2EGE A;  3QWY A;  4M7A F;  2DBM A;  4F04 B;  5GMK h;  3TCJ A;  3OA6 A;  3CBO A;  4M75 C;  2E41 A;  3C12 A;  3JV3 A;  1IO6 A;  1IGU A;  2QYZ A;  3RMS A;  1KD1 U;  1LJO A;  2BZ8 A;  5KYX A;  3P8H A;  3JCM g;  1Q81 C;  4F7U B;  4Z02 A;  3OY9 A;  1T0J A;  2DX1 A;  2CZ7 B;  4RUG A;  2RHU A;  1YJ9 Q;  3CCM Q;  1EX4 A;  1KFZ A;  2DL7 A;  2YRD A;  5GAN f;  2KAF A;  3OSS C;  1QCN A;  1VIF A;  2WAC A;  2L3Q A;  2RHI A;  1BKB A;  1WYX A;  2H3J A;  5IHK A;  3CCM T;  4M78 B;  1QVG P;  1ZQ1 A;  3QHS A;  4IUT A;  3QDR B;  1BCM A;  2DPP B;  3S3M A;  3VYG A;  1O75 A;  4KH0 B;  4J7F A;  1ACM B;  4FYV B;  1YIT T;  4E7I A;  2G3R A;  5GAO n;  4RTT A;  2A0F B;  1YJN Q;  1Q86 R;  2E3H A;  3LWH A;  4N0A C;  4M78 A;  4FM4 B;  2JXB A;  1RLP C;  4QQ6 A;  1E7O A;  4BI3 A;  2RD1 A;  2D1X A;  1OYX A;  4KGV B;  3SHW A;  3KFV A;  1RAA B;  1MND A;  1UG1 A;  2LX7 A;  1AWO A;  4XQ3 A;  2QQS A;  1NBE B;  4PJL A;  1ZUK A;  3J80 E;  1RL2 A;  4OB3 B;  2JMA A;  1UGV A;  4PJO B;  3NTI A;  3CCS A;  4BE0 A;  5HY6 A;  2BE9 B;  3FIF A;  4EMG A;  1SRM A;  1JO8 A;  3AT1 B;  3CC4 Q;  4FIB A;  4M75 B;  4A4E A;  2CT4 A;  5GAN 4;  4OMF B;  3ZL7 C;  2FPE A;  4OML A;  5LJ3 e;  3OYG A;  2J7I A;  3OYI A;  2AK5 A;  3I56 T;  1UDL A;  4ATO A;  3E2U A;  2LRQ A;  5CO7 A;  1YP5 A;  3JCM W;  1ZX6 A;  2QAZ A;  4EMK A;  3VS7 A;  5GMK i;  4D8D A;  2E70 A;  2MAM A;  5KE2 A;  2JT4 A;  1X2Q A;  1YWO A;  4OGE A;  3I56 Q;  2PVO B;  4BI8 B;  2HMA A;  4M77 D;  4DBF A;  4DOW A;  5EC7 A;  2XMF A;  4JLI A;  2V8J A;  2BE7 D;  3VKI A;  1YI2 A;  1W1F A;  1BI2 A;  5CQY A;  4DQ2 A;  3X28 B;  4LDW A;  1N27 A;  2X3X D;  3CCQ Q;  1AWW A;  1KG1 A;  3EG2 A;  3RR6 A;  1G8X A;  1M30 A;  4M75 G;  1UB4 A;  1SG5 A;  3V8J A;  2KRO A;  1PSF A;  3FDR A;  4NL3 A;  2A37 A;  3OS1 A;  4OMO A;  2EYW A;  3V7R A;  1YHQ A;  2NUT B;  1QWF A;  2R57 A;  4XTV A;  5FU7 B;  3REB B;  1UGP B;  1T0H A;  4QQD A;  1T3S A;  5GAM e;  3OBW A;  5I11 A;  3S3N A;  4PJO C;  1CSK A;  4E7J A;  2MYS A;  2YRC A;  2ED0 A;  3QSU