4OMMA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant n113s
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNSTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title The role of Gutamine 128 of the SH3 domain of the c-Src tyrosine kinase in 3D domain swapping and amyloid formation
rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 5
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ommA00
1GRIA 2VWFA 1H3HA 2SEMA 2A28A 1PWTA 2ECZA 5EC7A 4Z89A 2JT4A 4HXJA 4LNPA 2RQUA 4OMQA 3TSWA 1AEYA 2B86A 2YT6A 3VS5A 1M3AA 3M0SA 1OPLA 1WIEA 1X27A 1AOJA 1UHFA 3H0HA 2M51A 1GBQA 1TUDA 1CSKA 3QWYA 4AG1C 3SHWA 1M27C 1WX6A 1SRMA 2A37A 2J6OA 2KT8A 4Z8AA 1Z9ZA 2LMJA 2CT3A 2DL8A 2CSIA 3U23A 2DM1A 2EW3A 4HCKA 1VYTA 3REAB 2KNBB 4IIMA 4ZNXA 5HCKA 1AZEA 3JV3A 1JO8A 2O31A 4R0KA 1PHTA 3UF4A 2YUNA 2O9VA 2HCKA 2ENMA 2V1RA 5IH2A 1MV3A 4J9BA 4RUGA 1M30A 4D8KA 3M0QA 2JW4A 2KROA 1E7OA 4LN2A 2YUQA 2HEQA 2KEAA 1SHFA 4D8DA 1ABQA 4DEYA 2V1QA 2A08A 1U06A 1WXUA 1UDLA 2BZ8A 1YP5A 2EKHA 2FRYA 2CDTA 4AFZC 4RTVA 1X2KA 1U3OA 1W1FA 1T3LA 1Y0MA 2O2OA 2RNAA 2OI3A 1GBRA 2DBKA 2DILA 4RTUA 1K4US 4AFUC 1K76A 1MUZA 2CUBA 1GCQA 2JM9A 2L0AA 2ROTA 1QKXA 4RTYA 1NEGA 1I0CA 1NEBA 1WDXA 2DX1A 1LCKA 1JU5C 2KRSA 5FWBA 5GJVB 3VS3A 3VS0A 5IHKA 1M3BA 1T0JA 2DRKA 2DE0X 2JXBA 4CC2A 2XMFA 4OMPA 5FW9A 1RI9A 4DEXA 2D1XA 2YSQA 1YWPA 1AWXA 4RTWA 1K9AA 1HD3A 1OV3A 1ZBJA 3CQTA 4HVWA 2DA9A 4K11A 2EGCA 4OMOA 1X6BA 3EHRA 3H0FA 1KSWA 1QWEA 4QT7A 1BBZA 2KGTA 4X1VA 5L23A 1Z9QA 2K7AA 3THKA 2EPDA 2GBQA 2FO0A 4HVVA 4CC3A 3VRZA 2CREA 1KFZA 4AFSC 4LUDA 2FRWA 1TG0A 2JM8A 2DVJA 2E5KA 1BB9A 3M0PA 1XOVA 4GLMA 4ESRA 2RF0A 3PE0A 1S1NA 4RTZA 4JJBA 5ECAA 1BU1A 4JZ3A 2LZ6B 2RQVA 4WCIA 2FPEA 1RLPC 2LX7A 4KRTA 4EIKA 2CUDA 2P4RA 2DL7A 4J9EA 1A0NB 1QKWA 2KR3A 2F2VA 3EG1A 1K1ZA 1VYVA 4HVUA 2KE9A 3EG3A 1WI7A 2L3QA 1SPKA 4AFQC 2HDAA 2PZ1A 2EVRA 2KYMA 4F14A 3M0RA 2L3PA 2W10A 1NM7A 1JQQA 2KYBA 1PRMC 1JXMA 2DYBA 1HJDA 3VS7A 1RUWA 2KXDA 2DJQA 2DF6A 3NPFA 4J9IA 2EQIA 2CH4A 1GCPA 2G6FX 3NGPA 3VS6A 1NLPC 3R6NA 1OOTA 1N5ZA 1NYFA 2K3BA 1PKTA 1ZSGA 2C0OA 2EYWA 1H8KA 2AKLA 1JEGA 5IHNA 2VVKA 2CSQA 3EGUA 2O88A 4Z88A 2MCNA 3RNJA 2IIMA 1CKAA 1MV0B 1FYNA 2JMAA 1PNJA 2EBPA 1QWFA 3I9QA 4ORZA 2AK5A 3EG2A 1CKBA 3TVTA 2J06A 4GBQA 2BTTA 1UE9A 2LJ3A 3ZL7C 3TSZA 2CH4W 2HBWA 5FWCA 4LE9A 1GCQC 2NWMA 2EGAA 1NG2A 1WLPB 3SEMA 1Y57A 2JTEA 2K2MA 4J9DA 2ED0A 2FPDA 2JS2A 2A36A 2KBTA 2JMCA 2L2PA 3A98A 2DL3A 4F17A 2KRMA 1AD5A 5I22A 2CT4A 1ARKA 1V1CA 1W70A 3REBB 1B3QA 1ZUKA 1UJ0A 4OMNA 1KIKA 2C0IA 2F2XA 2D8HA 2J6FA 1BK2A 4OMMA 1GL5A 2KRNA 1WXTA 3KFVA 2OJ2A 1UJYA 1X2QA 2HSPA 5GJWB 2X3WD 2X3XD 2LJ0A 1YN8A 1H92A 1QCFA 4IIOA 4JZ4A 2K9GA 2EYYA 5I11A 2BZYA 1SSHA 2ABLA 3PVQA 1K0XA 1UUEA 4Y92A 2NUZA 4RTXA 4J9HA 1OPKA 4FSSA 1PKSA 4JJCA 1ZUYA 1X43A 3VRYA 1E6HA 4J9CA 2ESWA 2GGRA 2DNUA 2YDLA 3GBQA 3LH5A 3FJ5A 1UFFA 3M0TA 1IO6A 3VS4A 1G83A 2GTJA 2FPFA 4CC7A 3H41A 3IQLA 5IXBA 1W6XA 2W0ZA 5IHIA 2PNIA 2KXCA 3NHNA 2RN8A 3UA6A 1AVZC 4AG2C 1AWOA 2H8HA 1GFCA 2AZSA 4E6RA 3PVLA 1I1JA 1AWWA 1SRLA 4J9GA 4A63B 2I0NA 1NYGA 1KJWA 3VS2A 1UTIA 2LJ1A 1WA7A 2C0TA 1UECA 2RQWA 3QWXX 2LP5A 1FMKA 2EYZA 1EFNA 1ZX6A 1ABOA 2F2WA 1UGVA 2OAWA 2YUOA 3I5RA 2K6DA 3UATA 3RBBB 1G2BA 2AKKA 2DL5A 2J7IA 2JS0A 1YNZA 1UHCA 1T0HA 2MOXA 2BZXA 3EG0A 1TUCA 2AZVA 3I5SA 2YUPA 1YWOA 3VS1A 2EYXA 1U5SA 1T3SA 3O5ZA 1YCSB 1ZUUA 3H0IA 2DLPA 2LQNA 2O9SA 1GFDA 5IXFA 1B07A 1I07A 2KT1A 2DL4A 2ED1A 2FG0A 2LCSA 1VYUA 2SRCA 1SEMA 3I35A 2LNHB 1SHGA 2GTOA 1VA7A 3C0CA 1M8MA 3EHQA 3NMZC 2J05A 1JXOA 1AWJA 2QDLA 1AZGB 4JPBW 1WFWA 1J3TA 1E6GA 3M0UA 1WYXA 2GQIA 1OEBA 1ZLMA 1RLQC 3ULRB 2RMOA 1X6GA 2RQRA 1HSQA 2PTKA 2FEIA 4M4ZA 4OMLA 2DBMA 2DMOA 2EGEA 4RTTA 4J9FA 2GNCA 2VKNA 2DRMA 2L3SA 1UG1A 1WXBA 4JJDA 2K79A 1K0SA 2LQWA 4F16A 1PRLC 2D8JA 2ROLA 1X69A 2RQTA 2D0NA 2M0YA 1QLYA 4LUEA 3UA7A 4CC4B 1NLOC 2MIOA 2J6KA 1M3CA 2RPNA
chains in the Genus database with same CATH superfamily
3A8HB 4M77B 4M77C 3M53A 2SEMA 2DTIA 4HCCA 2OTLA 1YJWQ 3BW1A 1AEYA 4OB0B 1U1TA 2NUTB 1OPLA 1WIEA 1X27A 1QP2A 3M57A 2DD5A 1VQ4Q 1S72Q 1R8OB 5C6SA 1KG1A 1ZBXA 1Z9ZA 2YLBA 2DM1A 2EW3A 4RG8A 4IIMA 5HCKA 3UDCA 4QVDA 3GNGA 1PSFA 1JO8A 2DXBA 3RKXA 1NBEB 2QA4Q 3CC7T 5GAOp 2V1RA 1XNIA 3BDLA 2WSCE 1D3BB 2LDMA 1LOJA 1VQNT 1VUBA 1E7OA 4LDXA 4BE0A 2RM4A 2HEQA 4FYVB 1SHFA 4N4GA 4BACA 1KHIA 2A08A 3J81E 1AT1B 1WXUA 1VQ7Q 2BZ8A 4IUQA 3OW2S 3VJPA 3CMAT 3SB2A 5A0DA 3CPWP 2CP6A 2FRYA 2CDTA 5CCAA 2QEXT 4CI0C 4KH1B 3CBOA 2HL5C 2RNAA 1OQKA 2DBKA 4RTUA 1I8FA 4PJOD 4FIBA 2VASA 2L0AA 1GCQA 2JM9A 2ROTA 1QKXA 4PNOA 1NEGA 2HBPA 2IG0A 4FM4B 4M78G 1UB4A 2DX1A 4LDVA 3CC4A 2WSFE 3OYDA 3QUIA 2KRSA 2DEUA 4PJOE 3J80E 3G6ET 1QVFP 1M3BA 5KYUA 1D1BA 5GANj 3RDVA 3CC2Q 2M1HA 4KGXB 3M58A 1VQMT 3CCLA 2QTXA 5CIUA 1TOVA 2MF2A 2DYIA 3I55T 4E7LA 3M9QA 4FYWB 5GAOm 1HD3A 1OV3A 2OX7A 2DA9A 2EGCA 1VQPT 3EHRA 4DBRA 4X1VA 4PJJA 1Z9QA 2K7AA 3THKA 4C0FA 2EPDA 2GBQA 2K3XA 3EH2A 3CCJQ 4EDUA 3CCEA 2DZ9A 2XD0A 2FRWA 2DERA 2DEQA 2EJ9A 2JM8A 1VQ8T 1YI2A 4M78F 1BB9A 4OGCA 3M0PA 4M7AF 4C92D 5KCOA 3ER0A 2V26A 1VQ6Q 2DTHA 4OB3B 3P8HA 5FRMA 3JCMf 2LZ6B 3HRSA 2E1HA 2RK2A 2CZ1B 1Y7XA 4C92E 3JCMX 1YJNQ 2CUDA 3QKJA 4C0GA 2A7YA 2XICA 4J9EA 1Q86U 1QKWA 4JLGA 2LVMA 2NUTA 3EFRA 2JTMA 2P0PA 1KK7A 2KE9A 3L2ZA 4JS5A 4ZGEB 3OYAA 1Q82C 2L3QA 3HFOA 4ME7A 4AFQC 2PZ1A 2RHYA 4XU1A 4F14A 2A0FB 2E3HA 3L2WA 2L3PA 2QTVA 3QG1A 4A4HA 1NM7A 5KYXB 5GAOl 1JQQA 2JN0A 3DLLA 1NJIC 1ZSZC 2VXEA 3VS6A 3OYEA 1FXXA 1N5ZA 1PKTA 1VQOA 1H3ZA 2EYWA 1G3YA 3L2VA 2HKNA 1JEGA 4C0DC 4OF1A 2VVKA 3EGUA 3GOXA 3RNJA 1I4K1 4J83A 5GAN2 3SFMA 1FYNA 2JMAA 1Y96B 1D0ZA 3E1SA 5KYWA 4ORZA 3TVTA 2DXUA 1FWZA 1R77A 3ZL7C 1OZ3A 1VQLQ 3V8LA 8AT1B 3CCMA 3CCST 4OB2B 2EGAA 3SEMA 2K2MA 4M7DF 3M54A 1YHQT 2O4XB 4NL2A 2KBTA 2R5AA 1TSFA 4F17A 5CO7A 5DY9A 2CT4A 1V1CA 2IPOB 3REBB 2LTOA 2KAFA 3OSVA 3CXCS 1VQ9T 4PJOG 3PMTA 3FB9A 4FU6A 4L6V5 3VV0A 5GAOn 3CCQA 2E5QA 4O6JA 1K8AC 1H92A 5GANd 1Q86R 2K9GA 5CKFA 1SSHA 2ABLA 3I56A 3PVQA 2E64A 1UUEA 1BCOA 2C06A 3VU3C 4IKFA 3VRYA 3DLMA 4J9CA 2ESWA 2DNUA 2G3RA 1W2BS 2EYQA 1UGQB 1OU9A 3M0TA 3TCJA 4KUDK 3JCMb 