4OMOA

Crystal structure of the c-src tyrosine kinase sh3 domain mutant q128e
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGETGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 13
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4omoA00
2A08A 1K1ZA 2HCKA 2JM8A 4F14A 5FW9A 1X43A 4HVWA 5IXFA 3VS0A 4CC2A 1HSQA 2K6DA 2O9SA 2KBTA 1T0HA 2J6OA 1T3SA 2KYBA 2I0NA 1M3CA 1X2KA 4FSSA 5GJVB 1M27C 2EKHA 1WX6A 2EBPA 2AZVA 1BB9A 3M0TA 2X3WD 1MV0B 2KRSA 1K76A 4GLMA 3I5SA 2FPEA 2CUDA 3NPFA 4J9HA 4J9GA 3QWYA 1AEYA 2GQIA 1GBRA 4OMPA 2HSPA 2M0YA 2DYBA 2FEIA 4HVUA 2KT1A 2RF0A 2JMCA 2LJ0A 2DE0X 3NHNA 2DBMA 3QWXX 2EPDA 2RMOA 4RTTA 2YUQA 1QWEA 2YT6A 2DL8A 2ROLA 2CH4W 1GCPA 2EGAA 3I5RA 4F16A 1ZBJA 1UJYA 1WI7A 2D8JA 3JV3A 2LCSA 1MV3A 4J9BA 1AWXA 1JEGA 3VRYA 4AFQC 4GBQA 1YCSB 3M0RA 2DRKA 3H0HA 4ORZA 1PHTA 2ED0A 2RQWA 4OMLA 2W0ZA 1AWJA 2JMAA 2KYMA 1NYGA 2J7IA 3EHQA 4RTXA 2RN8A 5HCKA 4HVVA 1ARKA 3VS7A 2BZXA 2A36A 2D1XA 2CREA 3TVTA 2JM9A 4DEYA 2P4RA 4JJCA 4JJDA 1RUWA 1HJDA 2EW3A 5GJWB 3VS5A 1I1JA 1U06A 2EVRA 2FO0A 1UDLA 4RTVA 2LMJA 3UF4A 2KT8A 1NLPC 1ZUKA 1K9AA 3ZL7C 3M0PA 1M8MA 2EYYA 3EG3A 2JXBA 1AWOA 4A63B 5I22A 2DM1A 4ZNXA 1BK2A 1GCQA 4Z88A 2ED1A 5IXBA 4D8DA 2DRMA 3KFVA 1AWWA 2KRMA 3FJ5A 3M0SA 2DBKA 2LNHB 3EG2A 4LN2A 1JO8A 1G83A 1WXUA 1AD5A 1WDXA 1WYXA 1UFFA 2L2PA 3LH5A 4OMNA 1UTIA 2GGRA 2CT3A 2SEMA 2PZ1A 1E6GA 3UA6A 3H41A 1SRLA 5FWCA 4LNPA 2VVKA 1AVZC 1AZEA 3RNJA 1S1NA 2KGTA 2DILA 5IHKA 2MCNA 1G2BA 4E6RA 2BZ8A 1MUZA 2DA9A 2J6FA 2KEAA 2KROA 2G6FX 2YSQA 2CUBA 2V1QA 2AZSA 2RQVA 2VWFA 3PVLA 1TG0A 1XOVA 1WXTA 2C0TA 2LP5A 4HCKA 1Z9QA 2A37A 2LZ6B 2ENMA 2J05A 2KE9A 1Y57A 4IIOA 3CQTA 1SHGA 1NEBA 3UATA 1UE9A 4LE9A 1B07A 1YWPA 2L0AA 3UA7A 1JU5C 2LQNA 2RQTA 3VS6A 4WCIA 2EQIA 1WIEA 3C0CA 4J9CA 2DLPA 1H92A 2DVJA 4F17A 2KR3A 2GTJA 4RTUA 3R6NA 4JJBA 1YWOA 2FRWA 2YUOA 1I07A 3SEMA 4AFSC 1YNZA 2DL4A 2FPFA 3VRZA 4RTYA 4HXJA 1VYUA 1PRMC 2F2VA 1X6GA 4ESRA 3EG0A 5FWBA 1VYTA 1HD3A 3IQLA 1J3TA 1M3AA 2SRCA 4KRTA 2K3BA 2V1RA 3EGUA 1NM7A 1QCFA 1WLPB 2MIOA 1W6XA 1X27A 2JT4A 5I11A 1TUDA 3EG1A 3REAB 3REBB 2O88A 4D8KA 2O9VA 1KSWA 1YN8A 1Z9ZA 1WA7A 2LJ3A 3NGPA 2L3PA 1K0SA 2DNUA 3SHWA 1E6HA 3A98A 1PKSA 4Z89A 1FYNA 2D8HA 1NG2A 2KRNA 1ZX6A 2B86A 2MOXA 1V1CA 3EHRA 4J9IA 2RNAA 2YUPA 2W10A 2A28A 1UECA 1X2QA 1K4US 2NWMA 2EYZA 2KXDA 2YUNA 1E7OA 2RPNA 1BBZA 1GCQC 3VS2A 4M4ZA 1SPKA 2BZYA 1WXBA 5IHNA 1QLYA 1TUCA 2EGEA 2JS0A 1ABQA 2L3SA 1JXMA 2IIMA 1CSKA 2EGCA 1OV3A 2C0OA 2AKKA 3NMZC 2PTKA 5IHIA 2CH4A 2K9GA 2JW4A 1JQQA 1U3OA 2E5KA 2YDLA 2H8HA 3GBQA 4AG2C 2XMFA 2ABLA 1JXOA 2PNIA 3THKA 2EYXA 4RUGA 4RTWA 2O2OA 3M0QA 4LUDA 2LX7A 2JS2A 3I9QA 2K79A 1GFCA 2HEQA 4AFUC 1UHFA 2GNCA 2M51A 1GFDA 2O31A 3PVQA 1OEBA 1ZLMA 1PKTA 1WFWA 1BU1A 1LCKA 1ZUUA 2DL3A 1GL5A 1PWTA 4JZ4A 1UUEA 2LJ1A 2QDLA 1NYFA 4RTZA 1FMKA 4J9DA 2OJ2A 2DL7A 2FPDA 4CC4B 1KJWA 2ECZA 4JPBW 4IIMA 1QWFA 3O5ZA 1Y0MA 2DF6A 2AK5A 1K0XA 1T0JA 4LUEA 1EFNA 1SRMA 1RLPC 1H8KA 2CSQA 4AFZC 1SSHA 4EIKA 2DX1A 1CKAA 2FG0A 4Y92A 2F2XA 3H0FA 2F2WA 2EYWA 1ABOA 1PNJA 2C0IA 2FRYA 2KXCA 1YP5A 3VS4A 1OPKA 1AZGB 1RLQC 5ECAA 2ROTA 3TSZA 3PE0A 4JZ3A 3TSWA 2DMOA 1KIKA 2NUZA 2K2MA 4J9EA 1U5SA 1H3HA 1OPLA 4OMMA 1RI9A 1QKXA 4CC7A 2DL5A 5EC7A 4Z8AA 3M0UA 2GBQA 4J9FA 2CDTA 1NEGA 2BTTA 1VA7A 2K7AA 1M30A 4K11A 3RBBB 4AG1C 1UHCA 1B3QA 2JTEA 2KNBB 1UJ0A 5L23A 2L3QA 2HDAA 2X3XD 1I0CA 1M3BA 2CT4A 2OAWA 2GTOA 2J6KA 2LQWA 2OI3A 4CC3A 4R0KA 2RQRA 1AOJA 1PRLC 1VYVA 1GBQA 1UGVA 4OMQA 3U23A 1X6BA 1X69A 2CSIA 2DJQA 1SHFA 1SEMA 3VS1A 3VS3A 1KFZA 1N5ZA 3H0IA 1NLOC 2HBWA 1A0NB 3ULRB 2J06A 4QT7A 5IH2A 2RQUA 1ZSGA 1W1FA 2D0NA 1QKWA 1GRIA 1UG1A 1CKBA 2VKNA 4OMOA 3I35A 1ZUYA 1W70A 2AKLA 4X1VA 4DEXA 2ESWA 1OOTA 1IO6A 1T3LA
chains in the Genus database with same CATH superfamily
5FW9A 2MWPA 4XAXB 5IXFA 5LJ5j 3VS0A 2WSEE 4CC2A 4PKCC 2XDBA 2V26A 3GLXA 1M2VA 2D6FA 2Z0WA 3JCMW 2I0NA 4M78D 1X2KA 3OBWA 3OYEA 2O4XB 2EYQA 1OX8A 1M27C 2ZPBB 3M0TA 3WXMB 5GANd 2NUTA 3EGXA 1MV0B 2DJZA 1K76A 5KE3A 1V76A 2CUDA 3NPFA 3QWYA 8ATCB 1AEYA 5GANf 1U1SA 1GBRA 2RHIA 4IUUA 4BD3A 3MJXA 2HQXA 1NJIU 4HVUA 4MZPA 2DE0X 3QWXX 2RMOA 4PJOG 2M9UA 4RTTA 2DIGA 1GCPA 3RERA 1NJIC 4KT0E 3JCMe 3I5RA 2COWA 1ZHIA 1IRXA 3QJ6A 2AHJB 4E7SA 2DVEA 2QQBA 2KY9A 1AWXA 1HK9A 1Q86R 1YCSB 4C92E 4M7AE 2DRKA 3EFRA 4M78C 1PHTA 2L3RA 3EGXB 4OMLA 2W0ZA 3M56A 5GAOq 2H3JA 1M1FA 3OYBA 1NYGA 2YXYA 5LJ5h 3CD6A 5I21A 2J7IA 2RN8A 3EFSA 3QZ9B 5HCKA 5D6YA 2DETA 3VS7A 2BZXA 2A36A 2X9HA 4II1A 2QQ9A 1LNXA 2DKGA 4DEYA 1OU9A 1YI2Q 1YHQA 2G3RA 2QI2A 3MO8A 3J80E 1ZA2B 4JLIA 1RUWA 3CPFA 2KMTA 4J6YA 1KHIA 2EW3A 2WSCE 3VS5A 2KT8A 3CCSA 1VQNA 2V8IA 4XU3A 2HBPA 1AWOA 5I22A 2DM1A 4DOWA 3C12A 4OB1B 3E9FA 5IXBA 2XG8D 2QEXT 1KQ2A 5C0MA 3CMEA 2L5QA 2MAMA 2DBKA 3JAME 1YJ9T 1WDXA 4IUQA 3V8KA 2CT3A 2PZ1A 4CRIA 3CBPA 1D0XA 1SRLA 2Y4YA 3V8JA 4FCYA 3SB2A 2M16A 4OB2B 3RNJA 1H641 4M78G 3CCJA 2J6FA 2K5FA 2FVUA 3M4GA 4Y91A 2KROA 2G6FX 3PVLA 2VWFA 2RQVA 2HKQB 1Z9QA 3LWIA 4X9CA 1VQOQ 4XTYA 1I81A 1QP2A 2ENMA 2J05A 2DK3A 3CQTA 1SHGA 1YCYA 3G1JA 3UA7A 1TWBA 3CMEQ 2RHZA 2DO3A 1X6OA 2RK2A 2RQTA 4WCIA 2IVWA 1WIEA 3C0CA 3JRZA 2DLPA 2KR3A 1UGSB 1D1AA 1YWOA 1I07A 4J5YA 2DD4A 2RH2A 2DL4A 2FPFA 3VRZA 4M77A 3SWNC 1RAFB 4RTYA 1MHNA 4E7LA 2KDSA 1OZ2A 1OX9A 2X35A 3CMAA 1SSFA 1X6GA 3OYAA 3QSUA 1VQ4A 3NFCA 2FZCB 1ACMB 1MGQA 1VYTA 1D0ZA 1JBMA 4KRTA 3PTAA 3E9GA 1NM7A 1Y96A 2EQKA 2EIFA 1K73C 1QCFA 3JCMb 2DD5A 5I2MA 1TUDA 3EG1A 3REAB 1FWZA 3REBB 3EG9B 2O88A 2JJ9A 3CCMT 1KSWA 1TOVA 3BE3A 2QGGA 2LJ3A 1X75C 2QQRA 5FLXE 1K0SA 3I56T 2DNUA 4F04B 1FYNA 1VQ8Q 2V8JA 1ZX6A 2B86A 3EHRA 2RB6A 1WHGA 4C5HA 2RNAA 2XDPA 3JB9G 1X2QA 2NWMA 2QK0A 2HQHA 1YJNT 3G6EQ 1GCQC 4M78E 1FMVA 5IHNA 3OBYA 1QLYA 1RI0A 1ABQA 2E6ZA 2L3SA 5FRNA 2DFUA 1JXMA 3M57A 3DLMA 2VGNA 3NMZC 1BKBA 5HKCA 1NZ9A 2K9GA 2JW4A 3QKJA 2EJ9A 5KCOA 3LW5E 2OTJQ 3THKA 1Q86U 1Y96B 1SKUB 3H8ZA 1PD1A 4RTWA 2OTLA 2O2OA 4LUDA 3G4SA 5DLQE 1YI2T 4LDUA 1N8RR 4PFOA 2F69A 2M51A 5L8RE 2JVVA 1LJOA 1OEBA 1RL2A 1ZLMA 3BW1A 1WQ7A 1WFWA 1BU1A 2CP7A 3CCQT 3RMSA 2LJ1A 3RDVA 1NYFA 2EFIA 2YRDA 3JB9I 1SG5A 1EZZB 3DLLA 