4OMMA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant n113s
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNSTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The role of Gutamine 128 of the SH3 domain of the c-Src tyrosine kinase in 3D domain swapping and amyloid formation
rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 5
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ommA00
2LJ3A 2O2OA 1RI9A 1JXOA 2FG0A 1I07A 2A08A 4LUDA 2EYYA 1SRMA 1U5SA 3ZL7C 2DF6A 2RQWA 4DEXA 1QWEA 1ZLMA 2HSPA 3EHQA 3PVQA 2DL3A 5I22A 1AWXA 1K4US 1GCQC 1JXMA 2F2XA 4Z8AA 3C0CA 3VS3A 1WA7A 4CC3A 3R6NA 4J9GA 4J9BA 2DX1A 1ZSGA 1M8MA 2F2WA 2BZ8A 4QT7A 5IHKA 4HVWA 1NLOC 1VA7A 4RTYA 4OMMA 2LMJA 4RTUA 2O9VA 3NMZC 1EFNA 2KE9A 1WLPB 5ECAA 2D1XA 2ED0A 2FRYA 2AKKA 2C0TA 1S1NA 3UF4A 1AVZC 1GBQA 2DL4A 1YN8A 2NUZA 4CC7A 1X2QA 3M0PA 2RNAA 2MOXA 2LNHB 2KRNA 1GBRA 1E6GA 1WI7A 1RUWA 4CC4B 5HCKA 4OMPA 1E6HA 1ZX6A 4F16A 1JEGA 1GFCA 1X69A 2BTTA 2JMAA 1CKBA 2DL8A 1BK2A 2DBKA 2DVJA 4HVUA 4OMNA 2VKNA 1IO6A 4JZ4A 4J9IA 1Y0MA 2BZYA 4LNPA 1OOTA 4WCIA 2KYMA 2ABLA 4EIKA 3REBB 4OMOA 5FWBA 4LN2A 3UA6A 2EW3A 1WDXA 2EBPA 2SEMA 2CH4W 3VS5A 2CSIA 2HDAA 3M0TA 4IIOA 1AWWA 1QLYA 1BB9A 2RQTA 1JU5C 2DILA 1PNJA 1UECA 2K2MA 2FPFA 2A37A 4GBQA 2O9SA 4RTZA 1RLPC 1M27C 3VS4A 4D8DA 2DBMA 3EG1A 2K7AA 1GRIA 4J9DA 5IHNA 2DE0X 1GCPA 4HCKA 1MV0B 4JJCA 1M3CA 4OMLA 2KROA 4FSSA 4ESRA 1W1FA 2K79A 3NPFA 2D0NA 1HD3A 1PHTA 1T3SA 1E7OA 1AZEA 2NWMA 4K11A 4CC2A 2BZXA 3O5ZA 1AZGB 1KSWA 2JM8A 4AG2C 1BBZA 4RTXA 5L23A 2LJ1A 4JPBW 2JW4A 2CH4A 5FWCA 1B07A 3H0HA 2KEAA 4AFSC 1X6BA 1UJ0A 2YUQA 4JJBA 3I35A 4HXJA 3QWXX 3FJ5A 1WXTA 4ORZA 1UTIA 2DA9A 2LP5A 1G83A 2CDTA 2CUBA 1QCFA 2DJQA 2V1QA 4J9CA 2KGTA 2FO0A 3EHRA 2RPNA 4GLMA 2J6OA 1Z9ZA 1YWPA 3EG0A 3TSWA 3IQLA 2DRMA 1UGVA 2DYBA 2D8JA 3H41A 1KFZA 1I0CA 2EVRA 1K0XA 1WXUA 1K76A 1FYNA 2LX7A 3VRYA 4Y92A 4DEYA 1A0NB 3EG3A 2A36A 2FPEA 3U23A 3CQTA 1SRLA 1U3OA 2CREA 1X6GA 2PTKA 1PKTA 2YUNA 1SSHA 2MCNA 2ECZA 3A98A 5GJWB 1NM7A 3PVLA 4M4ZA 1VYUA 2ESWA 2M0YA 2GQIA 1OPKA 1ZBJA 2F2VA 2AZSA 3VS0A 2D8HA 3M0RA 1CSKA 3RBBB 3ULRB 2FRWA 1OV3A 3SEMA 2YUOA 2YT6A 1UJYA 1TUCA 2M51A 1B3QA 2JMCA 2PNIA 1WX6A 3M0SA 1H92A 2YDLA 3REAB 2GNCA 1VYTA 2LQNA 4AFUC 1TUDA 2J6FA 4F17A 2DM1A 1FMKA 4J9FA 1PWTA 2DRKA 2AZVA 3GBQA 1GFDA 1NYGA 1H3HA 2RF0A 2L3PA 3H0IA 1CKAA 1YCSB 3TVTA 2A28A 2GGRA 2YSQA 1ARKA 1QKXA 1HJDA 2KR3A 4AFZC 3VS7A 2ROTA 3VS6A 5EC7A 1NLPC 1ABQA 2KT1A 2K6DA 1PKSA 3NHNA 1ZUKA 2JT4A 2LCSA 1W6XA 2MIOA 2G6FX 3JV3A 5IXFA 2C0OA 2V1RA 2EQIA 2DL5A 1MV3A 2KXDA 4KRTA 4LE9A 4X1VA 2O88A 4AFQC 1K1ZA 1UDLA 1W70A 1WXBA 1QKWA 1AD5A 1K9AA 1NYFA 2J7IA 4JZ3A 2KXCA 2RN8A 2IIMA 1T0HA 2KBTA 1X2KA 4AG1C 4R0KA 2EGEA 1WFWA 2ED1A 3M0QA 2B86A 2P4RA 2FPDA 2GTJA 3I5RA 1J3TA 2JS0A 4A63B 2C0IA 1PRLC 1V1CA 4Z89A 2EKHA 2AKLA 4HVVA 4ZNXA 2I0NA 1G2BA 3PE0A 2RQVA 4F14A 3QWYA 2CT3A 2E5KA 1M3AA 1UFFA 1UG1A 1Y57A 2JS2A 2SRCA 3UA7A 3I9QA 2L0AA 2EGAA 2K9GA 1UUEA 2GBQA 2ENMA 2H8HA 4E6RA 1JO8A 4RTTA 4RTVA 2EGCA 1AOJA 1QWFA 4J9HA 2ROLA 1RLQC 2GTOA 2JTEA 2K3BA 2CT4A 1X27A 1N5ZA 1UE9A 2LQWA 2DL7A 4IIMA 5IHIA 3THKA 2CUDA 2W0ZA 1M3BA 1OEBA 4RUGA 2HCKA 4D8KA 1UHFA 2HBWA 2EYWA 1OPLA 2RQUA 1KJWA 1MUZA 5GJVB 2L2PA 3VS1A 2JM9A 2OI3A 1YP5A 3I5SA 2KNBB 3LH5A 2OAWA 1SHGA 1JQQA 2PZ1A 3UATA 2J06A 3RNJA 1AEYA 2DMOA 5FW9A 2RQRA 2W10A 2LZ6B 1SPKA 2JXBA 1XOVA 4RTWA 1NG2A 1GCQA 2KT8A 1BU1A 2XMFA 2YUPA 1SHFA 2O31A 1TG0A 2VVKA 3VRZA 1I1JA 1YWOA 4Z88A 3NGPA 2QDLA 1AWJA 1T3LA 2KYBA 4JJDA 5IXBA 4J9EA 1HSQA 1WIEA 2DLPA 2VWFA 2LJ0A 1LCKA 1WYXA 5IH2A 3TSZA 1Z9QA 1AWOA 2L3QA 3EG2A 3H0FA 1KIKA 4LUEA 1SEMA 2RMOA 2X3WD 3VS2A 2EPDA 1UHCA 2J05A 3KFVA 2EYXA 2KRSA 1VYVA 2DNUA 4OMQA 2CSQA 3SHWA 1ZUYA 1NEGA 1M30A 2KRMA 1YNZA 2OJ2A 1X43A 1K0SA 1ABOA 2L3SA 1ZUUA 3EGUA 2FEIA 2HEQA 1NEBA 2EYZA 1T0JA 1U06A 2X3XD 2AK5A 5I11A 1GL5A 1PRMC 2J6KA 3M0UA 1H8KA
chains in the Genus database with same CATH superfamily
2OTLT 2LJ3A 2HZYA 1JXOA 1I07A 1U5SA 2P0PA 1D0ZA 5GAN3 3ZL7C 2DF6A 2RQWA 1ZLMA 2RK2A 4MDXA 2DL3A 1AWXA 1RADB 1WHHA 3HHTB 3FJPA 2F2XA 5GAMj 1K73C 5M9OA 4Z8AA 4E2FB 1VQ6Q 2NYSA 1RAEB 1BI2A 5D7UA 3R6NA 4J9GA 3N5BB 2DX1A 2CYZB 3JCMe 1O75A 3PMIA 3LW5E 3QKJA 1PSEA 3H6ZA 4A53A 4ELZC 2LMJA 1D1BA 4A4KA 5GAMg 2AHJB 1R0CB 3CCRQ 4XAXB 3URGA 3JB9H 1WLPB 2ED0A 1QW1A 4BI3A 5AYFA 2DTHA 2C0TA 1XQHA 1KG1A 3TCJA 2VUBA 2CP5A 1MNEA 5LJ3d 3UF4A 3PIPA 1YN8A 2EAYA 3JB9J 4M77A 2CZ7B 3EGXA 3OBWA 3C12A 3TREA 3M0PA 3L2VA 2RNAA 2DD5A 2LNHB 4BI8B 5D6YA 2EIFA 1RUWA 1XTDA 2I2LA 4FL6A 2G3RA 4M7AG 5CIUA 2BTTA 2JMAA 4F7UG 1BK2A 4MMKA 4MZMA 4RCBA 1VQ5Q 1VQLQ 5GMKj 5CKFA 4ZGJB 4DOWA 1YBYA 7AT1B 3CD6Q 1IO6A 4JZ4A 2BZYA 1OOTA 2KYMA 4OMOA 4IUQA 4LN2A 3UA6A 5GAN5 1N8RC 2EJFA 2EW3A 3UPUA 3CCJQ 3M0TA 2FZCB 4J6XA 1EX4A 1YJWT 4OGCA 1JU5C 4JRPA 4N4GA 1JJ2P 5KYWA 1H3ZA 4J6YA 2K2MA 3CCSA 4JS5A 4GBQA 1WNLA 4RTZA 1M27C 2GFUA 1FWZA 5IHNA 4HKEA 1GCPA 5DY9A 2XK0A 3JCMX 2QGFB 3I56A 2VB6A 4LDXA 2DVEA 2K79A 3FIFA 1Y96A 3NPFA 4O6JA 1AZEA 4K11A 2V8KA 3TQ7P 3O5ZA 3G71T 3MCAB 3G71A 4M75A 3DKMA 4FW1A 3HRTA 5L23A 4KUIA 5J26A 1N9RA 1BYMA 1VUBA 1SSFA 3H0HA 1YITT 4BE2A 2JVVA 4AFSC 4E7ZA 1N8RR 4HCBA 1LNXA 1I5LA 4EMHA 1KC8C 4HXJA 3UT1A 4A4HA 4M7AF 4ORZA 3CBOA 3QPHA 2RHIA 2DA9A 3S3NA 1VQNT 2QXFA 2CDTA 1QCFA 1O9SA 4J9CA 5KYNA 3EHRA 2RPNA 2HKQB 5CQXA 1Z9ZA 2DRMA 4FYXB 3CC4T 2FVUA 2DYBA 4DQ2A 5GAN4 3OS1A 2XIDA 5A0LA 3CXCP 1K0XA 1WXUA 2LX7A 1S72A 3VRYA 1Q82C 2EQJA 4DEYA 2K5FA 2FPEA 3LYIA 4NL3A 3U23A 3E2UA 3ME9A 1SKUB 3CPWP 2YUNA 5KYXA 2F1LA 4QQ6A 3LH0A 4EDUA 2RM4A 4QQGA 5GANd 3FRNA 2NUPB 4KGZB 1BKBA 2GQIA 1OPKA 5LJ5g 1OU9A 1X01A 4EPCA 1MGQA 2AZSA 5DLOA 2XDPA 2XI9A 1RAIB 1CSKA 3ULRB 1JBMA 2EQKA 3BDUA 1OV3A 4KBMB 1W2BS 1UJYA 1FX7A 1MMGA 3CC7Q 5LJ5j 2WACA 4JRIA 4II1A 2EKOA 3CC2T 4BY6C 4HA8A 2DM1A 3CBMA 1KQSP 1FMKA 4KH1B 2P4TA 3CXCS 2DTOA 3VJPA 1R8OB 3JCMc 4PJOG 4R56A 1H3HA 3GNFB 2RF0A 3A8OB 1CKAA 1VQ7A 2A28A 5DM7R 3ER0A 1YIJQ 4EMKC 2RJCA 3VS6A 3JCMf 5EC7A 1NLPC 2XD0A 2E10A 2JNGA 4XTYA 1PKSA 1ZUKA 2LCCA 4P5NA 1VQPT 1W6XA 5IXFA 2CKKA 3H8ZA 4X1VA 2O88A 4AFQC 1W70A 4XU3A 3JSCA 1QKWA 4M77B 4JZ3A 