1BI3A 2CGHA 1G83A 2FPFA 4CC7A 3JB9I 3JCMc 2X4XA 5IXBA 1U1SA 1XJWB 4LD6A 3BY7A 1MNDA 3CMET 3RERA 3NHNA 4C0ZA 5HK0A 3OS0A 3PIOA 4XK8E 1AVZC 3CCVA 3QDFA 4AG2C 3CCUT 4A54A 1AWOA 2H8HA 1GFCA 3PVLA 1AWWA 4C8QB 4C92G 4A63B 4C8QC 4N0AC 4M7DA 1KJWA 5DLQE 2E41A 1RAGB 3SWNC 4C92C 2C0TA 3QWXX 5KYXA 3CMAQ 2R5MA 5CAIA 2QEXQ 3PNWC 2DK3A 3I5RA 2JNGA 4J6WA 3CCLQ 2YRCA 2AKKA 5GAMg 1YJWA 2DL5A 2J7IA 1YNZA 2PVDB 2COYA 2MOXA 5CQXA 2BZXA 2AT1B 3C95A 4C5EA 4ZGJB 1WQ7A 1Q7YU 4EMKC 1VQ4A 2DFUA 2HSEB 3F70A 1S72A 1QVFS 3V7CA 3VS1A 2EYXA 4XTZA 4MDWA 1OX8A 1OZ2A 3O5ZA 2K2VA 1Y96A 2RK1A 2ZPGB 4BI8B 1Y07A 1HYOA 2DLPA 2X4YA 3CCEQ 3CXCA 4PLIA 5DLOA 5IXFA 2V8KA 1I07A 2KT1A 1YI2Q 4FYXB 4IURA 2ED1A 2QQSA 2FG0A 5LJ5j 3J7AF 2XDDA 3P8DA 1SEMA 4PFPA 3FC3A 4FYYB 5GAMh 1SHGA 2QA4A 1IHVA 1VA7A 1M8MA 1AZGB 4JPBW 1J3TA 1E6GA 2EIFA 5LJ5f 2K5LA 3SD4A 3NTHA 3CCRT 3BDUA 5GMKj 1M1FA 1M90U 3PT9A 1X6GA 1W2BA 2GFUA 2ZAEA 3QDRB 1HSQA 5HKCA 4RKUE 4FW1A 2FEIA 2DBMA 2EGEA 4P5NA 4RTTA 3JB9H 2GNCA 2H3JA 3CD6Q 1MMNA 2DXCA 1QW1A 1WXBA 4JJDA 2VGMA 3G7ZA 1PRLC 3HTRA 2CP3A 1MMDA 2MI6A 3UA7A 1Y71A 1TU0B 2J6KA 2RPNA 3R6OA 1GRIA 3OQ5A 2HD0A 4M75F 4Z89A 4HXJA 1P92A 4LNPA 4OMQA 1I5OB 2B86A 3JCMV 3M0SA 2MMPA 3M55A 1WZOA 1TUDA 2DVEA 2P0QA 3QWYA 4AG1C 5LJ3e 4Q5WA 4AT1B 1SRMA 3A8MB 1N9RA 1QVFA 2A37A 2KT8A 1RL2A 1G5VA 3MJXA 3FJPA 2P0KA 4B6MA 3M59A 2CT3A 3CPFA 1Q7YR 2DL8A 4C8QA 3LWHA 3C94A 4HCKA 1O9SA 1VQ6A 3JV3A 4M78D 1IZ6A 2O31A 4M7AD 4R0KA 5IT9E 3A8GB 1PHTA 3UF4A 3QO3A 2D9TA 4E7HA 4IUVA 2ENMA 2LNVA 2E65A 1C0MA 4J9BA 3DB4A 3LYIA 2DPPB 1SF9A 2KROA 1V76A 4MZMA 4LN2A 1YJNA 5A0LA 4M7AE 2KSSA 2RI3A 3CCSQ 4DEYA 3WVEB 4A4GA 2PVOB 1U06A 3MKDA 2L8DA 1YP5A 2EKHA 2NUPA 3V7RA 1ZA1B 2P84A 3CCQQ 4AFZC 4RTVA 1U3OA 1M1GA 1T3LA 2O2OA 1QMCA 1N27A 5CKEA 2CP0A 4AFUC 1M90R 1M8VA 4J7IA 3AHUA 2E12A 4RMOA 1NEBA 1U8RA 2QQRA 3CEYA 4M75A 1VQ9Q 4E7KA 3Q1JA 2QGGA 1X75C 5GJVB 4J6YA 3VS3A 3VS0A 3L1AA 3PGGA 1OYXA 1TXQA 2HZYA 2XMFA 5FW9A 1RI9A 4DEXA 3OYJA 2YSQA 4JRKA 4RTWA 1Q86C 1VQ5Q 1K9AA 4HVWA 1VQKT 3EAEA 4K11A 3CCVQ 4OMOA 1X6BA 3JRZA 1KSWA 4QT7A 2DJZA 2EJFA 2X35A 5L23A 1NPRA 1RAEB 4HVVA 3QZ9B 1H641 4IUPA 1KFZA 4WF2A 2DVJA 3E9FA 3O8VA 3PE0A 3FEOA 3CXCP 1K8AR 2OTLT 4BI4A 4ZGDB 1BU1A 3VYHB 3OYYA 4QW2A 4JZ3A 1SSFA 3VYGA 4M7DD 2RQVA 4WCIA 2HAXA 2FPEA 1RLPC 4KRTA 2RH2A 4EIKA 3HL8A 1PCXA 5KE2A 3OBWA 4B9WA 3LGFA 4M7DE 1RAHB 2L5QA 2FZCB 3FIFA 2M0OA 3X26B 5CK9A 3EG3A 2GCXA 1G3SA 2JVVA 1N9SA 2HDAA 3OYMA 1W2BP 2EVRA 2X4JA 2P4TA 2HNIA 1WPYA 2PUOB 2RJCA 2M9UA 4MMKA 6AT1B 1JXMA 4E7ZA 1RUWA 2XIDA 4PK4A 3NPFA 2EQIA 2CH4A 1M9SA 1GCPA 2LX9A 1KQSS 3NGPA 5M9OA 5KE3A 3ZFJA 1WQWA 4M77F 5AT1B 1ZSGA 3UWNA 1H8KA 3LLRA 5IHNA 1IHWA 2CSQA 2VUBA 2O88A 1OX9A 4ATOA 2MCNA 2AIRB 2HQHA 4WTOB 2RB6A 2ZPFB 1JJ2A 1VQNA 4IUTA 2RHXA 1PNJA 2EBPA 1QWFA 2QASA 2XK0A 2AK5A 1F1BB 2F5KA 3CCRQ 2WSEE 3LX7A 2GQVA 3OBYA 3CC4T 4M7AG 2D0QB 3S6WA 5C0MA 2LJ3A 1K9MU 4AMCA 4GY5A 5I2MA 3CMAA 3P8BB 4M78C 2BUDA 4M7AC 2QEXA 2NWMA 1WLPB 3L2RA 5D6YA 2QI2A 4HA8A 2FPDA 2JS2A 2L2PA 3A98A 1PM3A 1PG5B 2DL3A 5GANf 1ZUKA 4A4KA 1K73U 4L5GA 2PVGB 1RADB 2J6FA 1WXTA 3I55A 4JRPA 3EGDB 2LJ0A 1YN8A 4JZ4A 1JRIA 1VQPA 5I11A 3OYBA 2M02A 4M77A 4RTXA 1OPKA 4FSSA 4QVZA 4JJCA 3H6ZA 2YDLA 1QVGP 1RI0A 1VQ8A 3VS4A 1YJ9T 3JCMJ 3AT1B 2GTJA 2CZ6B 2QXFA 4DA4A 1Q7YC 4RCBA 1KQSA 3OYFA 1MNEA 4BE2A 2QQBA 2ATCB 1KD1U 1GXIE 4LDYA 2RN8A 1KHCA 2OAUA 1RAFB 2COZA 2EQJA 4E2FB 3KXTA 4YTLA 3CD6A 3JCMh 1SRLA 1PD0A 2I2LA 1I81A 1ZSZB 4OB1B 4XTVA 5I2SA 1TS9A 4M7DG 4LXCA 2OTJT 1EFNA 3L2UA 2F2WA 1D3BA 1VQOT 5FU7B 2ZZDA 3T9NA 5FU7C 4C0DB 1WGSA 2JS0A 1K9MR 4R55A 3OS5A 2LQKA 4FT2A 4M75D 2XU8A 2QK0A 2DO3A 5J26A 3UT1A 1KC8U 2AZVA 1M90C 2VGNA 3A8LB 1X6OA 2RHZA 3E19A 4M75E 1T3SA 1LPLA 3G71T 1YCSB 1R0CB 3X20B 3A5ZB 4DQ2A 2B8AA 4D6WA 1B07A 3X25B 2DL4A 4HT9A 1K73R 3JAME 4ZN1A 2IVWA 2LT1A 5LJ3g 4HT8A 2QAZA 5J39A 3EHQA 2J05A 3URGA 3G4ST 4J5YA 3M0UA 5KCHA 1WYXA 1RABB 5FU6C 1OEBA 1ZLMA 1RLQC 2KQWA 3CCSA 3MPUB 4MDXA 2MPXC 2KI7A 3MCAB 1G8XA 2PTKA 1YHQA 1G3TA 1BI0A 3HHTB 4PJOB 4OMLA 4B9XA 4PJOC 4XTWA 4J9FA 4QQDA 4JS4A 3I56T 2K79A 1PSEA 2V8JA 3MEAA 5LJ3h 3EGDA 3VKIA 1KD1R 1JJ2P 3FRNA 1VQ9A 1WJRA 1QLYA 4CC4B 1IGUA 2LCCA 1IREB 4ELYC 4F04B 3OYCA 2ECZA 3TSWA 3CC7Q 2YT6A 1VQ5A 3VS5A 2MWOA 2VB6A 1M3AA 4EMHA 1YIJT 1AOJA 1UHFA 2HL3A 2M51A 1VQNQ 3EGXB 4N4IA 4KULA 5GANe 4ZN3A 3SWNB 4C92B 4OVAA 1FMVA 1BI2A 4Z8AA 1KC8R 4C5HA 1EX4A 1ZSZA 1VYTA 3REAB 5FRNA 3MP6A 3ZEHA 2E10A 2QGFB 3RUXA 4DOVA 2RHUA 3CCUA 3ME9A 4V2SA 1M1KU 4MZTA 7AT1B 3OYLA 2O9VA 5GMKm 4FCYA 2HCKA 2ZGWA 4NS5A 5IH2A 1MV3A 3M56A 1M30A 4EMKB 3M0QA 5LL6S 2JW4A 2PUKB 1VQ4T 3JCMe 1YITT 1S72T 1XTDA 1D0YA 5GAMj 1UGPB 4D8DA 1ABQA 3G6EQ 3CBMA 1M2VB 2FYKA 1BCMA 4F7UB 3OYHA 1VQMQ 1TWBA 3I55Q 5L8RE 3QSUA 2RHIA 1KQSP 1W1FA 1GBRA 2OI3A 2E3IA 1LVKA 2DILA 1VQPQ 1MUZA 3X28B 2QA4T 2CUBA 2QQ9A 5HY6A 1WDXA 4C8QF 3GNFB 9ATCB 1JU5C 3RIRA 2DKGA 2O4XA 1OI1A 4M75G 2VC8A 3EG9B 2HKQB 1VQ8Q 3A8OB 5D6XA 4ZTFA 1VQ7T 2JXBA 5KYYB 2WACA 4CC2A 4M77D 3NTIA 3MEUA 1JB0E 2A3LA 5GAN4 1ZBJA 1QVGS 1MMGA 3CBPA 5GMKl 4QKUA 1N6AA 3H0FA 3RMQA 3RR6A 1BBZA 4CRIA 3CCRA 2CP5A 4M77E 2FO0A 1YJ9Q 3VRZA 2CREA 4X34A 5A2QE 4AFSC 2E4HA 4BUGA 4LUDA 4MZPA 2CP2A 4J8OA 1TG0A 1WHMA 2XKOC 5LJ3d 2E5KA 4PKCC 1O75A 1XOVA 4BB7A 4ESRA 2JZ2A 3CC2T 1S1NA 4RTZA 4JJBA 5ECAA 2E6ZA 3V8JA 2DIGA 3LWIA 2LX7A 3S3NA 3EH1A 1WJSA 2FZKB 2DL7A 3QZ5B 1M1KR 1IB8A 2FHDA 3CCJT 3D7SB 2F2VA 3EG1A 2KDSA 3L42A 1K1ZA 1VYVA 4DBHA 3EGXA 4UC4A 4N0AA 1SPKA 1YBYA 3M0RA 3E9GA 3SWNA 4C92A 3PTAA 4HCZA 1K9MC 2W10A 4KT0E 2HQEA 2KYBA 2EQKA 4ANJA 2DYBA 5GAN3 4QQ6A 5CQYA 2O01E 3GP8A 2X51A 2DF6A 1N8RU 2G6FX 4PJNA 4XU3A 1NLPC 1NZ9A 1OOTA 2K3BA 3E2UA 4EMKA 3H9NA 2C0OA 4C5IA 2AKLA 3RESA 1YHQQ 3DB3A 3GF5A 1WHLA 4Z88A 1B7TA 1D1CA 3OMCA 1M2VA 1RAIB 1MV0B 1K73C 4F7UA 3G1JA 4BE1A 5GAOq 2JTFA 2Z0WA 1CKBA 4HCBA 5CKDA 1QVGA 1MGQA 4XTYA 4LD9K 2BTTA 1G3WA 3TSZA 4EMGA 5GAMd 4Z02A 3JB9G 2MAMA 5FWCA 1GCQC 2HQXA 4JLIA 4MMLA 2LT4A 2JTEA 1D0XA 2ED0A 3EG9A 1JJ2S 2JMCA 2KRMA 2KMTA 2R57A 5FROA 1SKUB 1B34B 5I22A 1RACB 1W70A 1B3QA 1KD1C 2K57A 3PIPA 1UJ0A 4OMNA 2DETA 4NL3A 3V7SA 1VQLT 1HXDA 2KRNA 3KFVA 