4IUPA 4E7HA 3O5ZA 1G3WA 2GQVA 1D1BA 5IN1A 3OYJA 2JUFA 4O6JA 2CZ6B 3RUXA 1VQLA 2OX7A 4OF1A 3MHXA 3GOXA 3HPWA 4VUBA 3OYKA 1CKAA 4FIBA 3A1PA 2FG0A 1VQNQ 2F2WA 2E10A 1KQSA 2ZPGB 1D1CA 3PMIA 1MNEA 4ME7A 2RJFA 2BIVA 2E5QA 2FRYA 2HL3A 4M7AB 4C5EA 1OPKA 2KI7A 5D6XA 2FB7A 1N8RC 3CC2A 5HY6A 1V29B 1QCNA 7AT1B 2XD0A 2K2MA 3LWHA 1U5SA 3G4ST 1TXQA 3ZBDA 1OPLA 1K9MU 2NUPA 8AT1B 2OTLT 1QKXA 4MMKA 3ER0A 4J9FA 2GBQA 3BFMA 2BE7D 1WHKA 1BI2A 5CKFA 5FROA 2K7AA 3QUIA 1QVFS 1YIJQ 3RBBB 1UHCA 4HCZA 2JTEA 2KNBB 1VQPQ 4BY6C 2RD1A 1M3BA 1W4SA 2CT4A 2QEXQ 2GTOA 3JCMh 5GMKl 4EMKA 2E1HA 2LQWA 3TREA 4CC3A 1AOJA 3OS1A 4BDYA 1SHFA 5CQYA 1N5ZA 1NLOC 2YRVA 3V8LA 5GMKe 4XTZA 2HBWA 3QO3A 1AHJB 4QT7A 3HHTB 3OMGA 1M5Q1 1UG1A 4Q5WA 2VUBA 2PVDB 4OMOA 4B6MA 2AKLA 3V7CA 1M1GA 3ASKA 3L42A 2ESWA 3LGLA 1IO6A 3CC4Q 1K1ZA 4F14A 3CCLT 5CKHA 3CC4A 1I4K1 2OAUA 4HVWA 4C0FA 4J7IA 4PJOD 2K6DA 4JUVA 2KBTA 3C95A 3VKIA 1FXXA 4RMOA 3A5ZB 3QHSA 2KYBA 5FU6C 3CBMA 1M3CA 5AT1B 3FB9A 5GJVB 1VQ6T 2EQUA 1WX6A 2EBPA 2AZVA 3CCRQ 2K4YA 3OYMA 4KH1B 3AT1B 4J9HA 4J9GA 2X4YA 2GQIA 3HFNA 3MEWA 4OMPA 2HSPA 4M77C 4C92D 2DYBA 3KBGA 2PU9B 2AIRB 4N0AC 2FL7A 2LJ0A 2DBMA 2EPDA 3JCMf 4M77B 1QWEA 2BKDN 3CXCA 3X24B 4GY5A 4PJJA 4RCBA 2NUTB 3O8VA 3SD4A 2D8JA 4DBQA 4C0DC 2A7YA 1MV3A 3CMET 4J9BA 2QXFA 2XIDA 4B9XA 3VRYA 4AFQC 2YHTA 2RHUA 5A0DA 2LTOA 2KK4A 4BI8B 3QIIA 2ED0A 2RQWA 3OYHA 3CC7T 1AWJA 4JRQA 2JMAA 3JCMc 1VQ6A 1Q86C 4M75F 2MI6A 5GAMd 3EHQA 1IXDA 1VQNT 4ZN3A 1ARKA 4M7AF 2RJDA 2D1XA 3CCVQ 1JRIA 1VQLQ 4JJCA 4JJDA 1LOJA 1VIEA 3CCLA 2H3EB 4J83A 3HSBA 1HJDA 4LDYA 2DEUA 1I1JA 1U06A 2EQJA 2FO0A 2LT4A 2XK0A 4PLIA 3OS0A 4RTVA 3CCMQ 3UF4A 4NOYA 1EIFA 4KULA 2B8AA 3ZL7C 3M0PA 4ZGDB 4XTXA 1M8MA 1GXIE 3OY9A 4E47A 2DXBA 3CCSQ 3CMAQ 4A63B 4M77G 1QP3A 2RO0A 3EGDA 2ED1A 5GAOm 5DY9A 3META 3M0SA 2LNHB 4ZGEB 5FU7C 1WYXA 1MNDA 3CXCP 3PIOA 3LH5A 2CZ7B 3Q1JA 1M2OA 1UGRB 3S3NA 4M7DB 1JJ2P 5FWCA 3H9NA 3JB9D 1RAEB 1FMWA 4IURA 2OTLQ 2MCNA 1R8OB 1ZBXA 1M4ZA 4E6RA 3EFOB 4ZGJB 2V1QA 2AZSA 3JB9H 4JS4A 2C0TA 2LP5A 2QGFB 4FYXB 5GAOl 1VQ9Q 1FX7A 4R56A 2EWNA 2PVGB 5HK0A 2BE9B 4NL3A 3CCQQ 4IIOA 2EAYA 3MEAA 2VGMA 1VQOA 3UATA 3CC2T 1UE9A 4LE9A 3PFSA 1YWPA 2L0AA 5LJ5e 1JU5C 5LJ5d 1WPYA 5CCAA 4A4FA 1H92A 4AMCA 2QQAA 2GTJA 4RTUA 3R6NA 4JJBA 1M90C 4E7IA 3CD6Q 3SEMA 4L6V5 4AFSC 1XTDA 4HXJA 4ZN1A 3CCRT 2MWOA 1F1BB 3JCMQ 3CCUT 2VXFA 2F2VA 4M7AC 1TTHB 5GAMh 1HD3A 3VJPA 1M3AA 2SRCA 2GFAA 3CCUA 3OYGA 1WLPB 1Q7YR 3CCRA 2ZCFB 1Q82R 2JT4A 3OS5A 4FYYB 2OTJA 2JNGA 4D8KA 1D3BA 3URGA 3CPWS 2HL5C 2R58A 1YI2A 1YN8A 3JSCA 1PKSA 4Z89A 2D8HA 2KRNA 1M2VB 1V1CA 3I55Q 4KGZB 3DB4A 2YUPA 2W10A 1VQ9A 1KHCA 2FZKB 3QXEB 1LVKA 4HT8A 2PUOB 1E7OA 3M4YA 1I5OB 1KG1A 4M4ZA 3OYNA 1Q81R 2COYA 3FLGA 2EGEA 3CCEQ 2LDMA 1CSKA 4J6WA 1QVGP 1N6AA 1KC8R 2PTKA 4TVRA 3UWNA 3EG9A 1VQ8T 2CP5A 1JQQA 4MZMA 2H8HA 2CZ1B 2ZPHB 3GBQA 4B9WA 2ABLA 1G3SA 1JXOA 4A4GA 4NL2A 4JRKA 3M0QA 3QYHB 2RI5A 3G6ET 2K79A 2HEQA 1UHFA 1QVGS 2GNCA 1PG5B 2O31A 3S6WA 2M02A 2MK5A 3J7AF 2CGHA 3HRUA 2LCCA 1TUGB 4PFPA 3C94A 1VQ5A 1D3BB 2DL3A 1WGSA 3L2VA 1GL5A 1PWTA 1VQKT 4RTZA 2DL7A 5GAN5 3HKSA 4CC4B 4OB3B 4IIMA 4MDWA 3UT1A 1Y0MA 3CMAT 4LUEA 3A8OB 1BCMA 3FEOA 3OYIA 2EKOA 3HP9A 2E3IA 4EIKA 2DX1A 1D09B 3FJPA 4Y92A 1C1AA 2I2LA 2DIQA 2F2XA 2EYWA 4F7UE 5GAN8 2JOYA 4M75G 1W2BP 3E19A 2C0IA 3VS4A 4ELZC 4M7DF 2CP2A 3TSZA 3PE0A 4JZ3A 3CCEA 2XU8A 1Q82C 4J9EA 4FYVB 4C8QE 4OMMA 1TU0B 3M54A 1RI9A 4CC7A 2DZCA 3M0UA 3LGFA 3PIPA 4C92A 3CCJT 5LJ3g 2QA4Q 2BTTA 1VA7A 4K11A 3P8DA 1Y71A 4D6WA 5LJ3e 3QDFA 3KXTA 4MZTA 4BE0A 1KQ1A 5GANj 4DQ2A 1S72A 2P0QA 2WSFE 4DBRA 1YJ9A 2CKKA 2CP0A 4Y28E 1IB8A 4R0KA 4OMQA 1UGVA 1X6BA 2CSIA 1SEMA 4PJOA 5GAMf 3HFOA 1G8XA 4ZTFA 1A0NB 5IH2A 1KD1R 1GRIA 1CKBA 2FYKA 2ZZDA 1R0CB 1G3TA 4IUTA 3HRSA 3CCVA 1QVPA 1IHVA 5GAMe 1ZUYA 3KUFA 4X1VA 2GFUA 3EH1A 1VIFA 1BIBA 2P0KA 1OOTA 3QZ5B 3RR6A 2JM8A 4M75C 3RIRA 4BUGA 4JDSA 5FU6B 1UEBA 2XDDA 2HAXA 2LT1A 1T0HA 1RAAB 3OA6A 2J6OA 2QDYB 2E70A 4EMHA 2E6NA 1N9RA 1VQMT 3CD6T 2LNVA 3OYCA 4C8QG 3CC4T 5GANe 3CCLQ 1TH7A 2EKHA 5IAYA 3L2WA 1BB9A 2D0QB 4JRPA 2X3WD 4F7UB 1YBYA 4GLMA 3I5SA 2FPEA 1VQKA 1H3ZA 3JCMP 3TU4K 1VQ5T 2M0YA 3MEVA 4J8OA 3L2ZA 5LJ3f 3OYLA 2KT1A 2RF0A 5GAN2 3NHNA 2L89A 3HL8A 3G6EA 2YT6A 2DL8A 2ROLA 3SFMA 1K8AC 4F7UG 4BE1A 4F16A 2ZAEA 1UJYA 1WI7A 4QQGA 2LCSA 3A8LB 4C92B 5KE2A 3MP6A 1OI1A 3A8HB 4YTLA 4KUIA 1Y07A 3H0HA 4ORZA 1WQWA 4M7DG 3P8HA 1KQSS 4PJOF 3NTHA 2R5MA 1VQ9T 1ZQ1A 4RTXA 3CCUQ 2NYSA 4QKUA 4C5GA 3BY7A 2HD0A 3GF5A 2CREA 5GAN7 3TVTA 2JM9A 4PJOB 1B7TA 4PJOE 2NLUA 5KYYA 2P4RA 4RG2A 4C8QC 4AT1B 4XTWA 1UDLA 2EQMA 1VQKQ 4PNOA 2RI3A 6AT1B 4C8QF 1NLPC 5GAOr 2MF2A 4FW2A 4OGCA 4A4HA 3I56Q 2LVMA 2EYYA 3CPWP 3EG3A 2JXBA 4M77F 4BB7A 1M1KU 5KYWA 1GCQA 1YJWA 4Z88A 2HMAA 2RA2A 3CCQA 3TCJA 4FM4B 5CKDA 2KRMA 3ZEHA 1KC8U 3EG2A 4LN2A 4PJMA 3J81E 1JO8A 1G83A 1WXUA 2O4XA 1AD5A 3OS2A 2D9TA 2L2PA 4E7KA 1VQOT 2COZA 3AHUA 1UTIA 4HCBA 2SEMA 4RKUE 3H41A 3QYGB 4V2SA 4E7ZA 5KYXA 4RG8A 5J39A 1NPRA 1AZEA 2DERA 4BDZA 1IGQA 4M75D 1M90U 2KGTA 2DILA 5IHKA 1G2BA 4F7UA 1KQSP 3EGDB 1K9MR 1X01A 4QVCA 1TG0A 4KBMB 2A37A 4E7JA 2HQEA 1C0MA 2LZ6B 2QYZA 3JCMV 2HZYA 3RESA 1QMCA 1R0BG 1Y57A 2K57A 1WHHA 4OP0A 1YJNA 3D7SB 1P92A 1B07A 4M7DE 3VV0A 4ZTJA 3ZFJA 3OW2P 1BI3A 1IZ6A 4EMKB 5HK3A 2RM4A 4HKEA 3I56A 4F17A 1KD1C 2YUOA 4PJNA 3CCMA 1JB0E 5GAN6 2CYZB 3LH0A 3BDUA 4XQ3A 4HCCA 4OMFB 3EG0A 2XKOC 3MPUB 1D0YA 1RADB 3IQLA 1J3TA 4FT2A 2KVQG 2K3BA 3EGUA 2MIOA 5IT9E 1QVGA 1X27A 1YJNQ 4C0GA 2JN0A 2DYIA 4X9DA 1WA7A 3NGPA 3R6OA 3SHWA 3A98A 1OQKA 1SF9A 2QA4A 2VXEA 4J9IA 2KQWA 1BI0A 1JJ2A 3LLRA 4FU6A 4FYWB 5CKBA 3DB3A 5M9OA 1DJ7B 4EDUA 2KXDA 1XJWB 3CC7A 4A4KA 3VU3C 1SPKA 2JS0A 1G3YA 3UPUA 2C0OA 2HNIA 4F7UF 2AKKA 2R5AA 4CI0C 5IHIA 2CH4A 1BYMA 3JCMg 2R57A 2E5KA 2YDLA 1NBEB 2K3YA 4AG2C 5GAMj 4RUGA 5GANh 1UB4A 4M78F 4BE2A 1PCXA 2LX7A 3QDRB 2A0FB 2F5KA 4M7DD 5EG2A 1IREB 4DBHA 5A0GA 5FU7B 3OMCA 1I8FA 5GAOn 2DTHA 1PKTA 5GMKh 4BACA 5KYUA 1VQ7A 4A4EA 4XTVA 5CKEA 2QEXA 5GAOp 1UGPB 4JZ4A 1MMDA 1FMKA 4J9DA 1HYOA 2E4HA 1O75A 1KJWA 3G71Q 4DOVA 2DF6A 2AK5A 3LX7A 3INZA 1T0JA 1WHLA 3P8BB 1MMNA 