2IIMA 2KBTA 4OF1A 2B86A 2GTJA 2QEXT 4PJOC 1J3TA 1MNDA 4DA4A 4N4IA 1K9MU 1PRLC 4Z89A 2OTLA 1G2BA 3OYEA 3RIRA 1W2BP 1EIFA 1VQ9A 5CKHA 3JCMJ 4X9CA 1M3AA 1UFFA 1UG1A 1Y57A 2SRCA 3UA7A 1YIJA 3I9QA 4QVZA 1TWBA 2GCXA 1VQ7Q 1W4SA 1UEBA 4F7UF 3VYGA 8ATCB 3SD4A 1M1KC 1AOJA 1QWFA 3G4ST 4C0FA 2COYA 2KAFA 1M4ZA 3RKWA 1V76A 4M75G 4M78F 3HRSA 3CC2Q 2DL7A 4IIMA 3GP8A 4QVDA 1VQOQ 1D0YA 4OP0A 1OEBA 3MKDA 2E70A 2NUPA 2JZ2A 1OPLA 4M78G 4M75F 4JDSA 2MMPA 2L2PA 2ZPHB 5LJ3g 2LDMA 1YJWQ 3PMTA 4FSXA 1KQ2A 2KNBB 3LH5A 2VXFA 1SHGA 3OYGA 2J06A 3Q1JA 3RNJA 2DMOA 1YJWA 3MO8A 3OYIA 2ZPGB 3JRZA 2W10A 2LZ6B 1SPKA 4M7AB 1XOVA 1WHKA 3I55T 4RTWA 3MEAA 2L5QA 2A7YA 1Y07A 1S72Q 2V8JA 3CCMQ 1I1JA 1M1FA 3CC7A 2OAUA 1QVFP 3X26B 3NGPA 2QDLA 2KYBA 1WIEA 2DLPA 5GAOl 3E19A 2K2VA 3KUFA 5HK0A 3S3MA 3NTIA 1B34A 1PD1A 2X3WD 2BKDN 3E9FA 5KYYA 2J05A 4NOYA 4JRQA 1K8AR 2KRSA 4OMQA 2YLBA 2QTVA 2BE7D 4M7AD 2YLCA 5GAMd 2DD4A 1M30A 1YNZA 2LRQA 1ZUUA 3EGUA 2HKNA 2KVQG 2EYZA 4FM4B 1U06A 5KE2A 1GL5A 1KD1C 1Q86R 2MK5A 3G71Q 3L2ZA 2Y4XA 1SRMA 4QQDA 4MZPA 1PSFA 1QWEA 1NPPA 2DAQA 3CCUQ 3PVQA 4KT0E 3GF5A 1WGSA 4C0ZA 1GCQC 2MPXC 4C5EA 3RDVA 3ASKA 3VS3A 3G6EQ 3QUIA 3M9QA 4FYWB 4C0DB 3DB4A 4M7DC 1GXIE 3CCSQ 5GAOp 4QVCA 1NLOC 3CCMT 5IAYA 3E9GA 4C92B 2FZGB 2LNVA 2DZ9A 1EFNA 4XTVA 3G6EA 1AT1B 4PFZA 3JCMd 3DB3A 4O5VA 1KHIA 2FRYA 2KK4A 4C0DC 2E64A 4ZN3A 2ZAEA 4DBQA 2YRVA 1I4K1 1S1NA 2IPOB 3SWNA 4PK4A 4N0AA 3GNGA 2FHDA 2KY9A 3CC4Q 4CC7A 1DJ7B 1VQ8A 1PCXA 3OYDA 1FXXA 1VQLT 1XNIA 1MMNA 2KRNA 1UGRB 4F16A 5LJ5e 1JEGA 2VV5A 1CKBA 3HTRA 5FU6C 5CQYA 1QQJA 3CCQT 2DVJA 1G3YA 1QVFA 1G3WA 4OMNA 2QK0A 1OQKA 1YI2A 2VKNA 4LNPA 1Y0MA 2EQMA 1OU8A 3REBB 1Q81U 2QG9B 3S6WA 2X4YA 2SEMA 2KDSA 2CSIA 3BW1A 1VQ5T 1YHQQ 1KK7A 1ACMB 2P0KA 3FLGA 4C5HA 2DILA 4OB1B 1PNJA 2HL3A 1EZZB 4C8QB 2A3LA 4FYVB 2A37A 2NUTB 4PJOB 4D8DA 4ZN1A 3CCET 3OSSC 3WVEB 3L2QA 3PFSA 3CCVQ 1M1KU 2ZPIB 5FRNA 1KD1U 4JJCA 1M3CA 2ZCFB 3AT1B 3CMEQ 2EJ9A 1W1FA 4XTWA 4LDUA 2D0NA 3X24B 1HD3A 1T3SA 3OSVA 1YHQT 4XTZA 4ZTJA 3M59A 1AZGB 3BE3A 2JM8A 1K9MC 4ELYC 2DIGA 4E7KA 8AT1B 4LD6A 5CCAA 3V8LA 2LJ1A 3HRUA 5GANh 5D6WA 3J81E 1B07A 4L6V5 5LL6S 3A1PA 4F7UA 3H9NA 2YUQA 2EWNA 3OW2P 3QWXX 3QZ5B 2DIQA 1UTIA 4HCCA 3QG1A 1KC8R 2KGTA 2FO0A 2NLUA 2E12A 1WJQA 5GMKi 3EG0A 3TSWA 3IQLA 4X9DA 3MEUA 4IUUA 3H41A 1I0CA 5GAMf 4HT8A 1S72T 3CMAT 4M75B 1FYNA 3QYGB 4JLGA 5GAN7 3V7SA 1Q95G 1A0NB 3MP8A 2A36A 1VQ5A 3MJXA 4B6MA 3L1AA 2HSEB 1U3OA 1Y71A 4M77F 4M78C 1SSHA 2MCNA 2ECZA 2E4HA 3PVLA 2QA4T 2ESWA 2M0YA 1BIAA 3VS0A 2RI2A 4A54A 2D8HA 1C6VX 2MI6A 1UGPB 4XTUA 2YT6A 4Y28E 3V7CA 3D7SB 1NZ9A 1D0XA 4E7SA 1B3QA 5KYXB 3CMET 2PNIA 1WX6A 2M9UA 4TVRA 2YDLA 1I81A 1VYTA 2JJ9A 2LQNA 4OB3B 1WJSA 3RMSA 4J6WA 1PWTA 2DRKA 5GAOq 4XU1A 4C5IA 1I5OB 3P8HA 1M90C 1PM3A 5CK9A 2CZ6B 3H0IA 1VQ6A 2LVMA 5GAOr 1VQPQ 2WSFE 3EG9A 3EFSA 1RI0A 5GAMe 1ZBXA 4PKCC 4F7UB 4A4FA 3L2UA 2K6DA 3OYBA 5GANj 2D0QB 2LCSA 2MIOA 1Q86U 2DL5A 2RK1A 5J3BA 4KRTA 1Q7YR 2LQKA 1WXBA 1G3TA 1AD5A 1K9AA 2E41A 2RN8A 1RAFB 4AG1C 4BUGA 3OYMA 3CCQQ 1WFWA 4BD3A 4RCCA 1ZA1B 2JS0A 4A63B 2CP0A 3L2WA 3JB9F 1V1CA 4PFPA 3MP6A 2AKLA 4HVVA 3OYJA 1VQKA 4ZTFA 3WXMB 4F14A 2YXYA 2E5KA 1M5Q1 1X6OA 2F69A 5KCOA 2ZZDA 2L0AA 3M56A 2K9GA 3TU4K 1UUEA 2H8HA 1TOVA 1W2BA 2QQRA 4RTVA 2EGCA 4UC4A 1I8FA 1JJ2S 2CP2A 2HQXA 3GIBA 5L8RE 1N5ZA 1UE9A 2LQWA 1OZ2A 4RG8A 3JCMb 3THKA 1TS9A 2DTIA 2QTXA 2RHXA 3ZFJA 4E47A 2HBWA 1G5VA 2GQVA 1KJWA 1MUZA 1OZ3A 4B9WA 4C92D 1PC0A 2JM9A 1ZSZC 4JRKA 3OY9A 3CCLA 4BE0A 4IUPA 1ZA2B 3X25B 2OAWA 4RG2A 2XHCA 3T9NA 3CCLQ 5FRMA 1VQ4T 4HCZA 2LT1A 5FW9A 3VV0A 2JXBA 3JCMW 4PJOE 1GCQA 1NG2A 2LTOA 2XMFA 4MMLA 4MZTA 2YUPA 2QDYB 2YHTA 1BI0A 2M0OA 1TG0A 2VVKA 2R5AA 2CZ0B 3VRZA 3OYKA 4Z88A 2FYKA 3TEEA 4IUVA 1M90R 1T3LA 5CKDA 5IXBA 4PJNA 4J9EA 4XK8E 1OI1A 1HSQA 1P92A 4CI0C 2R57A 1AHJB 2VWFA 4NS5A 1WYXA 3MHXA 3ZEHA 3VKIA 1SEMA 4M7AA 2EPDA 2PVOB 1YI2Q 3QJ6A 2IG0A 2EYXA 1VYVA 4EMKB 3JCMh 1NEGA 4E7JA 4FU6A 2OJ2A 3KBGA 1K0SA 2FEIA 5IN1A 1VQMT 2J6KA 4C8QD 4RKUE 2RHUA 1RI9A 2FG0A 3JAME 1OULA 3PNWC 3CXCA 2A08A 1N27A 4LUDA 4ZGEB 2QEXA 2CP6A 1M2VB 4WTOB 2HSPA 1M2VA 4JUVA 4R55A 4FCYA 2RHYA 1LJOA 5KYWB 1JXMA 2PUOB 4M7DF 4C92C 4M78E 3C0CA 5GAN2 2A0FB 5CKBA 3BDLA 3OW2A 4J83A 4J9BA 4LXCA 2COWA 2RHZA 2YWWA 4Z02A 2BZ8A 4QT7A 4N4HA 1TUGB 1LVKA 5GMKe 2DZCA 3A8LB 2BUDA 4RTUA 5CVIA 4L59A 2LT4A 3C94A 2KE9A 3RERA 2D1XA 3A8MB 2IVWA 5AT1B 3I55Q 3HFOA 2DO3A 1IHVA 1YCYA 2X9HA 5LJ5h 1NBEB 1IRXA 4J8OA 1RAGB 1AVZC 1GBQA 1IGUA 3EGXB 1U8RA 1X75C 2EYQA 1HYOA 2EFIA 4BY6B 4Y91A 3DLLA 1M1KR 2L8DA 1OYXA 2X4XA 4KUDK 1QMCA 3PIOA 1VQMA 2VGMA 1WI7A 4CC4B 3G4SA 4OMPA 1K8AU 3FEOA 1X69A 1KQSS 2DL8A 5IT9E 2COZA 1D3BB 1VQNA 3EH2A 3QIIA 4LDVA 2QASA 2L3RA 1RABB 2KQWA 3CD6T 2ABLA 1K73U 2DEQA 1WDXA 2EBPA 4L5GA 2CH4W 2JN0A 2ATCB 2HDAA 4M77E 4M78B 4IIOA 1QLYA 2RQTA 2R5MA 2F5TX 3EH1A 2FPFA 2LQ8A 4M7AC 3X28B 3JB9D 3M57A 3CCQA 1RLPC 1WZOA 5EG2A 3HFNA 4ATOA 2DBMA 3EG1A 4AT1B 4M7AE 4EMKA 6AT1B 3SWNC 3I56T 4KGXB 2K57A 5DLQE 5GMKh 4N0AC 2PVGB 3OYNA 2P84A 4J7FA 4OMLA 4B9XA 4M78A 4ESRA 2RH2A 2PU9B 3V7RA 3CBPA 3SDZA 1M9SA 1PHTA 2NWMA 1Q82U 3V8KA 4CC2A 1HXDA 2BZXA 1KSWA 3JCMQ 4LD9K 4FW2A 3QHSA 4RMOA 1VQPA 1BBZA 1Q86C 2CH4A 2RD1A 2DYIA 2M02A 5GMKm 4BACA 1Q7YC 3M5AA 1X6BA 1UJ0A 2QAZA 3FJ5A 1WHMA 2ZPFB 1YJ9T 4QKUA 2RI3A 2DPPB 2F5KA 2OTJA 2RO0A 2X4JA 4GLMA 1Y96B 1UGVA 2PUKB 2E3HA 2D8JA 3G7ZA 1VQ9Q 3PT9A 3UDCA 3RMQA 4XU2A 1K76A 3META 4M77C 3KXTA 3A5ZB 1QVGP 2VYTA 3EG3A 1BCMA 3VYHB 3C95A 1RACB 3MEWA 2E1HA 1PKTA 1N9SA 3OMGA 3OYCA 3O8VA 1VQOT 1MHNA 3A98A 5GJWB 3HL8A 4M4ZA 1VYUA 1SG5A 2DXUA 4Q5WA 2F2VA 1NE8A 3M55A 1JB0E 2RJDA 1SF9A 5FU6B 2XICA 4QW2A 2FRWA 3CCVA 2YUOA 2QA4Q 1TUCA 2M51A 1RAHB 2QI2A 3M54A 4FIBA 3UWNA 2JMCA 3OYHA 1M8VA 4AFUC 5CKEA 1VQ4Q 4NL2A 1YITQ 3NTHA 5GANg 2JOYA 4J9FA 5CAIA 2H3EB 1D1CA 4PFOA 2D6FA 3QBYA 1GFDA 1NYGA 2BIVA 4D6WA 1YHQA 1YCSB 3TVTA 3EGDB 1ARKA 2FB7A 1QVFS 1QKXA 2QQBA 1HJDA 3VS7A 2ROTA 4JLIA 1IZ6A 5LJ3j 3NHNA 2JT4A 4FT4A 3ZBDA 1N6AA 4C8QF 2DXCA 2ZPBB 4GLKA 2C0OA 3CMEA 2V1RA 5HKCA 2K3YA 4F7UE 5KCHA 2DXBA 4M7DG 3P8BB 2J7IA 1U1TA 4M75C 3M58A 1X2KA 4R0KA 3I5RA 4M75E 1Q81C 