3GPLA 3CMEQ 3MO8A 4TVRA 3HFNA 5GJWB 2X3WD 2X3XD 2FZGB 1FX7A 1QCFA 4IIOA 3EFOB 1I5LA 2EYYA 1BI1A 4JJNK 1QQJA 3CCUQ 3JB9F 4IUUA 4Y92A 2NUZA 1PKSA 2Y90A 2RJFA 3KBGA 4M77G 1E6HA 3GBQA 3LH5A 3FJ5A 3JCMW 1UFFA 1Q81U 1MMAA 1BIAA 1IO6A 3C4SA 4E7JA 5LJ5e 3IQLA 1KC8C 1PD1A 1IRXA 2W0ZA 3ASKA 3OMGA 4PLLA 2NLUA 1N8RR 2BE9B 3UA6A 3MEVA 3MHXA 2CZ7B 2AZSA 1YITQ 4E6RA 5GAOr 4J9GA 5GMKe 2I0NA 1YCYA 3A1PA 3VS2A 1UTIA 4KBMB 2LJ1A 1WA7A 2M16A 2LP5A 1MHNA 1ABOA 2DIQA 3QBYA 4BD3A 1ZA2B 2CZ0B 1UGVA 2OAWA 4LDUA 3RBBB 3M4YA 1EZZB 2YWWA 1UHCA 3MP8A 1T0HA 3CC7A 2FVUA 4E7IA 4EPCA 5D7UA 3I5SA 1UEBA 2Y4XA 1V29B 2F1LA 2E70A 4LDWA 3QYHB 3OB9A 3H0IA 4DBQA 5KYWB 1WNLA 4M78B 1GFDA 4PFOA 4M7AB 5DM7R 2YLCA 2LCSA 2JOYA 5IN1A 3CCLT 2NYSA 3HRUA 3C0CA 3M4GA 5GANg 1JBMA 2VXFA 3RKWA 2XDPA 1M5Q1 4R56A 2AHJB 2DTOA 3OYGA 2YXYA 2XG8D 4XTUA 3G6EA 1WHJA 2KY9A 2RMOA 1B34A 4NOYA 3QXEB 3CCET 1VQMA 2VV5A 4M4ZA 1YI2T 2DMOA 1Q81R 2L89A 2L3SA 3MEWA 1UG1A 3JCMg 2QDYB 3EFSA 1K0SA 1LJOA 2QQAA 4JUVA 5GANh 2D8JA 3EFOA 1X69A 2RQTA 2M0YA 4LUEA 4C8QD 1NLOC 1M1KC 1M3CA 5GAN6 1XQHA 2VWFA 3LW5E 4A4FA 1H3HA 1QP3A 2EWNA 2LCLA 2HMAA 3OSSC 2A28A 1PWTA 3UPUA 5EC7A 3NFCA 1M2OA 2JT4A 1BIBA 2RQUA 4C8QE 1WHHA 2D6FA 2XI9A 3VUZA 3CD6T 2BKDN 3OYKA 3H0HA 1UGSB 1GBQA 2GFAA 4XU0A 3QHSA 1CSKA 3QYGB 3TEEA 2CS7A 5AYFA 3SHWA 1M27C 4OGEA 1YJ9A 1WX6A 5KYNA 2COWA 2J6OA 3WVDB 1VIFA 2K3YA 4DBFA 1NE8A 2LMJA 3TQ7P 3U23A 2CSIA 1SG5A 1UGRB 2K4YA 2KNBB 4L59A 4M7DB 4ZNXA 3OW2A 1AZEA 4M7DC 3LH0A 4XAXB 4BY6B 1X01A 2YUNA 4KGZB 4BY6C 3META 4RUGA 4D8KA 4F7UE 2RO0A 3H8ZA 2YUQA 1LNXA 2RI5A 2YHTA 4ELZC 1WJQA 2KEAA 2X9HA 2OTJA 4VUBA 3BE3A 1OU8A 3PMIA 4Y28E 2V1QA 2GF7A 3RMSA 2JJ9A 1UDLA 1PC0A 3CCMT 3KUFA 5A0GA 3M5AA 1X2KA 1Y0MA 1VQKQ 3N5BB 1K4US 1K76A 2PU9B 4M78A 4M7AA 4RTYA 1I0CA 5HK3A 4E7SA 1VIEA 3PFSA 1LCKA 2YRDA 4E47A 5KH6A 3G71A 4II1A 4X9CA 5FU6B 5FWBA 1AHJB 5LJ3j 5IHKA 3C12A 1T0JA 2DRKA 2DE0X 2OTLQ 4OMPA 2XHCA 2F69A 2D1XA 3CCQT 2EFIA 1YWPA 1AWXA 5LJ3f 3CQTA 3G4SA 5GAN5 1QWEA 1R0BG 3BFMA 2KGTA 5GMKi 4HKEA 2K5IA 4XTXA 4CC3A 4KH0B 2LRQA 2RA2A 2LC4A 2ZPBB 3MP1A 2VYTA 4JRQA 4GLMA 2RF0A 3TU4K 1ZQ1A 1N8RC 2F5TX 1QVPA 1VQ5T 1WHGA 1C6VX 1OULA 3CCVT 2ZCFB 5CKHA 3LGLA 2P4RA 5IAYA 3HKSA 1A0NB 2EKOA 2KR3A 4O5VA 1M4ZA 3V8KA 4HVUA 3JCMd 1WI7A 4N4HA 3L2QA 3CMEA 3JSCA 2RJDA 4PJOF 4JRIA 2KYMA 3FDRA 2PQWA 4C8QG 1YIJA 2ZPHB 4A53A 4PJMA 2RJEA 1YJWT 1PRMC 3JB9D 1HJDA 2DXTA 3VS7A 2KXDA 3CPWS 3CC4Q 2DJQA 4J9IA 3R6NA 2L3RA 1NYFA 3INZA 3NTKA 1KQ2A 1Q95G 2RI2A 2FB7A 2CYZB 3HP9A 1TTHB 5GAMf 2IIMA 1CKAA 1YITA 1Q82U 3I9QA 3EG2A 2NUPB 1QCNA 4F7UG 2J06A 5LJ5g 4GBQA 1UE9A 2ZPIB 2KK4A 1FMWA 4J6XA 4GLKA 2CH4W 4C92F 5EG2A 2HBWA 3OY9A 4LE9A 1NJIU 1IGQA 1NG2A 5GAN8 4M75B 1Y57A 4M75C 4J9DA 2Y4YA 4C5GA 2A36A 1Q81C 3OW2P 2DAQA 2EQMA 4PJLA 1AD5A 4XU2A 1ARKA 1C1AA 4KGVB 4PJOA 3DKMA 2YRVA 3GLXA 1BYMA 1KIKA 2C0IA 1ACMB 5LJ5h 1QCOA 2F2XA 1VQ7A 2D8HA 1BK2A 4OMMA 1GL5A 1VOMA 3SDZA 4F7UF 2OJ2A 1UJYA 2H3EB 1X2QA 2HSPA 4FSXA 2BIVA 4PFZA 4J7FA 4JDSA 3QJ6A 4QQGA 1DJ7B 2BZYA 4PL6A 5D6WA 3OS2A 1YFNA 1K0XA 1W4SA 1ZHIA 3X24B 4J9HA 5FLXE 5CR2A 2RD1A 5GMKh 1TH7A 1ZUYA 1X43A 2GGRA 3QIIA 3GIBA 2EAYA 3CPWA 2OTJQ 3QPHA 3H41A 2MK5A 3CC2A 1W6XA 1VQOQ 5IHIA 2PNIA 1RAAB 2KXCA 3VUBA 2JUFA 2CP7A 2K5FA 1NPPA 1VQ6T 1D1AA 2XDBA 3OYIA 2LQ8A 1I1JA 8ATCB 4DOWA 1K8AU 4RCCA 3CCJA 1NYGA 2CKKA 3JCMP 3G71Q 2RQWA 1UECA 1YJNT 3CCMQ 4RG2A 1FMKA 1Q82R 2EYZA 1ZX6A 4BDYA 3FLGA 3UATA 2YUOA 2FL7A 2K6DA 2V8IA 4FL6A 3HSBA 1G2BA 3OYNA 4FW2A 2DZCA 3EG0A 1NJIR 1TUCA 2MYSA 5J3BA 3G4SQ 4BDZA 1IXDA 4M78E 2YUPA 4OP0A 1YWOA 3JCMQ 3TREA 3S3MA 1U5SA 2KVQG 2EQUA 4QVCA 1ZUUA 3S3OA 2LQNA 2O9SA 1BKBA 1HK9A 4A4EA 1VYUA 2ZPEB 3HPWA 2SRCA 1D09B 3I35A 2QYZA 2MWPA 4XQ3A 2LNHB 4KUIA 3HRTA 3I56Q 2GTOA 3NMZC 1TUGB 4BI3A 5KYUB 1JXOA 1AWJA 2QDLA 5I21A 4X9DA 5KYYA 1KQ1A 1WFWA 1EIFA 2QG9B 2GQIA 2EJGA 1WHKA 3ULRB 2X4WA 3OS1A 2RQRA 3JB9J 4FT4A 2BE7D 3OA6A 5LJ5d 2DD4A 2VKNA 1VQKA 5CKBA 2DRMA 1YIJQ 2R58A 4ZTJA 5GAMe 5GAN7 3QJYA 3RKYA 4OMFB 2LQWA 3ZBDA 4F16A 2E6NA 2ROLA 4Y91A 2D0NA 1VQLA 5CVIA 3WXMB 2MIOA
chains in the Genus database with same CATH topology
1GRIA 2VWFA 1H3HA 2SEMA 2A28A 1PWTA 2ECZA 5EC7A 4Z89A 2JT4A 4HXJA 4LNPA 2RQUA 4OMQA 3TSWA 1AEYA 2B86A 2YT6A 3VS5A 1M3AA 3M0SA 1OPLA 1WIEA 1X27A 1AOJA 1UHFA 3H0HA 2M51A 1GBQA 1TUDA 1CSKA 3QWYA 4AG1C 3SHWA 1M27C 1WX6A 1SRMA 2A37A 2J6OA 2KT8A 4Z8AA 1Z9ZA 2LMJA 2CT3A 2DL8A 2CSIA 3U23A 2DM1A 2EW3A 4HCKA 1VYTA 3REAB 2KNBB 4IIMA 4ZNXA 5HCKA 1AZEA 3JV3A 1JO8A 2O31A 4R0KA 1PHTA 3UF4A 2YUNA 2O9VA 2HCKA 2ENMA 2V1RA 5IH2A 1MV3A 4J9BA 4RUGA 1M30A 4D8KA 3M0QA 2JW4A 2KROA 1E7OA 4LN2A 2YUQA 2HEQA 2KEAA 1SHFA 4D8DA 1ABQA 4DEYA 2V1QA 2A08A 1U06A 1WXUA 1UDLA 2BZ8A 1YP5A 2EKHA 2FRYA 2CDTA 4AFZC 4RTVA 1X2KA 1U3OA 1W1FA 1T3LA 1Y0MA 2O2OA 2RNAA 2OI3A 1GBRA 2DBKA 2DILA 4RTUA 1K4US 4AFUC 1K76A 1MUZA 2CUBA 1GCQA 2JM9A 2L0AA 2ROTA 1QKXA 4RTYA 1NEGA 1I0CA 1NEBA 1WDXA 2DX1A 1LCKA 1JU5C 2KRSA 5FWBA 5GJVB 3VS3A 3VS0A 5IHKA 1M3BA 1T0JA 2DRKA 2DE0X 2JXBA 4CC2A 2XMFA 4OMPA 5FW9A 1RI9A 4DEXA 2D1XA 2YSQA 1YWPA 1AWXA 4RTWA 1K9AA 1HD3A 1OV3A 1ZBJA 3CQTA 4HVWA 2DA9A 4K11A 2EGCA 4OMOA 1X6BA 3EHRA 3H0FA 1KSWA 1QWEA 4QT7A 1BBZA 2KGTA 4X1VA 5L23A 1Z9QA 2K7AA 3THKA 2EPDA 2GBQA 2FO0A 4HVVA 4CC3A 3VRZA 2CREA 1KFZA 4AFSC 4LUDA 2FRWA 1TG0A 2JM8A 2DVJA 2E5KA 1BB9A 3M0PA 1XOVA 4GLMA 4ESRA 2RF0A 3PE0A 1S1NA 4RTZA 4JJBA 5ECAA 1BU1A 4JZ3A 2LZ6B 2RQVA 4WCIA 2FPEA 1RLPC 2LX7A 4KRTA 4EIKA 2CUDA 2P4RA 2DL7A 4J9EA 1A0NB 1QKWA 2KR3A 2F2VA 3EG1A 1K1ZA 1VYVA 4HVUA 2KE9A 3EG3A 1WI7A 2L3QA 1SPKA 4AFQC 2HDAA 2PZ1A 2EVRA 2KYMA 4F14A 3M0RA 2L3PA 2W10A 1NM7A 1JQQA 2KYBA 1PRMC 1JXMA 2DYBA 1HJDA 3VS7A 1RUWA 2KXDA 2DJQA 2DF6A 3NPFA 4J9IA 2EQIA 2CH4A 1GCPA 2G6FX 3NGPA 3VS6A 1NLPC 3R6NA 1OOTA 1N5ZA 1NYFA 2K3BA 1PKTA 1ZSGA 2C0OA 2EYWA 1H8KA 2AKLA 1JEGA 5IHNA 2VVKA 2CSQA 3EGUA 2O88A 4Z88A 2MCNA 3RNJA 2IIMA 1CKAA 1MV0B 1FYNA 2JMAA 1PNJA 2EBPA 1QWFA 3I9QA 4ORZA 2AK5A 3EG2A 1CKBA 3TVTA 2J06A 4GBQA 2BTTA 1UE9A 2LJ3A 3ZL7C 3TSZA 2CH4W 2HBWA 5FWCA 4LE9A 1GCQC 2NWMA 2EGAA 1NG2A 1WLPB 3SEMA 1Y57A 2JTEA 2K2MA 4J9DA 2ED0A 2FPDA 2JS2A 2A36A 