5GMKi 2Y90A 1EFNA 2M1HA 3L1AA 1H8KA 2CSQA 1QVFP 3EFOA 1SSHA 3HTRA 2MPXC 3SWNB 3H0FA 1ABOA 5A2QE 3QPHA 2QQSA 1PNJA 3A8MB 2KXCA 1VQ7T 3N5BB 1YP5A 2QG9B 5D7UA 1RLQC 4ELYC 3S3MA 5AYFA 5ECAA 3RMQA 1YHQT 1VQ5Q 3TSWA 4LDXA 4C8QD 1KIKA 5CK9A 2NUZA 1C6VX 4BI4A 1Q81U 1OZ3A 2RHXA 5KCHA 5KYXB 1BCOA 1H3HA 2Y4XA 1VQ6Q 5LJ3h 5GANg 2DL5A 5EC7A 1M8VA 1KK7A 3S3OA 2CDTA 1NEGA 2X4WA 1VUBA 3MKDA 4P5NA 1NJIR 1OULA 5D6WA 2RJEA 1K73R 1M30A 1NE8A 3OYYA 1B3QA 5LJ3j 4C0DB 5L23A 1UGQB 3MP8A 4N4IA 4JJNK 3SDZA 1MMAA 1M90R 2K5LA 1YFNA 2CS7A 4FL6A 4M78A 1M9SA 3X26B 2XI9A 4OGEA 4XTUA 2QA4T 2RQRA 2DTIA 2DJQA 1EX4A 3VS1A 3VS3A 2LQKA 1TSFA 2RQUA 1W1FA 2D0NA 2C06A 2YLCA 2A3LA 3CXCS 2YRCA 3I35A 2MMPA 3CC7Q 3EAEA 2HKNA 4PLLA 4E2FB 4A54A 2ZGWA 2A08A 5A0LA 3L2QA 2HCKA 1X43A 2DTOA 1N8RU 1HSQA 1OYXA 2LC4A 2XICA 3FRNA 2MYSA 1OU8A 4A53A 4ANJA 2O9SA 3GP8A 1KD1U 2VB6A 2F1LA 3OYDA 1RACB 1RABB 2FZGB 5CQXA 3NTIA 2O01E 1M1KR 2CP3A 3OW2S 1T3SA 3X20B 1VQLT 2IPOB 5LJ5f 5KYUB 4FSSA 3G4SQ 4KH0B 4HA8A 1O9SA 4DBFA 2K2VA 2PQWA 2KRSA 4BI3A 4C5IA 2DPPB 4J6XA 4NS5A 1RAGB 2E64A 1YIJT 2BUDA 4N4GA 3C4SA 4PFZA 4N4HA 3FC3A 2KAFA 2DXCA 4M7AA 2FEIA 4XU2A 2QTVA 4LDVA 1ZA1B 2JMCA 2E12A 2CZ0B 2YUQA 1B34B 2CH4W 2EGAA 4FW1A 3GNGA 1ZBJA 4X34A 4GLKA 4UC4A 2EJFA 2LQ8A 1WZOA 5FRMA 2IG0A 3JV3A 4BY6B 1S72Q 1JEGA 1YIJA 4GBQA 2AT1B 3M0RA 1IGUA 4KGXB 2DEQA 2F5TX 4EMKC 3MP1A 3M5AA 2KYMA 3QBYA 5LL6S 3V7RA 3PGGA 4M78B 1YITA 1G5VA 2QAZA 3SWNA 1YJWQ 2PUKB 4HVVA 4O5VA 3OSVA 2P0PA 3E2UA 2JTFA 2YWWA 4M7AD 4Z02A 2E3HA 1N27A 3GIBA 4QQ6A 5GJWB 2EVRA 1B34A 1R77A 2LMJA 2LRQA 1VQ4T 1ZUKA 3CPWA 1K9MC 1K9AA 3H6ZA 4EMGA 5KYNA 5GAMg 1W2BS 3NTKA 2LCLA 4ZNXA 3M59A 4XU0A 1BK2A 1N9SA 5I2SA 1K73U 3JB9J 4D8DA 3QJYA 2DRMA 3KFVA 1AWWA 5J3BA 2ZPFB 2XHCA 5LJ5g 4FT4A 4C92G 2HSEB 3FJ5A 3G7ZA 2L8DA 1PSFA 4R55A 4QVDA 2GF7A 3JCMJ 1UFFA 4LDWA 1QCOA 3FIFA 4OMNA 2GGRA 3X25B 5CR2A 1PSEA 1Q7YC 1E6GA 3UA6A 3JCMd 3M9QA 4LNPA 2VVKA 1AVZC 5C6SA 4WF2A 2DAQA 1S1NA 1YITQ 3I55A 2BZ8A 4QW2A 1MUZA 1U1TA 2FHDA 2DA9A 2KEAA 2VASA 2YSQA 2CUBA 1XOVA 1WXTA 4HCKA 4QQDA 5KYWB 2KE9A 1NEBA 1XQHA 3VUBA 4IUVA 2LQNA 1PM3A 3VS6A 1VQMA 2NUPB 2EQIA 4OB0B 3RKWA 4J9CA 2DVJA 4PK4A 5CIUA 1TS9A 1WHMA 2FRWA 3DKMA 3JB9F 1YNZA 1QW1A 1PC0A 3BDLA 1VYUA 1VQ7Q 4PJLA 3TQ7P 1PD0A 1PRMC 4ESRA 9ATCB 3JCMX 3CCST 5FWBA 5DLOA 2X4XA 1YHQQ 5CVIA 3G71T 4EPCA 3RKXA 3G71A 3OB9A 3CCVT 4JS5A 2RHYA 2V1RA 4C8QA 2WACA 3CEYA 1M1KC 1W6XA 3L2RA 5I11A 1MMGA 1K8AR 2O9VA 1Z9ZA 1WJQA 5KH6A 4FSXA 1WJRA 2L3PA 1WJSA 5GAN4 1AT1B 1E6HA 1ZSZC 2VYTA 1NG2A 2MOXA 4LD9K 2A28A 1UECA 1K4US 4HT9A 1QVFA 2EYZA 2YUNA 2RPNA 1S72T 1ZSZB 1BBZA 1XNIA 3VS2A 4L59A 1BI1A 5KYYB 2BZYA 1IHWA 1WXBA 5DM7R 2E41A 5CAIA 1TUCA 3WVEB 2IIMA 2EGCA 1OV3A 3M53A 3MEUA 2CP6A 1RAIB 2V8KA 3OSSC 1QQJA 1U3OA 3I55T 2GCXA 4M75E 2XMFA 2ZPEB 2PNIA 4M75B 2EYXA 4MDXA 3PMTA 1HXDA 3VYGA 4JRIA 3OW2A 2JS2A 4M77D 3I9QA 5GAN3 1GFCA 2VC8A 3RKYA 4M7DA 3T9NA 1K8AU 3PNWC 4AFUC 3CCET 3HRTA 1GFDA 2P4TA 1Q7YU 2EJGA 2JZ2A 3PVQA 2DXTA 3A8GB 1LCKA 1ZUUA 4KGVB 3M55A 1UUEA 2QDLA 1VQ4Q 1RAHB 1WHJA 2OJ2A 4C92F 3CC2Q 2FPDA 2P84A 2ECZA 4JPBW 1Q82U 1QWFA 4C92C 1K0XA 3QG1A 1Y7XA 3WVDB 4DA4A 1ZSZA 4M77E 1SRMA 1RLPC 2DZ9A 2QASA 1JJ2S 2RJCA 4AFZC 1NPPA 2LX9A 4C0ZA 1U8RA 2JTMA 2ZPIB 5CO7A 4M7DC 3VYHB 1Q81C 4OVAA 1AZGB 1W2BA 2ROTA 3ME9A 5J26A 3GNFB 4PL6A 2DMOA 4LD6A 1VQPT 2KSSA 3X28B 3EH2A 1VQMQ 2PVOB 1YITT 1Q95G 4Z8AA 3MCAB 2K3XA 3OQ5A 4XK8E 1VQ8A 1I5LA 3TEEA 2E65A 3M58A 2X51A 4AG1C 4QVZA 1UJ0A 3E1SA 2L3QA 2RI2A 2HDAA 2X3XD 3F70A 4N0AA 1I0CA 2OAWA 4MMLA 5LJ3d 3V7SA 2J6KA 2QTXA 3CBOA 3VUZA 4PJOC 3OYFA 2ATCB 5GMKm 1YJ9Q 5GMKj 2OI3A 4J7FA 1VOMA 3CCJQ 2K5IA 4M7AG 2VV5A 4RCCA 3FDRA 3U23A 1PRLC 1VYVA 1GBQA 1X69A 4JLGA 1YJWT 1KFZA 4L5GA 3H0IA 4ATOA 4WTOB 3PT9A 1LPLA 2M0OA 2X4JA 4XU1A 2DXUA 2OTJT 3LYIA 4LXCA 3ULRB 2J06A 3UDCA 4IKFA 1ZSGA 1WNLA 1QKWA 2RK1A 3GPLA 1BIAA 2VKNA 1KC8C 4M75A 2YLBA 3L2UA 4KUDK 1W70A 4DEXA 1VQPA 4C8QB 1T3LA
chains in the Genus database with same CATH topology
2A08A 1K1ZA 2HCKA 2JM8A 4F14A 5FW9A 1X43A 4HVWA 5IXFA 3VS0A 4CC2A 1HSQA 2K6DA 2O9SA 2KBTA 1T0HA 2J6OA 1T3SA 2KYBA 2I0NA 1M3CA 1X2KA 4FSSA 5GJVB 1M27C 2EKHA 1WX6A 2EBPA 2AZVA 1BB9A 3M0TA 2X3WD 1MV0B 2KRSA 1K76A 4GLMA 3I5SA 2FPEA 2CUDA 3NPFA 4J9HA 4J9GA 3QWYA 1AEYA 2GQIA 1GBRA 4OMPA 2HSPA 2M0YA 2DYBA 2FEIA 4HVUA 2KT1A 2RF0A 2JMCA 2LJ0A 2DE0X 3NHNA 2DBMA 3QWXX 2EPDA 2RMOA 4RTTA 2YUQA 1QWEA 2YT6A 2DL8A 2ROLA 2CH4W 1GCPA 2EGAA 3I5RA 4F16A 1ZBJA 1UJYA 1WI7A 2D8JA 3JV3A 2LCSA 1MV3A 4J9BA 1AWXA 1JEGA 3VRYA 4AFQC 4GBQA 1YCSB 3M0RA 2DRKA 3H0HA 4ORZA 1PHTA 2ED0A 2RQWA 4OMLA 2W0ZA 1AWJA 2JMAA 2KYMA 1NYGA 2J7IA 3EHQA 4RTXA 2RN8A 5HCKA 4HVVA 1ARKA 3VS7A 2BZXA 2A36A 2D1XA 2CREA 3TVTA 2JM9A 4DEYA 2P4RA 4JJCA 4JJDA 1RUWA 1HJDA 2EW3A 5GJWB 3VS5A 1I1JA 1U06A 2EVRA 2FO0A 1UDLA 4RTVA 2LMJA 3UF4A 2KT8A 1NLPC 1ZUKA 1K9AA 3ZL7C 3M0PA 1M8MA 2EYYA 3EG3A 2JXBA 1AWOA 4A63B 5I22A 2DM1A 4ZNXA 1BK2A 1GCQA 4Z88A 2ED1A 5IXBA 4D8DA 2DRMA 3KFVA 1AWWA 2KRMA 3FJ5A 3M0SA 2DBKA 2LNHB 3EG2A 4LN2A 1JO8A 1G83A 1WXUA 1AD5A 1WDXA 1WYXA 1UFFA 2L2PA 3LH5A 4OMNA 1UTIA 2GGRA 2CT3A 2SEMA 2PZ1A 1E6GA 3UA6A 3H41A 1SRLA 5FWCA 4LNPA 2VVKA 1AVZC 1AZEA 3RNJA 1S1NA 2KGTA 2DILA 5IHKA 2MCNA 1G2BA 4E6RA 2BZ8A 1MUZA 2DA9A 2J6FA 2KEAA 2KROA 2G6FX 2YSQA 2CUBA 2V1QA 2AZSA 2RQVA 2VWFA 3PVLA 1TG0A 1XOVA 1WXTA 2C0TA 2LP5A 4HCKA 1Z9QA 2A37A 2LZ6B 2ENMA 2J05A 2KE9A 1Y57A 4IIOA 3CQTA 1SHGA 1NEBA 3UATA 1UE9A 4LE9A 1B07A 1YWPA 2L0AA 3UA7A 1JU5C 2LQNA 2RQTA 3VS6A 4WCIA 2EQIA 1WIEA 3C0CA 4J9CA 2DLPA 1H92A 2DVJA 4F17A 2KR3A 2GTJA 4RTUA 3R6NA 4JJBA 1YWOA 2FRWA 2YUOA 1I07A 3SEMA 4AFSC 1YNZA 2DL4A 2FPFA 3VRZA 4RTYA 4HXJA 1VYUA 1PRMC 2F2VA 1X6GA 4ESRA 3EG0A 5FWBA 1VYTA 1HD3A 3IQLA 1J3TA 1M3AA 2SRCA 4KRTA 2K3BA 2V1RA 3EGUA 1NM7A 1QCFA 1WLPB 2MIOA 1W6XA 1X27A 2JT4A 5I11A 1TUDA 3EG1A 3REAB 3REBB 2O88A 4D8KA 2O9VA 1KSWA 1YN8A 1Z9ZA 1WA7A 2LJ3A 3NGPA 2L3PA 1K0SA 2DNUA 3SHWA 1E6HA 3A98A 1PKSA 4Z89A 1FYNA 2D8HA 1NG2A 2KRNA 1ZX6A 2B86A 2MOXA 1V1CA 3EHRA 4J9IA 2RNAA 2YUPA 2W10A 2A28A 1UECA 1X2QA 1K4US 2NWMA 2EYZA 2KXDA 2YUNA 1E7OA 2RPNA 1BBZA 