2C0IA 5D6XA 2B8AA 2EKHA 3CC4A 4ZNXA 2RQVA 3QWYA 2CT3A 3OYAA 2RA2A 3J80E 2JS2A 2HD0A 2GBQA 3CPWA 4E6RA 4J5YA 1JO8A 1UGQB 3G1JA 4PJJA 2ROLA 1RLQC 2GTOA 3LWHA 2DKGA 2K3BA 3QJYA 1YFNA 1YITA 1VQ4A 1X27A 2HNIA 3EFRA 4C92F 5IHIA 2KSSA 2CUDA 5FU7B 1WPYA 2KMTA 1D1AA 4XQ3A 1M3BA 4RUGA 1ZQ1A 2DFUA 3RKYA 4D8KA 2XG8D 4IKFA 2RB6A 5LJ3h 2X35A 2PQWA 3HP9A 5FU7C 3CCLT 1TU0B 1Y7XA 5KYYB 5I2MA 2OI3A 1YP5A 1VQ8Q 3I5SA 3JCMg 1KQ1A 5GAN6 1JQQA 3UATA 4OGEA 1AEYA 1U1SA 3J7AF 2RQRA 1ZHIA 2LC4A 2M16A 2DXTA 1D3BA 3JB9G 1BU1A 3M4YA 1VQOA 2RJEA 3GPLA 1SHFA 3CC2A 2O31A 1VOMA 4BDYA 4KH0B 4C92G 1YWOA 2O4XB 1AWJA 1WQ7A 4JJDA 3CMAQ 3R6OA 2LJ0A 4MDWA 3TSZA 1Z9QA 5J39A 1VQ7T 3H0FA 3CCUA 4PJMA 2E6ZA 4LUEA 3EGDA 2BE9B 1LOJA 1XJWB 3CD6A 4BI4A 2JTFA 4C92E 3OB9A 3M53A 4M78D 3CCRT 2KI7A 2DNUA 4C5GA 5HK3A 2MF2A 2HMAA 2LCLA 2KRMA 3V8JA 1ABOA 2L3SA 2HAXA 5LJ5d 1NEBA 1VQKT 4HT9A 5I11A 1PRMC 1ZSZA 3M0UA 2XDDA 9ATCB 2O2OA 3QO3A 3HSBA 1VQ6T 3X20B 1Q7YU 3SFMA 4M7DD 2EYYA 1IHWA 4DEXA 4C8QE 4M77D 2DEUA 4LDWA 3EHQA 3RR6A 2AIRB 3GLXA 5I22A 1K4US 1QP3A 5A0DA 1WA7A 4CC3A 1QVGS 1KD1R 1RL2A 3L2RA 1IXDA 1ZSGA 3CCMA 2DETA 1M8MA 2F2WA 5FLXE 2HBPA 5IHKA 4HVWA 1IGQA 4J7IA 4WF2A 2VASA 1VA7A 4RTYA 4OMMA 5CR2A 2R58A 2O9VA 3BFMA 2OX7A 3NMZC 3LWIA 2ZPEB 5ECAA 4PLIA 1FMWA 2AKKA 1BI1A 2QA4A 1QP2A 2CP7A 3PGGA 4CRIA 3EFOB 3LGLA 3LLRA 2DL4A 3MEVA 1BI3A 2RJFA 2D9TA 4X34A 3SWNB 1M1GA 2NUZA 1X2QA 4LDYA 2O4XA 2MOXA 5GANe 2WSCE 2CS7A 4OB2B 1GBRA 1E6GA 3OQ5A 5HCKA 3OA6A 1E6HA 1ZX6A 4OB0B 5CO7A 1GFCA 2CGHA 3EG9B 3EFOA 4OVAA 2DBKA 4HVUA 4F04B 4KULA 1IB8A 2VXEA 2LX9A 4J9IA 4WCIA 4JJNK 4C92A 4EIKA 5FWBA 2M1HA 3VS5A 3CCUT 5A0GA 5LJ3e 2C06A 2OTJQ 4A4EA 3CMAA 1QVGA 1AWWA 2L89A 1TXQA 3OW2S 1BB9A 2HL5C 3QZ9B 1MMAA 5LJ5f 2QQ9A 1M2OA 3EAEA 2OTLQ 1UECA 1H641 2NUTA 3VUBA 4DOVA 4XTXA 4C0GA 2O9SA 4IURA 3VS4A 3CCEQ 4C8QA 2K7AA 1GRIA 4J9DA 2DK3A 1B7TA 2DE0X 4HCKA 1MV0B 2V26A 3FB9A 3C4SA 2KROA 3QDRB 4FSSA 1E7OA 1QVPA 5I21A 4AG2C 1C0MA 3QDFA 3I56Q 2DERA 4RTXA 3I55A 4M7DB 4DBRA 3FDRA 3OMCA 1B34B 2JW4A 4JPBW 3CCVT 5FWCA 3QXEB 1TSFA 2XU8A 2KEAA 5KE3A 4JJBA 3I35A 4PJOD 1NJIC 1WXTA 3PTAA 2QQSA 2JUFA 4ZGDB 5GAOn 2LP5A 3P8DA 1G83A 1MMDA 2CUBA 2PVDB 2DJQA 2V1QA 3CCJA 2E65A 3OYFA 2OTJT 2J6OA 1YWPA 3OS2A 3RESA 4VUBA 5KH6A 1KFZA 2EVRA 1NJIR 5FROA 1UGSB 1RAAB 2GF7A 2H3JA 2XKOC 1LPLA 1VQLA 1JRIA 4Y92A 2Y90A 3CEYA 2P0QA 3QSUA 3LX7A 3CQTA 4V2SA 1YI2T 1SRLA 2CREA 1X6GA 3LGFA 2PTKA 2FL7A 5A2QE 2K5LA 2Y4YA 3VU3C 2QGGA 4PLLA 5C6SA 1NJIU 3CCJT 1NM7A 1QCOA 1YJ9A 4KGVB 1ZBJA 2FZKB 4PJOA 1KC8U 2CP3A 4DBFA 4IUTA 3JB9I 3M0RA 4E7HA 1Q82R 3RBBB 1M90U 3OYYA 2QYZA 1VQ8T 3SEMA 3HPWA 5GAN8 3JCMV 1JJ2A 4GY5A 4M75D 1YJNT 2VGNA 2EJGA 4PNOA 2YRDA 3M0SA 1H92A 3REAB 2GNCA 1TUDA 2J6FA 1WHLA 3E1SA 4F17A 2V8IA 3AHUA 2CZ1B 2MAMA 3CCST 1UB4A 2AZVA 3GBQA 1F1BB 1IREB 2L3PA 1VIFA 4A4GA 3MPUB 4M77G 4C8QC 3GOXA 2GGRA 2YSQA 2E5QA 2KR3A 4AFZC 3INZA 2MWPA 1TH7A 1ABQA 2XDBA 1OX8A 2KT1A 2EQUA 2QEXQ 5LJ3f 2WSEE 4OMFB 2G6FX 3JV3A 5GAMh 1YJ9Q 4BB7A 1PD0A 2EQIA 3L42A 3SB2A 2YRCA 1MV3A 2KXDA 4LE9A 1WHGA 1K1ZA 1UDLA 3HKSA 4DBHA 5KYUA 3NTKA 3RUXA 1NYFA 4YTLA 2KXCA 1T0HA 2QQAA 2EGEA 3M0QA 2ED1A 3DLMA 3OYLA 4E7LA 3FC3A 2P4RA 2FPDA 5HY6A 3RKXA 1KHCA 4PL6A 3OBYA 2K5IA 2I0NA 3CPWS 3PE0A 2AT1B 4BE1A 1OX9A 1PG5B 2Z0WA 1Q81R 2ZGWA 3CPFA 1WJRA 2EGAA 5GMKl 2ENMA 1D09B 4RTTA 3CCRA 4J9HA 1VQKQ 2JTEA 2CT4A 1KQSA 2VC8A 2HQHA 1ZSZB 1V29B 2RI5A 2W0ZA 1HK9A 1R0BG 1WQWA 2MYSA 3A8HB 2HCKA 3F70A 1N8RU 3WVDB 4M7DE 1UHFA 1VIEA 4XU0A 2EYWA 3CC7T 2JTMA 2RQUA 2E6NA 3VUZA 5GJVB 3OS5A 4FYYB 3VS1A 2GFAA 1BIBA 5C0MA 1C1AA 3M4GA 4C8QG 3NFCA 2MWOA 5KYUB 2PZ1A 3QYHB 3A8GB 4BDZA 2K4YA 5GANf 1TTHB 2E3IA 3OS0A 1QCNA 1YJNQ 2KT8A 1WHJA 3JCMP 4FT2A 3CCEA 1G3SA 3MP1A 1G8XA 1NPRA 1BCOA 5I2SA 2K3XA 4ANJA 1R77A 1VQ9T 4M7DA 3G6ET 2DJZA 1LCKA 5IH2A 1AWOA 2L3QA 3EG2A 1KIKA 2X51A 4JS4A 2RMOA 3VS2A 3S3OA 1UHCA 3KFVA 1K73R 4EMGA 2O01E 1VQNQ 1YIJT 1K8AC 4PJLA 2CSQA 3SHWA 3BY7A 1ZUYA 4AMCA 5GAOm 1K9MR 4PJOF 2HQEA 1X43A 4E7IA 2X4WA 1YJNA 2HEQA 1T0JA 3G4SQ 2X3XD 2AK5A 4ME7A 1FMVA 1VQMQ 1H8KA
chains in the Genus database with same CATH topology
2LJ3A 2O2OA 1RI9A 1JXOA 2FG0A 1I07A 2A08A 4LUDA 2EYYA 1SRMA 1U5SA 3ZL7C 2DF6A 2RQWA 4DEXA 1QWEA 1ZLMA 2HSPA 3EHQA 3PVQA 2DL3A 5I22A 1AWXA 1K4US 1GCQC 1JXMA 2F2XA 4Z8AA 3C0CA 3VS3A 1WA7A 4CC3A 3R6NA 4J9GA 4J9BA 2DX1A 1ZSGA 1M8MA 2F2WA 2BZ8A 4QT7A 5IHKA 4HVWA 1NLOC 1VA7A 4RTYA 4OMMA 2LMJA 4RTUA 2O9VA 3NMZC 1EFNA 2KE9A 1WLPB 5ECAA 2D1XA 2ED0A 2FRYA 2AKKA 2C0TA 1S1NA 3UF4A 1AVZC 1GBQA 2DL4A 1YN8A 2NUZA 4CC7A 1X2QA 3M0PA 2RNAA 2MOXA 2LNHB 2KRNA 1GBRA 1E6GA 1WI7A 1RUWA 4CC4B 5HCKA 4OMPA 1E6HA 1ZX6A 4F16A 1JEGA 1GFCA 1X69A 2BTTA 2JMAA 1CKBA 2DL8A 1BK2A 2DBKA 2DVJA 4HVUA 4OMNA 2VKNA 1IO6A 4JZ4A 4J9IA 1Y0MA 2BZYA 4LNPA 1OOTA 4WCIA 2KYMA 2ABLA 4EIKA 3REBB 4OMOA 5FWBA 4LN2A 3UA6A 2EW3A 1WDXA 2EBPA 2SEMA 2CH4W 3VS5A 2CSIA 2HDAA 3M0TA 4IIOA 1AWWA 1QLYA 1BB9A 2RQTA 1JU5C 2DILA 1PNJA 1UECA 2K2MA 2FPFA 2A37A 4GBQA 2O9SA 4RTZA 1RLPC 1M27C 3VS4A 4D8DA 2DBMA 3EG1A 2K7AA 1GRIA 4J9DA 5IHNA 2DE0X 1GCPA 4HCKA 1MV0B 4JJCA 1M3CA 4OMLA 2KROA 4FSSA 4ESRA 1W1FA 2K79A 3NPFA 2D0NA 1HD3A 1PHTA 1T3SA 1E7OA 1AZEA 2NWMA 4K11A 4CC2A 2BZXA 3O5ZA 1AZGB 1KSWA 2JM8A 4AG2C 1BBZA 4RTXA 5L23A 2LJ1A 4JPBW 2JW4A 2CH4A 5FWCA 1B07A 3H0HA 2KEAA 4AFSC 1X6BA 1UJ0A 2YUQA 4JJBA 3I35A 4HXJA 3QWXX 3FJ5A 1WXTA 4ORZA 1UTIA 2DA9A 2LP5A 1G83A 2CDTA 2CUBA 1QCFA 2DJQA 2V1QA 4J9CA 2KGTA 2FO0A 3EHRA 2RPNA 4GLMA 2J6OA 1Z9ZA 1YWPA 3EG0A 3TSWA 3IQLA 2DRMA 1UGVA 2DYBA 2D8JA 3H41A 1KFZA 1I0CA 2EVRA 1K0XA 1WXUA 1K76A 1FYNA 2LX7A 3VRYA 4Y92A 4DEYA 1A0NB 3EG3A 2A36A 2FPEA 3U23A 3CQTA 1SRLA 1U3OA 2CREA 1X6GA 2PTKA 1PKTA 2YUNA 1SSHA 2MCNA 2ECZA 3A98A 5GJWB 1NM7A 3PVLA 4M4ZA 1VYUA 2ESWA 2M0YA 2GQIA 1OPKA 1ZBJA 2F2VA 2AZSA 3VS0A 2D8HA 3M0RA 1CSKA 3RBBB 3ULRB 2FRWA 1OV3A 3SEMA 2YUOA 2YT6A 1UJYA 1TUCA 2M51A 1B3QA 2JMCA 2PNIA 1WX6A 3M0SA 1H92A 2YDLA 3REAB 2GNCA 1VYTA 2LQNA 4AFUC 1TUDA 2J6FA 4F17A 2DM1A 1FMKA 4J9FA 1PWTA 2DRKA 2AZVA 3GBQA 1GFDA 1NYGA 1H3HA 2RF0A 2L3PA 3H0IA 1CKAA 1YCSB 3TVTA 2A28A 2GGRA 2YSQA 1ARKA 1QKXA 1HJDA 2KR3A 