A;  5GAN 8;  2JW4 A;  5AYF A;  2E6N A;  1VQM Q;  3CCE Q;  1VQ4 T;  3G6E Q;  5GAN 7;  2L3R A;  3JSC A;  2KI7 A;  1PRM C;  1ZHI A;  4QKU A;  2CYZ B;  3NGP A;  2JTF A;  5A2Q E;  2BIV A;  3PMT A;  4XTY A;  4V2S A;  5LJ5 h;  1VYT A;  1K9M C;  4BUG A;  1BYM A;  4EMK C;  5FLX E;  1FMW A;  2GGR A;  2FO0 A;  1JRI A;  3G4S T;  2LNV A;  4J6Y A;  1OU8 A;  2KK4 A;  4LUD A;  3UF4 A;  4PJO F;  3JB9 G;  2K5I A;  5KYN A;  3JCM P;  5GMK j;  3CCE T;  2BTT A;  1IHW A;  2KDS A;  1NLP C;  3VV0 A;  2D8J A;  3PVL A;  1PKS A;  5FW9 A;  1VQ5 A;  1UE9 A;  2PTK A;  5C6S A;  2VYT A;  1U5S A;  3OBY A;  3PNW C;  4QW2 A;  2KRM A;  1M1K U;  2K4Y A;  1KQS P;  3OYC A;  1KHI A;  1YJW A;  1LNX A;  3GLX A;  1NG2 A;  2ZPB B;  3LLR A;  4E2F B;  3JB9 J;  1YWP A;  3VS1 A;  3CC2 A;  4PJO A;  2M0Y A;  3WXM B;  5I2S A;  1G2B A;  3OQ5 A;  3R6N A;  4M7A E;  2O4X B;  1PCX A;  1MMD A;  2HNI A;  2XIC A;  4J9G A;  2X51 A;  3UA7 A;  4KT0 E;  4JJD A;  2OJ2 A;  1EIF A;  3X26 B;  2GFU A;  1TUG B;  1IXD A;  3P8B B;  1YIJ T;  4N0A A;  2C06 A;  3M59 A;  4ZN1 A;  3FLG A;  4OB1 B;  1SEM A;  1WXB A;  1C6V X;  2PVG B;  1QQJ A;  3QWX X;  3JB9 I;  2J6F A;  5AT1 B;  2OTJ T;  3MJX A;  1KC8 U;  1BI1 A;  5IXF A;  2DTO A;  2VUB A;  1WHM A;  2KBT A;  5KYW B;  3JAM E;  3PT9 A;  6AT1 B;  4J6W A;  1BBZ A;  4HA8 A;  5GAM g;  1M27 C;  3PVQ A;  2O9V A;  3S6W A;  3EGD B;  3M0R A;  1Q82 C;  3JCM Q;  2COZ A;  1SSH A;  1VQ7 T;  4D8K A;  4M7D C;  4JJB A;  2ZPE B;  4J9C A;  4JRP A;  1TUC A;  1YIJ A;  1Y96 A;  3L2Q A;  4FT2 A;  1I1J A;  1D0X A;  1VQ8 Q;  2ATC B;  4GLM A;  3ZEH A;  2JJ9 A;  4J6X A;  1I4K 1;  3NTH A;  1NJI C;  4D6W A;  2L8D A;  4ELY C;  3G4S Q;  4Z88 A;  5GMK e;  2ED1 A;  2M51 A;  1JU5 C;  4BD3 A;  4RTV A;  3MET A;  4PLI A;  4XU2 A;  1UEB A;  4OVA A;  5CKD A;  3JCM V;  3VU3 C;  4ELZ C;  2XK0 A;  4J83 A;  2CUD A;  2E6Z A;  2I0N A;  4PNO A;  2O88 A;  5CQX A;  5HKC A;  4C92 F;  3HL8 A;  1ZUU A;  1VQ7 A;  2R5A A;  2NYS A;  3MP6 A;  3VS4 A;  1TSF A;  5FRO A;  3WVD B;  1VQ6 