2KBTA 2JMCA 2L2PA 3A98A 2DL3A 4F17A 2KRMA 1AD5A 5I22A 2CT4A 1ARKA 1V1CA 1W70A 3REBB 1B3QA 1ZUKA 1UJ0A 4OMNA 1KIKA 2C0IA 2F2XA 2D8HA 2J6FA 1BK2A 4OMMA 1GL5A 2KRNA 1WXTA 3KFVA 2OJ2A 1UJYA 1X2QA 2HSPA 5GJWB 2X3WD 2X3XD 2LJ0A 1YN8A 1H92A 1QCFA 4IIOA 4JZ4A 2K9GA 2EYYA 5I11A 2BZYA 1SSHA 2ABLA 3PVQA 1K0XA 1UUEA 4Y92A 2NUZA 4RTXA 4J9HA 1OPKA 4FSSA 1PKSA 4JJCA 1ZUYA 1X43A 3VRYA 1E6HA 4J9CA 2ESWA 2GGRA 2DNUA 2YDLA 3GBQA 3LH5A 3FJ5A 1UFFA 3M0TA 1IO6A 3VS4A 1G83A 2GTJA 2FPFA 4CC7A 3H41A 3IQLA 5IXBA 1W6XA 2W0ZA 5IHIA 2PNIA 2KXCA 3NHNA 2RN8A 3UA6A 1AVZC 4AG2C 1AWOA 2H8HA 1GFCA 2AZSA 4E6RA 3PVLA 1I1JA 1AWWA 1SRLA 4J9GA 4A63B 2I0NA 1NYGA 1KJWA 3VS2A 1UTIA 2LJ1A 1WA7A 2C0TA 1UECA 2RQWA 3QWXX 2LP5A 1FMKA 2EYZA 1EFNA 1ZX6A 1ABOA 2F2WA 1UGVA 2OAWA 2YUOA 3I5RA 2K6DA 3UATA 3RBBB 1G2BA 2AKKA 2DL5A 2J7IA 2JS0A 1YNZA 1UHCA 1T0HA 2MOXA 2BZXA 3EG0A 1TUCA 2AZVA 3I5SA 2YUPA 1YWOA 3VS1A 2EYXA 1U5SA 1T3SA 3O5ZA 1YCSB 1ZUUA 3H0IA 2DLPA 2LQNA 2O9SA 1GFDA 5IXFA 1B07A 1I07A 2KT1A 2DL4A 2ED1A 2FG0A 2LCSA 1VYUA 2SRCA 1SEMA 3I35A 2LNHB 1SHGA 2GTOA 1VA7A 3C0CA 1M8MA 3EHQA 3NMZC 2J05A 1JXOA 1AWJA 2QDLA 1AZGB 4JPBW 1WFWA 1J3TA 1E6GA 3M0UA 1WYXA 2GQIA 1OEBA 1ZLMA 1RLQC 3ULRB 2RMOA 1X6GA 2RQRA 1HSQA 2PTKA 2FEIA 4M4ZA 4OMLA 2DBMA 2DMOA 2EGEA 4RTTA 4J9FA 2GNCA 2VKNA 2DRMA 2L3SA 1UG1A 1WXBA 4JJDA 2K79A 1K0SA 2LQWA 4F16A 1PRLC 2D8JA 2ROLA 1X69A 2RQTA 2D0NA 2M0YA 1QLYA 4LUEA 3UA7A 4CC4B 1NLOC 2MIOA 2J6KA 1M3CA 2RPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GRI A;  2VWF A;  1H3H A;  2SEM A;  2A28 A;  1PWT A;  2ECZ A;  5EC7 A;  4Z89 A;  2JT4 A;  4HXJ A;  4LNP A;  2RQU A;  4OMQ A;  3TSW A;  1AEY A;  2B86 A;  2YT6 A;  3VS5 A;  1M3A A;  3M0S A;  1OPL A;  1WIE A;  1X27 A;  1AOJ A;  1UHF A;  3H0H A;  2M51 A;  1GBQ A;  1TUD A;  1CSK A;  3QWY A;  4AG1 C;  3SHW A;  1M27 C;  1WX6 A;  1SRM A;  2A37 A;  2J6O A;  2KT8 A;  4Z8A A;  1Z9Z A;  2LMJ A;  2CT3 A;  2DL8 A;  2CSI A;  3U23 A;  2DM1 A;  2EW3 A;  4HCK A;  1VYT A;  3REA B;  2KNB B;  4IIM A;  4ZNX A;  5HCK A;  1AZE A;  3JV3 A;  1JO8 A;  2O31 A;  4R0K A;  1PHT A;  3UF4 A;  2YUN A;  2O9V A;  2HCK A;  2ENM A;  2V1R A;  5IH2 A;  1MV3 A;  4J9B A;  4RUG A;  1M30 A;  4D8K A;  3M0Q A;  2JW4 A;  2KRO A;  1E7O A;  4LN2 A;  2YUQ A;  2HEQ A;  2KEA A;  1SHF A;  4D8D A;  1ABQ A;  4DEY A;  2V1Q A;  2A08 A;  1U06 A;  1WXU A;  1UDL A;  2BZ8 A;  1YP5 A;  2EKH A;  2FRY A;  2CDT A;  4AFZ C;  4RTV A;  1X2K A;  1U3O A;  1W1F A;  1T3L A;  1Y0M A;  2O2O A;  2RNA A;  2OI3 A;  1GBR A;  2DBK A;  2DIL A;  4RTU A;  1K4U S;  4AFU C;  1K76 A;  1MUZ A;  2CUB A;  1GCQ A;  2JM9 A;  2L0A A;  2ROT A;  1QKX A;  4RTY A;  1NEG A;  1I0C A;  1NEB A;  1WDX A;  2DX1 A;  1LCK A;  1JU5 C;  2KRS A;  5FWB A;  5GJV B;  3VS3 A;  3VS0 A;  5IHK A;  1M3B A;  1T0J A;  2DRK A;  2DE0 X;  2JXB A;  4CC2 A;  2XMF A;  4OMP A;  5FW9 A;  1RI9 A;  4DEX A;  2D1X A;  2YSQ A;  1YWP A;  1AWX A;  4RTW A;  1K9A A;  1HD3 A;  1OV3 A;  1ZBJ A;  3CQT A;  4HVW A;  2DA9 A;  4K11 A;  2EGC A;  4OMO A;  1X6B A;  3EHR A;  3H0F A;  1KSW A;  1QWE A;  4QT7 A;  1BBZ A;  2KGT A;  4X1V A;  5L23 A;  1Z9Q A;  2K7A A;  3THK A;  2EPD A;  2GBQ A;  2FO0 A;  4HVV A;  4CC3 A;  3VRZ A;  2CRE A;  1KFZ A;  4AFS C;  4LUD A;  2FRW A;  1TG0 A;  2JM8 A;  2DVJ A;  2E5K A;  1BB9 A;  3M0P A;  1XOV A;  4GLM A;  4ESR A;  2RF0 A;  3PE0 A;  1S1N A;  4RTZ A;  4JJB A;  5ECA A;  1BU1 A;  4JZ3 A;  2LZ6 B;  2RQV A;  4WCI A;  2FPE A;  1RLP C;  2LX7 A;  4KRT A;  4EIK A;  2CUD A;  2P4R A;  2DL7 A;  4J9E A;  1A0N B;  1QKW A;  2KR3 A;  2F2V A;  3EG1 A;  1K1Z A;  1VYV A;  4HVU A;  2KE9 A;  3EG3 A;  1WI7 A;  2L3Q A;  1SPK A;  4AFQ C;  2HDA A;  2PZ1 A;  2EVR A;  2KYM A;  4F14 A;  3M0R A;  2L3P A;  2W10 A;  1NM7 A;  1JQQ A;  2KYB A;  1PRM C;  1JXM A;  2DYB A;  1HJD A;  3VS7 A;  1RUW A;  2KXD A;  2DJQ A;  2DF6 A;  3NPF A;  4J9I A;  2EQI A;  2CH4 A;  1GCP A;  2G6F X;  3NGP A;  3VS6 A;  1NLP C;  3R6N A;  1OOT A;  1N5Z A;  1NYF A;  2K3B A;  1PKT A;  1ZSG A;  2C0O A;  2EYW A;  1H8K A;  2AKL A;  1JEG A;  5IHN A;  2VVK A;  2CSQ A;  3EGU A;  2O88 A;  4Z88 A;  2MCN A;  3RNJ A;  2IIM A;  1CKA A;  1MV0 B;  1FYN A;  2JMA A;  1PNJ A;  2EBP A;  1QWF A;  3I9Q A;  4ORZ A;  2AK5 A;  3EG2 A;  1CKB A;  3TVT A;  2J06 A;  4GBQ A;  2BTT A;  1UE9 A;  2LJ3 A;  3ZL7 C;  3TSZ A;  2CH4 W;  2HBW A;  5FWC A;  4LE9 A;  1GCQ C;  2NWM A;  2EGA A;  1NG2 A;  1WLP B;  3SEM A;  1Y57 A;  2JTE A;  2K2M A;  4J9D A;  2ED0 A;  2FPD A;  2JS2 A;  2A36 A;  2KBT A;  2JMC A;  2L2P A;  3A98 A;  2DL3 A;  4F17 A;  2KRM A;  1AD5 A;  5I22 A;  2CT4 A;  1ARK A;  1V1C A;  1W70 A;  3REB B;  1B3Q A;  1ZUK A;  1UJ0 A;  4OMN A;  1KIK A;  2C0I A;  2F2X A;  2D8H A;  2J6F A;  1BK2 A;  4OMM A;  1GL5 A;  2KRN A;  1WXT A;  3KFV A;  2OJ2 A;  1UJY A;  1X2Q A;  2HSP A;  5GJW B;  2X3W D;  2X3X D;  2LJ0 A;  1YN8 A;  1H92 A;  1QCF A;  4IIO A;  4JZ4 A;  2K9G A;  2EYY A;  5I11 A;  2BZY A;  1SSH A;  2ABL A;  3PVQ A;  1K0X A;  1UUE A;  4Y92 A;  2NUZ A;  4RTX A;  4J9H A;  1OPK A;  4FSS A;  1PKS A;  4JJC A;  1ZUY A;  1X43 A;  3VRY A;  1E6H A;  4J9C A;  2ESW A;  2GGR A;  2DNU A;  2YDL A;  3GBQ A;  3LH5 A;  3FJ5 A;  1UFF A;  3M0T A;  1IO6 A;  3VS4 A;  1G83 A;  2GTJ A;  2FPF A;  4CC7 A;  3H41 A;  3IQL A;  5IXB A;  1W6X A;  2W0Z A;  5IHI A;  2PNI A;  2KXC A;  3NHN A;  2RN8 A;  3UA6 A;  1AVZ C;  4AG2 C;  1AWO A;  2H8H A;  1GFC A;  2AZS A;  4E6R A;  3PVL A;  1I1J A;  1AWW A;  1SRL A;  4J9G A;  4A63 B;  2I0N A;  1NYG A;  1KJW A;  3VS2 A;  1UTI A;  2LJ1 A;  1WA7 A;  2C0T A;  1UEC A;  2RQW A;  3QWX X;  2LP5 A;  1FMK A;  2EYZ A;  1EFN A;  1ZX6 A;  1ABO A;  2F2W A;  1UGV A;  2OAW A;  2YUO A;  3I5R A;  2K6D A;  3UAT A;  3RBB B;  1G2B A;  2AKK A;  2DL5 A;  2J7I A;  2JS0 A;  1YNZ A;  1UHC A;  1T0H A;  2MOX A;  2BZX A;  3EG0 A;  1TUC A;  2AZV A;  3I5S A;  2YUP A;  1YWO A;  3VS1 A;  2EYX A;  1U5S A;  1T3S A;  3O5Z A;  1YCS B;  1ZUU A;  3H0I A;  2DLP A;  2LQN A;  2O9S A;  1GFD A;  5IXF A;  1B07 A;  1I07 A;  2KT1 A;  2DL4 A;  2ED1 A;  2FG0 A;  2LCS A;  1VYU A;  2SRC A;  1SEM A;  3I35 A;  2LNH B;  1SHG A;  2GTO A;  1VA7 A;  3C0C A;  1M8M A;  3EHQ A;  3NMZ C;  2J05 A;  1JXO A;  1AWJ A;  2QDL A;  1AZG B;  4JPB W;  1WFW A;  1J3T A;  1E6G A;  3M0U A;  1WYX A;  2GQI A;  1OEB A;  1ZLM A;  1RLQ C;  3ULR B;  2RMO A;  1X6G A;  2RQR A;  1HSQ A;  2PTK A;  2FEI A;  4M4Z A;  4OML A;  2DBM A;  2DMO A;  2EGE A;  4RTT A;  4J9F A;  2GNC A;  2VKN A;  2DRM A;  2L3S A;  1UG1 A;  1WXB A;  4JJD A;  2K79 A;  1K0S A;  2LQW A;  4F16 A;  1PRL C;  2D8J A;  2ROL A;  1X69 A;  2RQT A;  2D0N A;  2M0Y A;  1QLY A;  4LUE A;  3UA7 A;  4CC4 B;  1NLO C;  2MIO A;  2J6K A;  1M3C A;  2RPN A; 