4AFZC 3VS7A 2ROTA 3VS6A 5EC7A 1NLPC 1ABQA 2KT1A 2K6DA 1PKSA 3NHNA 1ZUKA 2JT4A 2LCSA 1W6XA 2MIOA 2G6FX 3JV3A 5IXFA 2C0OA 2V1RA 2EQIA 2DL5A 1MV3A 2KXDA 4KRTA 4LE9A 4X1VA 2O88A 4AFQC 1K1ZA 1UDLA 1W70A 1WXBA 1QKWA 1AD5A 1K9AA 1NYFA 2J7IA 4JZ3A 2KXCA 2RN8A 2IIMA 1T0HA 2KBTA 1X2KA 4AG1C 4R0KA 2EGEA 1WFWA 2ED1A 3M0QA 2B86A 2P4RA 2FPDA 2GTJA 3I5RA 1J3TA 2JS0A 4A63B 2C0IA 1PRLC 1V1CA 4Z89A 2EKHA 2AKLA 4HVVA 4ZNXA 2I0NA 1G2BA 3PE0A 2RQVA 4F14A 3QWYA 2CT3A 2E5KA 1M3AA 1UFFA 1UG1A 1Y57A 2JS2A 2SRCA 3UA7A 3I9QA 2L0AA 2EGAA 2K9GA 1UUEA 2GBQA 2ENMA 2H8HA 4E6RA 1JO8A 4RTTA 4RTVA 2EGCA 1AOJA 1QWFA 4J9HA 2ROLA 1RLQC 2GTOA 2JTEA 2K3BA 2CT4A 1X27A 1N5ZA 1UE9A 2LQWA 2DL7A 4IIMA 5IHIA 3THKA 2CUDA 2W0ZA 1M3BA 1OEBA 4RUGA 2HCKA 4D8KA 1UHFA 2HBWA 2EYWA 1OPLA 2RQUA 1KJWA 1MUZA 5GJVB 2L2PA 3VS1A 2JM9A 2OI3A 1YP5A 3I5SA 2KNBB 3LH5A 2OAWA 1SHGA 1JQQA 2PZ1A 3UATA 2J06A 3RNJA 1AEYA 2DMOA 5FW9A 2RQRA 2W10A 2LZ6B 1SPKA 2JXBA 1XOVA 4RTWA 1NG2A 1GCQA 2KT8A 1BU1A 2XMFA 2YUPA 1SHFA 2O31A 1TG0A 2VVKA 3VRZA 1I1JA 1YWOA 4Z88A 3NGPA 2QDLA 1AWJA 1T3LA 2KYBA 4JJDA 5IXBA 4J9EA 1HSQA 1WIEA 2DLPA 2VWFA 2LJ0A 1LCKA 1WYXA 5IH2A 3TSZA 1Z9QA 1AWOA 2L3QA 3EG2A 3H0FA 1KIKA 4LUEA 1SEMA 2RMOA 2X3WD 3VS2A 2EPDA 1UHCA 2J05A 3KFVA 2EYXA 2KRSA 1VYVA 2DNUA 4OMQA 2CSQA 3SHWA 1ZUYA 1NEGA 1M30A 2KRMA 1YNZA 2OJ2A 1X43A 1K0SA 1ABOA 2L3SA 1ZUUA 3EGUA 2FEIA 2HEQA 1NEBA 2EYZA 1T0JA 1U06A 2X3XD 2AK5A 5I11A 1GL5A 1PRMC 2J6KA 3M0UA 1H8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ3 A;  2O2O A;  1RI9 A;  1JXO A;  2FG0 A;  1I07 A;  2A08 A;  4LUD A;  2EYY A;  1SRM A;  1U5S A;  3ZL7 C;  2DF6 A;  2RQW A;  4DEX A;  1QWE A;  1ZLM A;  2HSP A;  3EHQ A;  3PVQ A;  2DL3 A;  5I22 A;  1AWX A;  1K4U S;  1GCQ C;  1JXM A;  2F2X A;  4Z8A A;  3C0C A;  3VS3 A;  1WA7 A;  4CC3 A;  3R6N A;  4J9G A;  4J9B A;  2DX1 A;  1ZSG A;  1M8M A;  2F2W A;  2BZ8 A;  4QT7 A;  5IHK A;  4HVW A;  1NLO C;  1VA7 A;  4RTY A;  4OMM A;  2LMJ A;  4RTU A;  2O9V A;  3NMZ C;  1EFN A;  2KE9 A;  1WLP B;  5ECA A;  2D1X A;  2ED0 A;  2FRY A;  2AKK A;  2C0T A;  1S1N A;  3UF4 A;  1AVZ C;  1GBQ A;  2DL4 A;  1YN8 A;  2NUZ A;  4CC7 A;  1X2Q A;  3M0P A;  2RNA A;  2MOX A;  2LNH B;  2KRN A;  1GBR A;  1E6G A;  1WI7 A;  1RUW A;  4CC4 B;  5HCK A;  4OMP A;  1E6H A;  1ZX6 A;  4F16 A;  1JEG A;  1GFC A;  1X69 A;  2BTT A;  2JMA A;  1CKB A;  2DL8 A;  1BK2 A;  2DBK A;  2DVJ A;  4HVU A;  4OMN A;  2VKN A;  1IO6 A;  4JZ4 A;  4J9I A;  1Y0M A;  2BZY A;  4LNP A;  1OOT A;  4WCI A;  2KYM A;  2ABL A;  4EIK A;  3REB B;  4OMO A;  5FWB A;  4LN2 A;  3UA6 A;  2EW3 A;  1WDX A;  2EBP A;  2SEM A;  2CH4 W;  3VS5 A;  2CSI A;  2HDA A;  3M0T A;  4IIO A;  1AWW A;  1QLY A;  1BB9 A;  2RQT A;  1JU5 C;  2DIL A;  1PNJ A;  1UEC A;  2K2M A;  2FPF A;  2A37 A;  4GBQ A;  2O9S A;  4RTZ A;  1RLP C;  1M27 C;  3VS4 A;  4D8D A;  2DBM A;  3EG1 A;  2K7A A;  1GRI A;  4J9D A;  5IHN A;  2DE0 X;  1GCP A;  4HCK A;  1MV0 B;  4JJC A;  1M3C A;  4OML A;  2KRO A;  4FSS A;  4ESR A;  1W1F A;  2K79 A;  3NPF A;  2D0N A;  1HD3 A;  1PHT A;  1T3S A;  1E7O A;  1AZE A;  2NWM A;  4K11 A;  4CC2 A;  2BZX A;  3O5Z A;  1AZG B;  1KSW A;  2JM8 A;  4AG2 C;  1BBZ A;  4RTX A;  5L23 A;  2LJ1 A;  4JPB W;  2JW4 A;  2CH4 A;  5FWC A;  1B07 A;  3H0H A;  2KEA A;  4AFS C;  1X6B A;  1UJ0 A;  2YUQ A;  4JJB A;  3I35 A;  4HXJ A;  3QWX X;  3FJ5 A;  1WXT A;  4ORZ A;  1UTI A;  2DA9 A;  2LP5 A;  1G83 A;  2CDT A;  2CUB A;  1QCF A;  2DJQ A;  2V1Q A;  4J9C A;  2KGT A;  2FO0 A;  3EHR A;  2RPN A;  4GLM A;  2J6O A;  1Z9Z A;  1YWP A;  3EG0 A;  3TSW A;  3IQL A;  2DRM A;  1UGV A;  2DYB A;  2D8J A;  3H41 A;  1KFZ A;  1I0C A;  2EVR A;  1K0X A;  1WXU A;  1K76 A;  1FYN A;  2LX7 A;  3VRY A;  4Y92 A;  4DEY A;  1A0N B;  3EG3 A;  2A36 A;  2FPE A;  3U23 A;  3CQT A;  1SRL A;  1U3O A;  2CRE A;  1X6G A;  2PTK A;  1PKT A;  2YUN A;  1SSH A;  2MCN A;  2ECZ A;  3A98 A;  5GJW B;  1NM7 A;  3PVL A;  4M4Z A;  1VYU A;  2ESW A;  2M0Y A;  2GQI A;  1OPK A;  1ZBJ A;  2F2V A;  2AZS A;  3VS0 A;  2D8H A;  3M0R A;  1CSK A;  3RBB B;  3ULR B;  2FRW A;  1OV3 A;  3SEM A;  2YUO A;  2YT6 A;  1UJY A;  1TUC A;  2M51 A;  1B3Q A;  2JMC A;  2PNI A;  1WX6 A;  3M0S A;  1H92 A;  2YDL A;  3REA B;  2GNC A;  1VYT A;  2LQN A;  4AFU C;  1TUD A;  2J6F A;  4F17 A;  2DM1 A;  1FMK A;  4J9F A;  1PWT A;  2DRK A;  2AZV A;  3GBQ A;  1GFD A;  1NYG A;  1H3H A;  2RF0 A;  2L3P A;  3H0I A;  1CKA A;  1YCS B;  3TVT A;  2A28 A;  2GGR A;  2YSQ A;  1ARK A;  1QKX A;  1HJD A;  2KR3 A;  4AFZ C;  3VS7 A;  2ROT A;  3VS6 A;  5EC7 A;  1NLP C;  1ABQ A;  2KT1 A;  2K6D A;  1PKS A;  3NHN A;  1ZUK A;  2JT4 A;  2LCS A;  1W6X A;  2MIO A;  2G6F X;  3JV3 A;  5IXF A;  2C0O A;  2V1R A;  2EQI A;  2DL5 A;  1MV3 A;  2KXD A;  4KRT A;  4LE9 A;  4X1V A;  2O88 A;  4AFQ C;  1K1Z A;  1UDL A;  1W70 A;  1WXB A;  1QKW A;  1AD5 A;  1K9A A;  1NYF A;  2J7I A;  4JZ3 A;  2KXC A;  2RN8 A;  2IIM A;  1T0H A;  2KBT A;  1X2K A;  4AG1 C;  4R0K A;  2EGE A;  1WFW A;  2ED1 A;  3M0Q A;  2B86 A;  2P4R A;  2FPD A;  2GTJ A;  3I5R A;  1J3T A;  2JS0 A;  4A63 B;  2C0I A;  1PRL C;  1V1C A;  4Z89 A;  2EKH A;  2AKL A;  4HVV A;  4ZNX A;  2I0N A;  1G2B A;  3PE0 A;  2RQV A;  4F14 A;  3QWY A;  2CT3 A;  2E5K A;  1M3A A;  1UFF A;  1UG1 A;  1Y57 A;  2JS2 A;  2SRC A;  3UA7 A;  3I9Q A;  2L0A A;  2EGA A;  2K9G A;  1UUE A;  2GBQ A;  2ENM A;  2H8H A;  4E6R A;  1JO8 A;  4RTT A;  4RTV A;  2EGC A;  1AOJ A;  1QWF A;  4J9H A;  2ROL A;  1RLQ C;  2GTO A;  2JTE A;  2K3B A;  2CT4 A;  1X27 A;  1N5Z A;  1UE9 A;  2LQW A;  2DL7 A;  4IIM A;  5IHI A;  3THK A;  2CUD A;  2W0Z A;  1M3B A;  1OEB A;  4RUG A;  2HCK A;  4D8K A;  1UHF A;  2HBW A;  2EYW A;  1OPL A;  2RQU A;  1KJW A;  1MUZ A;  5GJV B;  2L2P A;  3VS1 A;  2JM9 A;  2OI3 A;  1YP5 A;  3I5S A;  2KNB B;  3LH5 A;  2OAW A;  1SHG A;  1JQQ A;  2PZ1 A;  3UAT A;  2J06 A;  3RNJ A;  1AEY A;  2DMO A;  5FW9 A;  2RQR A;  2W10 A;  2LZ6 B;  1SPK A;  2JXB A;  1XOV A;  4RTW A;  1NG2 A;  1GCQ A;  2KT8 A;  1BU1 A;  2XMF A;  2YUP A;  1SHF A;  2O31 A;  1TG0 A;  2VVK A;  3VRZ A;  1I1J A;  1YWO A;  4Z88 A;  3NGP A;  2QDL A;  1AWJ A;  1T3L A;  2KYB A;  4JJD A;  5IXB A;  4J9E A;  1HSQ A;  1WIE A;  2DLP A;  2VWF A;  2LJ0 A;  1LCK A;  1WYX A;  5IH2 A;  3TSZ A;  1Z9Q A;  1AWO A;  2L3Q A;  3EG2 A;  3H0F A;  1KIK A;  4LUE A;  1SEM A;  2RMO A;  2X3W D;  3VS2 A;  2EPD A;  1UHC A;  2J05 A;  3KFV A;  2EYX A;  2KRS A;  1VYV A;  2DNU A;  4OMQ A;  2CSQ A;  3SHW A;  1ZUY A;  1NEG A;  1M30 A;  2KRM A;  1YNZ A;  2OJ2 A;  1X43 A;  1K0S A;  1ABO A;  2L3S A;  1ZUU A;  3EGU A;  2FEI A;  2HEQ A;  1NEB A;  2EYZ A;  1T0J A;  1U06 A;  2X3X D;  2AK5 A;  5I11 A;  1GL5 A;  1PRM C;  2J6K A;  3M0U A;  1H8K A; 
