4OMOA

Crystal structure of the c-src tyrosine kinase sh3 domain mutant q128e
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGETGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 13
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4omoA00
2M51A 1PNJA 1IO6A 2KBTA 4ESRA 1WX6A 2FEIA 3M0TA 2YSQA 2CDTA 2KYBA 2J6FA 4R0KA 4RUGA 2O9VA 1KSWA 2A28A 2F2VA 3NPFA 1ZUYA 3H0IA 2K7AA 2EW3A 2YUOA 4RTYA 1GL5A 1NG2A 2KEAA 2ROLA 1GCPA 4F17A 1KJWA 2KXCA 1ABOA 2MCNA 1GBQA 1K1ZA 2MIOA 2YT6A 3A98A 3LH5A 2KT8A 1I07A 4CC2A 1K0SA 1WLPB 2EKHA 3SEMA 1B07A 2K2MA 2DNUA 2D1XA 4M4ZA 2DL4A 2VWFA 2B86A 2DL8A 4JJBA 1WYXA 4AG2C 1W1FA 2KT1A 2EGCA 1WIEA 1AOJA 3PVLA 4Y92A 1V1CA 4D8DA 1NYFA 4EIKA 1OPKA 2LMJA 1SPKA 1ZLMA 2RQVA 1SSHA 2CUBA 1VYTA 3VS5A 5I22A 3GBQA 3EG3A 2JW4A 2RQWA 2K6DA 1UJ0A 2JTEA 1MV0B 1UTIA 3PE0A 1GBRA 4J9IA 3FJ5A 2DL5A 4OMLA 1ZSGA 3JV3A 2DJQA 1NYGA 3VRYA 1I1JA 1PKTA 1QCFA 1UJYA 2OI3A 2YUQA 3TSWA 2RQUA 4LNPA 1OPLA 1M3AA 2OJ2A 4Z88A 2ENMA 2EGAA 2DE0X 4LUDA 5FW9A 2J6OA 2EYYA 1TUCA 2DF6A 2BTTA 2GNCA 3QWYA 1WI7A 3H0HA 2G6FX 1A0NB 1KIKA 3VS0A 4J9EA 2LZ6B 2K79A 2GQIA 2CREA 1U5SA 2YUPA 2O2OA 1G83A 2LCSA 2BZXA 3CQTA 3KFVA 2FPEA 1N5ZA 1TUDA 3REAB 2CSIA 1UHFA 2J6KA 2KYMA 3RBBB 2NWMA 2L2PA 1W70A 1X27A 2L3PA 4RTVA 3H41A 2KRNA 4J9BA 2AKLA 2FRYA 1U3OA 1QKXA 1SRLA 3VRZA 4AG1C 1JXOA 5IHNA 2EPDA 2DM1A 1RLQC 1KFZA 2RQTA 2DYBA 1ARKA 1WXBA 1M3BA 4OMNA 2DMOA 4GLMA 3R6NA 1RUWA 1NLPC 4F14A 1W6XA 1GCQC 3O5ZA 2ESWA 4DEYA 2SEMA 3UATA 4FSSA 2GTOA 1BB9A 3NGPA 2ROTA 4J9DA 5GJVB 2ED0A 2AZSA 4Z8AA 3UA7A 1VA7A 1PRLC 5FWBA 2RF0A 2RMOA 2DRKA 2L3QA 1GRIA 1Y0MA 2AKKA 2KRMA 1S1NA 2HDAA 2JXBA 1K4US 2GBQA 5IH2A 2FO0A 2EQIA 4HVWA 1T3LA 2C0TA 4AFSC 2I0NA 1JO8A 3NHNA 1PHTA 2P4RA 4HVUA 4WCIA 2DL3A 1YCSB 2CH4A 1NM7A 4JZ3A 1AWOA 1AEYA 2HEQA 4IIOA 4OMOA 4JJCA 2DX1A 2O9SA 1XOVA 1CSKA 2HBWA 3M0PA 4J9HA 2L0AA 5IXBA 2ED1A 1LCKA 4J9FA 1X2QA 1OOTA 2ECZA 1ZX6A 1AVZC 1E7OA 2KXDA 1X6GA 4QT7A 4GBQA 1OEBA 2PNIA 1NEBA 2A36A 1VYUA 2KGTA 3M0SA 2EYZA 1UFFA 2V1QA 1YNZA 1JQQA 2LJ1A 4X1VA 1WFWA 2JS2A 3TVTA 3IQLA 1WXTA 3TSZA 4RTUA 5I11A 3PVQA 2D0NA 2L3SA 1E6GA 2KRSA 4DEXA 5FWCA 4AFZC 2O88A 2RPNA 1UUEA 2CT3A 2DBKA 3RNJA 1PKSA 3ULRB 4LUEA 1FYNA 1T0JA 1AZEA 4ZNXA 2M0YA 2GGRA 2GTJA 1K9AA 3H0FA 2BZ8A 2BZYA 3I5SA 3U23A 3EHQA 4KRTA 1ABQA 3NMZC 1M8MA 1BBZA 2DILA 2O31A 2CH4W 2LX7A 3M0QA 2DRMA 2W10A 4CC3A 3VS2A 4J9GA 2LNHB 4LN2A 2K9GA 5HCKA 3VS7A 2KR3A 4RTZA 2DBMA 1HD3A 1X69A 1VYVA 1Z9QA 2FPDA 2LP5A 2SRCA 1GFDA 2W0ZA 2NUZA 3VS3A 1I0CA 5IHIA 1E6HA 1T0HA 2RNAA 2CSQA 3ZL7C 2QDLA 1ZBJA 2FG0A 1OV3A 2K3BA 1UECA 4IIMA 2VVKA 3EG2A 1QLYA 4AFQC 1AWXA 1RI9A 4J9CA 2AK5A 1SRMA 1WA7A 1YP5A 3SHWA 2X3XD 2RN8A 2JM9A 2C0OA 1HSQA 2EGEA 1G2BA 5GJWB 2LQNA 2EYXA 2IIMA 2A37A 2CUDA 3UF4A 4JZ4A 4OMMA 3QWXX 1X2KA 4F16A 1T3SA 5L23A 2EYWA 1H8KA 1HJDA 1JU5C 1H92A 1Y57A 2JT4A 1TG0A 2FPFA 1X43A 4JJDA 2D8JA 2EVRA 2D8HA 4OMPA 4D8KA 1UE9A 4HCKA 1AWJA 2J05A 2F2WA 2X3WD 1UGVA 3I35A 1GCQA 3VS1A 2F2XA 2FRWA 2YDLA 4JPBW 3I9QA 2DLPA 2JMAA 1MV3A 5IHKA 1M27C 1AZGB 1BK2A 1M3CA 2DA9A 1QKWA 2VKNA 2MOXA 4RTWA 2EBPA 3EHRA 3VS4A 1WXUA 3THKA 1UDLA 2LJ0A 3I5RA 1ZUUA 3VS6A 2DVJA 3EG0A 1GFCA 2KNBB 1EFNA 4CC7A 5ECAA 1X6BA 3C0CA 1QWFA 1UG1A 2J06A 2V1RA 2XMFA 1JEGA 1JXMA 2E5KA 4LE9A 4RTTA 2JM8A 2ABLA 3UA6A 1K76A 1M30A 1NEGA 1UHCA 2OAWA 2LQWA 4CC4B 1SHFA 4E6RA 2J7IA 2HCKA 1SHGA 1Z9ZA 2C0IA 2KE9A 4AFUC 2AZVA 2JS0A 1BU1A 4K11A 1ZUKA 1J3TA 2LJ3A 1CKAA 1AD5A 1YWPA 1CKBA 3M0RA 4HXJA 2A08A 1NLOC 1MUZA 4HVVA 4A63B 1YN8A 5IXFA 1PRMC 2RQRA 3EGUA 2JMCA 3EG1A 1AWWA 1K0XA 1FMKA 2CT4A 4RTXA 1PWTA 2HSPA 3REBB 4OMQA 4Z89A 2H8HA 2DL7A 1SEMA 1U06A 2YUNA 1B3QA 2KROA 2PTKA 1WDXA 3M0UA 2PZ1A 1QWEA 1H3HA 4ORZA 1RLPC 1YWOA 5EC7A
chains in the Genus database with same CATH superfamily