1GCQC 3VS2A 4M4ZA 1SPKA 2BZYA 1WXBA 5IHNA 1QLYA 1TUCA 2EGEA 2JS0A 1ABQA 2L3SA 1JXMA 2IIMA 1CSKA 2EGCA 1OV3A 2C0OA 2AKKA 3NMZC 2PTKA 5IHIA 2CH4A 2K9GA 2JW4A 1JQQA 1U3OA 2E5KA 2YDLA 2H8HA 3GBQA 4AG2C 2XMFA 2ABLA 1JXOA 2PNIA 3THKA 2EYXA 4RUGA 4RTWA 2O2OA 3M0QA 4LUDA 2LX7A 2JS2A 3I9QA 2K79A 1GFCA 2HEQA 4AFUC 1UHFA 2GNCA 2M51A 1GFDA 2O31A 3PVQA 1OEBA 1ZLMA 1PKTA 1WFWA 1BU1A 1LCKA 1ZUUA 2DL3A 1GL5A 1PWTA 4JZ4A 1UUEA 2LJ1A 2QDLA 1NYFA 4RTZA 1FMKA 4J9DA 2OJ2A 2DL7A 2FPDA 4CC4B 1KJWA 2ECZA 4JPBW 4IIMA 1QWFA 3O5ZA 1Y0MA 2DF6A 2AK5A 1K0XA 1T0JA 4LUEA 1EFNA 1SRMA 1RLPC 1H8KA 2CSQA 4AFZC 1SSHA 4EIKA 2DX1A 1CKAA 2FG0A 4Y92A 2F2XA 3H0FA 2F2WA 2EYWA 1ABOA 1PNJA 2C0IA 2FRYA 2KXCA 1YP5A 3VS4A 1OPKA 1AZGB 1RLQC 5ECAA 2ROTA 3TSZA 3PE0A 4JZ3A 3TSWA 2DMOA 1KIKA 2NUZA 2K2MA 4J9EA 1U5SA 1H3HA 1OPLA 4OMMA 1RI9A 1QKXA 4CC7A 2DL5A 5EC7A 4Z8AA 3M0UA 2GBQA 4J9FA 2CDTA 1NEGA 2BTTA 1VA7A 2K7AA 1M30A 4K11A 3RBBB 4AG1C 1UHCA 1B3QA 2JTEA 2KNBB 1UJ0A 5L23A 2L3QA 2HDAA 2X3XD 1I0CA 1M3BA 2CT4A 2OAWA 2GTOA 2J6KA 2LQWA 2OI3A 4CC3A 4R0KA 2RQRA 1AOJA 1PRLC 1VYVA 1GBQA 1UGVA 4OMQA 3U23A 1X6BA 1X69A 2CSIA 2DJQA 1SHFA 1SEMA 3VS1A 3VS3A 1KFZA 1N5ZA 3H0IA 1NLOC 2HBWA 1A0NB 3ULRB 2J06A 4QT7A 5IH2A 2RQUA 1ZSGA 1W1FA 2D0NA 1QKWA 1GRIA 1UG1A 1CKBA 2VKNA 4OMOA 3I35A 1ZUYA 1W70A 2AKLA 4X1VA 4DEXA 2ESWA 1OOTA 1IO6A 1T3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A08 A;  1K1Z A;  2HCK A;  2JM8 A;  4F14 A;  5FW9 A;  1X43 A;  4HVW A;  5IXF A;  3VS0 A;  4CC2 A;  1HSQ A;  2K6D A;  2O9S A;  2KBT A;  1T0H A;  2J6O A;  1T3S A;  2KYB A;  2I0N A;  1M3C A;  1X2K A;  4FSS A;  5GJV B;  1M27 C;  2EKH A;  1WX6 A;  2EBP A;  2AZV A;  1BB9 A;  3M0T A;  2X3W D;  1MV0 B;  2KRS A;  1K76 A;  4GLM A;  3I5S A;  2FPE A;  2CUD A;  3NPF A;  4J9H A;  4J9G A;  3QWY A;  1AEY A;  2GQI A;  1GBR A;  4OMP A;  2HSP A;  2M0Y A;  2DYB A;  2FEI A;  4HVU A;  2KT1 A;  2RF0 A;  2JMC A;  2LJ0 A;  2DE0 X;  3NHN A;  2DBM A;  3QWX X;  2EPD A;  2RMO A;  4RTT A;  2YUQ A;  1QWE A;  2YT6 A;  2DL8 A;  2ROL A;  2CH4 W;  1GCP A;  2EGA A;  3I5R A;  4F16 A;  1ZBJ A;  1UJY A;  1WI7 A;  2D8J A;  3JV3 A;  2LCS A;  1MV3 A;  4J9B A;  1AWX A;  1JEG A;  3VRY A;  4AFQ C;  4GBQ A;  1YCS B;  3M0R A;  2DRK A;  3H0H A;  4ORZ A;  1PHT A;  2ED0 A;  2RQW A;  4OML A;  2W0Z A;  1AWJ A;  2JMA A;  2KYM A;  1NYG A;  2J7I A;  3EHQ A;  4RTX A;  2RN8 A;  5HCK A;  4HVV A;  1ARK A;  3VS7 A;  2BZX A;  2A36 A;  2D1X A;  2CRE A;  3TVT A;  2JM9 A;  4DEY A;  2P4R A;  4JJC A;  4JJD A;  1RUW A;  1HJD A;  2EW3 A;  5GJW B;  3VS5 A;  1I1J A;  1U06 A;  2EVR A;  2FO0 A;  1UDL A;  4RTV A;  2LMJ A;  3UF4 A;  2KT8 A;  1NLP C;  1ZUK A;  1K9A A;  3ZL7 C;  3M0P A;  1M8M A;  2EYY A;  3EG3 A;  2JXB A;  1AWO A;  4A63 B;  5I22 A;  2DM1 A;  4ZNX A;  1BK2 A;  1GCQ A;  4Z88 A;  2ED1 A;  5IXB A;  4D8D A;  2DRM A;  3KFV A;  1AWW A;  2KRM A;  3FJ5 A;  3M0S A;  2DBK A;  2LNH B;  3EG2 A;  4LN2 A;  1JO8 A;  1G83 A;  1WXU A;  1AD5 A;  1WDX A;  1WYX A;  1UFF A;  2L2P A;  3LH5 A;  4OMN A;  1UTI A;  2GGR A;  2CT3 A;  2SEM A;  2PZ1 A;  1E6G A;  3UA6 A;  3H41 A;  1SRL A;  5FWC A;  4LNP A;  2VVK A;  1AVZ C;  1AZE A;  3RNJ A;  1S1N A;  2KGT A;  2DIL A;  5IHK A;  2MCN A;  1G2B A;  4E6R A;  2BZ8 A;  1MUZ A;  2DA9 A;  2J6F A;  2KEA A;  2KRO A;  2G6F X;  2YSQ A;  2CUB A;  2V1Q A;  2AZS A;  2RQV A;  2VWF A;  3PVL A;  1TG0 A;  1XOV A;  1WXT A;  2C0T A;  2LP5 A;  4HCK A;  1Z9Q A;  2A37 A;  2LZ6 B;  2ENM A;  2J05 A;  2KE9 A;  1Y57 A;  4IIO A;  3CQT A;  1SHG A;  1NEB A;  3UAT A;  1UE9 A;  4LE9 A;  1B07 A;  1YWP A;  2L0A A;  3UA7 A;  1JU5 C;  2LQN A;  2RQT A;  3VS6 A;  4WCI A;  2EQI A;  1WIE A;  3C0C A;  4J9C A;  2DLP A;  1H92 A;  2DVJ A;  4F17 A;  2KR3 A;  2GTJ A;  4RTU A;  3R6N A;  4JJB A;  1YWO A;  2FRW A;  2YUO A;  1I07 A;  3SEM A;  4AFS C;  1YNZ A;  2DL4 A;  2FPF A;  3VRZ A;  4RTY A;  4HXJ A;  1VYU A;  1PRM C;  2F2V A;  1X6G A;  4ESR A;  3EG0 A;  5FWB A;  1VYT A;  1HD3 A;  3IQL A;  1J3T A;  1M3A A;  2SRC A;  4KRT A;  2K3B A;  2V1R A;  3EGU A;  1NM7 A;  1QCF A;  1WLP B;  2MIO A;  1W6X A;  1X27 A;  2JT4 A;  5I11 A;  1TUD A;  3EG1 A;  3REA B;  3REB B;  2O88 A;  4D8K A;  2O9V A;  1KSW A;  1YN8 A;  1Z9Z A;  1WA7 A;  2LJ3 A;  3NGP A;  2L3P A;  1K0S A;  2DNU A;  3SHW A;  1E6H A;  3A98 A;  1PKS A;  4Z89 A;  1FYN A;  2D8H A;  1NG2 A;  2KRN A;  1ZX6 A;  2B86 A;  2MOX A;  1V1C A;  3EHR A;  4J9I A;  2RNA A;  2YUP A;  2W10 A;  2A28 A;  1UEC A;  1X2Q A;  1K4U S;  2NWM A;  2EYZ A;  2KXD A;  2YUN A;  1E7O A;  2RPN A;  1BBZ A;  1GCQ C;  3VS2 A;  4M4Z A;  1SPK A;  2BZY A;  1WXB A;  5IHN A;  1QLY A;  1TUC A;  2EGE A;  2JS0 A;  1ABQ A;  2L3S A;  1JXM A;  2IIM A;  1CSK A;  2EGC A;  1OV3 A;  2C0O A;  2AKK A;  3NMZ C;  2PTK A;  5IHI A;  2CH4 A;  2K9G A;  2JW4 A;  1JQQ A;  1U3O A;  2E5K A;  2YDL A;  2H8H A;  3GBQ A;  4AG2 C;  2XMF A;  2ABL A;  1JXO A;  2PNI A;  3THK A;  2EYX A;  4RUG A;  4RTW A;  2O2O A;  3M0Q A;  4LUD A;  2LX7 A;  2JS2 A;  3I9Q A;  2K79 A;  1GFC A;  2HEQ A;  4AFU C;  1UHF A;  2GNC A;  2M51 A;  1GFD A;  2O31 A;  3PVQ A;  1OEB A;  1ZLM A;  1PKT A;  1WFW A;  1BU1 A;  1LCK A;  1ZUU A;  2DL3 A;  1GL5 A;  1PWT A;  4JZ4 A;  1UUE A;  2LJ1 A;  2QDL A;  1NYF A;  4RTZ A;  1FMK A;  4J9D A;  2OJ2 A;  2DL7 A;  2FPD A;  4CC4 B;  1KJW A;  2ECZ A;  4JPB W;  4IIM A;  1QWF A;  3O5Z A;  1Y0M A;  2DF6 A;  2AK5 A;  1K0X A;  1T0J A;  4LUE A;  1EFN A;  1SRM A;  1RLP C;  1H8K A;  2CSQ A;  4AFZ C;  1SSH A;  4EIK A;  2DX1 A;  1CKA A;  2FG0 A;  4Y92 A;  2F2X A;  3H0F A;  2F2W A;  2EYW A;  1ABO A;  1PNJ A;  2C0I A;  2FRY A;  2KXC A;  1YP5 A;  3VS4 A;  1OPK A;  1AZG B;  1RLQ C;  5ECA A;  2ROT A;  3TSZ A;  3PE0 A;  4JZ3 A;  3TSW A;  2DMO A;  1KIK A;  2NUZ A;  2K2M A;  4J9E A;  1U5S A;  1H3H A;  1OPL A;  4OMM A;  1RI9 A;  1QKX A;  4CC7 A;  2DL5 A;  5EC7 A;  4Z8A A;  3M0U A;  2GBQ A;  4J9F A;  2CDT A;  1NEG A;  2BTT A;  1VA7 A;  2K7A A;  1M30 A;  4K11 A;  3RBB B;  4AG1 C;  1UHC A;  1B3Q A;  2JTE A;  2KNB B;  1UJ0 A;  5L23 A;  2L3Q A;  2HDA A;  2X3X D;  1I0C A;  1M3B A;  2CT4 A;  2OAW A;  2GTO A;  2J6K A;  2LQW A;  2OI3 A;  4CC3 A;  4R0K A;  2RQR A;  1AOJ A;  1PRL C;  1VYV A;  1GBQ A;  1UGV A;  4OMQ A;  3U23 A;  1X6B A;  1X69 A;  2CSI A;  2DJQ A;  1SHF A;  1SEM A;  3VS1 A;  3VS3 A;  1KFZ A;  1N5Z A;  3H0I A;  1NLO C;  2HBW A;  1A0N B;  3ULR B;  2J06 A;  4QT7 A;  5IH2 A;  2RQU A;  1ZSG A;  1W1F A;  2D0N A;  1QKW A;  1GRI A;  1UG1 A;  1CKB A;  2VKN A;  4OMO A;  3I35 A;  1ZUY A;  1W70 A;  2AKL A;  4X1V A;  4DEX A;  2ESW A;  1OOT A;  1IO6 A;  1T3L A; 