#chains in the Genus database with same CATH topology
 2OTL T;  2LJ3 A;  2HZY A;  1JXO A;  1I07 A;  1U5S A;  2P0P A;  1D0Z A;  5GAN 3;  3ZL7 C;  2DF6 A;  2RQW A;  1ZLM A;  2RK2 A;  4MDX A;  2DL3 A;  1AWX A;  1RAD B;  1WHH A;  3HHT B;  3FJP A;  2F2X A;  5GAM j;  1K73 C;  5M9O A;  4Z8A A;  4E2F B;  1VQ6 Q;  2NYS A;  1RAE B;  1BI2 A;  5D7U A;  3R6N A;  4J9G A;  3N5B B;  2DX1 A;  2CYZ B;  3JCM e;  1O75 A;  3PMI A;  3LW5 E;  3QKJ A;  1PSE A;  3H6Z A;  4A53 A;  4ELZ C;  2LMJ A;  1D1B A;  4A4K A;  5GAM g;  2AHJ B;  1R0C B;  3CCR Q;  4XAX B;  3URG A;  3JB9 H;  1WLP B;  2ED0 A;  1QW1 A;  4BI3 A;  5AYF A;  2DTH A;  2C0T A;  1XQH A;  1KG1 A;  3TCJ A;  2VUB A;  2CP5 A;  1MNE A;  5LJ3 d;  3UF4 A;  3PIP A;  1YN8 A;  2EAY A;  3JB9 J;  4M77 A;  2CZ7 B;  3EGX A;  3OBW A;  3C12 A;  3TRE A;  3M0P A;  3L2V A;  2RNA A;  2DD5 A;  2LNH B;  4BI8 B;  5D6Y A;  2EIF A;  1RUW A;  1XTD A;  2I2L A;  4FL6 A;  2G3R A;  4M7A G;  5CIU A;  2BTT A;  2JMA A;  4F7U G;  1BK2 A;  4MMK A;  4MZM A;  4RCB A;  1VQ5 Q;  1VQL Q;  5GMK j;  5CKF A;  4ZGJ B;  4DOW A;  1YBY A;  7AT1 B;  3CD6 Q;  1IO6 A;  4JZ4 A;  2BZY A;  1OOT A;  2KYM A;  4OMO A;  4IUQ A;  4LN2 A;  3UA6 A;  5GAN 5;  1N8R C;  2EJF A;  2EW3 A;  3UPU A;  3CCJ Q;  3M0T A;  2FZC B;  4J6X A;  1EX4 A;  1YJW T;  4OGC A;  1JU5 C;  4JRP A;  4N4G A;  1JJ2 P;  5KYW A;  1H3Z A;  4J6Y A;  2K2M A;  3CCS A;  4JS5 A;  4GBQ A;  1WNL A;  4RTZ A;  1M27 C;  2GFU A;  1FWZ A;  5IHN A;  4HKE A;  1GCP A;  5DY9 A;  2XK0 A;  3JCM X;  2QGF B;  3I56 A;  2VB6 A;  4LDX A;  2DVE A;  2K79 A;  3FIF A;  1Y96 A;  3NPF A;  4O6J A;  1AZE A;  4K11 A;  2V8K A;  3TQ7 P;  3O5Z A;  3G71 T;  3MCA B;  3G71 A;  4M75 A;  3DKM A;  4FW1 A;  3HRT A;  5L23 A;  4KUI A;  5J26 A;  1N9R A;  1BYM A;  1VUB A;  1SSF A;  3H0H A;  1YIT T;  4BE2 A;  2JVV A;  4AFS C;  4E7Z A;  1N8R R;  4HCB A;  1LNX A;  1I5L A;  4EMH A;  1KC8 C;  4HXJ A;  3UT1 A;  4A4H A;  4M7A F;  4ORZ A;  3CBO A;  3QPH A;  2RHI A;  2DA9 A;  3S3N A;  1VQN T;  2QXF A;  2CDT A;  1QCF A;  1O9S A;  4J9C A;  5KYN A;  3EHR A;  2RPN A;  2HKQ B;  5CQX A;  1Z9Z A;  2DRM A;  4FYX B;  3CC4 T;  2FVU A;  2DYB A;  4DQ2 A;  5GAN 4;  3OS1 A;  2XID A;  5A0L A;  3CXC P;  1K0X A;  1WXU A;  2LX7 A;  1S72 A;  3VRY A;  1Q82 C;  2EQJ A;  4DEY A;  2K5F A;  2FPE A;  3LYI A;  4NL3 A;  3U23 A;  3E2U A;  3ME9 A;  1SKU B;  3CPW P;  2YUN A;  5KYX A;  2F1L A;  4QQ6 A;  3LH0 A;  4EDU A;  2RM4 A;  4QQG A;  5GAN d;  3FRN A;  2NUP B;  4KGZ B;  1BKB A;  2GQI A;  1OPK A;  5LJ5 g;  1OU9 A;  1X01 A;  4EPC A;  1MGQ A;  2AZS A;  5DLO A;  2XDP A;  2XI9 A;  1RAI B;  1CSK A;  3ULR B;  1JBM A;  2EQK A;  3BDU A;  1OV3 A;  4KBM B;  1W2B S;  1UJY A;  1FX7 A;  1MMG A;  3CC7 Q;  5LJ5 j;  2WAC A;  4JRI A;  4II1 A;  2EKO A;  3CC2 T;  4BY6 C;  4HA8 A;  2DM1 A;  3CBM A;  1KQS P;  1FMK A;  4KH1 B;  2P4T A;  3CXC S;  2DTO A;  3VJP A;  1R8O B;  3JCM c;  4PJO G;  4R56 A;  1H3H A;  3GNF B;  2RF0 A;  3A8O B;  1CKA A;  1VQ7 A;  2A28 A;  5DM7 R;  3ER0 A;  1YIJ Q;  4EMK C;  2RJC A;  3VS6 A;  3JCM f;  5EC7 A;  1NLP C;  2XD0 A;  2E10 A;  2JNG A;  4XTY A;  1PKS A;  1ZUK A;  2LCC A;  4P5N A;  1VQP T;  1W6X A;  5IXF A;  2CKK A;  3H8Z A;  4X1V A;  2O88 A;  4AFQ C;  1W70 A;  4XU3 A;  3JSC A;  1QKW A;  4M77 B;  4JZ3 A;  2IIM A;  2KBT A;  4OF1 A;  2B86 A;  2GTJ A;  2QEX T;  4PJO C;  1J3T A;  1MND A;  4DA4 A;  4N4I A;  1K9M U;  1PRL C;  4Z89 A;  2OTL A;  1G2B A;  3OYE A;  3RIR A;  1W2B P;  1EIF A;  1VQ9 A;  5CKH A;  3JCM J;  4X9C A;  1M3A A;  1UFF A;  1UG1 A;  1Y57 A;  2SRC A;  3UA7 A;  1YIJ A;  3I9Q A;  4QVZ A;  1TWB A;  2GCX A;  1VQ7 Q;  1W4S A;  1UEB A;  4F7U F;  3VYG A;  8ATC B;  3SD4 A;  1M1K C;  1AOJ A;  1QWF A;  3G4S T;  4C0F A;  2COY A;  2KAF A;  1M4Z A;  3RKW A;  1V76 A;  4M75 G;  4M78 F;  3HRS A;  3CC2 Q;  2DL7 A;  4IIM A;  3GP8 A;  4QVD A;  1VQO Q;  1D0Y A;  4OP0 A;  1OEB A;  3MKD A;  2E70 A;  2NUP A;  2JZ2 A;  1OPL A;  4M78 G;  4M75 F;  4JDS A;  2MMP A;  2L2P A;  2ZPH B;  5LJ3 g;  2LDM A;  1YJW Q;  3PMT A;  4FSX A;  1KQ2 A;  2KNB B;  3LH5 A;  2VXF A;  1SHG A;  3OYG A;  2J06 A;  3Q1J A;  3RNJ A;  2DMO A;  1YJW A;  3MO8 A;  3OYI A;  2ZPG B;  3JRZ A;  2W10 A;  2LZ6 B;  1SPK A;  4M7A B;  1XOV A;  1WHK A;  3I55 T;  4RTW A;  3MEA A;  2L5Q A;  2A7Y A;  1Y07 A;  1S72 Q;  2V8J A;  3CCM Q;  1I1J A;  1M1F A;  3CC7 A;  2OAU A;  1QVF P;  3X26 B;  3NGP A;  2QDL A;  2KYB A;  1WIE A;  2DLP A;  5GAO l;  3E19 A;  2K2V A;  3KUF A;  5HK0 A;  3S3M A;  3NTI A;  1B34 A;  1PD1 A;  2X3W D;  2BKD N;  3E9F A;  5KYY A;  2J05 A;  4NOY A;  4JRQ A;  1K8A R;  2KRS A;  4OMQ A;  2YLB A;  2QTV A;  2BE7 D;  4M7A D;  2YLC A;  5GAM d;  2DD4 A;  1M30 A;  1YNZ A;  2LRQ A;  1ZUU A;  3EGU A;  2HKN A;  2KVQ G;  2EYZ A;  4FM4 B;  1U06 A;  5KE2 A;  1GL5 A;  1KD1 C;  1Q86 R;  2MK5 A;  3G71 Q;  3L2Z A;  2Y4X A;  1SRM A;  4QQD A;  4MZP A;  1PSF A;  1QWE A;  1NPP A;  2DAQ A;  3CCU Q;  3PVQ A;  4KT0 E;  3GF5 A;  1WGS A;  4C0Z A;  1GCQ C;  2MPX C;  4C5E A;  3RDV A;  3ASK A;  3VS3 A;  3G6E Q;  3QUI A;  3M9Q A;  4FYW B;  4C0D B;  3DB4 A;  4M7D C;  1GXI E;  3CCS Q;  5GAO p;  4QVC A;  1NLO C;  3CCM T;  5IAY A;  3E9G A;  4C92 B;  2FZG B;  2LNV A;  2DZ9 A;  1EFN A;  4XTV A;  3G6E A;  1AT1 B;  4PFZ A;  3JCM d;  3DB3 A;  4O5V A;  1KHI A;  2FRY A;  2KK4 A;  4C0D C;  2E64 A;  4ZN3 A;  2ZAE A;  4DBQ A;  2YRV A;  1I4K 1;  1S1N A;  2IPO B;  3SWN A;  4PK4 A;  4N0A A;  3GNG A;  2FHD A;  2KY9 A;  3CC4 Q;  4CC7 A;  1DJ7 B;  1VQ8 A;  1PCX A;  3OYD