2DTHA 2QXFA 3OBWA 2KYBA 2HL5C 1TWBA 2E3IA 5GAOm 1K9MU 1KSWA 2A28A 2F2VA 4DBHA 4XTWA 2MK5A 5GAN7 2X4WA 1ZUYA 3INZA 4BE1A 2QA4Q 2QQBA 2YUOA 3OS0A 1Q81U 2KEAA 4O6JA 2ROLA 1VQ4Q 4XU0A 5FRNA 2KXCA 3P8DA 1VQOQ 2KT8A 1FMVA 1QCOA 2DNUA 2D1XA 4WTOB 4P5NA 4BI8B 4JJBA 5KE2A 4AG2C 1VQKA 1WIEA 3PVLA 4Y92A 1KQ2A 4EIKA 2QA4T 1ZLMA 2RJDA 3EG3A 2JW4A 2QQAA 2RQWA 1X75C 3PNWC 2K6DA 2DVEA 1M1FA 3LWIA 4E7KA 4JS5A 2E4HA 1UTIA 4LD6A 3JB9D 1VQ7A 3M58A 2PQWA 4J9IA 5CKFA 4O5VA 1OQKA 4PKCC 4XTZA 3CCUQ 4M7DE 3PFSA 4M7AE 1VQ6Q 2DL5A 1ZSGA 2DJQA 1PKTA 1UJYA 1M90U 2XU8A 5GAMh 4XTYA 1X01A 5LJ3e 4FL6A 3WXMB 2EQJA 4N4HA 1S72Q 2J6OA 1K9MC 4N4IA 2BTTA 1VQLA 4PJOF 4N0AC 3LGFA 1A0NB 1KIKA 2LZ6B 3DB4A 2RHYA 4FYVB 4ZGJB 4QQDA 1QP2A 3KFVA 4E7SA 3DB3A 4PFZA 1TUDA 2EYQA 4PNOA 3CCRQ 1Q95G 2D9TA 2HKQB 2KYMA 1M8VA 3ASKA 3WVEB 2OTJQ 1W70A 1ZA1B 2FYKA 3SFMA 4MZMA 1VQ8Q 2EPDA 2RQTA 2DYBA 4M78A 1WXBA 4M7DG 2DMOA 3R6NA 8ATCB 3MP1A 3QG1A 2ESWA 3X26B 5KYWB 4FSSA 1OI1A 1KC8C 2ROTA 5GJVB 4C5EA 1LPLA 4C8QA 4Z8AA 1K73R 3UA7A 1VA7A 3KBGA 2CZ1B 5LJ3d 5CVIA 4KT0E 3HFOA 2L3QA 2RMOA 1YBYA 2PU9B 4XTXA 3GNGA 1RL2A 1VQ7T 2LDMA 1GRIA 1Y0MA 1M2VA 3OW2S 2GCXA 1S1NA 2JTMA 3A8MB 3N5BB 3KXTA 1Q81R 5GAOq 2GBQA 5AYFA 1NPRA 2NUPA 4AFSC 2I0NA 5CAIA 3NHNA 4HVUA 2P4RA 2ZPGB 2DL3A 1YCSB 2M0OA 3TEEA 2QA4A 2C06A 2CH4A 1NM7A 2MYSA 3HFNA 4IIOA 4JJCA 1AT1B 2GFUA 4E7IA 4J9HA 3EG9A 5IXBA 1E7OA 1WGSA 3S3NA 2EJ9A 3OA6A 2QYZA 4Y28E 1Q7YU 1KC8R 3MCAB 3EFRA 4JS4A 5LJ5h 2PNIA 4J7IA 5GAMj 1NEBA 4BDYA 2A36A 1UFFA 2MWOA 1M1KU 3FEOA 4NOYA 2CKKA 3CMET 3QDRB 1WXTA 3TSZA 1Q86C 4ATOA 1YJWQ 1YHQQ 5J3BA 1ZA2B 1OU9A 3EGDB 2NUTA 5CKEA 1BCMA 4CI0C 1RADB 2L89A 2RHXA 1T0JA 2E65A 3VYHB 3CXCS 2GGRA 3EHQA 2DAQA 4KRTA 2FB7A 2DEQA 3NMZC 3L42A 1M8MA 2E10A 2Y4YA 4C5IA 1VQ8A 2XIDA 3EFOB 2FVUA 1XNIA 3CCQT 2HQXA 2DRMA 2PVDB 2K5LA 4J9GA 2E1HA 2RM4A 1YI2T 4M7AA 3OYFA 2P0KA 2ZAEA 1QQJA 5HCKA 3H9NA 2CZ6B 3PT9A 2AT1B 1HD3A 2DBMA 5LJ5e 4X34A 2LP5A 3QPHA 4E47A 2QG9B 1V76A 2NUZA 2LCCA 4C92C 5IHIA 3CCVQ 2V8KA 3VU3C 5CO7A 2YLBA 3L2VA 3FIFA 1G3YA 3LX7A 4F7UE 3WVDB 4ZGDB 2QDLA 4A4FA 1ZBJA 1OV3A 2K3BA 3LYIA 3LH0A 3CXCP 2RA2A 1QLYA 1C0MA 1VQ5T 1YI2A 4J9CA 1SRMA 1Y07A 2H3EB 1WA7A 5LJ5f 1YP5A 4FT2A 2X3XD 2RN8A 5KCHA 2PVGB 1Y71A 4C92D 2EYXA 1VQPA 1I5OB 4M7AG 2A37A 2CUDA 3DKMA 4JZ4A 2GQVA 4F16A 3QWXX 3JB9G 1VQ6A 4DOVA 5L23A 1H8KA 3QJYA 1WHKA 5CQXA 1YIJT 2JZ2A 4LDVA 2HSEB 1N8RU 1YITT 3JB9J 5GMKj 3J81E 2FPFA 3CC7T 4JJDA 2NYSA 4RG2A 1D09B 4MMKA 3OYAA 4M77A 4J83A 4D8KA 3OYNA 4M75C 1M4ZA 2XKOC 3CCQQ 3HPWA 2FRWA 5D6WA 3C12A 3I9QA 1MV3A 1M27C 1RI0A 2VXFA 2FHDA 2EBPA 4E7JA 1PSEA 4ZTFA 2VUBA 1UDLA 2RH2A 3HRUA 1I5LA 2CP7A 2CZ7B 4OMFB 3CD6A 1VQ4T 1RACB 2D6FA 5J39A 1JXMA 2E5KA 3S3MA 3VKIA 3FLGA 4LDUA 1JBMA 1M30A 4C0DC 3X25B 3TQ7P 2M16A 4M7DD 1M5Q1 2DD5A 2C0IA 2ZPIB 2LTOA 1QP3A 4LDXA 3G4SQ 1N6AA 3OYHA 5HK0A 3SB2A 1J3TA 2P0PA 1AD5A 1MUZA 3CD6Q 4IUVA 2LT4A 1KD1R 3L2ZA 4HVVA 4HA8A 4B9WA 3CC7Q 1YHQA 4XQ3A 4R56A 1FMWA 3DLLA 4QVDA 2HNIA 4C0GA 6AT1B 1AWWA 3OBYA 2EQMA 2VC8A 4RTXA 5I21A 1ZSZA 4F7UF 4Z89A 1SEMA 4N0AA 3G1JA 3JB9H 2PZ1A 5KYXB 1I81A 4NL2A 5GANf 2LQKA 2M51A 2QGGA 2XDDA 1WX6A 2YSQA 1KHIA 5GMKh 3NFCA 2VASA 5CKDA 3NPFA 3QKJA 2RHIA 2K7AA 3GPLA 4RTYA 1NG2A 3CBOA 1GCPA 3PMIA 4F17A 1KJWA 5GAMf 3LH5A 1K0SA 2EKHA 1B07A 2K2MA 2OAUA 2DL4A 2DPPB 2X4JA 1W1FA 2KT1A 2EGCA 4B9XA 1VOMA 3M4YA 1VQ9Q 4MDXA 1C1AA 2LMJA 3M59A 4EMKA 2RQVA 1SSHA 5I22A 3GBQA 1Q82U 1RAIB 2YRCA 5HY6A 5GANg 2E6NA 5EG2A 1RAAB 4OGEA 3G71A 1FX7A 3HL8A 1G3SA 1BCOA 2E12A 3CCJA 3JV3A 3OY9A 2R5AA 5GAN4 4PJOA 1K8AR 3RIRA 4R55A 3OYLA 3CCMQ 3TSWA 2DXUA 4HT9A 4IURA 2RQUA 4LNPA 4MZTA 1M3AA 3CPWP 2EGAA 5FW9A 1MMAA 2EYYA 2DIQA 2DF6A 4OP0A 1VQNQ 1N9RA 3OYMA 1TS9A 3VS0A 4B6MA 1KHCA 1R0BG 2K79A 1Y96B 2E6ZA 4ZGEB 5GMKi 2LCSA 3ZBDA 2FPEA 1N5ZA 4QVZA 3OYDA 3QSUA 5LJ3h 4M7DA 3REAB 2YRVA 2NWMA 4Y91A 5KE3A 4FIBA 5GAOn 1D1BA 2E70A 4PJOG 2RJCA 3H41A 2RHUA 5A0GA 4J9BA 2AKLA 4ZN3A 1Q82R 4ELZC 4AG1C 3JAME 5IHNA 2JNGA 2DM1A 1R77A 1KFZA 4FU6A 3L2WA 3JCMP 3OB9A 1M3BA 3EH2A 4OMNA 4A4HA 4HT8A 4LDYA 4XTUA 4FCYA 2A3LA 4GLMA 1RUWA 4FW2A 4F14A 1W6XA 2EWNA 4C92B 4VUBA 4DEYA 2SEMA 4JLIA 4M7AF 3JSCA 2COYA 3X28B 2X35A 