#chains in the Genus database with same CATH topology
 3A8H B;  4M77 B;  4M77 C;  3M53 A;  2SEM A;  2DTI A;  4HCC A;  2OTL A;  1YJW Q;  3BW1 A;  1AEY A;  4OB0 B;  1U1T A;  2NUT B;  1OPL A;  1WIE A;  1X27 A;  1QP2 A;  3M57 A;  2DD5 A;  1VQ4 Q;  1S72 Q;  1R8O B;  5C6S A;  1KG1 A;  1ZBX A;  1Z9Z A;  2YLB A;  2DM1 A;  2EW3 A;  4RG8 A;  4IIM A;  5HCK A;  3UDC A;  4QVD A;  3GNG A;  1PSF A;  1JO8 A;  2DXB A;  3RKX A;  1NBE B;  2QA4 Q;  3CC7 T;  5GAO p;  2V1R A;  1XNI A;  3BDL A;  2WSC E;  1D3B B;  2LDM A;  1LOJ A;  1VQN T;  1VUB A;  1E7O A;  4LDX A;  4BE0 A;  2RM4 A;  2HEQ A;  4FYV B;  1SHF A;  4N4G A;  4BAC A;  1KHI A;  2A08 A;  3J81 E;  1AT1 B;  1WXU A;  1VQ7 Q;  2BZ8 A;  4IUQ A;  3OW2 S;  3VJP A;  3CMA T;  3SB2 A;  5A0D A;  3CPW P;  2CP6 A;  2FRY A;  2CDT A;  5CCA A;  2QEX T;  4CI0 C;  4KH1 B;  3CBO A;  2HL5 C;  2RNA A;  1OQK A;  2DBK A;  4RTU A;  1I8F A;  4PJO D;  4FIB A;  2VAS A;  2L0A A;  1GCQ A;  2JM9 A;  2ROT A;  1QKX A;  4PNO A;  1NEG A;  2HBP A;  2IG0 A;  4FM4 B;  4M78 G;  1UB4 A;  2DX1 A;  4LDV A;  3CC4 A;  2WSF E;  3OYD A;  3QUI A;  2KRS A;  2DEU A;  4PJO E;  3J80 E;  3G6E T;  1QVF P;  1M3B A;  5KYU A;  1D1B A;  5GAN j;  3RDV A;  3CC2 Q;  2M1H A;  4KGX B;  3M58 A;  1VQM T;  3CCL A;  2QTX A;  5CIU A;  1TOV A;  2MF2 A;  2DYI A;  3I55 T;  4E7L A;  3M9Q A;  4FYW B;  5GAO m;  1HD3 A;  1OV3 A;  2OX7 A;  2DA9 A;  2EGC A;  1VQP T;  3EHR A;  4DBR A;  4X1V A;  4PJJ A;  1Z9Q A;  2K7A A;  3THK A;  4C0F A;  2EPD A;  2GBQ A;  2K3X A;  3EH2 A;  3CCJ Q;  4EDU A;  3CCE A;  2DZ9 A;  2XD0 A;  2FRW A;  2DER A;  2DEQ A;  2EJ9 A;  2JM8 A;  1VQ8 T;  1YI2 A;  4M78 F;  1BB9 A;  4OGC A;  3M0P A;  4M7A F;  4C92 D;  5KCO A;  3ER0 A;  2V26 A;  1VQ6 Q;  2DTH A;  4OB3 B;  3P8H A;  5FRM A;  3JCM f;  2LZ6 B;  3HRS A;  2E1H A;  2RK2 A;  2CZ1 B;  1Y7X A;  4C92 E;  3JCM X;  1YJN Q;  2CUD A;  3QKJ A;  4C0G A;  2A7Y A;  2XIC A;  4J9E A;  1Q86 U;  1QKW A;  4JLG A;  2LVM A;  2NUT A;  3EFR A;  2JTM A;  2P0P A;  1KK7 A;  2KE9 A;  3L2Z A;  4JS5 A;  4ZGE B;  3OYA A;  1Q82 C;  2L3Q A;  3HFO A;  4ME7 A;  4AFQ C;  2PZ1 A;  2RHY A;  4XU1 A;  4F14 A;  2A0F B;  2E3H A;  3L2W A;  2L3P A;  2QTV A;  3QG1 A;  4A4H A;  1NM7 A;  5KYX B;  5GAO l;  1JQQ A;  2JN0 A;  3DLL A;  1NJI C;  1ZSZ C;  2VXE A;  3VS6 A;  3OYE A;  1FXX A;  1N5Z A;  1PKT A;  1VQO A;  1H3Z A;  2EYW A;  1G3Y A;  3L2V A;  2HKN A;  1JEG A;  4C0D C;  4OF1 A;  2VVK A;  3EGU A;  3GOX A;  3RNJ A;  1I4K 1;  4J83 A;  5GAN 2;  3SFM A;  1FYN A;  2JMA A;  1Y96 B;  1D0Z A;  3E1S A;  5KYW A;  4ORZ A;  3TVT A;  2DXU A;  1FWZ A;  1R77 A;  3ZL7 C;  1OZ3 A;  1VQL Q;  3V8L A;  8AT1 B;  3CCM A;  3CCS T;  4OB2 B;  2EGA A;  3SEM A;  2K2M A;  4M7D F;  3M54 A;  1YHQ T;  2O4X B;  4NL2 A;  2KBT A;  2R5A A;  1TSF A;  4F17 A;  5CO7 A;  5DY9 A;  2CT4 A;  1V1C A;  2IPO B;  3REB B;  2LTO A;  2KAF A;  3OSV A;  3CXC S;  1VQ9 T;  4PJO G;  3PMT A;  3FB9 A;  4FU6 A;  4L6V 5;  3VV0 A;  5GAO n;  3CCQ A;  2E5Q A;  4O6J A;  1K8A C;  1H92 A;  5GAN d;  1Q86 R;  2K9G A;  5CKF A;  1SSH A;  2ABL A;  3I56 A;  3PVQ A;  2E64 A;  1UUE A;  1BCO A;  2C06 A;  3VU3 C;  4IKF A;  3VRY A;  3DLM A;  4J9C A;  2ESW A;  2DNU A;  2G3R A;  1W2B S;  2EYQ A;  1UGQ B;  1OU9 A;  3M0T A;  3TCJ A;  4KUD K;  3JCM b;  1BI3 A;  2CGH A;  1G83 A;  2FPF A;  4CC7 A;  3JB9 I;  3JCM c;  2X4X A;  5IXB A;  1U1S A;  1XJW B;  4LD6 A;  3BY7 A;  1MND A;  3CME T;  3RER A;  3NHN A;  4C0Z A;  5HK0 A;  3OS0 A;  3PIO A;  4XK8 E;  1AVZ C;  3CCV A;  3QDF A;  4AG2 C;  3CCU T;  4A54 A;  1AWO A;  2H8H A;  1GFC A;  3PVL A;  1AWW A;  4C8Q B;  4C92 G;  4A63 B;  4C8Q C;  4N0A C;  4M7D A;  1KJW A;  5DLQ E;  2E41 A;  1RAG B;  3SWN C;  4C92 C;  2C0T A;  3QWX X;  5KYX A;  3CMA Q;  2R5M A;  5CAI A;  2QEX Q;  3PNW C;  2DK3 A;  3I5R A;  2JNG A;  4J6W A;  3CCL Q;  2YRC A;  2AKK A;  5GAM g;  1YJW A;  2DL5 A;  2J7I A;  1YNZ A;  2PVD B;  2COY A;  2MOX A;  5CQX A;  2BZX A;  2AT1 B;  3C95 A;  4C5E A;  4ZGJ B;  1WQ7 A;  1Q7Y U;  4EMK C;  1VQ4 A;  2DFU A;  2HSE B;  3F70 A;  1S72 A;  1QVF S;  3V7C A;  3VS1 A;  2EYX A;  4XTZ A;  4MDW A;  1OX8 A;  1OZ2 A;  3O5Z A;  2K2V A;  1Y96 A;  2RK1 A;  2ZPG B;  4BI8 B;  1Y07 A;  1HYO A;  2DLP A;  2X4Y A;  3CCE Q;  3CXC A;  4PLI A;  5DLO A;  5IXF A;  2V8K A;  1I07 A;  2KT1 A;  1YI2 Q;  4FYX B;  4IUR A;  2ED1 A;  2QQS A;  2FG0 A;  5LJ5 j;  3J7A F;  2XDD A;  3P8D A;  1SEM A;  4PFP A;  3FC3 A;  4FYY B;  5GAM h;  1SHG A;  2QA4 A;  1IHV A;  1VA7 A;  1M8M A;  1AZG B;  4JPB W;  1J3T A;  1E6G A;  2EIF A;  5LJ5 f;  2K5L A;  3SD4 A;  3NTH A;  3CCR T;  3BDU A;  5GMK j;  1M1F A;  1M90 U;  3PT9 A;  1X6G A;  1W2B A;  2GFU A;  2ZAE A;  3QDR B;  1HSQ A;  5HKC A;  4RKU E;  4FW1 A;  2FEI A;  2DBM A;  2EGE A;  4P5N A;  4RTT A;  3JB9 H;  2GNC A;  2H3J A;  3CD6 Q;  1MMN A;  2DXC A;  1QW1 A;  1WXB A;  4JJD A;  2VGM A;  3G7Z A;  1PRL C;  3HTR A;  2CP3 A;  1MMD A;  2MI6 A;  3UA7 A;  1Y71 A;  1TU0 B;  2J6K A;  2RPN A;  3R6O A;  1GRI A;  3OQ5 A;  2HD0 A;  4M75 F;  4Z89 A;  4HXJ A;  1P92 A;  4LNP A;  4OMQ A;  1I5O B;  2B86 A;  3JCM V;  3M0S A;  2MMP A;  3M55 A;  1WZO A;  1TUD A;  2DVE A;  2P0Q A;  3QWY A;  4AG1 C;  5LJ3 e;  4Q5W A;  4AT1 B;  1SRM A;  3A8M B;  1N9R A;  1QVF A;  2A37 A;  2KT8 A;  1RL2 A;  1G5V A;  3MJX A;  3FJP A;  2P0K A;  4B6M A;  3M59 A;  2CT3 A;  3CPF A;  1Q7Y R;  2DL8 A;  4C8Q A;  3LWH A;  3C94 A;  4HCK A;  1O9S A;  1VQ6 A;  3JV3 A;  4M78 D;  1IZ6 A;  2O31 A;  4M7A D;  4R0K A;  5IT9 E;  3A8G B;  1PHT A;  3UF4 