A;  1FXX A;  1VQL T;  1XNI A;  1MMN A;  2KRN A;  1UGR B;  4F16 A;  5LJ5 e;  1JEG A;  2VV5 A;  1CKB A;  3HTR A;  5FU6 C;  5CQY A;  1QQJ A;  3CCQ T;  2DVJ A;  1G3Y A;  1QVF A;  1G3W A;  4OMN A;  2QK0 A;  1OQK A;  1YI2 A;  2VKN A;  4LNP A;  1Y0M A;  2EQM A;  1OU8 A;  3REB B;  1Q81 U;  2QG9 B;  3S6W A;  2X4Y A;  2SEM A;  2KDS A;  2CSI A;  3BW1 A;  1VQ5 T;  1YHQ Q;  1KK7 A;  1ACM B;  2P0K A;  3FLG A;  4C5H A;  2DIL A;  4OB1 B;  1PNJ A;  2HL3 A;  1EZZ B;  4C8Q B;  2A3L A;  4FYV B;  2A37 A;  2NUT B;  4PJO B;  4D8D A;  4ZN1 A;  3CCE T;  3OSS C;  3WVE B;  3L2Q A;  3PFS A;  3CCV Q;  1M1K U;  2ZPI B;  5FRN A;  1KD1 U;  4JJC A;  1M3C A;  2ZCF B;  3AT1 B;  3CME Q;  2EJ9 A;  1W1F A;  4XTW A;  4LDU A;  2D0N A;  3X24 B;  1HD3 A;  1T3S A;  3OSV A;  1YHQ T;  4XTZ A;  4ZTJ A;  3M59 A;  1AZG B;  3BE3 A;  2JM8 A;  1K9M C;  4ELY C;  2DIG A;  4E7K A;  8AT1 B;  4LD6 A;  5CCA A;  3V8L A;  2LJ1 A;  3HRU A;  5GAN h;  5D6W A;  3J81 E;  1B07 A;  4L6V 5;  5LL6 S;  3A1P A;  4F7U A;  3H9N A;  2YUQ A;  2EWN A;  3OW2 P;  3QWX X;  3QZ5 B;  2DIQ A;  1UTI A;  4HCC A;  3QG1 A;  1KC8 R;  2KGT A;  2FO0 A;  2NLU A;  2E12 A;  1WJQ A;  5GMK i;  3EG0 A;  3TSW A;  3IQL A;  4X9D A;  3MEU A;  4IUU A;  3H41 A;  1I0C A;  5GAM f;  4HT8 A;  1S72 T;  3CMA T;  4M75 B;  1FYN A;  3QYG B;  4JLG A;  5GAN 7;  3V7S A;  1Q95 G;  1A0N B;  3MP8 A;  2A36 A;  1VQ5 A;  3MJX A;  4B6M A;  3L1A A;  2HSE B;  1U3O A;  1Y71 A;  4M77 F;  4M78 C;  1SSH A;  2MCN A;  2ECZ A;  2E4H A;  3PVL A;  2QA4 T;  2ESW A;  2M0Y A;  1BIA A;  3VS0 A;  2RI2 A;  4A54 A;  2D8H A;  1C6V X;  2MI6 A;  1UGP B;  4XTU A;  2YT6 A;  4Y28 E;  3V7C A;  3D7S B;  1NZ9 A;  1D0X A;  4E7S A;  1B3Q A;  5KYX B;  3CME T;  2PNI A;  1WX6 A;  2M9U A;  4TVR A;  2YDL A;  1I81 A;  1VYT A;  2JJ9 A;  2LQN A;  4OB3 B;  1WJS A;  3RMS A;  4J6W A;  1PWT A;  2DRK A;  5GAO q;  4XU1 A;  4C5I A;  1I5O B;  3P8H A;  1M90 C;  1PM3 A;  5CK9 A;  2CZ6 B;  3H0I A;  1VQ6 A;  2LVM A;  5GAO r;  1VQP Q;  2WSF E;  3EG9 A;  3EFS A;  1RI0 A;  5GAM e;  1ZBX A;  4PKC C;  4F7U B;  4A4F A;  3L2U A;  2K6D A;  3OYB A;  5GAN j;  2D0Q B;  2LCS A;  2MIO A;  1Q86 U;  2DL5 A;  2RK1 A;  5J3B A;  4KRT A;  1Q7Y R;  2LQK A;  1WXB A;  1G3T A;  1AD5 A;  1K9A A;  2E41 A;  2RN8 A;  1RAF B;  4AG1 C;  4BUG A;  3OYM A;  3CCQ Q;  1WFW A;  4BD3 A;  4RCC A;  1ZA1 B;  2JS0 A;  4A63 B;  2CP0 A;  3L2W A;  3JB9 F;  1V1C A;  4PFP A;  3MP6 A;  2AKL A;  4HVV A;  3OYJ A;  1VQK A;  4ZTF A;  3WXM B;  4F14 A;  2YXY A;  2E5K A;  1M5Q 1;  1X6O A;  2F69 A;  5KCO A;  2ZZD A;  2L0A A;  3M56 A;  2K9G A;  3TU4 K;  1UUE A;  2H8H A;  1TOV A;  1W2B A;  2QQR A;  4RTV A;  2EGC A;  4UC4 A;  1I8F A;  1JJ2 S;  2CP2 A;  2HQX A;  3GIB A;  5L8R E;  1N5Z A;  1UE9 A;  2LQW A;  1OZ2 A;  4RG8 A;  3JCM b;  3THK A;  1TS9 A;  2DTI A;  2QTX A;  2RHX A;  3ZFJ A;  4E47 A;  2HBW A;  1G5V A;  2GQV A;  1KJW A;  1MUZ A;  1OZ3 A;  4B9W A;  4C92 D;  1PC0 A;  2JM9 A;  1ZSZ C;  4JRK A;  3OY9 A;  3CCL A;  4BE0 A;  4IUP A;  1ZA2 B;  3X25 B;  2OAW A;  4RG2 A;  2XHC A;  3T9N A;  3CCL Q;  5FRM A;  1VQ4 T;  4HCZ A;  2LT1 A;  5FW9 A;  3VV0 A;  2JXB A;  3JCM W;  4PJO E;  1GCQ A;  1NG2 A;  2LTO A;  2XMF A;  4MML A;  4MZT A;  2YUP A;  2QDY B;  2YHT A;  1BI0 A;  2M0O A;  1TG0 A;  2VVK A;  2R5A A;  2CZ0 B;  3VRZ A;  3OYK A;  4Z88 A;  2FYK A;  3TEE A;  4IUV A;  1M90 R;  1T3L A;  5CKD A;  5IXB A;  4PJN A;  4J9E A;  4XK8 E;  1OI1 A;  1HSQ A;  1P92 A;  4CI0 C;  2R57 A;  1AHJ B;  2VWF A;  4NS5 A;  1WYX A;  3MHX A;  3ZEH A;  3VKI A;  1SEM A;  4M7A A;  2EPD A;  2PVO B;  1YI2 Q;  3QJ6 A;  2IG0 A;  2EYX A;  1VYV A;  4EMK B;  3JCM h;  1NEG A;  4E7J A;  4FU6 A;  2OJ2 A;  3KBG A;  1K0S A;  2FEI A;  5IN1 A;  1VQM T;  2J6K A;  4C8Q D;  4RKU E;  2RHU A;  1RI9 A;  2FG0 A;  3JAM E;  1OUL A;  3PNW C;  3CXC A;  2A08 A;  1N27 A;  4LUD A;  4ZGE B;  2QEX A;  2CP6 A;  1M2V B;  4WTO B;  2HSP A;  1M2V A;  4JUV A;  4R55 A;  4FCY A;  2RHY A;  1LJO A;  5KYW B;  1JXM A;  2PUO B;  4M7D F;  4C92 C;  4M78 E;  3C0C A;  5GAN 2;  2A0F B;  5CKB A;  3BDL A;  3OW2 A;  4J83 A;  4J9B A;  4LXC A;  2COW A;  2RHZ A;  2YWW A;  4Z02 A;  2BZ8 A;  4QT7 A;  4N4H A;  1TUG B;  1LVK A;  5GMK e;  2DZC A;  3A8L B;  2BUD A;  4RTU A;  5CVI A;  4L59 A;  2LT4 A;  3C94 A;  2KE9 A;  3RER A;  2D1X A;  3A8M B;  2IVW A;  5AT1 B;  3I55 Q;  3HFO A;  2DO3 A;  1IHV A;  1YCY A;  2X9H A;  5LJ5 h;  1NBE B;  1IRX A;  4J8O A;  1RAG B;  1AVZ C;  1GBQ A;  1IGU A;  3EGX B;  1U8R A;  1X75 C;  2EYQ A;  1HYO A;  2EFI A;  4BY6 B;  4Y91 A;  3DLL A;  1M1K R;  2L8D A;  1OYX A;  2X4X A;  4KUD K;  1QMC A;  3PIO A;  1VQM A;  2VGM A;  1WI7 A;  4CC4 B;  3G4S A;  4OMP A;  1K8A U;  3FEO A;  1X69 A;  1KQS S;  2DL8 A;  5IT9 E;  2COZ A;  1D3B B;  1VQN A;  3EH2 A;  3QII A;  4LDV A;  2QAS A;  2L3R A;  1RAB B;  2KQW A;  3CD6 T;  2ABL A;  1K73 U;  2DEQ A;  1WDX A;  2EBP A;  4L5G A;  2CH4 W;  2JN0 A;  2ATC B;  2HDA A;  4M77 E;  4M78 B;  4IIO A;  1QLY A;  2RQT A;  2R5M A;  2F5T X;  3EH1 A;  2FPF A;  2LQ8 A;  4M7A C;  3X28 B;  3JB9 D;  3M57 A;  3CCQ A;  1RLP C;  1WZO A;  5EG2 A;  3HFN A;  4ATO A;  2DBM A;  3EG1 A;  4AT1 B;  4M7A E;  4EMK A;  6AT1 B;  3SWN C;  3I56 T;  4KGX B;  2K57 A;  5DLQ E;  5GMK h;  4N0A C;  2PVG B;  3OYN A;  2P84 A;  4J7F A;  4OML A;  4B9X A;  4M78 A;  4ESR A;  2RH2 A;  2PU9 B;  3V7R A;  3CBP A;  3SDZ A;  1M9S A;  1PHT A;  2NWM A;  1Q82 U;  3V8K A;  4CC2 A;  1HXD A;  2BZX A;  1KSW A;  3JCM Q;  4LD9 K;  4FW2 A;  3QHS A;  4RMO A;  1VQP A;  1BBZ A;  1Q86 C;  2CH4 A;  2RD1 A;  2DYI A;  2M02 A;  5GMK m;  4BAC A;  1Q7Y C;  3M5A A;  1X6B A;  1UJ0 A;  2QAZ A;  3FJ5 A;  1WHM A;  2ZPF B;  1YJ9 T;  4QKU A;  2RI3 A;  2DPP B;  2F5K A;  2OTJ A;  2RO0 A;  2X4J A;  4GLM A;  1Y96 B;  1UGV A;  2PUK B;  2E3H A;  2D8J A;  3G7Z A;  1VQ9 Q;  3PT9 A;  3UDC A;  3RMQ A;  4XU2 A;  1K76 A;  3MET A;  4M77 C;  3KXT A;  3A5Z B;  1QVG P;  2VYT A;  3EG3 A;  1BCM A;  3VYH B;  3C95 A;  1RAC B;  3MEW A;  2E1H A;  1PKT A;  1N9S A;  3OMG A;  3OYC A;  3O8V A;  1VQO T;  1MHN A;  3A98 A;  5GJW B;  3HL8 A;  4M4Z A;  1VYU A;  1SG5 