2ED0A 4F7UB 4ANJA 1VQ6T 2AZSA 3CCJT 1BIBA 3V8KA 3MHXA 3CCMT 1F1BB 2DKGA 4A53A 2KRMA 1DJ7B 3PGGA 2JXBA 3OW2A 3QBYA 2RO0A 1M1GA 3RUXA 1VQMA 3M55A 4WCIA 3M54A 1I4K1 4JZ3A 1AWOA 2HEQA 1XOVA 5FRMA 5KCOA 3OYKA 3CMEQ 7AT1B 3FB9A 3M0PA 5CK9A 4PLIA 4BI3A 2ED1A 4J9FA 1X2QA 1OOTA 1ZX6A 2QTVA 1BKBA 4DBRA 2KXDA 3GLXA 1X6GA 4QT7A 3EG9B 4GBQA 1OEBA 2DYIA 3OYEA 3G7ZA 4XU1A 1BYMA 3DLMA 2DK3A 3EFSA 3JCMe 4C8QG 3VJPA 1WFWA 3MO8A 3I55T 3TU4K 3TVTA 3OMGA 3V8LA 3IQLA 3S3OA 2MI6A 3PVQA 2D0NA 2L3SA 2QAZA 5FWCA 1JB0E 2EFIA 2DBKA 1VIEA 2BE7D 3HTRA 5CKHA 4XU2A 4OB2B 2QASA 5LJ3g 4JDSA 2LX9A 2CP3A 1BI1A 1D1AA 1K9AA 2BZYA 3I5SA 3U23A 2FZGB 5A0LA 2VGNA 2DILA 2O31A 3CMEA 5IN1A 3CCST 5LJ5g 3CCLT 4C0FA 3FJPA 3HKSA 4XK8E 1IXDA 4EMHA 1U1SA 1OYXA 3LWHA 2KR3A 1SG5A 2VV5A 2CZ0B 1JJ2A 1X69A 2FPDA 2SRCA 1GFDA 2W0ZA 3BDUA 3VS3A 4M77E 1I0CA 1K8AC 1E6HA 1T0HA 2V8JA 2RNAA 1UB4A 5KH6A 4BE2A 4M7DB 1IREB 3H8ZA 2NUPB 1IB8A 1N9SA 3ZL7C 2K3YA 4BI4A 3V7SA 3CBMA 3MJXA 1XTDA 4C92E 1FXXA 1QVPA 4OB3B 1Y96A 4M7DF 1JJ2S 4C92F 5FU6B 4ELYC 1TTHB 3CCLA 3SHWA 2YLCA 3CPWS 2F5KA 4M75B 5KYXA 5FLXE 1HSQA 3EFOA 1K8AU 2HD0A 3R6OA 4X9DA 3MKDA 3RKXA 2IIMA 3UF4A 4JRPA 1X2KA 4M77G 1T3SA 2EYWA 3RDVA 2Y90A 1MGQA 3MP8A 2HMAA 1H92A 3CCEA 3RKYA 1EX4A 3JCMJ 4KULA 2F5TX 2B8AA 2BKDN 2D8JA 4C8QC 1W2BA 3SDZA 1RAFB 2OTLQ 1WHHA 2CP5A 1UGPB 3QHSA 4HCKA 3C4SA 3JB9F 2J05A 2X3WD 1YJNQ 3MPUB 4NS5A 2D0QB 2YDLA 3TREA 5D7UA 1YIJA 2QEXQ 5IAYA 1AZGB 1BK2A 1M3CA 3A8LB 2DA9A 4V2SA 4JJNK 3OYGA 3EHRA 1WXUA 1R8OB 2HQHA 1YJWA 3I5RA 2DVJA 5DLQE 2QQRA 2KNBB 2O01E 1IRXA 9ATCB 1EFNA 2PVOB 1MNEA 5GMKm 1QWFA 3RERA 2J06A 4PJOD 2V1RA 3E9FA 3FRNA 4D6WA 1JEGA 4BDZA 1D1CA 5LJ3j 3UA6A 2OAWA 1TOVA 4CC4B 4QQ6A 2HCKA 4KGXB 1Z9ZA 3ZFJA 2CS7A 2A7YA 4K11A 1Q7YR 3JCMf 1KC8U 4BUGA 4C0ZA 1VQ9A 1BIAA 1CKAA 2LJ3A 4FYWB 1YWPA 1S72T 4HXJA 4QQGA 5KYYB 4A4KA 2ZPBB 5KYWA 1MMDA 1NE8A 4A63B 5IXFA 4J7FA 5KYUA 2L8DA 2JMCA 1K0XA 1VQ4A 1D0YA 2CT4A 2HSPA 4M78B 3CD6T 2QQSA 1RABB 2H8HA 5GAN6 3JB9I 1U06A 2YUNA 1B3QA 3OS5A 2KROA 1WDXA 4RCBA 5GMKl 2CP2A 1PNJA 3JCMc 1IO6A 2KBTA 3EGDA 3T9NA 1VQNA 3OMCA 3OYYA 4JRQA 4R0KA 4RUGA 3QYHB 3BY7A 3SWNB 3J80E 1NPPA 4BD3A 4F04B 3E19A 5GANd 2HZYA 3H0IA 3KUFA 5A2QE 4IKFA 4M77B 2K4YA 2MIOA 3QJ6A 1YCYA 2YT6A 3A98A 1WLPB 3SEMA 3A8HB 3CC7A 2B86A 2COZA 2DL8A 1WYXA 2XK0A 2QEXT 4DA4A 3HRTA 3QYGB 1YITA 4PJOC 2OTJT 1G5VA 1BI2A 1V1CA 1NYFA 3CCUT 5J26A 1OPKA 4OB1B 1SPKA 2CUBA 3UWNA 4BY6B 3CBPA 4M75E 3JCMh 1QVGA 3CEYA 2JTEA 2P0QA 3CMAT 2HQEA 3I56T 3M56A 2WSEE 5GAMe 3L2RA 1GBRA 5GANe 5CCAA 1SKUB 1PG5B 4OMLA 2LRQA 2CYZB 2E5QA 4PJLA 2X9HA 2PUKB 1OPLA 4HCZA 2JTFA 4Z88A 4OGCA 3I56Q 1QVFA 2DE0X 2P4TA 2ZZDA 4LUDA 1KQSA 1TUCA 4KGVB 2EIFA 2GNCA 3QWYA 3URGA 4M75A 1VUBA 1YJ9Q 4C8QE 3E9GA 2G6FX 4PK4A 3CCQA 4IUQA 1WQ7A 1N8RR 5C6SA 1JRIA 2GQIA 2CREA 4XU3A 4ZTJA 2O2OA 2CGHA 3CQTA 1EZZB 2KI7A 1YJ9T 2RJFA 3RBBB 3MEUA 2XDPA 4RCCA 3E1SA 3P8HA 3OS1A 2KRNA 3F70A 1U3OA 3CC4A 1SRLA 3MEVA 3VRZA 1RLQC 2L5QA 3OW2P 5C0MA 4QKUA 3CCET 1GCQC 2EAYA 1QW1A 3O5ZA 2X51A 3G6EA 2R5MA 4II1A 1QVGP 3NGPA 5LJ5d 3EGXA 5I2SA 4BB7A 2M02A 3GF5A 4UC4A 1PRLC 3CCVA 2RF0A 5CKBA 2DRKA 3RKWA 1VIFA 2F69A 2YWWA 2AKKA 2LCLA 3PIPA 1VQ5Q 2ATCB 1WQWA 4LXCA 5IH2A 2CP6A 2EQIA 2ZCFB 4TVRA 1ZHIA 2KK4A 1T3LA 4HVWA 1TSFA 4A4GA 1JO8A 4M78G 1WHJA 1PHTA 4LD9K 2LVMA 1TUGB 4E7HA 3A5ZB 3A8OB 2DX1A 4C92G 4FSXA 2HBWA 3JCMV 2DXTA 1LCKA 1K73C 4M78E 1RAGB 2FZKB 4F7UA 3CC2T 5L8RE 4DQ2A 1FWZA 5GANh 2V8IA 2G3RA 3G6ET 3M0SA 2K2VA 4OB0B 3L1AA 3CCSA 8AT1B 1YNZA 2JJ9A 3SWNA 2M1HA 2RI5A 3VUBA 4EDUA 4RTUA 2IG0A 4DEXA 3CPWA 3UPUA 1H641 5GAN2 3CC4T 2O88A 3M5AA 2A0FB 1UUEA 1PKSA 4LUEA 1KQ1A 4ZNXA 3CCLQ 3CCRT 1YJ9A 1ABQA 2EJGA 2WSFE 3I55A 1VQPT 4RMOA 2CH4W 2LX7A 1Q86U 2HBPA 3MEAA 1K73U 2O4XA 1IHWA 1PM3A 1OX8A 1HK9A 3GIBA 1WPYA 3VS2A 2LNHB 1K9MR 3SWNC 5CQYA 1WHGA 1IGQA 2K9GA 3VS7A 2WACA 5FU7B 3VV0A 4RTZA 1W4SA 5GAMd 4M75F 2H3JA 2CSQA 4IUPA 4KGZB 3C95A 1AHJB 4M7AC 3CC2Q 1HYOA 1IHVA 1UECA 4IIMA 2OX7A 4JRKA 1QVFP 