A;  3QO3 A;  2D9T A;  4E7H A;  4IUV A;  2ENM A;  2LNV A;  2E65 A;  1C0M A;  4J9B A;  3DB4 A;  3LYI A;  2DPP B;  1SF9 A;  2KRO A;  1V76 A;  4MZM A;  4LN2 A;  1YJN A;  5A0L A;  4M7A E;  2KSS A;  2RI3 A;  3CCS Q;  4DEY A;  3WVE B;  4A4G A;  2PVO B;  1U06 A;  3MKD A;  2L8D A;  1YP5 A;  2EKH A;  2NUP A;  3V7R A;  1ZA1 B;  2P84 A;  3CCQ Q;  4AFZ C;  4RTV A;  1U3O A;  1M1G A;  1T3L A;  2O2O A;  1QMC A;  1N27 A;  5CKE A;  2CP0 A;  4AFU C;  1M90 R;  1M8V A;  4J7I A;  3AHU A;  2E12 A;  4RMO A;  1NEB A;  1U8R A;  2QQR A;  3CEY A;  4M75 A;  1VQ9 Q;  4E7K A;  3Q1J A;  2QGG A;  1X75 C;  5GJV B;  4J6Y A;  3VS3 A;  3VS0 A;  3L1A A;  3PGG A;  1OYX A;  1TXQ A;  2HZY A;  2XMF A;  5FW9 A;  1RI9 A;  4DEX A;  3OYJ A;  2YSQ A;  4JRK A;  4RTW A;  1Q86 C;  1VQ5 Q;  1K9A A;  4HVW A;  1VQK T;  3EAE A;  4K11 A;  3CCV Q;  4OMO A;  1X6B A;  3JRZ A;  1KSW A;  4QT7 A;  2DJZ A;  2EJF A;  2X35 A;  5L23 A;  1NPR A;  1RAE B;  4HVV A;  3QZ9 B;  1H64 1;  4IUP A;  1KFZ A;  4WF2 A;  2DVJ A;  3E9F A;  3O8V A;  3PE0 A;  3FEO A;  3CXC P;  1K8A R;  2OTL T;  4BI4 A;  4ZGD B;  1BU1 A;  3VYH B;  3OYY A;  4QW2 A;  4JZ3 A;  1SSF A;  3VYG A;  4M7D D;  2RQV A;  4WCI A;  2HAX A;  2FPE A;  1RLP C;  4KRT A;  2RH2 A;  4EIK A;  3HL8 A;  1PCX A;  5KE2 A;  3OBW A;  4B9W A;  3LGF A;  4M7D E;  1RAH B;  2L5Q A;  2FZC B;  3FIF A;  2M0O A;  3X26 B;  5CK9 A;  3EG3 A;  2GCX A;  1G3S A;  2JVV A;  1N9S A;  2HDA A;  3OYM A;  1W2B P;  2EVR A;  2X4J A;  2P4T A;  2HNI A;  1WPY A;  2PUO B;  2RJC A;  2M9U A;  4MMK A;  6AT1 B;  1JXM A;  4E7Z A;  1RUW A;  2XID A;  4PK4 A;  3NPF A;  2EQI A;  2CH4 A;  1M9S A;  1GCP A;  2LX9 A;  1KQS S;  3NGP A;  5M9O A;  5KE3 A;  3ZFJ A;  1WQW A;  4M77 F;  5AT1 B;  1ZSG A;  3UWN A;  1H8K A;  3LLR A;  5IHN A;  1IHW A;  2CSQ A;  2VUB A;  2O88 A;  1OX9 A;  4ATO A;  2MCN A;  2AIR B;  2HQH A;  4WTO B;  2RB6 A;  2ZPF B;  1JJ2 A;  1VQN A;  4IUT A;  2RHX A;  1PNJ A;  2EBP A;  1QWF A;  2QAS A;  2XK0 A;  2AK5 A;  1F1B B;  2F5K A;  3CCR Q;  2WSE E;  3LX7 A;  2GQV A;  3OBY A;  3CC4 T;  4M7A G;  2D0Q B;  3S6W A;  5C0M A;  2LJ3 A;  1K9M U;  4AMC A;  4GY5 A;  5I2M A;  3CMA A;  3P8B B;  4M78 C;  2BUD A;  4M7A C;  2QEX A;  2NWM A;  1WLP B;  3L2R A;  5D6Y A;  2QI2 A;  4HA8 A;  2FPD A;  2JS2 A;  2L2P A;  3A98 A;  1PM3 A;  1PG5 B;  2DL3 A;  5GAN f;  1ZUK A;  4A4K A;  1K73 U;  4L5G A;  2PVG B;  1RAD B;  2J6F A;  1WXT A;  3I55 A;  4JRP A;  3EGD B;  2LJ0 A;  1YN8 A;  4JZ4 A;  1JRI A;  1VQP A;  5I11 A;  3OYB A;  2M02 A;  4M77 A;  4RTX A;  1OPK A;  4FSS A;  4QVZ A;  4JJC A;  3H6Z A;  2YDL A;  1QVG P;  1RI0 A;  1VQ8 A;  3VS4 A;  1YJ9 T;  3JCM J;  3AT1 B;  2GTJ A;  2CZ6 B;  2QXF A;  4DA4 A;  1Q7Y C;  4RCB A;  1KQS A;  3OYF A;  1MNE A;  4BE2 A;  2QQB A;  2ATC B;  1KD1 U;  1GXI E;  4LDY A;  2RN8 A;  1KHC A;  2OAU A;  1RAF B;  2COZ A;  2EQJ A;  4E2F B;  3KXT A;  4YTL A;  3CD6 A;  3JCM h;  1SRL A;  1PD0 A;  2I2L A;  1I81 A;  1ZSZ B;  4OB1 B;  4XTV A;  5I2S A;  1TS9 A;  4M7D G;  4LXC A;  2OTJ T;  1EFN A;  3L2U A;  2F2W A;  1D3B A;  1VQO T;  5FU7 B;  2ZZD A;  3T9N A;  5FU7 C;  4C0D B;  1WGS A;  2JS0 A;  1K9M R;  4R55 A;  3OS5 A;  2LQK A;  4FT2 A;  4M75 D;  2XU8 A;  2QK0 A;  2DO3 A;  5J26 A;  3UT1 A;  1KC8 U;  2AZV A;  1M90 C;  2VGN A;  3A8L B;  1X6O A;  2RHZ A;  3E19 A;  4M75 E;  1T3S A;  1LPL A;  3G71 T;  1YCS B;  1R0C B;  3X20 B;  3A5Z B;  4DQ2 A;  2B8A A;  4D6W A;  1B07 A;  3X25 B;  2DL4 A;  4HT9 A;  1K73 R;  3JAM E;  4ZN1 A;  2IVW A;  2LT1 A;  5LJ3 g;  4HT8 A;  2QAZ A;  5J39 A;  3EHQ A;  2J05 A;  3URG A;  3G4S T;  4J5Y A;  3M0U A;  5KCH A;  1WYX A;  1RAB B;  5FU6 C;  1OEB A;  1ZLM A;  1RLQ C;  2KQW A;  3CCS A;  3MPU B;  4MDX A;  2MPX C;  2KI7 A;  3MCA B;  1G8X A;  2PTK A;  1YHQ A;  1G3T A;  1BI0 A;  3HHT B;  4PJO B;  4OML A;  4B9X A;  4PJO C;  4XTW A;  4J9F A;  4QQD A;  4JS4 A;  3I56 T;  2K79 A;  1PSE A;  2V8J A;  3MEA A;  5LJ3 h;  3EGD A;  3VKI A;  1KD1 R;  1JJ2 P;  3FRN A;  1VQ9 A;  1WJR A;  1QLY A;  4CC4 B;  1IGU A;  2LCC A;  1IRE B;  4ELY C;  4F04 B;  3OYC A;  2ECZ A;  3TSW A;  3CC7 Q;  2YT6 A;  1VQ5 A;  3VS5 A;  2MWO A;  2VB6 A;  1M3A A;  4EMH A;  1YIJ T;  1AOJ A;  1UHF A;  2HL3 A;  2M51 A;  1VQN Q;  3EGX B;  4N4I A;  4KUL A;  5GAN e;  4ZN3 A;  3SWN B;  4C92 B;  4OVA A;  1FMV A;  1BI2 A;  4Z8A A;  1KC8 R;  4C5H A;  1EX4 A;  1ZSZ A;  1VYT A;  3REA B;  5FRN A;  3MP6 A;  3ZEH A;  2E10 A;  2QGF B;  3RUX A;  4DOV A;  2RHU A;  3CCU A;  3ME9 A;  4V2S A;  1M1K U;  4MZT A;  7AT1 B;  3OYL A;  2O9V A;  5GMK m;  4FCY A;  2HCK A;  2ZGW A;  4NS5 A;  5IH2 A;  1MV3 A;  3M56 A;  1M30 A;  4EMK B;  3M0Q A;  5LL6 S;  2JW4 A;  2PUK B;  1VQ4 T;  3JCM e;  1YIT T;  1S72 T;  1XTD A;  1D0Y A;  5GAM j;  1UGP B;  4D8D A;  1ABQ A;  3G6E Q;  3CBM A;  1M2V B;  2FYK A;  1BCM A;  4F7U B;  3OYH A;  1VQM Q;  1TWB A;  3I55 Q;  5L8R E;  3QSU A;  2RHI A;  1KQS P;  1W1F A;  1GBR A;  2OI3 A;  2E3I A;  1LVK A;  2DIL A;  1VQP Q;  1MUZ A;  3X28 B;  2QA4 T;  2CUB A;  2QQ9 A;  5HY6 A;  1WDX A;  4C8Q F;  3GNF B;  9ATC B;  1JU5 C;  3RIR A;  2DKG A;  2O4X A;  1OI1 A;  4M75 G;  2VC8 A;  3EG9 B;  2HKQ B;  1VQ8 Q;  3A8O B;  5D6X A;  4ZTF A;  1VQ7 T;  2JXB A;  5KYY B;  2WAC A;  4CC2 A;  4M77 D;  3NTI A;  3MEU A;  1JB0 E;  2A3L A;  5GAN 4;  1ZBJ A;  1QVG S;  1MMG A;  3CBP A;  5GMK l;  4QKU A;  1N6A A;  3H0F A;  3RMQ A;  3RR6 A;  1BBZ A;  4CRI A;  3CCR A;  2CP5 A;  4M77 E;  2FO0 A;  1YJ9 Q;  3VRZ A;  2CRE A;  4X34 A;  5A2Q E;  4AFS C;  2E4H A;  4BUG A;  4LUD A;  4MZP A;  2CP2 A;  4J8O A;  1TG0 A;  1WHM A;  2XKO C;  5LJ3 d;  2E5K A;  4PKC C;  1O75 A;  1XOV A;  4BB7 A;  4ESR A;  2JZ2 A;  3CC2 T;  1S1N A;  4RTZ A;  4JJB A;  5ECA A;  2E6Z A;  3V8J A;  2DIG A;  3LWI A;  2LX7 A;  3S3N A;  3EH1 A;  1WJS A;  2FZK B;  2DL7 A;  3QZ5 B;  1M1K R;  1IB8 A;  2FHD A;  3CCJ T;  3D7S B;  2F2V A;  3EG1 A;  2KDS A;  3L42 A;  1K1Z A;  1VYV A;  4DBH A;  3EGX A;  4UC4 A;  4N0A A;  1SPK A;  1YBY A;  3M0R A;  3E9G A;  3SWN A;  4C92 A;  3PTA A;  4HCZ A;  1K9M C;  2W10 A;  4KT0 E;  2HQE A;  2KYB A;  2EQK A;  4ANJ A;  2DYB A;  5GAN 3;  