Q;  3VJP A;  2QEX A;  2DXU A;  1U1S A;  2EYX A;  2QK0 A;  4RCC A;  1JJ2 S;  3GPL A;  1D1B A;  2KRS A;  1OV3 A;  2LNH B;  1K9A A;  3M57 A;  4M77 B;  2CSQ A;  1Y57 A;  4EPC A;  4PLL A;  4XK8 E;  2DYI A;  1V1C A;  1B7T A;  3MPU B;  2FYK A;  3OYB A;  4Y91 A;  1AOJ A;  2CH4 A;  2W10 A;  3BDU A;  4AFZ C;  1K0X A;  5FWC A;  2QDL A;  1PD0 A;  2VKN A;  1KQ2 A;  3EGD A;  1NZ9 A;  3I5R A;  4AFS C;  4K11 A;  1G5V A;  2WSC E;  2MIO A;  1Q81 R;  4JZ3 A;  4PJO G;  3JB9 F;  3N5B B;  2F5K A;  4Y28 E;  3HRU A;  4HT9 A;  5KYW A;  2HQX A;  2LQW A;  2EQJ A;  2RH2 A;  1Y07 A;  2AKK A;  2IIM A;  2MWO A;  5GAN j;  5DM7 R;  5LJ5 j;  3RUX A;  2F2W A;  3A98 A;  2XHC A;  3HRS A;  4AG2 C;  1XJW B;  1QVG A;  3UWN A;  1OEB A;  1Y71 A;  4EIK A;  4FU6 A;  1K4U S;  3RES A;  1WGS A;  3HFN A;  5D6X A;  3H0F A;  4LDV A;  4J9F A;  3CME Q;  1GBQ A;  2DD4 A;  2DEQ A;  2YLC A;  2J06 A;  4M7A A;  1VYU A;  4C5I A;  2EYZ A;  1RAC B;  4E47 A;  4QVD A;  2FB7 A;  3MP8 A;  2GCX A;  2Z0W A;  1K8A U;  4IUV A;  2OTJ Q;  3HSB A;  3EH1 A;  2FZG B;  3CPF A;  1WXU A;  5GAN e;  2RA2 A;  2RQV A;  3I5S A;  3CCJ A;  3DB4 A;  3JCM f;  2V1R A;  4IKF A;  2NLU A;  4RMO A;  5LJ3 d;  1YJ9 T;  1I81 A;  1AEY A;  2K5L A;  1BI0 A;  3LW5 E;  4M75 F;  2CRE A;  2SRC A;  2NUT A;  3RDV A;  1G3T A;  2KVQ G;  1G3S A;  3M58 A;  2QDY B;  2QQR A;  3SWN A;  1XTD A;  5A0L A;  5L23 A;  3EFO A;  1LOJ A;  4OF1 A;  3OS0 A;  4A63 B;  3G71 T;  2H3E B;  1Y7X A;  2YWW A;  2FVU A;  1ZA1 B;  3OSV A;  1NJI R;  1Q95 G;  1T3L A;  3BE3 A;  1TUD A;  3QII A;  3TU4 K;  3D7S B;  1AZG B;  1NPP A;  2MWP A;  2DIL A;  1I5O B;  4DOV A;  1YCS B;  2MPX C;  2X4W A;  2K3B A;  1Q82 U;  1N6A A;  3SDZ A;  2KGT A;  5FRN A;  1TOV A;  1OUL A;  2AHJ B;  2JS2 A;  2XKO C;  3DLL A;  2MOX A;  2LT1 A;  1Y0M A;  4ANJ A;  4M7A D;  3VRZ A;  5LJ5 e;  4A54 A;  2RB6 A;  2ZPH B;  1I5L A;  3CCV A;  2K9G A;  1GXI E;  2L89 A;  1M90 R;  2DL8 A;  2KT1 A;  1R0C B;  1VQ8 T;  1ABO A;  3CCU A;  3OYA A;  4C8Q B;  3OS2 A;  4F7U G;  2RM4 A;  