A;  2DXU A;  4Q5W A;  2F2V A;  1NE8 A;  3M55 A;  1JB0 E;  2RJD A;  1SF9 A;  5FU6 B;  2XIC A;  4QW2 A;  2FRW A;  3CCV A;  2YUO A;  2QA4 Q;  1TUC A;  2M51 A;  1RAH B;  2QI2 A;  3M54 A;  4FIB A;  3UWN A;  2JMC A;  3OYH A;  1M8V A;  4AFU C;  5CKE A;  1VQ4 Q;  4NL2 A;  1YIT Q;  3NTH A;  5GAN g;  2JOY A;  4J9F A;  5CAI A;  2H3E B;  1D1C A;  4PFO A;  2D6F A;  3QBY A;  1GFD A;  1NYG A;  2BIV A;  4D6W A;  1YHQ A;  1YCS B;  3TVT A;  3EGD B;  1ARK A;  2FB7 A;  1QVF S;  1QKX A;  2QQB A;  1HJD A;  3VS7 A;  2ROT A;  4JLI A;  1IZ6 A;  5LJ3 j;  3NHN A;  2JT4 A;  4FT4 A;  3ZBD A;  1N6A A;  4C8Q F;  2DXC A;  2ZPB B;  4GLK A;  2C0O A;  3CME A;  2V1R A;  5HKC A;  2K3Y A;  4F7U E;  5KCH A;  2DXB A;  4M7D G;  3P8B B;  2J7I A;  1U1T A;  4M75 C;  3M58 A;  1X2K A;  4R0K A;  3I5R A;  4M75 E;  1Q81 C;  2C0I A;  5D6X A;  2B8A A;  2EKH A;  3CC4 A;  4ZNX A;  2RQV A;  3QWY A;  2CT3 A;  3OYA A;  2RA2 A;  3J80 E;  2JS2 A;  2HD0 A;  2GBQ A;  3CPW A;  4E6R A;  4J5Y A;  1JO8 A;  1UGQ B;  3G1J A;  4PJJ A;  2ROL A;  1RLQ C;  2GTO A;  3LWH A;  2DKG A;  2K3B A;  3QJY A;  1YFN A;  1YIT A;  1VQ4 A;  1X27 A;  2HNI A;  3EFR A;  4C92 F;  5IHI A;  2KSS A;  2CUD A;  5FU7 B;  1WPY A;  2KMT A;  1D1A A;  4XQ3 A;  1M3B A;  4RUG A;  1ZQ1 A;  2DFU A;  3RKY A;  4D8K A;  2XG8 D;  4IKF A;  2RB6 A;  5LJ3 h;  2X35 A;  2PQW A;  3HP9 A;  5FU7 C;  3CCL T;  1TU0 B;  1Y7X A;  5KYY B;  5I2M A;  2OI3 A;  1YP5 A;  1VQ8 Q;  3I5S A;  3JCM g;  1KQ1 A;  5GAN 6;  1JQQ A;  3UAT A;  4OGE A;  1AEY A;  1U1S A;  3J7A F;  2RQR A;  1ZHI A;  2LC4 A;  2M16 A;  2DXT A;  1D3B A;  3JB9 G;  1BU1 A;  3M4Y A;  1VQO A;  2RJE A;  3GPL A;  1SHF A;  3CC2 A;  2O31 A;  1VOM A;  4BDY A;  4KH0 B;  4C92 G;  1YWO A;  2O4X B;  1AWJ A;  1WQ7 A;  4JJD A;  3CMA Q;  3R6O A;  2LJ0 A;  4MDW A;  3TSZ A;  1Z9Q A;  5J39 A;  1VQ7 T;  3H0F A;  3CCU A;  4PJM A;  2E6Z A;  4LUE A;  3EGD A;  2BE9 B;  1LOJ A;  1XJW B;  3CD6 A;  4BI4 A;  2JTF A;  4C92 E;  3OB9 A;  3M53 A;  4M78 D;  3CCR T;  2KI7 A;  2DNU A;  4C5G A;  5HK3 A;  2MF2 A;  2HMA A;  2LCL A;  2KRM A;  3V8J A;  1ABO A;  2L3S A;  2HAX A;  5LJ5 d;  1NEB A;  1VQK T;  4HT9 A;  5I11 A;  1PRM C;  1ZSZ A;  3M0U A;  2XDD A;  9ATC B;  2O2O A;  3QO3 A;  3HSB A;  1VQ6 T;  3X20 B;  1Q7Y U;  3SFM A;  4M7D D;  2EYY A;  1IHW A;  4DEX A;  4C8Q E;  4M77 D;  2DEU A;  4LDW A;  3EHQ A;  3RR6 A;  2AIR B;  3GLX A;  5I22 A;  1K4U S;  1QP3 A;  5A0D A;  1WA7 A;  4CC3 A;  1QVG S;  1KD1 R;  1RL2 A;  3L2R A;  1IXD A;  1ZSG A;  3CCM A;  2DET A;  1M8M A;  2F2W A;  5FLX E;  2HBP A;  5IHK A;  4HVW A;  1IGQ A;  4J7I A;  4WF2 A;  2VAS A;  1VA7 A;  4RTY A;  4OMM A;  5CR2 A;  2R58 A;  2O9V A;  3BFM A;  2OX7 A;  3NMZ C;  3LWI A;  2ZPE B;  5ECA A;  4PLI A;  1FMW A;  2AKK A;  1BI1 A;  2QA4 A;  1QP2 A;  2CP7 A;  3PGG A;  4CRI A;  3EFO B;  3LGL A;  3LLR A;  2DL4 A;  3MEV A;  1BI3 A;  2RJF A;  2D9T A;  4X34 A;  3SWN B;  1M1G A;  2NUZ A;  1X2Q A;  4LDY A;  2O4X A;  2MOX A;  5GAN e;  2WSC E;  2CS7 A;  4OB2 B;  1GBR A;  1E6G A;  3OQ5 A;  5HCK A;  3OA6 A;  1E6H A;  1ZX6 A;  4OB0 B;  5CO7 A;  1GFC A;  2CGH A;  3EG9 B;  3EFO A;  4OVA A;  2DBK A;  4HVU A;  4F04 B;  4KUL A;  1IB8 A;  2VXE A;  2LX9 A;  4J9I A;  4WCI A;  4JJN K;  4C92 A;  4EIK A;  5FWB A;  2M1H A;  3VS5 A;  3CCU T;  5A0G A;  5LJ3 e;  2C06 A;  2OTJ Q;  4A4E A;  3CMA A;  1QVG A;  1AWW A;  2L89 A;  1TXQ A;  3OW2 S;  1BB9 A;  2HL5 C;  3QZ9 B;  1MMA A;  5LJ5 f;  2QQ9 A;  1M2O A;  3EAE A;  2OTL Q;  1UEC A;  1H64 1;  2NUT A;  3VUB A;  4DOV A;  4XTX A;  4C0G A;  2O9S A;  4IUR A;  3VS4 A;  3CCE Q;  4C8Q A;  2K7A A;  1GRI A;  4J9D A;  2DK3 A;  1B7T A;  2DE0 X;  4HCK A;  1MV0 B;  2V26 A;  3FB9 A;  3C4S A;  2KRO A;  3QDR B;  4FSS A;  1E7O A;  1QVP A;  5I21 A;  4AG2 C;  1C0M A;  3QDF A;  3I56 Q;  2DER A;  4RTX A;  3I55 A;  4M7D B;  4DBR A;  3FDR A;  3OMC A;  1B34 B;  2JW4 A;  4JPB W;  3CCV T;  5FWC A;  3QXE B;  1TSF A;  2XU8 A;  2KEA A;  5KE3 A;  4JJB A;  3I35 A;  4PJO D;  1NJI C;  1WXT A;  3PTA A;  2QQS A;  2JUF A;  4ZGD B;  5GAO n;  2LP5 A;  3P8D A;  1G83 A;  1MMD A;  2CUB A;  2PVD B;  2DJQ A;  2V1Q A;  3CCJ A;  2E65 A;  3OYF A;  2OTJ T;  2J6O A;  1YWP A;  3OS2 A;  3RES A;  4VUB A;  5KH6 A;  1KFZ A;  2EVR A;  1NJI R;  5FRO A;  1UGS B;  1RAA B;  2GF7 A;  2H3J A;  2XKO C;  1LPL A;  1VQL A;  1JRI A;  4Y92 A;  2Y90 A;  3CEY A;  2P0Q A;  3QSU A;  3LX7 A;  3CQT A;  4V2S A;  1YI2 T;  1SRL A;  2CRE A;  1X6G A;  3LGF A;  2PTK A;  2FL7 A;  5A2Q E;  2K5L A;  2Y4Y A;  3VU3 C;  2QGG A;  4PLL A;  5C6S A;  1NJI U;  3CCJ T;  1NM7 A;  1QCO A;  1YJ9 A;  4KGV B;  1ZBJ A;  2FZK B;  4PJO A;  1KC8 U;  2CP3 A;  4DBF A;  4IUT A;  3JB9 I;  3M0R A;  4E7H A;  1Q82 R;  3RBB B;  1M90 U;  3OYY A;  2QYZ A;  1VQ8 T;  3SEM A;  3HPW A;  5GAN 8;  3JCM V;  1JJ2 A;  4GY5 A;  4M75 D;  1YJN T;  2VGN A;  2EJG A;  4PNO A;  2YRD A;  3M0S A;  1H92 A;  3REA B;  2GNC A;  1TUD A;  2J6F A;  1WHL A;  3E1S A;  4F17 A;  2V8I A;  3AHU A;  2CZ1 B;  2MAM A;  3CCS T;  1UB4 A;  2AZV A;  3GBQ A;  1F1B B;  1IRE B;  2L3P A;  1VIF A;  4A4G A;  3MPU B;  4M77 G;  4C8Q C;  3GOX A;  2GGR A;  2YSQ A;  2E5Q A;  2KR3 A;  4AFZ C;  3INZ A;  2MWP A;  1TH7 A;  1ABQ A;  2XDB A;  1OX8 A;  2KT1 A;  2EQU A;  2QEX Q;  5LJ3 f;  2WSE E;  4OMF B;  2G6F X;  3JV3 A;  5GAM h;  1YJ9 Q;  4BB7 A;  1PD0 A;  2EQI A;  3L42 A;  3SB2 A;  2YRC A;  1MV3 A;  2KXD A;  4LE9 A;  1WHG A;  1K1Z A;  1UDL A;  3HKS A;  4DBH A;  5KYU A;  3NTK A;  3RUX A;  1NYF A;  4YTL A;  2KXC A;  1T0H A;  2QQA A;  2EGE A;  3M0Q A;  2ED1 A;  3DLM A;  3OYL A;  4E7L A;  3FC3 A;  2P4R A;  2FPD A;  5HY6 A;  3RKX A;  1KHC A;  4PL6 A;  3OBY A;  2K5I A;  2I0N A;  3CPW S;  3PE0 A;  2AT1 B;  4BE1 A;  1OX9 A;  1PG5 B;  2Z0W A;  1Q81 R;  2ZGW A;  3CPF A;  1WJR A;  2EGA A;  5GMK l;  2ENM A;  1D09 B;  4RTT A;  3CCR A;  4J9H A;  1VQK Q;  2JTE A;  2CT4 A;  1KQS A;  2VC8 A;  2HQH A;  1ZSZ B;  1V29 B;  2RI5 A;  2W0Z A;  1HK9 A;  1R0B G;  1WQW A;  2MYS A;  3A8H B;  2HCK A;  3F70 A;  1N8R U;  3WVD B;  4M7D E;  1UHF A;  1VIE A;  4XU0 A;  2EYW A;  3CC7 T;  2JTM A;  2RQU A;  2E6N A;  3VUZ A;  5GJV B;  3OS5 A;  4FYY B;  3VS1 A;  2GFA A;  1BIB A;  5C0M A;  1C1A A;  3M4G A;  4C8Q G;  3NFC A;  2MWO A;  5KYU B;  2PZ1 A;  3QYH B;  3A8G B;  4BDZ A;  2K4Y A;  5GAN f;  1TTH B;  2E3I A;  3OS0 A;  1QCN A;  1YJN Q;  2KT8 A;  1WHJ A;  3JCM P;  4FT2 A;  3CCE A;  1G3S A;  3MP1 A;  1G8X A;  1NPR A;  1BCO A;  5I2S A;  2K3X A;  4ANJ A;  1R77 A;  1VQ9 T;  4M7D A;  3G6E T;  2DJZ A;  1LCK A;  5IH2 A;  1AWO A;  2L3Q A;  3EG2 A;  1KIK A;  2X51 A;  4JS4 A;  2RMO A;  3VS2 A;  3S3O A;  1UHC A;  3KFV A;  1K73 R;  4EMG A;  2O01 E;  1VQN Q;  1YIJ T;  1K8A C;  4PJL A;  2CSQ A;  3SHW A;  3BY7 A;  1ZUY A;  4AMC A;  5GAO m;  1K9M R;  4PJO F;  2HQE A;  1X43 A;  4E7I A;  2X4W A;  1YJN A;  2HEQ A;  1T0J A;  3G4S Q;  2X3X D;  2AK5 A;  4ME7 A;  1FMV A;  1VQM Q;  1H8K A; 