3UDCA 1MHNA 4Q5WA 3EG2A 1N8RC 1YIJQ 2YHTA 3MP6A 4ZN1A 1RI9A 4M7AB 2AK5A 5A0DA 3I56A 5GAOr 2DZCA 4PLLA 2E64A 3M9QA 2C0OA 3CCMA 2YRDA 1YITQ 5KYUB 3C94A 4A4EA 1W2BP 2E3HA 1HJDA 2GFAA 5KYYA 3RR6A 4PJNA 4HCBA 2OTJA 2BE9B 2JT4A 1D0XA 1KD1C 2XICA 5D6XA 4FYXB 2D8HA 2DERA 1UE9A 2DXCA 3G6EQ 2F2WA 1UGVA 4FM4B 3I35A 2BUDA 4BY6C 1YJNA 1RAHB 3VS1A 2HKNA 3OYIA 4JPBW 2F1LA 3E2UA 1VQLQ 2DLPA 2JMAA 4J6XA 4EMGA 4HCCA 2XG8D 3CC2A 2VKNA 3A1PA 4RTWA 3L2UA 1QCNA 3VS4A 3THKA 1UGQB 4LDWA 2LJ0A 4M7DC 1Y7XA 1ZUUA 3VS6A 3GOXA 1UGRB 2RK2A 1VQMQ 1OZ3A 3EG0A 1QVGS 1GFCA 1M90R 3SD4A 4CC7A 3C0CA 4KBMB 3G4ST 2E41A 4C5GA 1UG1A 2XMFA 1PD0A 1KG1A 4C8QF 3RMSA 1K76A 3V8JA 1YI2Q 2LQWA 2RI2A 5FU6C 3RESA 3LW5E 4E6RA 3HHTB 1VQ9T 3J7AF 4AFUC 1BU1A 3LGLA 5FU7C 2ZPFB 1U8RA 2PUOB 3OYCA 2LQ8A 3G71T 3M0RA 3EGXB 2A08A 2EQKA 5CIUA 1ZSZB 2JN0A 1LJOA 4C0DB 3ER0A 2OTLT 4PFOA 2RQRA 1MMNA 4RG8A 4OF1A 4AT1B 1ZQ1A 2M9UA 1FMKA 3REBB 2RI3A 4JRIA 1W2BS 4KUDK 2DZ9A 4M77C 4M7AD 2PTKA 2KQWA 4M78D 1XJWB 2LT1A 3OYBA 1H3HA 4ORZA 1AOJA 2VYTA 4ESRA 3CPFA 1G3WA 4EMKC 2FEIA 3M0TA 1WNLA 1D0ZA 2CDTA 1OU8A 2J6FA 2O9VA 3MEWA 4MMLA 4XAXB 3X24B 4DOWA 3OYJA 3JCMb 2EW3A 1GL5A 1KQSS 3CCEQ 1PSFA 1ABOA 2MCNA 3CXCA 1GBQA 1K1ZA 1NZ9A 4L6V5 5GMKe 1I07A 4PJMA 1B34A 4CC2A 2DTIA 2HAXA 3HP9A 4M4ZA 2VWFA 5D6YA 3CMAQ 1G8XA 5GANj 1NJIR 2R58A 4D8DA 4DBQA 3QXEB 1VQ7Q 2K57A 5AT1B 4PJOB 1IZ6A 1OX9A 1VYTA 3VS5A 3QO3A 4X9CA 2OTLA 3H6ZA 3LLRA 3FDRA 3HRSA 1UJ0A 1MV0B 3A8GB 3PE0A 2NUTB 1Q86R 4PJJA 1B7TA 4JUVA 5DY9A 4A54A 5HK3A 1D3BA 4JLGA 3FJ5A 1PC0A 2DXBA 1NYGA 3VRYA 1I1JA 4AMCA 3CCUA 1VQOA 1QCFA 2OI3A 2YUQA 2VXEA 1I8FA 1VQKT 2OJ2A 1G3TA 2ENMA 4BE0A 5FROA 2GF7A 2MWPA 1WI7A 3H0HA 1C6VX 2MPXC 4C8QD 4J6YA 4MDWA 5I2MA 4J9EA 4GLKA 2RB6A 1U5SA 2IPOB 2HL3A 2JOYA 2YUPA 1G83A 2BZXA 1JJ2P 3GNFB 1VQNT 1WJQA 1P92A 4M75G 2CSIA 1UHFA 2J6KA 4M77F 1WJRA 1SF9A 2L2PA 1X27A 2L3PA 4CRIA 4RTVA 1LNXA 2FRYA 1Q81C 3PIOA 1QKXA 3CCSQ 1O75A 1RAEB 3BW1A 3GP8A 1JXOA 2KVQG 5GAMg 3QDFA 1ARKA 1MNDA 2NLUA 1NLPC 5DLOA 4YTLA 2ZGWA 4OVAA 4E7ZA 3UATA 2GTOA 1BB9A 1VQOT 4FT4A 1S72A 4J9DA 1WZOA 2EQUA 1NBEB 3D7SB 4M78F 5CR2A 3M53A 4WF2A 1TU0B 5FWBA 3NTKA 4FW1A 3QZ5B 1M1KC 2JVVA 3VUZA 1V29B 2HDAA 3CCJQ 1UGSB 1UEBA 2KY9A 1VQ5A 1K4US 4N4GA 2FO0A 2KMTA 2COWA 2FZCB 5GAN8 1KQSP 2C0TA 2ZPEB 2XI9A 1ACMB 1AEYA 4OMOA 1LVKA 2O9SA 1CSKA 1M2OA 2L0AA 3I55Q 1QMCA 4M77D 1NJIC 2K5FA 2ECZA 1AVZC 1ZBXA 1YJWT 3NTIA 4C8QB 4KH1B 2QGFB 2KDSA 1WJSA 1VQKQ 1VYUA 1SSFA 2KGTA 2EYZA 2Y4XA 3CC4Q 4GY5A 3S6WA 2V1QA 1VQ8T 1JQQA 2LJ1A 4X1VA 1MMGA 2JS2A 1KD1U 2X4XA 2K3XA 5I11A 1ZSZC 1E6GA 2KRSA 4AFZC 2QQ9A 2RPNA 1M1KR 1YFNA 1D3BB 3UT1A 4MZPA 1R0CB 2CT3A 1TH7A 3RNJA 4QVCA 3ULRB 1FYNA 1AZEA 2DO3A 2M0YA 3PMTA 2MF2A 2GTJA 5KYNA 3FC3A 2FL7A 1KK7A 3H0FA 2BZ8A 3JRZA 2BIVA 4EMKB 2QDYB 3OS2A 1BBZA 2DFUA 4KUIA 1YHQT 4C92A 4FYYB 3NTHA 4J5YA 2VGMA 3M0QA 2L3RA 3BFMA 4PJOE 1TXQA 2EKOA 3JCMW 2W10A 4CC3A 4LN2A 1B34B 1M9SA 2Z0WA 4F7UG 2MAMA 1Z9QA 1VYVA 3O8VA 4E7LA 4XTVA 2IVWA 3G71Q 5HKCA 1NJIU 1X6OA 2EJFA 4QW2A 3JCMd 2FG0A 1O9SA 3PTAA 2CP0A 3ME9A 2QTXA 2VVKA 3EH1A 3X20B 4M78C 3JCMQ 4AFQC 1AWXA 2YXYA 3OSVA 1OZ2A 3VYGA 1M2VB 1BI3A 3BE3A 1N27A 3AT1B 4PFPA 2JM9A 2RHZA 5LL6S 5GAN3 1M90C 2EGEA 2O4XB 3V7RA 3CCVT 1HXDA 1G2BA 5GJWB 2LQNA 1GXIE 3EAEA 4OMMA 2JUFA 4J6WA 2AHJB 1JU5C 2AIRB 4L59A 3M57A 1Y57A 1YJNT 2R57A 4PL6A 1TG0A 1X43A 3L2QA 2EVRA 1PCXA 1BI0A 2X4YA 1VQPQ 4OMPA 3QUIA 5GAN5 1AWJA 2DEUA 3QZ9B 3Q1JA 3JCMg 1Q7YC 1GCQA 1IGUA 5LJ3f 5IT9E 2F2XA 1OULA 3HSBA 4IUUA 5IHKA 2RK1A 3META 2XD0A 1QKWA 2DTOA 3JCMX 1LOJA 2MOXA 3ZEHA 1PD1A 1WHMA 4J8OA 2DJZA 4KH0B 1H3ZA 4HKEA 3TCJA 2WSCE 2VB6A 2K5IA 3V7CA 3RMQA 4M75D 5ECAA 1X6BA 1XQHA 1WHLA 5LJ5j 1VQLT 5M9OA 2KAFA 3AHUA 2MMPA 4E2FB 5GAOp 4LE9A 4RTTA 1VQMT 2JM8A 3OSSC 2V26A 2ABLA 4BACA 5GAOl 2QI2A 3M4GA 1NEGA 1UHCA 2ZPHB 2DETA 2KSSA 2DD4A 1SHFA 2J7IA 1SHGA 2KE9A 3P8BB 2AZVA 2JS0A 2P84A 2QK0A 3OQ5A 1ZUKA 5DM7R 4L5GA 4IUTA 2RJEA 1CKBA 1U1TA 1NLOC 2DIGA 1EIFA 3CMAA 2XDBA 4NL3A 3QIIA 4DBFA 1YN8A 3BDLA 4ME7A 4EPCA 4RKUE 2LNVA 1PRMC 3EGUA 3EG1A 2XHCA 1PWTA 2LC4A 4OMQA 3CCRA 2I2LA 3G4SA 2DL7A 4Z02A 4C5HA 3M0UA 1QWEA 1Q82C 1QVFS 2QEXA 2RD1A 1RLPC 1YWOA 5EC7A