1YHQ Q;  2KXD A;  1G83 A;  2P4R A;  5GAM d;  1WJR A;  4JS5 A;  1VQP Q;  4BY6 B;  4KUD K;  2A7Y A;  5FWB A;  3CXC A;  4F7U E;  1M1K C;  4A53 A;  1QCF A;  1NE8 A;  2SEM A;  1IHV A;  1ZUY A;  2I2L A;  1YIT A;  4LD9 K;  3KXT A;  2E64 A;  3C95 A;  1C0M A;  3RNJ A;  4JRQ A;  3EG9 B;  2D6F A;  4FCY A;  2V8I A;  1N8R U;  4GLK A;  1SF9 A;  4RTY A;  3CCS Q;  3LX7 A;  3CCV T;  1KIK A;  1F1B B;  1K8A R;  4PJN A;  2LC4 A;  1GCP A;  4BE2 A;  2QAS A;  3V8L A;  1OX8 A;  2X3W D;  5KYU A;  2QEX Q;  3DLM A;  1VA7 A;  2RK2 A;  1VQK A;  1GFD A;  1OI1 A;  4NL2 A;  2RI2 A;  2VAS A;  1X27 A;  2EQU A;  2QA4 T;  3JCM h;  1VQ9 A;  1TXQ A;  1KHC A;  2GBQ A;  4FYY B;  1HJD A;  5DLO A;  3L2U A;  4BDZ A;  2VV5 A;  2GFA A;  2X4Y A;  3V7S A;  1BIB A;  1RUW A;  3CCU Q;  3TEE A;  3L2W A;  2VGN A;  2KT8 A;  2DL3 A;  2MCN A;  1OZ3 A;  5GAN 6;  4M7A G;  2MF2 A;  2OAU A;  3MEU A;  1VQP A;  1YJN T;  2Y4X A;  3EGX A;  3U23 A;  1ZBX A;  4HXJ A;  3CCQ A;  3TQ7 P;  3CC4 A;  2DVE A;  1RAB B;  1X6G A;  4JLG A;  3CPW A;  3OYE A;  3JB9 D;  4VUB A;  5GAN h;  3E9F A;  2DZ9 A;  3MEW A;  1M1G A;  3M0P A;  4ZGJ B;  3URG A;  4F17 A;  2EVR A;  1UHF A;  1N5Z A;  3H6Z A;  2RI3 A;  1Q7Y R;  3PFS A;  2DK3 A;  2NWM A;  3Q1J A;  1MMN A;  1YI2 T;  3V7C A;  3OMG A;  1SHF A;  2RO0 A;  1M1K R;  3THK A;  2EKH A;  1R8O B;  2BUD A;  2EGC A;  4J9H A;  4LUE A;  4JRI A;  1M3A A;  3CME A;  2L2P A;  3RKY A;  2P0K A;  3M0Q A;  2KE9 A;  1Q86 U;  2HDA A;  3GIB A;  2EJG A;  4JZ4 A;  4E7H A;  7AT1 B;  4M7D F;  1MMG A;  4M7A B;  4R56 A;  2CUB A;  3CD6 T;  2K6D A;  1FXX A;  3M0U A;  2R5M A;  3HKS A;  1W2B S;  1Q82 R;  1V29 B;  1ZA2 B;  3SB2 A;  1UUE A;  4OP0 A;  1YN8 A;  4FL6 A;  2RF0 A;  5CCA A;  2CP5 A;  4O6J A;  3LGL A;  1WFW A;  3P8D A;  3EHR A;  2CP0 A;  3I55 Q;  1QKW A;  2YRV A;  2X35 A;  4JRK A;  4C0G A;  4A4G A;  1X01 A;  3A8M B;  1GL5 A;  1VQN A;  2B86 A;  1WJS A;  3JCM X;  2FL7 A;  2QGG A;  2KQW A;  5KYX B;  3SWN C;  1S72 T;  5LJ3 g;  4RG8 A;  3FRN A;  1B34 B;  1RI0 A;  1WQ7 