#chains in the Genus database with same CATH homology
 2LJ3 A;  2O2O A;  1RI9 A;  1JXO A;  2FG0 A;  1I07 A;  2A08 A;  4LUD A;  2EYY A;  1SRM A;  1U5S A;  3ZL7 C;  2DF6 A;  2RQW A;  4DEX A;  1QWE A;  1ZLM A;  2HSP A;  3EHQ A;  3PVQ A;  2DL3 A;  5I22 A;  1AWX A;  1K4U S;  1GCQ C;  1JXM A;  2F2X A;  4Z8A A;  3C0C A;  3VS3 A;  1WA7 A;  4CC3 A;  3R6N A;  4J9G A;  4J9B A;  2DX1 A;  1ZSG A;  1M8M A;  2F2W A;  2BZ8 A;  4QT7 A;  5IHK A;  4HVW A;  1NLO C;  1VA7 A;  4RTY A;  4OMM A;  2LMJ A;  4RTU A;  2O9V A;  3NMZ C;  1EFN A;  2KE9 A;  1WLP B;  5ECA A;  2D1X A;  2ED0 A;  2FRY A;  2AKK A;  2C0T A;  1S1N A;  3UF4 A;  1AVZ C;  1GBQ A;  2DL4 A;  1YN8 A;  2NUZ A;  4CC7 A;  1X2Q A;  3M0P A;  2RNA A;  2MOX A;  2LNH B;  2KRN A;  1GBR A;  1E6G A;  1WI7 A;  1RUW A;  4CC4 B;  5HCK A;  4OMP A;  1E6H A;  1ZX6 A;  4F16 A;  1JEG A;  1GFC A;  1X69 A;  2BTT A;  2JMA A;  1CKB A;  2DL8 A;  1BK2 A;  2DBK A;  2DVJ A;  4HVU A;  4OMN A;  2VKN A;  1IO6 A;  4JZ4 A;  4J9I A;  1Y0M A;  2BZY A;  4LNP A;  1OOT A;  4WCI A;  2KYM A;  2ABL A;  4EIK A;  3REB B;  4OMO A;  5FWB A;  4LN2 A;  3UA6 A;  2EW3 A;  1WDX A;  2EBP A;  2SEM A;  2CH4 W;  3VS5 A;  2CSI A;  2HDA A;  3M0T A;  4IIO A;  1AWW A;  1QLY A;  1BB9 A;  2RQT A;  1JU5 C;  2DIL A;  1PNJ A;  1UEC A;  2K2M A;  2FPF A;  2A37 A;  4GBQ A;  2O9S A;  4RTZ A;  1RLP C;  1M27 C;  3VS4 A;  4D8D A;  2DBM A;  3EG1 A;  2K7A A;  1GRI A;  4J9D A;  5IHN A;  2DE0 X;  1GCP A;  4HCK A;  1MV0 B;  4JJC A;  1M3C A;  4OML A;  2KRO A;  4FSS A;  4ESR A;  1W1F A;  2K79 A;  3NPF A;  2D0N A;  1HD3 A;  1PHT A;  1T3S A;  1E7O A;  1AZE A;  2NWM A;  4K11 A;  4CC2 A;  2BZX A;  3O5Z A;  1AZG B;  1KSW A;  2JM8 A;  4AG2 C;  1BBZ A;  4RTX A;  5L23 A;  2LJ1 A;  4JPB W;  2JW4 A;  2CH4 A;  5FWC A;  1B07 A;  3H0H A;  2KEA A;  4AFS C;  1X6B A;  1UJ0 A;  2YUQ A;  4JJB A;  3I35 A;  4HXJ A;  3QWX X;  3FJ5 A;  1WXT A;  4ORZ A;  1UTI A;  2DA9 A;  2LP5 A;  1G83 A;  2CDT A;  2CUB A;  1QCF A;  2DJQ A;  2V1Q A;  4J9C A;  2KGT A;  2FO0 A;  3EHR A;  2RPN A;  4GLM A;  2J6O A;  1Z9Z A;  1YWP A;  3EG0 A;  3TSW A;  3IQL A;  2DRM A;  1UGV A;  2DYB A;  2D8J A;  3H41 A;  1KFZ A;  1I0C A;  2EVR A;  1K0X A;  1WXU A;  1K76 A;  1FYN A;  2LX7 A;  3VRY A;  4Y92 A;  4DEY A;  1A0N B;  3EG3 A;  2A36 A;  2FPE A;  3U23 A;  3CQT A;  1SRL A;  1U3O A;  2CRE A;  1X6G A;  2PTK A;  1PKT A;  2YUN A;  1SSH A;  2MCN A;  2ECZ A;  3A98 A;  5GJW B;  1NM7 A;  3PVL A;  4M4Z A;  1VYU A;  2ESW A;  2M0Y A;  2GQI A;  1OPK A;  1ZBJ A;  2F2V A;  2AZS A;  3VS0 A;  2D8H A;  3M0R A;  1CSK A;  3RBB B;  3ULR B;  2FRW A;  1OV3 A;  3SEM A;  2YUO A;  2YT6 A;  1UJY A;  1TUC A;  2M51 A;  1B3Q A;  2JMC A;  2PNI A;  1WX6 A;  3M0S A;  1H92 A;  2YDL A;  3REA B;  2GNC A;  1VYT A;  2LQN A;  4AFU C;  1TUD A;  2J6F A;  4F17 A;  2DM1 A;  1FMK A;  4J9F A;  1PWT A;  2DRK A;  2AZV A;  3GBQ A;  1GFD A;  1NYG A;  1H3H A;  2RF0 A;  2L3P A;  3H0I A;  1CKA A;  1YCS B;  3TVT A;  2A28 A;  2GGR A;  2YSQ A;  1ARK A;  1QKX A;  1HJD A;  2KR3 A;  4AFZ C;  3VS7 A;  2ROT A;  3VS6 A;  5EC7 A;  1NLP C;  1ABQ A;  2KT1 A;  2K6D A;  1PKS A;  3NHN A;  1ZUK A;  2JT4 A;  2LCS A;  1W6X A;  2MIO A;  2G6F X;  3JV3 A;  5IXF A;  2C0O A;  2V1R A;  2EQI A;  2DL5 A;  1MV3 A;  2KXD A;  4KRT A;  4LE9 A;  4X1V A;  2O88 A;  4AFQ C;  1K1Z A;  1UDL A;  1W70 A;  1WXB A;  1QKW A;  1AD5 A;  1K9A A;  1NYF A;  2J7I A;  4JZ3 A;  2KXC A;  2RN8 A;  2IIM A;  1T0H A;  2KBT A;  1X2K A;  4AG1 C;  4R0K A;  2EGE A;  1WFW A;  2ED1 A;  3M0Q A;  2B86 A;  2P4R A;  2FPD A;  2GTJ A;  3I5R A;  1J3T A;  2JS0 A;  4A63 B;  2C0I A;  1PRL C;  1V1C A;  4Z89 A;  2EKH A;  2AKL A;  4HVV A;  4ZNX A;  2I0N A;  1G2B A;  3PE0 A;  2RQV A;  4F14 A;  3QWY A;  2CT3 A;  2E5K A;  1M3A A;  1UFF A;  1UG1 A;  1Y57 A;  2JS2 A;  2SRC A;  3UA7 A;  3I9Q A;  2L0A A;  2EGA A;  2K9G A;  1UUE A;  2GBQ A;  2ENM A;  2H8H A;  4E6R A;  1JO8 A;  4RTT A;  4RTV A;  2EGC A;  1AOJ A;  1QWF A;  4J9H A;  2ROL A;  1RLQ C;  2GTO A;  2JTE A;  2K3B A;  2CT4 A;  1X27 A;  1N5Z A;  1UE9 A;  2LQW A;  2DL7 A;  4IIM A;  5IHI A;  3THK A;  2CUD A;  2W0Z A;  1M3B A;  1OEB A;  4RUG A;  2HCK A;  4D8K A;  1UHF A;  2HBW A;  2EYW A;  1OPL A;  2RQU A;  1KJW A;  1MUZ A;  5GJV B;  2L2P A;  3VS1 A;  2JM9 A;  2OI3 A;  1YP5 A;  3I5S A;  2KNB B;  3LH5 A;  2OAW A;  1SHG A;  1JQQ A;  2PZ1 A;  3UAT A;  2J06 A;  3RNJ A;  1AEY A;  2DMO A;  5FW9 A;  2RQR A;  2W10 A;  2LZ6 B;  1SPK A;  2JXB A;  1XOV A;  4RTW A;  1NG2 A;  1GCQ A;  2KT8 A;  1BU1 A;  2XMF A;  2YUP A;  1SHF A;  2O31 A;  1TG0 A;  2VVK A;  3VRZ A;  1I1J A;  1YWO A;  4Z88 A;  3NGP A;  2QDL A;  1AWJ A;  1T3L A;  2KYB A;  4JJD A;  5IXB A;  4J9E A;  1HSQ A;  1WIE A;  2DLP A;  2VWF A;  2LJ0 A;  1LCK A;  1WYX A;  5IH2 A;  3TSZ A;  1Z9Q A;  1AWO A;  2L3Q A;  3EG2 A;  3H0F A;  1KIK A;  4LUE A;  1SEM A;  2RMO A;  2X3W D;  3VS2 A;  2EPD A;  1UHC A;  2J05 A;  3KFV A;  2EYX A;  2KRS A;  1VYV A;  2DNU A;  4OMQ A;  2CSQ A;  3SHW A;  1ZUY A;  1NEG A;  1M30 A;  2KRM A;  1YNZ A;  2OJ2 A;  1X43 A;  1K0S A;  1ABO A;  2L3S A;  1ZUU A;  3EGU A;  2FEI A;  2HEQ A;  1NEB A;  2EYZ A;  1T0J A;  1U06 A;  2X3X D;  2AK5 A;  5I11 A;  1GL5 A;  1PRM C;  2J6K A;  3M0U A;  1H8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...