4QQ6 A;  5CQY A;  2O01 E;  3GP8 A;  2X51 A;  2DF6 A;  1N8R U;  2G6F X;  4PJN A;  4XU3 A;  1NLP C;  1NZ9 A;  1OOT A;  2K3B A;  3E2U A;  4EMK A;  3H9N A;  2C0O A;  4C5I A;  2AKL A;  3RES A;  1YHQ Q;  3DB3 A;  3GF5 A;  1WHL A;  4Z88 A;  1B7T A;  1D1C A;  3OMC A;  1M2V A;  1RAI B;  1MV0 B;  1K73 C;  4F7U A;  3G1J A;  4BE1 A;  5GAO q;  2JTF A;  2Z0W A;  1CKB A;  4HCB A;  5CKD A;  1QVG A;  1MGQ A;  4XTY A;  4LD9 K;  2BTT A;  1G3W A;  3TSZ A;  4EMG A;  5GAM d;  4Z02 A;  3JB9 G;  2MAM A;  5FWC A;  1GCQ C;  2HQX A;  4JLI A;  4MML A;  2LT4 A;  2JTE A;  1D0X A;  2ED0 A;  3EG9 A;  1JJ2 S;  2JMC A;  2KRM A;  2KMT A;  2R57 A;  5FRO A;  1SKU B;  1B34 B;  5I22 A;  1RAC B;  1W70 A;  1B3Q A;  1KD1 C;  2K57 A;  3PIP A;  1UJ0 A;  4OMN A;  2DET A;  4NL3 A;  3V7S A;  1VQL T;  1HXD A;  2KRN A;  3KFV A;  3GPL A;  3CME Q;  3MO8 A;  4TVR A;  3HFN A;  5GJW B;  2X3W D;  2X3X D;  2FZG B;  1FX7 A;  1QCF A;  4IIO A;  3EFO B;  1I5L A;  2EYY A;  1BI1 A;  4JJN K;  1QQJ A;  3CCU Q;  3JB9 F;  4IUU A;  4Y92 A;  2NUZ A;  1PKS A;  2Y90 A;  2RJF A;  3KBG A;  4M77 G;  1E6H A;  3GBQ A;  3LH5 A;  3FJ5 A;  3JCM W;  1UFF A;  1Q81 U;  1MMA A;  1BIA A;  1IO6 A;  3C4S A;  4E7J A;  5LJ5 e;  3IQL A;  1KC8 C;  1PD1 A;  1IRX A;  2W0Z A;  3ASK A;  3OMG A;  4PLL A;  2NLU A;  1N8R R;  2BE9 B;  3UA6 A;  3MEV A;  3MHX A;  2CZ7 B;  2AZS A;  1YIT Q;  4E6R A;  5GAO r;  4J9G A;  5GMK e;  2I0N A;  1YCY A;  3A1P A;  3VS2 A;  1UTI A;  4KBM B;  2LJ1 A;  1WA7 A;  2M16 A;  2LP5 A;  1MHN A;  1ABO A;  2DIQ A;  3QBY A;  4BD3 A;  1ZA2 B;  2CZ0 B;  1UGV A;  2OAW A;  4LDU A;  3RBB B;  3M4Y A;  1EZZ B;  2YWW A;  1UHC A;  3MP8 A;  1T0H A;  3CC7 A;  2FVU A;  4E7I A;  4EPC A;  5D7U A;  3I5S A;  1UEB A;  2Y4X A;  1V29 B;  2F1L A;  2E70 A;  4LDW A;  3QYH B;  3OB9 A;  3H0I A;  4DBQ A;  5KYW B;  1WNL A;  4M78 B;  1GFD A;  4PFO A;  4M7A B;  5DM7 R;  2YLC A;  2LCS A;  2JOY A;  5IN1 A;  3CCL T;  2NYS A;  3HRU A;  3C0C A;  3M4G A;  5GAN g;  1JBM A;  2VXF A;  3RKW A;  2XDP A;  1M5Q 1;  4R56 A;  2AHJ B;  2DTO A;  3OYG A;  2YXY A;  2XG8 D;  4XTU A;  3G6E A;  1WHJ A;  2KY9 A;  2RMO A;  1B34 A;  4NOY A;  3QXE B;  3CCE T;  1VQM A;  2VV5 A;  4M4Z A;  1YI2 T;  2DMO A;  1Q81 R;  2L89 A;  2L3S A;  3MEW A;  1UG1 A;  3JCM g;  2QDY B;  3EFS A;  1K0S A;  1LJO A;  2QQA A;  4JUV A;  5GAN h;  2D8J A;  3EFO A;  1X69 A;  2RQT A;  2M0Y A;  4LUE A;  4C8Q D;  1NLO C;  1M1K C;  1M3C A;  5GAN 6;  1XQH A;  2VWF A;  3LW5 E;  4A4F A;  1H3H A;  1QP3 A;  2EWN A;  2LCL A;  2HMA A;  3OSS C;  2A28 A;  1PWT A;  3UPU A;  5EC7 A;  3NFC A;  1M2O A;  2JT4 A;  1BIB A;  2RQU A;  4C8Q E;  1WHH A;  2D6F A;  2XI9 A;  3VUZ A;  3CD6 T;  2BKD N;  3OYK A;  3H0H A;  1UGS B;  1GBQ A;  2GFA A;  4XU0 A;  3QHS A;  1CSK A;  3QYG B;  3TEE A;  2CS7 A;  5AYF A;  3SHW A;  1M27 C;  4OGE A;  1YJ9 A;  1WX6 A;  5KYN A;  2COW A;  2J6O A;  3WVD B;  1VIF A;  2K3Y A;  4DBF A;  1NE8 A;  2LMJ A;  3TQ7 P;  3U23 A;  2CSI A;  1SG5 A;  1UGR B;  2K4Y A;  2KNB B;  4L59 A;  4M7D B;  4ZNX A;  3OW2 A;  1AZE A;  4M7D C;  3LH0 A;  4XAX B;  4BY6 B;  1X01 A;  2YUN A;  4KGZ B;  4BY6 C;  3MET A;  4RUG A;  4D8K A;  4F7U E;  2RO0 A;  3H8Z A;  2YUQ A;  1LNX A;  2RI5 A;  2YHT A;  4ELZ C;  1WJQ A;  2KEA A;  2X9H A;  2OTJ A;  4VUB A;  3BE3 A;  1OU8 A;  3PMI A;  4Y28 E;  2V1Q A;  2GF7 A;  3RMS A;  2JJ9 A;  1UDL A;  1PC0 A;  3CCM T;  3KUF A;  5A0G A;  3M5A A;  1X2K A;  1Y0M A;  1VQK Q;  3N5B B;  1K4U S;  1K76 A;  2PU9 B;  4M78 A;  4M7A A;  4RTY A;  1I0C A;  5HK3 A;  4E7S A;  1VIE A;  3PFS A;  1LCK A;  2YRD A;  4E47 A;  5KH6 A;  3G71 A;  4II1 A;  4X9C A;  5FU6 B;  5FWB A;  1AHJ B;  5LJ3 j;  5IHK A;  3C12 A;  1T0J A;  2DRK A;  2DE0 X;  2OTL Q;  4OMP A;  2XHC A;  2F69 A;  2D1X A;  3CCQ T;  2EFI A;  1YWP A;  1AWX A;  5LJ3 f;  3CQT A;  3G4S A;  5GAN 5;  1QWE A;  1R0B G;  3BFM A;  2KGT A;  5GMK i;  4HKE A;  2K5I A;  4XTX A;  4CC3 A;  4KH0 B;  2LRQ A;  2RA2 A;  2LC4 A;  2ZPB B;  3MP1 A;  2VYT A;  4JRQ A;  4GLM A;  2RF0 A;  3TU4 K;  1ZQ1 A;  1N8R C;  2F5T X;  1QVP A;  1VQ5 T;  1WHG A;  1C6V X;  1OUL A;  3CCV T;  2ZCF B;  5CKH A;  3LGL A;  2P4R A;  5IAY A;  3HKS A;  1A0N B;  2EKO A;  2KR3 A;  4O5V A;  1M4Z A;  3V8K A;  4HVU A;  3JCM d;  1WI7 A;  4N4H A;  3L2Q A;  3CME A;  3JSC A;  2RJD A;  4PJO F;  4JRI A;  2KYM A;  3FDR A;  2PQW A;  4C8Q G;  1YIJ A;  2ZPH B;  4A53 A;  4PJM A;  2RJE A;  1YJW T;  1PRM C;  3JB9 D;  1HJD A;  2DXT A;  3VS7 A;  2KXD A;  3CPW S;  3CC4 Q;  2DJQ A;  4J9I A;  3R6N A;  2L3R A;  1NYF A;  3INZ A;  3NTK A;  1KQ2 A;  1Q95 G;  2RI2 A;  2FB7 A;  2CYZ B;  3HP9 A;  1TTH B;  5GAM f;  2IIM A;  1CKA A;  1YIT A;  1Q82 U;  3I9Q A;  3EG2 A;  2NUP B;  1QCN A;  4F7U G;  2J06 A;  5LJ5 g;  4GBQ A;  1UE9 A;  2ZPI B;  2KK4 A;  1FMW A;  4J6X A;  4GLK A;  2CH4 W;  4C92 F;  5EG2 A;  2HBW A;  3OY9 A;  4LE9 A;  1NJI U;  1IGQ A;  1NG2 A;  5GAN 8;  4M75 B;  1Y57 A;  4M75 C;  4J9D A;  2Y4Y A;  4C5G A;  2A36 A;  1Q81 C;  3OW2 P;  2DAQ A;  2EQM A;  4PJL A;  1AD5 A;  4XU2 A;  1ARK A;  1C1A A;  4KGV B;  4PJO A;  3DKM A;  2YRV A;  3GLX A;  1BYM A;  1KIK A;  2C0I A;  1ACM B;  5LJ5 h;  1QCO A;  2F2X A;  1VQ7 A;  2D8H A;  1BK2 A;  4OMM A;  1GL5 A;  1VOM A;  3SDZ A;  4F7U F;  2OJ2 A;  1UJY A;  2H3E B;  1X2Q A;  2HSP A;  4FSX A;  2BIV A;  4PFZ A;  4J7F A;  4JDS A;  3QJ6 A;  4QQG A;  1DJ7 B;  2BZY A;  4PL6 A;  5D6W A;  3OS2 A;  1YFN A;  1K0X A;  1W4S A;  1ZHI A;  3X24 B;  4J9H A;  5FLX E;  5CR2 A;  2RD1 A;  5GMK h;  1TH7 A;  1ZUY A;  1X43 A;  2GGR A;  3QII A;  3GIB A;  2EAY A;  3CPW A;  2OTJ Q;  3QPH A;  3H41 A;  2MK5 A;  3CC2 A;  1W6X A;  1VQO Q;  5IHI A;  2PNI A;  1RAA B;  2KXC A;  3VUB A;  2JUF A;  2CP7 A;  2K5F A;  1NPP A;  1VQ6 T;  1D1A A;  2XDB A;  3OYI A;  2LQ8 A;  1I1J A;  8ATC B;  4DOW A;  1K8A U;  4RCC A;  3CCJ A;  1NYG A;  2CKK A;  3JCM P;  3G71 Q;  2RQW A;  1UEC A;  1YJN T;  3CCM Q;  4RG2 A;  1FMK A;  1Q82 R;  2EYZ A;  1ZX6 A;  4BDY A;  3FLG A;  3UAT A;  2YUO A;  2FL7 A;  2K6D A;  2V8I A;  4FL6 A;  3HSB A;  1G2B A;  3OYN A;  4FW2 A;  2DZC A;  3EG0 A;  1NJI R;  1TUC A;  2MYS A;  5J3B A;  3G4S Q;  4BDZ A;  1IXD A;  4M78 E;  2YUP A;  4OP0 A;  1YWO A;  3JCM Q;  3TRE A;  3S3M A;  1U5S A;  2KVQ G;  2EQU A;  4QVC A;  1ZUU A;  3S3O A;  2LQN A;  2O9S A;  1BKB A;  1HK9 A;  4A4E A;  1VYU A;  2ZPE B;  3HPW A;  2SRC A;  1D09 B;  3I35 A;  2QYZ A;  2MWP A;  4XQ3 A;  2LNH B;  4KUI A;  3HRT A;  3I56 Q;  2GTO A;  3NMZ C;  1TUG B;  4BI3 A;  5KYU B;  1JXO A;  1AWJ A;  2QDL A;  5I21 A;  4X9D A;  5KYY A;  1KQ1 A;  1WFW A;  1EIF A;  2QG9 B;  2GQI A;  2EJG A;  1WHK A;  3ULR B;  2X4W A;  3OS1 A;  2RQR A;  3JB9 J;  4FT4 A;  2BE7 D;  3OA6 A;  5LJ5 d;  2DD4 A;  2VKN A;  1VQK A;  5CKB A;  2DRM A;  1YIJ Q;  2R58 A;  4ZTJ A;  5GAM e;  5GAN 7;  3QJY A;  3RKY A;  4OMF B;  2LQW A;  3ZBD A;  4F16 A;  2E6N A;  2ROL A;  4Y91 A;  2D0N A;  1VQL A;  5CVI A;  3WXM B;  2MIO A; 