#chains in the Genus database with same CATH topology
 5FW9 A;  2MWP A;  4XAX B;  5IXF A;  5LJ5 j;  3VS0 A;  2WSE E;  4CC2 A;  4PKC C;  2XDB A;  2V26 A;  3GLX A;  1M2V A;  2D6F A;  2Z0W A;  3JCM W;  2I0N A;  4M78 D;  1X2K A;  3OBW A;  3OYE A;  2O4X B;  2EYQ A;  1OX8 A;  1M27 C;  2ZPB B;  3M0T A;  3WXM B;  5GAN d;  2NUT A;  3EGX A;  1MV0 B;  2DJZ A;  1K76 A;  5KE3 A;  1V76 A;  2CUD A;  3NPF A;  3QWY A;  8ATC B;  1AEY A;  5GAN f;  1U1S A;  1GBR A;  2RHI A;  4IUU A;  4BD3 A;  3MJX A;  2HQX A;  1NJI U;  4HVU A;  4MZP A;  2DE0 X;  3QWX X;  2RMO A;  4PJO G;  2M9U A;  4RTT A;  2DIG A;  1GCP A;  3RER A;  1NJI C;  4KT0 E;  3JCM e;  3I5R A;  2COW A;  1ZHI A;  1IRX A;  3QJ6 A;  2AHJ B;  4E7S A;  2DVE A;  2QQB A;  2KY9 A;  1AWX A;  1HK9 A;  1Q86 R;  1YCS B;  4C92 E;  4M7A E;  2DRK A;  3EFR A;  4M78 C;  1PHT A;  2L3R A;  3EGX B;  4OML A;  2W0Z A;  3M56 A;  5GAO q;  2H3J A;  1M1F A;  3OYB A;  1NYG A;  2YXY A;  5LJ5 h;  3CD6 A;  5I21 A;  2J7I A;  2RN8 A;  3EFS A;  3QZ9 B;  5HCK A;  5D6Y A;  2DET A;  3VS7 A;  2BZX A;  2A36 A;  2X9H A;  4II1 A;  2QQ9 A;  1LNX A;  2DKG A;  4DEY A;  1OU9 A;  1YI2 Q;  1YHQ A;  2G3R A;  2QI2 A;  3MO8 A;  3J80 E;  1ZA2 B;  4JLI A;  1RUW A;  3CPF A;  2KMT A;  4J6Y A;  1KHI A;  2EW3 A;  2WSC E;  3VS5 A;  2KT8 A;  3CCS A;  1VQN A;  2V8I A;  4XU3 A;  2HBP A;  1AWO A;  5I22 A;  2DM1 A;  4DOW A;  3C12 A;  4OB1 B;  3E9F A;  5IXB A;  2XG8 D;  2QEX T;  1KQ2 A;  5C0M A;  3CME A;  2L5Q A;  2MAM A;  2DBK A;  3JAM E;  1YJ9 T;  1WDX A;  4IUQ A;  3V8K A;  2CT3 A;  2PZ1 A;  4CRI A;  3CBP A;  1D0X A;  1SRL A;  2Y4Y A;  3V8J A;  4FCY A;  3SB2 A;  2M16 A;  4OB2 B;  3RNJ A;  1H64 1;  4M78 G;  3CCJ A;  2J6F A;  2K5F A;  2FVU A;  3M4G A;  4Y91 A;  2KRO A;  2G6F X;  3PVL A;  2VWF A;  2RQV A;  2HKQ B;  1Z9Q A;  3LWI A;  4X9C A;  1VQO Q;  4XTY A;  1I81 A;  1QP2 A;  2ENM A;  2J05 A;  2DK3 A;  3CQT A;  1SHG A;  1YCY A;  3G1J A;  3UA7 A;  1TWB A;  3CME Q;  2RHZ A;  2DO3 A;  1X6O A;  2RK2 A;  2RQT A;  4WCI A;  2IVW A;  1WIE A;  3C0C A;  3JRZ A;  2DLP A;  2KR3 A;  1UGS B;  1D1A A;  1YWO A;  1I07 A;  4J5Y A;  2DD4 A;  2RH2 A;  2DL4 A;  2FPF A;  3VRZ A;  4M77 A;  3SWN C;  1RAF B;  4RTY A;  1MHN A;  4E7L A;  2KDS A;  1OZ2 A;  1OX9 A;  2X35 A;  3CMA A;  1SSF A;  1X6G A;  3OYA A;  3QSU A;  1VQ4 A;  3NFC A;  2FZC B;  1ACM B;  1MGQ A;  1VYT A;  1D0Z A;  1JBM A;  4KRT A;  3PTA A;  3E9G A;  1NM7 A;  1Y96 A;  2EQK A;  2EIF A;  1K73 C;  1QCF A;  3JCM b;  2DD5 A;  5I2M A;  1TUD A;  3EG1 A;  3REA B;  1FWZ A;  3REB B;  3EG9 B;  2O88 A;  2JJ9 A;  3CCM T;  1KSW A;  1TOV A;  3BE3 A;  2QGG A;  2LJ3 A;  1X75 C;  2QQR A;  5FLX E;  1K0S A;  3I56 T;  2DNU A;  4F04 B;  1FYN A;  1VQ8 Q;  2V8J A;  1ZX6 A;  2B86 A;  3EHR A;  2RB6 A;  1WHG A;  4C5H A;  2RNA A;  2XDP A;  3JB9 G;  1X2Q A;  2NWM A;  2QK0 A;  2HQH A;  1YJN T;  3G6E Q;  1GCQ C;  4M78 E;  1FMV A;  5IHN A;  3OBY A;  1QLY A;  1RI0 A;  1ABQ A;  2E6Z A;  2L3S A;  5FRN A;  2DFU A;  1JXM A;  3M57 A;  3DLM A;  2VGN A;  3NMZ C;  1BKB A;  5HKC A;  1NZ9 A;  2K9G A;  2JW4 A;  3QKJ A;  2EJ9 A;  5KCO A;  3LW5 E;  2OTJ Q;  3THK A;  1Q86 U;  1Y96 B;  1SKU B;  3H8Z A;  1PD1 A;  4RTW A;  2OTL A;  2O2O A;  4LUD A;  3G4S A;  5DLQ E;  1YI2 T;  4LDU A;  1N8R R;  4PFO A;  2F69 A;  2M51 A;  5L8R E;  2JVV A;  1LJO A;  1OEB A;  1RL2 A;  1ZLM A;  3BW1 A;  1WQ7 A;  1WFW A;  1BU1 A;  2CP7 A;  3CCQ T;  3RMS A;  2LJ1 A;  3RDV A;  1NYF A;  2EFI A;  2YRD A;  3JB9 I;  1SG5 A;  1EZZ B;  3DLL A;  4IUP A;  4E7H A;  3O5Z A;  1G3W A;  2GQV A;  1D1B A;  5IN1 A;  3OYJ A;  2JUF A;  4O6J A;  2CZ6 B;  3RUX A;  1VQL A;  2OX7 A;  4OF1 A;  3MHX A;  3GOX A;  3HPW A;  4VUB A;  3OYK A;  1CKA A;  4FIB A;  3A1P A;  2FG0 A;  1VQN Q;  2F2W A;  2E10 A;  1KQS A;  2ZPG B;  1D1C A;  3PMI A;  1MNE A;  4ME7 A;  2RJF A;  2BIV A;  2E5Q A;  2FRY A;  2HL3 A;  4M7A B;  4C5E A;  1OPK A;  2KI7 A;  5D6X A;  2FB7 A;  1N8R C;  3CC2 A;  5HY6 A;  1V29 B;  1QCN A;  7AT1 B;  2XD0 A;  2K2M A;  3LWH A;  1U5S A;  3G4S T;  1TXQ A;  3ZBD A;  1OPL A;  1K9M U;  2NUP A;  8AT1 B;  2OTL T;  1QKX A;  4MMK A;  3ER0 A;  4J9F A;  2GBQ A;  3BFM A;  2BE7 D;  1WHK A;  1BI2 A;  5CKF A;  5FRO A;  2K7A A;  3QUI A;  1QVF S;  1YIJ Q;  3RBB B;  1UHC A;  4HCZ A;  2JTE A;  2KNB B;  1VQP Q;  4BY6 C;  2RD1 A;  1M3B A;  1W4S A;  2CT4 A;  2QEX Q;  2GTO A;  3JCM h;  5GMK l;  4EMK A;  2E1H A;  2LQW A;  3TRE A;  4CC3 A;  1AOJ A;  3OS1 A;  4BDY A;  1SHF A;  5CQY A;  1N5Z A;  1NLO C;  2YRV A;  3V8L A;  5GMK e;  4XTZ A;  2HBW A;  3QO3 A;  1AHJ B;  4QT7 A;  3HHT B;  3OMG A;  1M5Q 1;  1UG1 A;  4Q5W A;  2VUB A;  2PVD B;  4OMO A;  4B6M A;  2AKL A;  3V7C A;  1M1G A;  3ASK A;  3L42 A;  2ESW A;  3LGL A;  1IO6 A;  3CC4 Q;  1K1Z A;  4F14 A;  3CCL T;  5CKH A;  3CC4 A;  1I4K 1;  2OAU A;  4HVW A;  4C0F A;  4J7I A;  4PJO D;  2K6D A;  4JUV A;  2KBT A;  3C95 A;  3VKI A;  1FXX A;  4RMO A;  3A5Z B;  3QHS A;  2KYB A;  5FU6 C;  3CBM A;  1M3C A;  5AT1 B;  3FB9 A;  5GJV B;  1VQ6 T;  2EQU A;  1WX6 A;  2EBP A;  2AZV A;  3CCR Q;  2K4Y A;  3OYM A;  4KH1 B;  3AT1 B;  4J9H A;  4J9G A;  2X4Y A;  2GQI A;  3HFN A;  3MEW A;  4OMP A;  2HSP A;  4M77 C;  4C92 D;  2DYB A;  3KBG A;  2PU9 B;  2AIR B;  4N0A C;  2FL7 A;  2LJ0 A;  2DBM A;  2EPD A;  3JCM f;  4M77 B;  1QWE A;  2BKD N;  3CXC A;  3X24 B;  4GY5 A;  4PJJ A;  4RCB A;  2NUT B;  3O8V A;  3SD4 A;  2D8J A;  4DBQ A;  4C0D C;  2A7Y A;  1MV3 A;  3CME T;  4J9B A;  2QXF A;  2XID A;  4B9X A;  3VRY A;  4AFQ C;  2YHT A;  2RHU A;  5A0D A;  2LTO A;  2KK4 A;  4BI8 B;  3QII A;  2ED0 A;  