chains in the Genus database with same CATH topology
2M51A 1PNJA 1IO6A 2KBTA 4ESRA 1WX6A 2FEIA 3M0TA 2YSQA 2CDTA 2KYBA 2J6FA 4R0KA 4RUGA 2O9VA 1KSWA 2A28A 2F2VA 3NPFA 1ZUYA 3H0IA 2K7AA 2EW3A 2YUOA 4RTYA 1GL5A 1NG2A 2KEAA 2ROLA 1GCPA 4F17A 1KJWA 2KXCA 1ABOA 2MCNA 1GBQA 1K1ZA 2MIOA 2YT6A 3A98A 3LH5A 2KT8A 1I07A 4CC2A 1K0SA 1WLPB 2EKHA 3SEMA 1B07A 2K2MA 2DNUA 2D1XA 4M4ZA 2DL4A 2VWFA 2B86A 2DL8A 4JJBA 1WYXA 4AG2C 1W1FA 2KT1A 2EGCA 1WIEA 1AOJA 3PVLA 4Y92A 1V1CA 4D8DA 1NYFA 4EIKA 1OPKA 2LMJA 1SPKA 1ZLMA 2RQVA 1SSHA 2CUBA 1VYTA 3VS5A 5I22A 3GBQA 3EG3A 2JW4A 2RQWA 2K6DA 1UJ0A 2JTEA 1MV0B 1UTIA 3PE0A 1GBRA 4J9IA 3FJ5A 2DL5A 4OMLA 1ZSGA 3JV3A 2DJQA 1NYGA 3VRYA 1I1JA 1PKTA 1QCFA 1UJYA 2OI3A 2YUQA 3TSWA 2RQUA 4LNPA 1OPLA 1M3AA 2OJ2A 4Z88A 2ENMA 2EGAA 2DE0X 4LUDA 5FW9A 2J6OA 2EYYA 1TUCA 2DF6A 2BTTA 2GNCA 3QWYA 1WI7A 3H0HA 2G6FX 1A0NB 1KIKA 3VS0A 4J9EA 2LZ6B 2K79A 2GQIA 2CREA 1U5SA 2YUPA 2O2OA 1G83A 2LCSA 2BZXA 3CQTA 3KFVA 2FPEA 1N5ZA 1TUDA 3REAB 2CSIA 1UHFA 2J6KA 2KYMA 3RBBB 2NWMA 2L2PA 1W70A 1X27A 2L3PA 4RTVA 3H41A 2KRNA 4J9BA 2AKLA 2FRYA 1U3OA 1QKXA 1SRLA 3VRZA 4AG1C 1JXOA 5IHNA 2EPDA 2DM1A 1RLQC 1KFZA 2RQTA 2DYBA 1ARKA 1WXBA 1M3BA 4OMNA 2DMOA 4GLMA 3R6NA 1RUWA 1NLPC 4F14A 1W6XA 1GCQC 3O5ZA 2ESWA 4DEYA 2SEMA 3UATA 4FSSA 2GTOA 1BB9A 3NGPA 2ROTA 4J9DA 5GJVB 2ED0A 2AZSA 4Z8AA 3UA7A 1VA7A 1PRLC 5FWBA 2RF0A 2RMOA 2DRKA 2L3QA 1GRIA 1Y0MA 2AKKA 2KRMA 1S1NA 2HDAA 2JXBA 1K4US 2GBQA 5IH2A 2FO0A 2EQIA 4HVWA 1T3LA 2C0TA 4AFSC 2I0NA 1JO8A 3NHNA 1PHTA 2P4RA 4HVUA 4WCIA 2DL3A 1YCSB 2CH4A 1NM7A 4JZ3A 1AWOA 1AEYA 2HEQA 4IIOA 4OMOA 4JJCA 2DX1A 2O9SA 1XOVA 1CSKA 2HBWA 3M0PA 4J9HA 2L0AA 5IXBA 2ED1A 1LCKA 4J9FA 1X2QA 1OOTA 2ECZA 1ZX6A 1AVZC 1E7OA 2KXDA 1X6GA 4QT7A 4GBQA 1OEBA 2PNIA 1NEBA 2A36A 1VYUA 2KGTA 3M0SA 2EYZA 1UFFA 2V1QA 1YNZA 1JQQA 2LJ1A 4X1VA 1WFWA 2JS2A 3TVTA 3IQLA 1WXTA 3TSZA 4RTUA 5I11A 3PVQA 2D0NA 2L3SA 1E6GA 2KRSA 4DEXA 5FWCA 4AFZC 2O88A 2RPNA 1UUEA 2CT3A 2DBKA 3RNJA 1PKSA 3ULRB 4LUEA 1FYNA 1T0JA 1AZEA 4ZNXA 2M0YA 2GGRA 2GTJA 1K9AA 3H0FA 2BZ8A 2BZYA 3I5SA 3U23A 3EHQA 4KRTA 1ABQA 3NMZC 1M8MA 1BBZA 2DILA 2O31A 2CH4W 2LX7A 3M0QA 2DRMA 2W10A 4CC3A 3VS2A 4J9GA 2LNHB 4LN2A 2K9GA 5HCKA 3VS7A 2KR3A 4RTZA 2DBMA 1HD3A 1X69A 1VYVA 1Z9QA 2FPDA 2LP5A 2SRCA 1GFDA 2W0ZA 2NUZA 3VS3A 1I0CA 5IHIA 1E6HA 1T0HA 2RNAA 2CSQA 3ZL7C 2QDLA 1ZBJA 2FG0A 1OV3A 2K3BA 1UECA 4IIMA 2VVKA 3EG2A 1QLYA 4AFQC 1AWXA 1RI9A 4J9CA 2AK5A 1SRMA 1WA7A 1YP5A 3SHWA 2X3XD 2RN8A 2JM9A 2C0OA 1HSQA 2EGEA 1G2BA 5GJWB 2LQNA 2EYXA 2IIMA 2A37A 2CUDA 3UF4A 4JZ4A 4OMMA 3QWXX 1X2KA 4F16A 1T3SA 5L23A 2EYWA 1H8KA 1HJDA 1JU5C 1H92A 1Y57A 2JT4A 1TG0A 2FPFA 1X43A 4JJDA 2D8JA 2EVRA 2D8HA 4OMPA 4D8KA 1UE9A 4HCKA 1AWJA 2J05A 2F2WA 2X3WD 1UGVA 3I35A 1GCQA 3VS1A 2F2XA 2FRWA 2YDLA 4JPBW 3I9QA 2DLPA 2JMAA 1MV3A 5IHKA 1M27C 1AZGB 1BK2A 1M3CA 2DA9A 1QKWA 2VKNA 2MOXA 4RTWA 2EBPA 3EHRA 3VS4A 1WXUA 3THKA 1UDLA 2LJ0A 3I5RA 1ZUUA 3VS6A 2DVJA 3EG0A 1GFCA 2KNBB 1EFNA 4CC7A 5ECAA 1X6BA 3C0CA 1QWFA 1UG1A 2J06A 2V1RA 2XMFA 1JEGA 1JXMA 2E5KA 4LE9A 4RTTA 2JM8A 2ABLA 3UA6A 1K76A 1M30A 1NEGA 1UHCA 2OAWA 2LQWA 4CC4B 1SHFA 4E6RA 2J7IA 2HCKA 1SHGA 1Z9ZA 2C0IA 2KE9A 4AFUC 2AZVA 2JS0A 1BU1A 4K11A 1ZUKA 1J3TA 2LJ3A 1CKAA 1AD5A 1YWPA 1CKBA 3M0RA 4HXJA 2A08A 1NLOC 1MUZA 4HVVA 4A63B 1YN8A 5IXFA 1PRMC 2RQRA 3EGUA 2JMCA 3EG1A 1AWWA 1K0XA 1FMKA 2CT4A 4RTXA 1PWTA 2HSPA 3REBB 4OMQA 4Z89A 2H8HA 2DL7A 1SEMA 1U06A 2YUNA 1B3QA 2KROA 2PTKA 1WDXA 3M0UA 2PZ1A 1QWEA 1H3HA 4ORZA 1RLPC 1YWOA 5EC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M51 A;  1PNJ A;  1IO6 A;  2KBT A;  4ESR A;  1WX6 A;  2FEI A;  3M0T A;  2YSQ A;  2CDT A;  2KYB A;  2J6F A;  4R0K A;  4RUG A;  2O9V A;  1KSW A;  2A28 A;  2F2V A;  3NPF A;  1ZUY A;  3H0I A;  2K7A A;  2EW3 A;  2YUO