#chains in the Genus database with same CATH homology
 1GRI A;  2VWF A;  1H3H A;  2SEM A;  2A28 A;  1PWT A;  2ECZ A;  5EC7 A;  4Z89 A;  2JT4 A;  4HXJ A;  4LNP A;  2RQU A;  4OMQ A;  3TSW A;  1AEY A;  2B86 A;  2YT6 A;  3VS5 A;  1M3A A;  3M0S A;  1OPL A;  1WIE A;  1X27 A;  1AOJ A;  1UHF A;  3H0H A;  2M51 A;  1GBQ A;  1TUD A;  1CSK A;  3QWY A;  4AG1 C;  3SHW A;  1M27 C;  1WX6 A;  1SRM A;  2A37 A;  2J6O A;  2KT8 A;  4Z8A A;  1Z9Z A;  2LMJ A;  2CT3 A;  2DL8 A;  2CSI A;  3U23 A;  2DM1 A;  2EW3 A;  4HCK A;  1VYT A;  3REA B;  2KNB B;  4IIM A;  4ZNX A;  5HCK A;  1AZE A;  3JV3 A;  1JO8 A;  2O31 A;  4R0K A;  1PHT A;  3UF4 A;  2YUN A;  2O9V A;  2HCK A;  2ENM A;  2V1R A;  5IH2 A;  1MV3 A;  4J9B A;  4RUG A;  1M30 A;  4D8K A;  3M0Q A;  2JW4 A;  2KRO A;  1E7O A;  4LN2 A;  2YUQ A;  2HEQ A;  2KEA A;  1SHF A;  4D8D A;  1ABQ A;  4DEY A;  2V1Q A;  2A08 A;  1U06 A;  1WXU A;  1UDL A;  2BZ8 A;  1YP5 A;  2EKH A;  2FRY A;  2CDT A;  4AFZ C;  4RTV A;  1X2K A;  1U3O A;  1W1F A;  1T3L A;  1Y0M A;  2O2O A;  2RNA A;  2OI3 A;  1GBR A;  2DBK A;  2DIL A;  4RTU A;  1K4U S;  4AFU C;  1K76 A;  1MUZ A;  2CUB A;  1GCQ A;  2JM9 A;  2L0A A;  2ROT A;  1QKX A;  4RTY A;  1NEG A;  1I0C A;  1NEB A;  1WDX A;  2DX1 A;  1LCK A;  1JU5 C;  2KRS A;  5FWB A;  5GJV B;  3VS3 A;  3VS0 A;  5IHK A;  1M3B A;  1T0J A;  2DRK A;  2DE0 X;  2JXB A;  4CC2 A;  2XMF A;  4OMP A;  5FW9 A;  1RI9 A;  4DEX A;  2D1X A;  2YSQ A;  1YWP A;  1AWX A;  4RTW A;  1K9A A;  1HD3 A;  1OV3 A;  1ZBJ A;  3CQT A;  4HVW A;  2DA9 A;  4K11 A;  2EGC A;  4OMO A;  1X6B A;  3EHR A;  3H0F A;  1KSW A;  1QWE A;  4QT7 A;  1BBZ A;  2KGT A;  4X1V A;  5L23 A;  1Z9Q A;  2K7A A;  3THK A;  2EPD A;  2GBQ A;  2FO0 A;  4HVV A;  4CC3 A;  3VRZ A;  2CRE A;  1KFZ A;  4AFS C;  4LUD A;  2FRW A;  1TG0 A;  2JM8 A;  2DVJ A;  2E5K A;  1BB9 A;  3M0P A;  1XOV A;  4GLM A;  4ESR A;  2RF0 A;  3PE0 A;  1S1N A;  4RTZ A;  4JJB A;  5ECA A;  1BU1 A;  4JZ3 A;  2LZ6 B;  2RQV A;  4WCI A;  2FPE A;  1RLP C;  2LX7 A;  4KRT A;  4EIK A;  2CUD A;  2P4R A;  2DL7 A;  4J9E A;  1A0N B;  1QKW A;  2KR3 A;  2F2V A;  3EG1 A;  1K1Z A;  1VYV A;  4HVU A;  2KE9 A;  3EG3 A;  1WI7 A;  2L3Q A;  1SPK A;  4AFQ C;  2HDA A;  2PZ1 A;  2EVR A;  2KYM A;  4F14 A;  3M0R A;  2L3P A;  2W10 A;  1NM7 A;  1JQQ A;  2KYB A;  1PRM C;  1JXM A;  2DYB A;  1HJD A;  3VS7 A;  1RUW A;  2KXD A;  2DJQ A;  2DF6 A;  3NPF A;  4J9I A;  2EQI A;  2CH4 A;  1GCP A;  2G6F X;  3NGP A;  3VS6 A;  1NLP C;  3R6N A;  1OOT A;  1N5Z A;  1NYF A;  2K3B A;  1PKT A;  1ZSG A;  2C0O A;  2EYW A;  1H8K A;  2AKL A;  1JEG A;  5IHN A;  2VVK A;  2CSQ A;  3EGU A;  2O88 A;  4Z88 A;  2MCN A;  3RNJ A;  2IIM A;  1CKA A;  1MV0 B;  1FYN A;  2JMA A;  1PNJ A;  2EBP A;  1QWF A;  3I9Q A;  4ORZ A;  2AK5 A;  3EG2 A;  1CKB A;  3TVT A;  2J06 A;  4GBQ A;  2BTT A;  1UE9 A;  2LJ3 A;  3ZL7 C;  3TSZ A;  2CH4 W;  2HBW A;  5FWC A;  4LE9 A;  1GCQ C;  2NWM A;  2EGA A;  1NG2 A;  1WLP B;  3SEM A;  1Y57 A;  2JTE A;  2K2M A;  4J9D A;  2ED0 A;  2FPD A;  2JS2 A;  2A36 A;  2KBT A;  2JMC A;  2L2P A;  3A98 A;  2DL3 A;  4F17 A;  2KRM A;  1AD5 A;  5I22 A;  2CT4 A;  1ARK A;  1V1C A;  1W70 A;  3REB B;  1B3Q A;  1ZUK A;  1UJ0 A;  4OMN A;  1KIK A;  2C0I A;  2F2X A;  2D8H A;  2J6F A;  1BK2 A;  4OMM A;  1GL5 A;  2KRN A;  1WXT A;  3KFV A;  2OJ2 A;  1UJY A;  1X2Q A;  2HSP A;  5GJW B;  2X3W D;  2X3X D;  2LJ0 A;  1YN8 A;  1H92 A;  1QCF A;  4IIO A;  4JZ4 A;  2K9G A;  2EYY A;  5I11 A;  2BZY A;  1SSH A;  2ABL A;  3PVQ A;  1K0X A;  1UUE A;  4Y92 A;  2NUZ A;  4RTX A;  4J9H A;  1OPK A;  4FSS A;  1PKS A;  4JJC A;  1ZUY A;  1X43 A;  3VRY A;  1E6H A;  4J9C A;  2ESW A;  2GGR A;  2DNU A;  2YDL A;  3GBQ A;  3LH5 A;  3FJ5 A;  1UFF A;  3M0T A;  1IO6 A;  3VS4 A;  1G83 A;  2GTJ A;  2FPF A;  4CC7 A;  3H41 A;  3IQL A;  5IXB A;  1W6X A;  2W0Z A;  5IHI A;  2PNI A;  2KXC A;  3NHN A;  2RN8 A;  3UA6 A;  1AVZ C;  4AG2 C;  1AWO A;  2H8H A;  1GFC A;  2AZS A;  4E6R A;  3PVL A;  1I1J A;  1AWW A;  1SRL A;  4J9G A;  4A63 B;  2I0N A;  1NYG A;  1KJW A;  3VS2 A;  1UTI A;  2LJ1 A;  1WA7 A;  2C0T A;  1UEC A;  2RQW A;  3QWX X;  2LP5 A;  1FMK A;  2EYZ A;  1EFN A;  1ZX6 A;  1ABO A;  2F2W A;  1UGV A;  2OAW A;  2YUO A;  3I5R A;  2K6D A;  3UAT A;  3RBB B;  1G2B A;  2AKK A;  2DL5 A;  2J7I A;  2JS0 A;  1YNZ A;  1UHC A;  1T0H A;  2MOX A;  2BZX A;  3EG0 A;  1TUC A;  2AZV A;  3I5S A;  2YUP A;  1YWO A;  3VS1 A;  2EYX A;  1U5S A;  1T3S A;  3O5Z A;  1YCS B;  1ZUU A;  3H0I A;  2DLP A;  2LQN A;  2O9S A;  1GFD A;  5IXF A;  1B07 A;  1I07 A;  2KT1 A;  2DL4 A;  2ED1 A;  2FG0 A;  2LCS A;  1VYU A;  2SRC A;  1SEM A;  3I35 A;  2LNH B;  1SHG A;  2GTO A;  1VA7 A;  3C0C A;  1M8M A;  3EHQ A;  3NMZ C;  2J05 A;  1JXO A;  1AWJ A;  2QDL A;  1AZG B;  4JPB W;  1WFW A;  1J3T A;  1E6G A;  3M0U A;  1WYX A;  2GQI A;  1OEB A;  1ZLM A;  1RLQ C;  3ULR B;  2RMO A;  1X6G A;  2RQR A;  1HSQ A;  2PTK A;  2FEI A;  4M4Z A;  4OML A;  2DBM A;  2DMO A;  2EGE A;  4RTT A;  4J9F A;  2GNC A;  2VKN A;  2DRM A;  2L3S A;  1UG1 A;  1WXB A;  4JJD A;  2K79 A;  1K0S A;  2LQW A;  4F16 A;  1PRL C;  2D8J A;  2ROL A;  1X69 A;  2RQT A;  2D0N A;  2M0Y A;  1QLY A;  4LUE A;  3UA7 A;  4CC4 B;  1NLO C;  2MIO A;  2J6K A;  1M3C A;  2RPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...