2RQW A;  3OYH A;  3CC7 T;  1AWJ A;  4JRQ A;  2JMA A;  3JCM c;  1VQ6 A;  1Q86 C;  4M75 F;  2MI6 A;  5GAM d;  3EHQ A;  1IXD A;  1VQN T;  4ZN3 A;  1ARK A;  4M7A F;  2RJD A;  2D1X A;  3CCV Q;  1JRI A;  1VQL Q;  4JJC A;  4JJD A;  1LOJ A;  1VIE A;  3CCL A;  2H3E B;  4J83 A;  3HSB A;  1HJD A;  4LDY A;  2DEU A;  1I1J A;  1U06 A;  2EQJ A;  2FO0 A;  2LT4 A;  2XK0 A;  4PLI A;  3OS0 A;  4RTV A;  3CCM Q;  3UF4 A;  4NOY A;  1EIF A;  4KUL A;  2B8A A;  3ZL7 C;  3M0P A;  4ZGD B;  4XTX A;  1M8M A;  1GXI E;  3OY9 A;  4E47 A;  2DXB A;  3CCS Q;  3CMA Q;  4A63 B;  4M77 G;  1QP3 A;  2RO0 A;  3EGD A;  2ED1 A;  5GAO m;  5DY9 A;  3MET A;  3M0S A;  2LNH B;  4ZGE B;  5FU7 C;  1WYX A;  1MND A;  3CXC P;  3PIO A;  3LH5 A;  2CZ7 B;  3Q1J A;  1M2O A;  1UGR B;  3S3N A;  4M7D B;  1JJ2 P;  5FWC A;  3H9N A;  3JB9 D;  1RAE B;  1FMW A;  4IUR A;  2OTL Q;  2MCN A;  1R8O B;  1ZBX A;  1M4Z A;  4E6R A;  3EFO B;  4ZGJ B;  2V1Q A;  2AZS A;  3JB9 H;  4JS4 A;  2C0T A;  2LP5 A;  2QGF B;  4FYX B;  5GAO l;  1VQ9 Q;  1FX7 A;  4R56 A;  2EWN A;  2PVG B;  5HK0 A;  2BE9 B;  4NL3 A;  3CCQ Q;  4IIO A;  2EAY A;  3MEA A;  2VGM A;  1VQO A;  3UAT A;  3CC2 T;  1UE9 A;  4LE9 A;  3PFS A;  1YWP A;  2L0A A;  5LJ5 e;  1JU5 C;  5LJ5 d;  1WPY A;  5CCA A;  4A4F A;  1H92 A;  4AMC A;  2QQA A;  2GTJ A;  4RTU A;  3R6N A;  4JJB A;  1M90 C;  4E7I A;  3CD6 Q;  3SEM A;  4L6V 5;  4AFS C;  1XTD A;  4HXJ A;  4ZN1 A;  3CCR T;  2MWO A;  1F1B B;  3JCM Q;  3CCU T;  2VXF A;  2F2V A;  4M7A C;  1TTH B;  5GAM h;  1HD3 A;  3VJP A;  1M3A A;  2SRC A;  2GFA A;  3CCU A;  3OYG A;  1WLP B;  1Q7Y R;  3CCR A;  2ZCF B;  1Q82 R;  2JT4 A;  3OS5 A;  4FYY B;  2OTJ A;  2JNG A;  4D8K A;  1D3B A;  3URG A;  3CPW S;  2HL5 C;  2R58 A;  1YI2 A;  1YN8 A;  3JSC A;  1PKS A;  4Z89 A;  2D8H A;  2KRN A;  1M2V B;  1V1C A;  3I55 Q;  4KGZ B;  3DB4 A;  2YUP A;  2W10 A;  1VQ9 A;  1KHC A;  2FZK B;  3QXE B;  1LVK A;  4HT8 A;  2PUO B;  1E7O A;  3M4Y A;  1I5O B;  1KG1 A;  4M4Z A;  3OYN A;  1Q81 R;  2COY A;  3FLG A;  2EGE A;  3CCE Q;  2LDM A;  1CSK A;  4J6W A;  1QVG P;  1N6A A;  1KC8 R;  2PTK A;  4TVR A;  3UWN A;  3EG9 A;  1VQ8 T;  2CP5 A;  1JQQ A;  4MZM A;  2H8H A;  2CZ1 B;  2ZPH B;  3GBQ A;  4B9W A;  2ABL A;  1G3S A;  1JXO A;  4A4G A;  4NL2 A;  4JRK A;  3M0Q A;  3QYH B;  2RI5 A;  3G6E T;  2K79 A;  2HEQ A;  1UHF A;  1QVG S;  2GNC A;  1PG5 B;  2O31 A;  3S6W A;  2M02 A;  2MK5 A;  3J7A F;  2CGH A;  3HRU A;  2LCC A;  1TUG B;  4PFP A;  3C94 A;  1VQ5 A;  1D3B B;  2DL3 A;  1WGS A;  3L2V A;  1GL5 A;  1PWT A;  1VQK T;  4RTZ A;  2DL7 A;  5GAN 5;  3HKS A;  4CC4 B;  4OB3 B;  4IIM A;  4MDW A;  3UT1 A;  1Y0M A;  3CMA T;  4LUE A;  3A8O B;  1BCM A;  3FEO A;  3OYI A;  2EKO A;  3HP9 A;  2E3I A;  4EIK A;  2DX1 A;  1D09 B;  3FJP A;  4Y92 A;  1C1A A;  2I2L A;  2DIQ A;  2F2X A;  2EYW A;  4F7U E;  5GAN 8;  2JOY A;  4M75 G;  1W2B P;  3E19 A;  2C0I A;  3VS4 A;  4ELZ C;  4M7D F;  2CP2 A;  3TSZ A;  3PE0 A;  4JZ3 A;  3CCE A;  2XU8 A;  1Q82 C;  4J9E A;  4FYV B;  4C8Q E;  4OMM A;  1TU0 B;  3M54 A;  1RI9 A;  4CC7 A;  2DZC A;  3M0U A;  3LGF A;  3PIP A;  4C92 A;  3CCJ T;  5LJ3 g;  2QA4 Q;  2BTT A;  1VA7 A;  4K11 A;  3P8D A;  1Y71 A;  4D6W A;  5LJ3 e;  3QDF A;  3KXT A;  4MZT A;  4BE0 A;  1KQ1 A;  5GAN j;  4DQ2 A;  1S72 A;  2P0Q A;  2WSF E;  4DBR A;  1YJ9 A;  2CKK A;  2CP0 A;  4Y28 E;  1IB8 A;  4R0K A;  4OMQ A;  1UGV A;  1X6B A;  2CSI A;  1SEM A;  4PJO A;  5GAM f;  3HFO A;  1G8X A;  4ZTF A;  1A0N B;  5IH2 A;  1KD1 R;  1GRI A;  1CKB A;  2FYK A;  2ZZD A;  1R0C B;  1G3T A;  4IUT A;  3HRS A;  3CCV A;  1QVP A;  1IHV A;  5GAM e;  1ZUY A;  3KUF A;  4X1V A;  2GFU A;  3EH1 A;  1VIF A;  1BIB A;  2P0K A;  1OOT A;  3QZ5 B;  3RR6 A;  2JM8 A;  4M75 C;  3RIR A;  4BUG A;  4JDS A;  5FU6 B;  1UEB A;  2XDD A;  2HAX A;  2LT1 A;  1T0H A;  1RAA B;  3OA6 A;  2J6O A;  2QDY B;  2E70 A;  4EMH A;  2E6N A;  1N9R A;  1VQM T;  3CD6 T;  2LNV A;  3OYC A;  4C8Q G;  3CC4 T;  5GAN e;  3CCL Q;  1TH7 A;  2EKH A;  5IAY A;  3L2W A;  1BB9 A;  2D0Q B;  4JRP A;  2X3W D;  4F7U B;  1YBY A;  4GLM A;  3I5S A;  2FPE A;  1VQK A;  1H3Z A;  3JCM P;  3TU4 K;  1VQ5 T;  2M0Y A;  3MEV A;  4J8O A;  3L2Z A;  5LJ3 f;  3OYL A;  2KT1 A;  2RF0 A;  5GAN 2;  3NHN A;  2L89 A;  3HL8 A;  3G6E A;  2YT6 A;  2DL8 A;  2ROL A;  3SFM A;  1K8A C;  4F7U G;  4BE1 A;  4F16 A;  2ZAE A;  1UJY A;  1WI7 A;  4QQG A;  2LCS A;  3A8L B;  4C92 B;  5KE2 A;  3MP6 A;  1OI1 A;  3A8H B;  4YTL A;  4KUI A;  1Y07 A;  3H0H A;  4ORZ A;  1WQW A;  4M7D G;  3P8H A;  1KQS S;  4PJO F;  3NTH A;  2R5M A;  1VQ9 T;  1ZQ1 A;  4RTX A;  3CCU Q;  2NYS A;  4QKU A;  4C5G A;  3BY7 A;  2HD0 A;  3GF5 A;  2CRE A;  5GAN 7;  3TVT A;  2JM9 A;  4PJO B;  1B7T A;  4PJO E;  2NLU A;  5KYY A;  2P4R A;  4RG2 A;  4C8Q C;  4AT1 B;  4XTW A;  1UDL A;  2EQM A;  1VQK Q;  4PNO A;  2RI3 A;  6AT1 B;  4C8Q F;  1NLP C;  5GAO r;  2MF2 A;  4FW2 A;  4OGC A;  4A4H A;  3I56 Q;  2LVM A;  2EYY A;  3CPW P;  3EG3 A;  2JXB A;  4M77 F;  4BB7 A;  1M1K U;  5KYW A;  1GCQ A;  1YJW A;  4Z88 A;  2HMA A;  2RA2 A;  3CCQ A;  3TCJ A;  4FM4 B;  5CKD A;  2KRM A;  3ZEH A;  1KC8 U;  3EG2 A;  4LN2 A;  4PJM A;  3J81 E;  1JO8 A;  1G83 A;  1WXU A;  2O4X A;  1AD5 A;  3OS2 A;  2D9T A;  2L2P A;  4E7K A;  1VQO T;  2COZ A;  3AHU A;  1UTI A;  4HCB A;  2SEM A;  4RKU E;  3H41 A;  3QYG B;  4V2S A;  4E7Z A;  5KYX A;  4RG8 A;  5J39 A;  1NPR A;  1AZE A;  2DER A;  4BDZ A;  1IGQ A;  4M75 D;  1M90 U;  2KGT A;  2DIL A;  5IHK A;  1G2B A;  4F7U A;  1KQS P;  3EGD B;  1K9M R;  1X01 A;  4QVC A;  1TG0 A;  4KBM B;  2A37 A;  4E7J A;  2HQE A;  1C0M A;  2LZ6 B;  2QYZ A;  3JCM V;  2HZY A;  3RES A;  1QMC A;  1R0B G;  1Y57 A;  2K57 A;  1WHH A;  4OP0 A;  1YJN A;  3D7S B;  1P92 A;  1B07 A;  4M7D E;  3VV0 A;  4ZTJ A;  3ZFJ A;  3OW2 P;  1BI3 A;  1IZ6 A;  4EMK B;  5HK3 A;  2RM4 A;  4HKE A;  3I56 A;  4F17 A;  1KD1 C;  2YUO A;  4PJN A;  3CCM A;  1JB0 E;  5GAN 6;  2CYZ B;  3LH0 A;  3BDU A;  4XQ3 A;  4HCC A;  4OMF B;  3EG0 A;  2XKO C;  3MPU B;  1D0Y A;  1RAD B;  3IQL A;  1J3T A;  4FT2 A;  2KVQ G;  2K3B A;  3EGU A;  2MIO A;  5IT9 