A;  2D0Q B;  4IUU A;  2JM8 A;  3E1S A;  2DET A;  2RNA A;  2YUN A;  1WXT A;  3CMA T;  1H64 1;  1M3B A;  3CD6 A;  2DER A;  5LJ3 f;  1ABQ A;  5GAO l;  4BB7 A;  3VYH B;  2QQB A;  4F7U A;  1VQM A;  4RG2 A;  1VQO T;  4OB2 B;  2LTO A;  3CCJ T;  2RHY A;  1WX6 A;  2RPN A;  3EG0 A;  4M7D A;  4IIM A;  5KE3 A;  1K9M R;  2CH4 W;  1WZO A;  1RAG B;  2VWF A;  1DJ7 B;  4MML A;  1JEG A;  2JS0 A;  1WNL A;  4MZT A;  4PJO D;  2HBP A;  1KJW A;  2A36 A;  4F14 A;  2KSS A;  4M7D E;  5DLQ E;  2LCS A;  2DF6 A;  4QVC A;  2XID A;  3G71 A;  3OW2 P;  1FYN A;  2DTH A;  2K3Y A;  3CEY A;  4MZP A;  4E7L A;  4PKC C;  1M2V A;  2RJF A;  4HCC A;  5GAO p;  1VQ4 Q;  4J9E A;  3KUF A;  1NPR A;  3QO3 A;  2RQW A;  2QA4 Q;  3RMQ A;  2OI3 A;  1M8M A;  2LDM A;  3EFS A;  1ZSZ A;  4JDS A;  5KYU B;  3INZ A;  1Q86 C;  1FX7 A; 
#chains in the Genus database with same CATH homology
 1TG0 A;  1UFF A;  2D8H A;  2EYX A;  2KR3 A;  3O5Z A;  1OPK A;  2KRS A;  1B07 A;  1OV3 A;  2LNH B;  1K9A A;  2YUQ A;  2CSQ A;  1Y57 A;  2ESW A;  2KXC A;  1HSQ A;  4JJC A;  1V1C A;  2CT3 A;  2OAW A;  4J9B A;  4DEY A;  4LE9 A;  2DJQ A;  1BB9 A;  2KYM A;  1ZSG A;  1WA7 A;  4Z8A A;  2GQI A;  2BZX A;  4Y92 A;  1AOJ A;  3SEM A;  1BU1 A;  2CH4 A;  2E5K A;  2A08 A;  1UJ0 A;  4OMN A;  4OMP A;  4WCI A;  2W10 A;  4AFZ C;  4HVW A;  5ECA A;  1K0X A;  1Z9Q A;  5FWC A;  3ULR B;  2QDL A;  1ARK A;  1K1Z A;  2VKN A;  3I5R A;  4AFS C;  2HSP A;  2J05 A;  4K11 A;  4DEX A;  4OMQ A;  4KRT A;  2FEI A;  2MIO A;  4JZ3 A;  4GBQ A;  1XOV A;  2ABL A;  2DNU A;  2K79 A;  1E6G A;  1GCQ A;  2EGE A;  3QWY A;  1MUZ A;  1FMK A;  2DBM A;  3PE0 A;  2EW3 A;  4M4Z A;  2LQW A;  2AKK A;  2IIM A;  2NUZ A;  1PKT A;  3JV3 A;  2ROL A;  3GBQ A;  1IO6 A;  2F2W A;  3A98 A;  1UEC A;  4X1V A;  4AG2 C;  2BZ8 A;  1X6B A;  1OEB A;  4AFQ C;  1T0J A;  2DX1 A;  2D0N A;  4RUG A;  4EIK A;  1K4U S;  3I35 A;  4OMM A;  1X2K A;  1KFZ A;  3H0F A;  2DL7 A;  2YDL A;  4J9F A;  1GBQ A;  2L3Q A;  2J06 A;  1VYU A;  1WYX A;  1WLP B;  5IHK A;  2EYZ A;  