A;  4RTY A;  1GL5 A;  1NG2 A;  2KEA A;  2ROL A;  1GCP A;  4F17 A;  1KJW A;  2KXC A;  1ABO A;  2MCN A;  1GBQ A;  1K1Z A;  2MIO A;  2YT6 A;  3A98 A;  3LH5 A;  2KT8 A;  1I07 A;  4CC2 A;  1K0S A;  1WLP B;  2EKH A;  3SEM A;  1B07 A;  2K2M A;  2DNU A;  2D1X A;  4M4Z A;  2DL4 A;  2VWF A;  2B86 A;  2DL8 A;  4JJB A;  1WYX A;  4AG2 C;  1W1F A;  2KT1 A;  2EGC A;  1WIE A;  1AOJ A;  3PVL A;  4Y92 A;  1V1C A;  4D8D A;  1NYF A;  4EIK A;  1OPK A;  2LMJ A;  1SPK A;  1ZLM A;  2RQV A;  1SSH A;  2CUB A;  1VYT A;  3VS5 A;  5I22 A;  3GBQ A;  3EG3 A;  2JW4 A;  2RQW A;  2K6D A;  1UJ0 A;  2JTE A;  1MV0 B;  1UTI A;  3PE0 A;  1GBR A;  4J9I A;  3FJ5 A;  2DL5 A;  4OML A;  1ZSG A;  3JV3 A;  2DJQ A;  1NYG A;  3VRY A;  1I1J A;  1PKT A;  1QCF A;  1UJY A;  2OI3 A;  2YUQ A;  3TSW A;  2RQU A;  4LNP A;  1OPL A;  1M3A A;  2OJ2 A;  4Z88 A;  2ENM A;  2EGA A;  2DE0 X;  4LUD A;  5FW9 A;  2J6O A;  2EYY A;  1TUC A;  2DF6 A;  2BTT A;  2GNC A;  3QWY A;  1WI7 A;  3H0H A;  2G6F X;  1A0N B;  1KIK A;  3VS0 A;  4J9E A;  2LZ6 B;  2K79 A;  2GQI A;  2CRE A;  1U5S A;  2YUP A;  2O2O A;  1G83 A;  2LCS A;  2BZX A;  3CQT A;  3KFV A;  2FPE A;  1N5Z A;  1TUD A;  3REA B;  2CSI A;  1UHF A;  2J6K A;  2KYM A;  3RBB B;  2NWM A;  2L2P A;  1W70 A;  1X27 A;  2L3P A;  4RTV A;  3H41 A;  2KRN A;  4J9B A;  2AKL A;  2FRY A;  1U3O A;  1QKX A;  1SRL A;  3VRZ A;  4AG1 C;  1JXO A;  5IHN A;  2EPD A;  2DM1 A;  1RLQ C;  1KFZ A;  2RQT A;  2DYB A;  1ARK A;  1WXB A;  1M3B A;  4OMN A;  2DMO A;  4GLM A;  3R6N A;  1RUW A;  1NLP C;  4F14 A;  1W6X A;  1GCQ C;  3O5Z A;  2ESW A;  4DEY A;  2SEM A;  3UAT A;  4FSS A;  2GTO A;  1BB9 A;  3NGP A;  2ROT A;  4J9D A;  5GJV B;  2ED0 A;  2AZS A;  4Z8A A;  3UA7 A;  1VA7 A;  1PRL C;  5FWB A;  2RF0 A;  2RMO A;  2DRK A;  2L3Q A;  1GRI A;  1Y0M A;  2AKK A;  2KRM A;  1S1N A;  2HDA A;  2JXB A;  1K4U S;  2GBQ A;  5IH2 A;  2FO0 A;  2EQI A;  4HVW A;  1T3L A;  2C0T A;  4AFS C;  2I0N A;  1JO8 A;  3NHN A;  1PHT A;  2P4R A;  4HVU A;  4WCI A;  2DL3 A;  1YCS B;  2CH4 A;  1NM7 A;  4JZ3 A;  1AWO A;  1AEY A;  2HEQ A;  4IIO A;  4OMO A;  4JJC A;  2DX1 A;  2O9S A;  1XOV A;  1CSK A;  2HBW A;  3M0P A;  4J9H A;  2L0A A;  5IXB A;  2ED1 A;  1LCK A;  4J9F A;  1X2Q A;  1OOT A;  2ECZ A;  1ZX6 A;  1AVZ C;  1E7O A;  2KXD A;  1X6G A;  4QT7 A;  4GBQ A;  1OEB A;  2PNI A;  1NEB A;  2A36 A;  1VYU A;  2KGT A;  3M0S A;  2EYZ A;  1UFF A;  2V1Q A;  1YNZ A;  1JQQ A;  2LJ1 A;  4X1V A;  1WFW A;  2JS2 A;  3TVT A;  3IQL A;  1WXT A;  3TSZ A;  4RTU A;  5I11 A;  3PVQ A;  2D0N A;  2L3S A;  1E6G A;  2KRS A;  4DEX A;  5FWC A;  4AFZ C;  2O88 A;  2RPN A;  1UUE A;  2CT3 A;  2DBK A;  3RNJ A;  1PKS A;  3ULR B;  4LUE A;  1FYN A;  1T0J A;  1AZE A;  4ZNX A;  2M0Y A;  2GGR A;  2GTJ A;  1K9A A;  3H0F A;  2BZ8 A;  2BZY A;  3I5S A;  3U23 A;  3EHQ A;  4KRT A;  1ABQ A;  3NMZ C;  1M8M A;  1BBZ A;  2DIL A;  2O31 A;  2CH4 W;  2LX7 A;  3M0Q A;  2DRM A;  2W10 A;  4CC3 A;  3VS2 A;  4J9G A;  2LNH B;  4LN2 A;  2K9G A;  5HCK A;  3VS7 A;  2KR3 A;  4RTZ A;  2DBM A;  1HD3 A;  1X69 A;  1VYV A;  1Z9Q A;  2FPD A;  2LP5 A;  2SRC A;  1GFD A;  2W0Z A;  2NUZ A;  3VS3 A;  1I0C A;  5IHI A;  1E6H A;  1T0H A;  2RNA A;  2CSQ A;  3ZL7 C;  2QDL A;  1ZBJ A;  2FG0 A;  1OV3 A;  2K3B A;  1UEC A;  4IIM A;  2VVK A;  3EG2 A;  1QLY A;  4AFQ C;  1AWX A;  1RI9 A;  4J9C A;  2AK5 A;  1SRM A;  1WA7 A;  1YP5 A;  3SHW A;  2X3X D;  2RN8 A;  2JM9 A;  2C0O A;  1HSQ A;  2EGE A;  1G2B A;  5GJW B;  2LQN A;  2EYX A;  2IIM A;  2A37 A;  2CUD A;  3UF4 A;  4JZ4 A;  4OMM A;  3QWX X;  1X2K A;  4F16 A;  1T3S A;  5L23 A;  2EYW A;  1H8K A;  1HJD A;  1JU5 C;  1H92 A;  1Y57 A;  2JT4 A;  1TG0 A;  2FPF A;  1X43 A;  4JJD A;  2D8J A;  2EVR A;  2D8H A;  4OMP A;  4D8K A;  1UE9 A;  4HCK A;  1AWJ A;  2J05 A;  2F2W A;  2X3W D;  1UGV A;  3I35 A;  1GCQ A;  3VS1 A;  2F2X A;  2FRW A;  2YDL A;  4JPB W;  3I9Q A;  2DLP A;  2JMA A;  1MV3 A;  5IHK A;  1M27 C;  1AZG B;  1BK2 A;  1M3C A;  2DA9 A;  