E;  1QVG A;  1X27 A;  1YJN Q;  4C0G A;  2JN0 A;  2DYI A;  4X9D A;  1WA7 A;  3NGP A;  3R6O A;  3SHW A;  3A98 A;  1OQK A;  1SF9 A;  2QA4 A;  2VXE A;  4J9I A;  2KQW A;  1BI0 A;  1JJ2 A;  3LLR A;  4FU6 A;  4FYW B;  5CKB A;  3DB3 A;  5M9O A;  1DJ7 B;  4EDU A;  2KXD A;  1XJW B;  3CC7 A;  4A4K A;  3VU3 C;  1SPK A;  2JS0 A;  1G3Y A;  3UPU A;  2C0O A;  2HNI A;  4F7U F;  2AKK A;  2R5A A;  4CI0 C;  5IHI A;  2CH4 A;  1BYM A;  3JCM g;  2R57 A;  2E5K A;  2YDL A;  1NBE B;  2K3Y A;  4AG2 C;  5GAM j;  4RUG A;  5GAN h;  1UB4 A;  4M78 F;  4BE2 A;  1PCX A;  2LX7 A;  3QDR B;  2A0F B;  2F5K A;  4M7D D;  5EG2 A;  1IRE B;  4DBH A;  5A0G A;  5FU7 B;  3OMC A;  1I8F A;  5GAO n;  2DTH A;  1PKT A;  5GMK h;  4BAC A;  5KYU A;  1VQ7 A;  4A4E A;  4XTV A;  5CKE A;  2QEX A;  5GAO p;  1UGP B;  4JZ4 A;  1MMD A;  1FMK A;  4J9D A;  1HYO A;  2E4H A;  1O75 A;  1KJW A;  3G71 Q;  4DOV A;  2DF6 A;  2AK5 A;  3LX7 A;  3INZ A;  1T0J A;  1WHL A;  3P8B B;  1MMN A;  5GMK i;  2Y90 A;  1EFN A;  2M1H A;  3L1A A;  1H8K A;  2CSQ A;  1QVF P;  3EFO A;  1SSH A;  3HTR A;  2MPX C;  3SWN B;  3H0F A;  1ABO A;  5A2Q E;  3QPH A;  2QQS A;  1PNJ A;  3A8M B;  2KXC A;  1VQ7 T;  3N5B B;  1YP5 A;  2QG9 B;  5D7U A;  1RLQ C;  4ELY C;  3S3M A;  5AYF A;  5ECA A;  3RMQ A;  1YHQ T;  1VQ5 Q;  3TSW A;  4LDX A;  4C8Q D;  1KIK A;  5CK9 A;  2NUZ A;  1C6V X;  4BI4 A;  1Q81 U;  1OZ3 A;  2RHX A;  5KCH A;  5KYX B;  1BCO A;  1H3H A;  2Y4X A;  1VQ6 Q;  5LJ3 h;  5GAN g;  2DL5 A;  5EC7 A;  1M8V A;  1KK7 A;  3S3O A;  2CDT A;  1NEG A;  2X4W A;  1VUB A;  3MKD A;  4P5N A;  1NJI R;  1OUL A;  5D6W A;  2RJE A;  1K73 R;  1M30 A;  1NE8 A;  3OYY A;  1B3Q A;  5LJ3 j;  4C0D B;  5L23 A;  1UGQ B;  3MP8 A;  4N4I A;  4JJN K;  3SDZ A;  1MMA A;  1M90 R;  2K5L A;  1YFN A;  2CS7 A;  4FL6 A;  4M78 A;  1M9S A;  3X26 B;  2XI9 A;  4OGE A;  4XTU A;  2QA4 T;  2RQR A;  2DTI A;  2DJQ A;  1EX4 A;  3VS1 A;  3VS3 A;  2LQK A;  1TSF A;  2RQU A;  1W1F A;  2D0N A;  2C06 A;  2YLC A;  2A3L A;  3CXC S;  2YRC A;  3I35 A;  2MMP A;  3CC7 Q;  3EAE A;  2HKN A;  4PLL A;  4E2F B;  4A54 A;  2ZGW A;  2A08 A;  5A0L A;  3L2Q A;  2HCK A;  1X43 A;  2DTO A;  1N8R U;  1HSQ A;  1OYX A;  2LC4 A;  2XIC A;  3FRN A;  2MYS A;  1OU8 A;  4A53 A;  4ANJ A;  2O9S A;  3GP8 A;  1KD1 U;  2VB6 A;  2F1L A;  3OYD A;  1RAC B;  1RAB B;  2FZG B;  5CQX A;  3NTI A;  2O01 E;  1M1K R;  2CP3 A;  3OW2 S;  1T3S A;  3X20 B;  1VQL T;  2IPO B;  5LJ5 f;  5KYU B;  4FSS A;  3G4S Q;  4KH0 B;  4HA8 A;  1O9S A;  4DBF A;  2K2V A;  2PQW A;  2KRS A;  4BI3 A;  4C5I A;  2DPP B;  4J6X A;  4NS5 A;  1RAG B;  2E64 A;  1YIJ T;  2BUD A;  4N4G A;  3C4S A;  4PFZ A;  4N4H A;  3FC3 A;  2KAF A;  2DXC A;  4M7A A;  2FEI A;  4XU2 A;  2QTV A;  4LDV A;  1ZA1 B;  2JMC A;  2E12 A;  2CZ0 B;  2YUQ A;  1B34 B;  2CH4 W;  2EGA A;  4FW1 A;  3GNG A;  1ZBJ A;  4X34 A;  4GLK A;  4UC4 A;  2EJF A;  2LQ8 A;  1WZO A;  5FRM A;  2IG0 A;  3JV3 A;  4BY6 B;  1S72 Q;  1JEG A;  1YIJ A;  4GBQ A;  2AT1 B;  3M0R A;  1IGU A;  4KGX B;  2DEQ A;  2F5T X;  4EMK C;  3MP1 A;  3M5A A;  2KYM A;  3QBY A;  5LL6 S;  3V7R A;  3PGG A;  4M78 B;  1YIT A;  1G5V A;  2QAZ A;  3SWN A;  1YJW Q;  2PUK B;  4HVV A;  4O5V A;  3OSV A;  2P0P A;  3E2U A;  2JTF A;  2YWW A;  4M7A D;  4Z02 A;  2E3H A;  1N27 A;  3GIB A;  4QQ6 A;  5GJW B;  2EVR A;  1B34 A;  1R77 A;  2LMJ A;  2LRQ A;  1VQ4 T;  1ZUK A;  3CPW A;  1K9M C;  1K9A A;  3H6Z A;  4EMG A;  5KYN A;  5GAM g;  1W2B S;  3NTK A;  2LCL A;  4ZNX A;  3M59 A;  4XU0 A;  1BK2 A;  1N9S A;  5I2S A;  1K73 U;  3JB9 J;  4D8D A;  3QJY A;  2DRM A;  3KFV A;  1AWW A;  5J3B A;  2ZPF B;  2XHC A;  5LJ5 g;  4FT4 A;  4C92 G;  2HSE B;  3FJ5 A;  3G7Z A;  2L8D A;  1PSF A;  4R55 A;  4QVD A;  2GF7 A;  3JCM J;  1UFF A;  4LDW A;  1QCO A;  3FIF A;  4OMN A;  2GGR A;  3X25 B;  5CR2 A;  1PSE A;  1Q7Y C;  1E6G A;  3UA6 A;  3JCM d;  3M9Q A;  4LNP A;  2VVK A;  1AVZ C;  5C6S A;  4WF2 A;  2DAQ A;  1S1N A;  1YIT Q;  3I55 A;  2BZ8 A;  4QW2 A;  1MUZ A;  1U1T A;  2FHD A;  2DA9 A;  2KEA A;  2VAS A;  2YSQ A;  2CUB A;  1XOV A;  1WXT A;  4HCK A;  4QQD A;  5KYW B;  2KE9 A;  1NEB A;  1XQH A;  3VUB A;  4IUV A;  2LQN A;  1PM3 A;  3VS6 A;  1VQM A;  2NUP B;  2EQI A;  4OB0 B;  3RKW A;  4J9C A;  2DVJ A;  4PK4 A;  5CIU A;  1TS9 A;  1WHM A;  2FRW A;  3DKM A;  3JB9 F;  1YNZ A;  1QW1 A;  1PC0 A;  3BDL A;  1VYU A;  1VQ7 Q;  4PJL A;  3TQ7 P;  1PD0 A;  1PRM C;  4ESR A;  9ATC B;  3JCM X;  3CCS T;  5FWB A;  5DLO A;  2X4X A;  1YHQ Q;  5CVI A;  3G71 T;  4EPC A;  3RKX A;  3G71 A;  3OB9 A;  3CCV T;  4JS5 A;  2RHY A;  2V1R A;  4C8Q A;  2WAC A;  3CEY A;  1M1K C;  1W6X A;  3L2R A;  5I11 A;  1MMG A;  1K8A R;  2O9V A;  1Z9Z A;  1WJQ A;  5KH6 A;  4FSX A;  1WJR A;  2L3P A;  1WJS A;  5GAN 4;  1AT1 B;  1E6H A;  1ZSZ C;  2VYT A;  1NG2 A;  2MOX A;  4LD9 K;  2A28 A;  1UEC A;  1K4U S;  4HT9 A;  1QVF A;  2EYZ A;  2YUN A;  2RPN A;  1S72 T;  1ZSZ B;  1BBZ A;  1XNI A;  3VS2 A;  4L59 A;  1BI1 A;  5KYY B;  2BZY A;  1IHW A;  1WXB A;  5DM7 R;  2E41 A;  5CAI A;  1TUC A;  3WVE B;  2IIM A;  2EGC A;  1OV3 A;  3M53 A;  3MEU A;  2CP6 A;  1RAI B;  2V8K A;  3OSS C;  1QQJ A;  1U3O A;  3I55 T;  2GCX A;  4M75 E;  2XMF A;  2ZPE B;  2PNI A;  4M75 B;  2EYX A;  4MDX A;  3PMT A;  1HXD A;  3VYG A;  4JRI A;  3OW2 A;  2JS2 A;  4M77 D;  3I9Q A;  5GAN 3;  1GFC A;  2VC8 A;  3RKY A;  4M7D A;  3T9N A;  1K8A U;  3PNW C;  4AFU C;  3CCE T;  3HRT A;  1GFD A;  2P4T A;  1Q7Y U;  2EJG A;  2JZ2 A;  3PVQ A;  2DXT A;  3A8G B;  1LCK A;  1ZUU A;  4KGV B;  3M55 A;  1UUE A;  2QDL A;  1VQ4 Q;  1RAH B;  1WHJ A;  2OJ2 A;  4C92 F;  3CC2 Q;  2FPD A;  2P84 A;  2ECZ A;  4JPB W;  1Q82 U;  1QWF A;  4C92 C;  1K0X A;  3QG1 A;  1Y7X A;  3WVD B;  4DA4 A;  1ZSZ A;  4M77 E;  1SRM A;  1RLP C;  2DZ9 A;  2QAS A;  1JJ2 S;  2RJC A;  4AFZ C;  1NPP A;  2LX9 A;  4C0Z A;  1U8R A;  2JTM A;  2ZPI B;  5CO7 A;  4M7D C;  3VYH B;  1Q81 C;  4OVA A;  1AZG B;  1W2B A;  2ROT A;  3ME9 A;  5J26 A;  3GNF B;  4PL6 A;  2DMO A;  4LD6 A;  1VQP T;  2KSS A;  3X28 B;  3EH2 A;  1VQM Q;  2PVO B;  1YIT T;  1Q95 G;  4Z8A A;  3MCA B;  2K3X A;  3OQ5 A;  4XK8 E;  1VQ8 A;  1I5L A;  3TEE A;  2E65 A;  3M58 A;  2X51 A;  4AG1 C;  4QVZ A;  1UJ0 A;  3E1S A;  2L3Q A;  2RI2 A;  2HDA A;  2X3X D;  3F70 A;  4N0A A;  1I0C A;  2OAW A;  4MML A;  5LJ3 d;  3V7S A;  2J6K A;  2QTX A;  3CBO A;  3VUZ A;  4PJO C;  3OYF A;  2ATC B;  5GMK m;  1YJ9 Q;  5GMK j;  2OI3 A;  4J7F A;  1VOM A;  3CCJ Q;  2K5I A;  4M7A G;  2VV5 A;  4RCC A;  3FDR A;  3U23 A;  1PRL C;  1VYV A;  1GBQ A;  1X69 A;  4JLG A;  1YJW T;  1KFZ A;  4L5G A;  3H0I A;  4ATO A;  4WTO B;  3PT9 A;  1LPL A;  2M0O A;  2X4J A;  4XU1 A;  2DXU A;  2OTJ T;  3LYI A;  4LXC A;  3ULR B;  2J06 A;  3UDC A;  4IKF A;  1ZSG A;  1WNL A;  1QKW A;  2RK1 A;  3GPL A;  1BIA A;  2VKN A;  1KC8 C;  4M75 A;  2YLB A;  3L2U A;  4KUD K;  1W70 A;  4DEX A;  1VQP A;  4C8Q B;  1T3L A; 