1QKX A;  2C0I A;  2FRW A;  4ESR A;  1X69 A;  2PNI A;  3LH5 A;  2L0A A;  4AG1 C;  1WXU A;  3TSZ A;  4RTT A;  2BZY A;  1U3O A;  2RQV A;  3I5S A;  3M0T A;  2JMC A;  2G6F X;  2DVJ A;  2V1R A;  1NYF A;  2AZV A;  2DBK A;  2EPD A;  2JTE A;  3VS2 A;  2HCK A;  4LN2 A;  1AEY A;  2YUO A;  1PHT A;  2F2V A;  1NM7 A;  2ROT A;  4RTU A;  2JXB A;  1RLP C;  2CRE A;  2SRC A;  1JXO A;  2LJ1 A;  1E7O A;  1EFN A;  1M3C A;  2D1X A;  4J9I A;  2DMO A;  5L23 A;  3SHW A;  3KFV A;  4A63 B;  1UG1 A;  2LX7 A;  1AWO A;  2FPD A;  2RQT A;  3VS0 A;  2DYB A;  1ZUK A;  2JMA A;  1AWX A;  1T3L A;  1UGV A;  2YT6 A;  2GTO A;  1H3H A;  4HVU A;  4ORZ A;  1TUD A;  1SRM A;  2DM1 A;  3NHN A;  2RN8 A;  1JO8 A;  4ZNX A;  1AZG B;  1WI7 A;  2L3S A;  3H0I A;  2DIL A;  2CT4 A;  1QLY A;  3ZL7 C;  2FPE A;  4OML A;  1X43 A;  1YCS B;  2J7I A;  1MV0 B;  2K3B A;  2KRN A;  2AK5 A;  2LMJ A;  1UDL A;  2KYB A;  1AZE A;  2KGT A;  2JS2 A;  3H0H A;  2MOX A;  1YP5 A;  2FPF A;  1Y0M A;  3VRZ A;  1ZX6 A;  4JPB W;  2YUP A;  3VS7 A;  1SRL A;  4D8D A;  2K9G A;  1WDX A;  2DA9 A;  4HVV A;  1WIE A;  2DL8 A;  2KT1 A;  1K0S A;  1B3Q A;  2JT4 A;  1ABO A;  1X2Q A;  2EYY A;  1YWO A;  2KXD A;  3REA B;  1G83 A;  2J6K A;  2P4R A;  4AFU C;  3NMZ C;  5EC7 A;  2XMF A;  1NEG A;  4CC4 B;  1W1F A;  1QWE A;  5FWB A;  2LZ6 B;  1K76 A;  2LQN A;  2V1Q A;  1YNZ A;  2X3X D;  1QCF A;  1AWW A;  1J3T A;  2O31 A;  4R0K A;  2SEM A;  3EG2 A;  1VYV A;  1HD3 A;  1M30 A;  1ZUY A;  2EQI A;  2KRO A;  2LJ0 A;  2A37 A;  3RNJ A;  4OMO A;  2EYW A;  2CSI A;  3EG3 A;  1QWF A;  1OOT A;  3REB B;  4RTY A;  1PNJ A;  1I07 A;  1T0H A;  1KIK A;  2YSQ A;  1T3S A;  4CC7 A;  2ENM A;  5I11 A;  1H8K A;  1GCP A;  1CSK A;  1A0N B;  2AZS A;  2K7A A;  2ED0 A;  2ECZ A;  3VS6 A;  2DRM A;  2X3W D;  2JW4 A;  1VA7 A;  2O9S A;  2RQU A;  1GFD A;  2L3P A;  1PRM C;  1E6H A;  1X27 A;  3NGP A;  1NEB A;  2GBQ A;  1HJD A;  4LNP A;  1ZLM A;  2RMO A;  1VYT A;  1RUW A;  2K2M A;  3I9Q A;  4RTZ A;  4QT7 A;  2KT8 A;  2DL3 A;  2MCN A;  1GFC A;  