1QKW A;  2VKN A;  2MOX A;  4RTW A;  2EBP A;  3EHR A;  3VS4 A;  1WXU A;  3THK A;  1UDL A;  2LJ0 A;  3I5R A;  1ZUU A;  3VS6 A;  2DVJ A;  3EG0 A;  1GFC A;  2KNB B;  1EFN A;  4CC7 A;  5ECA A;  1X6B A;  3C0C A;  1QWF A;  1UG1 A;  2J06 A;  2V1R A;  2XMF A;  1JEG A;  1JXM A;  2E5K A;  4LE9 A;  4RTT A;  2JM8 A;  2ABL A;  3UA6 A;  1K76 A;  1M30 A;  1NEG A;  1UHC A;  2OAW A;  2LQW A;  4CC4 B;  1SHF A;  4E6R A;  2J7I A;  2HCK A;  1SHG A;  1Z9Z A;  2C0I A;  2KE9 A;  4AFU C;  2AZV A;  2JS0 A;  1BU1 A;  4K11 A;  1ZUK A;  1J3T A;  2LJ3 A;  1CKA A;  1AD5 A;  1YWP A;  1CKB A;  3M0R A;  4HXJ A;  2A08 A;  1NLO C;  1MUZ A;  4HVV A;  4A63 B;  1YN8 A;  5IXF A;  1PRM C;  2RQR A;  3EGU A;  2JMC A;  3EG1 A;  1AWW A;  1K0X A;  1FMK A;  2CT4 A;  4RTX A;  1PWT A;  2HSP A;  3REB B;  4OMQ A;  4Z89 A;  2H8H A;  2DL7 A;  1SEM A;  1U06 A;  2YUN A;  1B3Q A;  2KRO A;  2PTK A;  1WDX A;  3M0U A;  2PZ1 A;  1QWE A;  1H3H A;  4ORZ A;  1RLP C;  1YWO A;  5EC7 A; 
#chains in the Genus database with same CATH topology
 2DTH A;  2QXF A;  3OBW A;  2KYB A;  2HL5 C;  1TWB A;  2E3I A;  5GAO m;  1K9M U;  1KSW A;  2A28 A;  2F2V A;  4DBH A;  4XTW A;  2MK5 A;  5GAN 7;  2X4W A;  1ZUY A;  3INZ A;  4BE1 A;  2QA4 Q;  2QQB A;  2YUO A;  3OS0 A;  1Q81 U;  2KEA A;  4O6J A;  2ROL A;  1VQ4 Q;  4XU0 A;  5FRN A;  2KXC A;  3P8D A;  1VQO Q;  2KT8 A;  1FMV A;  1QCO A;  2DNU A;  2D1X A;  4WTO B;  4P5N A;  4BI8 B;  4JJB A;  5KE2 A;  4AG2 C;  1VQK A;  1WIE A;  3PVL A;  4Y92 A;  1KQ2 A;  4EIK A;  2QA4 T;  1ZLM A;  2RJD A;  3EG3 A;  2JW4 A;  2QQA A;  2RQW A;  1X75 C;  3PNW C;  2K6D A;  2DVE A;  1M1F A;  3LWI A;  4E7K A;  4JS5 A;  2E4H A;  1UTI A;  4LD6 A;  3JB9 D;  1VQ7 A;  3M58 A;  2PQW A;  4J9I A;  5CKF A;  4O5V A;  1OQK A;  4PKC C;  4XTZ A;  3CCU Q;  4M7D E;  3PFS A;  4M7A E;  1VQ6 Q;  2DL5 A;  1ZSG A;  2DJQ A;  1PKT A;  1UJY A;  1M90 U;  2XU8 A;  5GAM h;  4XTY A;  1X01 A;  5LJ3 e;  4FL6 A;  3WXM B;  2EQJ A;  4N4H A;  1S72 Q;  2J6O A;  1K9M C;  4N4I A;  2BTT A;  1VQL A;  4PJO F;  4N0A C;  3LGF A;  1A0N B;  1KIK A;  2LZ6 B;  3DB4 A;  2RHY A;  4FYV B;  4ZGJ B;  4QQD A;  1QP2 A;  3KFV A;  4E7S A;  3DB3 A;  4PFZ A;  1TUD A;  2EYQ A;  4PNO A;  3CCR Q;  1Q95 G;  2D9T A;  2HKQ B;  2KYM A;  1M8V A;  3ASK A;  3WVE B;  2OTJ Q;  1W70 A;  1ZA1 B;  2FYK A;  3SFM A;  4MZM A;  1VQ8 Q;  2EPD A;  2RQT A;  2DYB A;  4M78 A;  1WXB A;  4M7D G;  2DMO A;  3R6N A;  8ATC B;  3MP1 A;  3QG1 A;  2ESW A;  3X26 B;  5KYW B;  4FSS A;  1OI1 A;  1KC8 C;  2ROT A;  5GJV B;  4C5E A;  1LPL A;  4C8Q A;  4Z8A A;  1K73 R;  3UA7 A;  1VA7 A;  3KBG A;  2CZ1 B;  5LJ3 d;  5CVI A;  4KT0 E;  3HFO A;  2L3Q A;  2RMO A;  1YBY A;  2PU9 B;  4XTX A;  3GNG A;  1RL2 A;  1VQ7 T;  2LDM A;  1GRI A;  1Y0M A;  1M2V A;  3OW2 S;  2GCX A;  1S1N A;  2JTM A;  3A8M B;  3N5B B;  3KXT A;  1Q81 R;  5GAO q;  2GBQ A;  5AYF A;  1NPR A;  2NUP A;  4AFS C;  2I0N A;  5CAI A;  3NHN A;  4HVU A;  2P4R A;  2ZPG B;  2DL3 A;  1YCS B;  2M0O A;  3TEE A;  2QA4 A;  2C06 A;  2CH4 A;  1NM7 A;  2MYS A;  3HFN A;  4IIO A;  4JJC A;  1AT1 B;  2GFU A;  4E7I A;  4J9H A;  3EG9 A;  5IXB A;  1E7O A;  1WGS A;  3S3N A;  2EJ9 A;  3OA6 A;  2QYZ A;  4Y28 E;  1Q7Y U;  1KC8 R;  3MCA B;  3EFR A;  4JS4 A;  5LJ5 h;  2PNI A;  4J7I A;  5GAM j;  1NEB A;  4BDY A;  2A36 A;  1UFF A;  2MWO A;  1M1K U;  3FEO A;  4NOY A;  2CKK A;  3CME T;  3QDR B;  1WXT A;  3TSZ A;  1Q86 C;  4ATO A;  1YJW Q;  1YHQ Q;  5J3B A;  1ZA2 B;  1OU9 A;  3EGD B;  2NUT A;  5CKE A;  1BCM A;  4CI0 C;  1RAD B;  2L89 A;  2RHX A;  1T0J A;  2E65 A;  3VYH B;  3CXC S;  2GGR A;  3EHQ A;  2DAQ A;  4KRT A;  2FB7 A;  2DEQ A;  3NMZ C;  3L42 A;  1M8M A;  2E10 A;  2Y4Y A;  4C5I A;  1VQ8 A;  2XID A;  3EFO B;  2FVU A;  1XNI A;  3CCQ T;  2HQX A;  2DRM A;  2PVD B;  2K5L A;  4J9G A;  2E1H A;  2RM4 A;  1YI2 T;  4M7A A;  3OYF A;  2P0K A;  2ZAE A;  1QQJ A;  5HCK A;  3H9N A;  2CZ6 B;  3PT9 A;  2AT1 B;  1HD3 A;  2DBM A;  5LJ5 e;  4X34 A;  2LP5 A;  