#chains in the Genus database with same CATH homology
 2A08 A;  1K1Z A;  2HCK A;  2JM8 A;  4F14 A;  5FW9 A;  1X43 A;  4HVW A;  5IXF A;  3VS0 A;  4CC2 A;  1HSQ A;  2K6D A;  2O9S A;  2KBT A;  1T0H A;  2J6O A;  1T3S A;  2KYB A;  2I0N A;  1M3C A;  1X2K A;  4FSS A;  5GJV B;  1M27 C;  2EKH A;  1WX6 A;  2EBP A;  2AZV A;  1BB9 A;  3M0T A;  2X3W D;  1MV0 B;  2KRS A;  1K76 A;  4GLM A;  3I5S A;  2FPE A;  2CUD A;  3NPF A;  4J9H A;  4J9G A;  3QWY A;  1AEY A;  2GQI A;  1GBR A;  4OMP A;  2HSP A;  2M0Y A;  2DYB A;  2FEI A;  4HVU A;  2KT1 A;  2RF0 A;  2JMC A;  2LJ0 A;  2DE0 X;  3NHN A;  2DBM A;  3QWX X;  2EPD A;  2RMO A;  4RTT A;  2YUQ A;  1QWE A;  2YT6 A;  2DL8 A;  2ROL A;  2CH4 W;  1GCP A;  2EGA A;  3I5R A;  4F16 A;  1ZBJ A;  1UJY A;  1WI7 A;  2D8J A;  3JV3 A;  2LCS A;  1MV3 A;  4J9B A;  1AWX A;  1JEG A;  3VRY A;  4AFQ C;  4GBQ A;  1YCS B;  3M0R A;  2DRK A;  3H0H A;  4ORZ A;  1PHT A;  2ED0 A;  2RQW A;  4OML A;  2W0Z A;  1AWJ A;  2JMA A;  2KYM A;  1NYG A;  2J7I A;  3EHQ A;  4RTX A;  2RN8 A;  5HCK A;  4HVV A;  1ARK A;  3VS7 A;  2BZX A;  2A36 A;  2D1X A;  2CRE A;  3TVT A;  2JM9 A;  4DEY A;  2P4R A;  4JJC A;  4JJD A;  1RUW A;  1HJD A;  2EW3 A;  5GJW B;  3VS5 A;  1I1J A;  1U06 A;  2EVR A;  2FO0 A;  1UDL A;  4RTV A;  2LMJ A;  3UF4 A;  2KT8 A;  1NLP C;  1ZUK A;  1K9A A;  3ZL7 C;  3M0P A;  1M8M A;  2EYY A;  3EG3 A;  2JXB A;  1AWO A;  4A63 B;  5I22 A;  2DM1 A;  4ZNX A;  1BK2 A;  1GCQ A;  4Z88 A;  2ED1 A;  5IXB A;  4D8D A;  2DRM A;  3KFV A;  1AWW A;  2KRM A;  3FJ5 A;  3M0S A;  2DBK A;  2LNH B;  3EG2 A;  4LN2 A;  1JO8 A;  1G83 A;  1WXU A;  1AD5 A;  1WDX A;  1WYX A;  1UFF A;  2L2P A;  3LH5 A;  4OMN A;  1UTI A;  2GGR A;  2CT3 A;  2SEM A;  2PZ1 A;  1E6G A;  3UA6 A;  3H41 A;  1SRL A;  5FWC A;  4LNP A;  2VVK A;  1AVZ C;  1AZE A;  3RNJ A;  1S1N A;  2KGT A;  2DIL A;  5IHK A;  2MCN A;  1G2B A;  4E6R A;  2BZ8 A;  1MUZ A;  2DA9 A;  2J6F A;  2KEA A;  2KRO A;  2G6F X;  2YSQ A;  2CUB A;  2V1Q A;  2AZS A;  2RQV A;  2VWF A;  3PVL A;  1TG0 A;  1XOV A;  1WXT A;  2C0T A;  2LP5 A;  4HCK A;  1Z9Q A;  2A37 A;  2LZ6 B;  2ENM A;  2J05 A;  2KE9 A;  1Y57 A;  4IIO A;  3CQT A;  1SHG A;  1NEB A;  3UAT A;  1UE9 A;  4LE9 A;  1B07 A;  1YWP A;  2L0A A;  3UA7 A;  1JU5 C;  2LQN A;  2RQT A;  3VS6 A;  4WCI A;  2EQI A;  1WIE A;  3C0C A;  4J9C A;  2DLP A;  1H92 A;  2DVJ A;  4F17 A;  2KR3 A;  2GTJ A;  4RTU A;  3R6N A;  4JJB A;  1YWO A;  2FRW A;  2YUO A;  1I07 A;  3SEM A;  4AFS C;  1YNZ A;  2DL4 A;  2FPF A;  3VRZ A;  4RTY A;  4HXJ A;  1VYU A;  1PRM C;  2F2V A;  1X6G A;  4ESR A;  3EG0 A;  5FWB A;  1VYT A;  1HD3 A;  3IQL A;  1J3T A;  1M3A A;  2SRC A;  4KRT A;  2K3B A;  2V1R A;  3EGU A;  1NM7 A;  1QCF A;  1WLP B;  2MIO A;  1W6X A;  1X27 A;  2JT4 A;  5I11 A;  1TUD A;  3EG1 A;  3REA B;  3REB B;  2O88 A;  4D8K A;  2O9V A;  1KSW A;  1YN8 A;  1Z9Z A;  1WA7 A;  2LJ3 A;  3NGP A;  2L3P A;  1K0S A;  2DNU A;  3SHW A;  1E6H A;  3A98 A;  1PKS A;  4Z89 A;  1FYN A;  2D8H A;  1NG2 A;  2KRN A;  1ZX6 A;  2B86 A;  2MOX A;  1V1C A;  3EHR A;  4J9I A;  2RNA A;  2YUP A;  2W10 A;  2A28 A;  1UEC A;  1X2Q A;  1K4U S;  2NWM A;  2EYZ A;  2KXD A;  2YUN A;  1E7O A;  2RPN A;  1BBZ A;  1GCQ C;  3VS2 A;  4M4Z A;  1SPK A;  2BZY A;  1WXB A;  5IHN A;  1QLY A;  1TUC A;  2EGE A;  2JS0 A;  1ABQ A;  2L3S A;  1JXM A;  2IIM A;  1CSK A;  2EGC A;  1OV3 A;  2C0O A;  2AKK A;  3NMZ C;  2PTK A;  5IHI A;  2CH4 A;  2K9G A;  2JW4 A;  1JQQ A;  1U3O A;  2E5K A;  2YDL A;  2H8H A;  3GBQ A;  4AG2 C;  2XMF A;  2ABL A;  1JXO A;  2PNI A;  3THK A;  2EYX A;  4RUG A;  4RTW A;  2O2O A;  3M0Q A;  4LUD A;  2LX7 A;  2JS2 A;  3I9Q A;  2K79 A;  1GFC A;  2HEQ A;  4AFU C;  1UHF A;  2GNC A;  2M51 A;  1GFD A;  2O31 A;  3PVQ A;  1OEB A;  1ZLM A;  1PKT A;  1WFW A;  1BU1 A;  1LCK A;  1ZUU A;  2DL3 A;  1GL5 A;  1PWT A;  4JZ4 A;  1UUE A;  2LJ1 A;  2QDL A;  1NYF A;  4RTZ A;  1FMK A;  4J9D A;  2OJ2 A;  2DL7 A;  2FPD A;  4CC4 B;  1KJW A;  2ECZ A;  4JPB W;  4IIM A;  1QWF A;  3O5Z A;  1Y0M A;  2DF6 A;  2AK5 A;  1K0X A;  1T0J A;  4LUE A;  1EFN A;  1SRM A;  1RLP C;  1H8K A;  2CSQ A;  4AFZ C;  1SSH A;  4EIK A;  2DX1 A;  1CKA A;  2FG0 A;  4Y92 A;  2F2X A;  3H0F A;  2F2W A;  2EYW A;  1ABO A;  1PNJ A;  2C0I A;  2FRY A;  2KXC A;  1YP5 A;  3VS4 A;  1OPK A;  1AZG B;  1RLQ C;  5ECA A;  2ROT A;  3TSZ A;  3PE0 A;  4JZ3 A;  3TSW A;  2DMO A;  1KIK A;  2NUZ A;  2K2M A;  4J9E A;  1U5S A;  1H3H A;  1OPL A;  4OMM A;  1RI9 A;  1QKX A;  4CC7 A;  2DL5 A;  5EC7 A;  4Z8A A;  3M0U A;  2GBQ A;  4J9F A;  2CDT A;  1NEG A;  2BTT A;  1VA7 A;  2K7A A;  1M30 A;  4K11 A;  3RBB B;  4AG1 C;  1UHC A;  1B3Q A;  2JTE A;  2KNB B;  1UJ0 A;  5L23 A;  2L3Q A;  2HDA A;  2X3X D;  1I0C A;  1M3B A;  2CT4 A;  2OAW A;  2GTO A;  2J6K A;  2LQW A;  2OI3 A;  4CC3 A;  4R0K A;  2RQR A;  1AOJ A;  1PRL C;  1VYV A;  1GBQ A;  1UGV A;  4OMQ A;  3U23 A;  1X6B A;  1X69 A;  2CSI A;  2DJQ A;  1SHF A;  1SEM A;  3VS1 A;  3VS3 A;  1KFZ A;  1N5Z A;  3H0I A;  1NLO C;  2HBW A;  1A0N B;  3ULR B;  2J06 A;  4QT7 A;  5IH2 A;  2RQU A;  1ZSG A;  1W1F A;  2D0N A;  1QKW A;  1GRI A;  1UG1 A;  1CKB A;  2VKN A;  4OMO A;  3I35 A;  1ZUY A;  1W70 A;  2AKL A;  4X1V A;  4DEX A;  2ESW A;  1OOT A;  1IO6 A;  1T3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...