2GGR A;  1NLO C;  2FO0 A;  1UTI A;  4IIO A;  1UJY A;  1H92 A;  2DL4 A;  4LUD A;  2DLP A;  2CDT A;  3UF4 A;  1U06 A;  1GCQ C;  3U23 A;  4HXJ A;  4CC3 A;  2DE0 X;  3UA6 A;  1X6G A;  2FG0 A;  4FSS A;  1I0C A;  3UAT A;  1CKB A;  2BTT A;  3VRY A;  3M0P A;  1NLP C;  1AVZ C;  2D8J A;  3PVL A;  5GJW B;  4F17 A;  1JQQ A;  1PKS A;  1UHF A;  2EVR A;  5FW9 A;  3TSW A;  1N5Z A;  1UE9 A;  2PTK A;  2W0Z A;  1LCK A;  2NWM A;  4HCK A;  3FJ5 A;  3EHQ A;  1SHF A;  5HCK A;  3THK A;  2EKH A;  2EGC A;  1U5S A;  2KRM A;  4J9H A;  4LUE A;  3EG1 A;  1S1N A;  1GBR A;  4Z89 A;  2KNB B;  1M3A A;  1CKA A;  2DRK A;  1PWT A;  1RI9 A;  2L2P A;  2F2X A;  3M0Q A;  2KE9 A;  2HDA A;  1NG2 A;  4JZ4 A;  2JM9 A;  1YWP A;  3VS1 A;  2J6O A;  3NPF A;  2M0Y A;  2CUB A;  1W70 A;  1G2B A;  3R6N A;  2K6D A;  3M0U A;  1SHG A;  5IH2 A;  2HEQ A;  4RTX A;  1UUE A;  4J9G A;  3UA7 A;  3EGU A;  1YN8 A;  2RF0 A;  4JJD A;  2OJ2 A;  2H8H A;  1WFW A;  3M0S A;  3EHR A;  2RQR A;  1QKW A;  1AD5 A;  1SPK A;  1SEM A;  1WXB A;  5I22 A;  1ZBJ A;  1KSW A;  3IQL A;  3QWX X;  2J6F A;  1GL5 A;  5IXF A;  2B86 A;  1MV3 A;  2C0O A;  1UHC A;  2KBT A;  3RBB B;  2FRY A;  2JM8 A;  2RNA A;  2YUN A;  1BBZ A;  1W6X A;  1WXT A;  1M27 C;  3PVQ A;  2O9V A;  3VS5 A;  1M3B A;  1Z9Z A;  1OPL A;  3M0R A;  1ABQ A;  4RTW A;  2GNC A;  2O2O A;  2A28 A;  4J9D A;  1SSH A;  5IHI A;  5GJV B;  4D8K A;  2EBP A;  4JJB A;  5IHN A;  3VS3 A;  1WX6 A;  2RPN A;  4J9C A;  3EG0 A;  4IIM A;  1TUC A;  2CH4 W;  1JXM A;  2C0T A;  2VWF A;  1I1J A;  4GLM A;  1JEG A;  2JS0 A;  2EGA A;  2VVK A;  2LJ3 A;  1PRL C;  1NYG A;  1KJW A;  1BK2 A;  2A36 A;  4Z88 A;  4F14 A;  2GTJ A;  1AWJ A;  2ED1 A;  2M51 A;  1JU5 C;  4RTV A;  4CC2 A;  3H41 A;  2LCS A;  3CQT A;  2DF6 A;  3C0C A;  5IXB A;  2KEA A;  1FYN A;  2PZ1 A;  4E6R A;  1GRI A;  2CUD A;  2I0N A;  2O88 A;  2HBW A;  1RLQ C;  4J9E A;  4F16 A;  1ZUU A;  2RQW A;  2AKL A;  2OI3 A;  1M8M A;  2DL5 A;  2LP5 A;  3VS4 A;  3TVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...