3QPH A;  4E47 A;  2QG9 B;  1V76 A;  2NUZ A;  2LCC A;  4C92 C;  5IHI A;  3CCV Q;  2V8K A;  3VU3 C;  5CO7 A;  2YLB A;  3L2V A;  3FIF A;  1G3Y A;  3LX7 A;  4F7U E;  3WVD B;  4ZGD B;  2QDL A;  4A4F A;  1ZBJ A;  1OV3 A;  2K3B A;  3LYI A;  3LH0 A;  3CXC P;  2RA2 A;  1QLY A;  1C0M A;  1VQ5 T;  1YI2 A;  4J9C A;  1SRM A;  1Y07 A;  2H3E B;  1WA7 A;  5LJ5 f;  1YP5 A;  4FT2 A;  2X3X D;  2RN8 A;  5KCH A;  2PVG B;  1Y71 A;  4C92 D;  2EYX A;  1VQP A;  1I5O B;  4M7A G;  2A37 A;  2CUD A;  3DKM A;  4JZ4 A;  2GQV A;  4F16 A;  3QWX X;  3JB9 G;  1VQ6 A;  4DOV A;  5L23 A;  1H8K A;  3QJY A;  1WHK A;  5CQX A;  1YIJ T;  2JZ2 A;  4LDV A;  2HSE B;  1N8R U;  1YIT T;  3JB9 J;  5GMK j;  3J81 E;  2FPF A;  3CC7 T;  4JJD A;  2NYS A;  4RG2 A;  1D09 B;  4MMK A;  3OYA A;  4M77 A;  4J83 A;  4D8K A;  3OYN A;  4M75 C;  1M4Z A;  2XKO C;  3CCQ Q;  3HPW A;  2FRW A;  5D6W A;  3C12 A;  3I9Q A;  1MV3 A;  1M27 C;  1RI0 A;  2VXF A;  2FHD A;  2EBP A;  4E7J A;  1PSE A;  4ZTF A;  2VUB A;  1UDL A;  2RH2 A;  3HRU A;  1I5L A;  2CP7 A;  2CZ7 B;  4OMF B;  3CD6 A;  1VQ4 T;  1RAC B;  2D6F A;  5J39 A;  1JXM A;  2E5K A;  3S3M A;  3VKI A;  3FLG A;  4LDU A;  1JBM A;  1M30 A;  4C0D C;  3X25 B;  3TQ7 P;  2M16 A;  4M7D D;  1M5Q 1;  2DD5 A;  2C0I A;  2ZPI B;  2LTO A;  1QP3 A;  4LDX A;  3G4S Q;  1N6A A;  3OYH A;  5HK0 A;  3SB2 A;  1J3T A;  2P0P A;  1AD5 A;  1MUZ A;  3CD6 Q;  4IUV A;  2LT4 A;  1KD1 R;  3L2Z A;  4HVV A;  4HA8 A;  4B9W A;  3CC7 Q;  1YHQ A;  4XQ3 A;  4R56 A;  1FMW A;  3DLL A;  4QVD A;  2HNI A;  4C0G A;  6AT1 B;  1AWW A;  3OBY A;  2EQM A;  2VC8 A;  4RTX A;  5I21 A;  1ZSZ A;  4F7U F;  4Z89 A;  1SEM A;  4N0A A;  3G1J A;  3JB9 H;  2PZ1 A;  5KYX B;  1I81 A;  4NL2 A;  5GAN f;  2LQK A;  2M51 A;  2QGG A;  2XDD A;  1WX6 A;  2YSQ A;  1KHI A;  5GMK h;  3NFC A;  2VAS A;  5CKD A;  3NPF A;  3QKJ A;  2RHI A;  2K7A A;  3GPL A;  4RTY A;  1NG2 A;  3CBO A;  1GCP A;  3PMI A;  4F17 A;  1KJW A;  5GAM f;  3LH5 A;  1K0S A;  2EKH A;  1B07 A;  2K2M A;  2OAU A;  2DL4 A;  2DPP B;  2X4J A;  1W1F A;  2KT1 A;  2EGC A;  4B9X A;  1VOM A;  3M4Y A;  1VQ9 Q;  4MDX A;  1C1A A;  2LMJ A;  3M59 A;  4EMK A;  2RQV A;  1SSH A;  5I22 A;  3GBQ A;  1Q82 U;  1RAI B;  2YRC A;  5HY6 A;  5GAN g;  2E6N A;  5EG2 A;  1RAA B;  4OGE A;  3G71 A;  1FX7 A;  3HL8 A;  1G3S A;  1BCO A;  2E12 A;  3CCJ A;  3JV3 A;  3OY9 A;  2R5A A;  5GAN 4;  4PJO A;  1K8A R;  3RIR A;  4R55 A;  3OYL A;  3CCM Q;  3TSW A;  2DXU A;  4HT9 A;  4IUR A;  2RQU A;  4LNP A;  4MZT A;  1M3A A;  3CPW P;  2EGA A;  5FW9 A;  1MMA A;  2EYY A;  2DIQ A;  2DF6 A;  4OP0 A;  1VQN Q;  1N9R A;  3OYM A;  1TS9 A;  3VS0 A;  4B6M A;  1KHC A;  1R0B G;  2K79 A;  1Y96 B;  2E6Z A;  4ZGE B;  5GMK i;  2LCS A;  3ZBD A;  2FPE A;  1N5Z A;  4QVZ A;  3OYD A;  3QSU A;  5LJ3 h;  4M7D A;  3REA B;  2YRV A;  2NWM A;  4Y91 A;  5KE3 A;  4FIB A;  5GAO n;  1D1B A;  2E70 A;  4PJO G;  2RJC A;  3H41 A;  2RHU A;  5A0G A;  4J9B A;  2AKL A;  4ZN3 A;  1Q82 R;  4ELZ C;  4AG1 C;  3JAM E;  5IHN A;  2JNG A;  2DM1 A;  1R77 A;  1KFZ A;  4FU6 A;  3L2W A;  3JCM P;  3OB9 A;  1M3B A;  3EH2 A;  4OMN A;  4A4H A;  4HT8 A;  4LDY A;  4XTU A;  4FCY A;  2A3L A;  4GLM A;  1RUW A;  4FW2 A;  4F14 A;  1W6X A;  2EWN A;  4C92 B;  4VUB A;  4DEY A;  2SEM A;  4JLI A;  4M7A F;  3JSC A;  2COY A;  3X28 B;  2X35 A;  2ED0 A;  4F7U B;  4ANJ A;  1VQ6 T;  2AZS A;  3CCJ T;  1BIB A;  3V8K A;  3MHX A;  3CCM T;  1F1B B;  2DKG A;  4A53 A;  2KRM A;  1DJ7 B;  3PGG A;  2JXB A;  3OW2 A;  3QBY A;  2RO0 A;  1M1G A;  3RUX A;  1VQM A;  3M55 A;  4WCI A;  3M54 A;  1I4K 1;  4JZ3 A;  1AWO A;  2HEQ A;  1XOV A;  5FRM A;  5KCO A;  3OYK A;  3CME Q;  7AT1 B;  3FB9 A;  3M0P A;  5CK9 A;  4PLI A;  4BI3 A;  2ED1 A;  4J9F A;  1X2Q A;  1OOT A;  1ZX6 A;  2QTV A;  1BKB A;  4DBR A;  2KXD A;  3GLX A;  1X6G A;  4QT7 A;  3EG9 B;  4GBQ A;  1OEB A;  2DYI A;  3OYE A;  3G7Z A;  4XU1 A;  1BYM A;  3DLM A;  2DK3 A;  3EFS A;  3JCM e;  4C8Q G;  3VJP A;  1WFW A;  3MO8 A;  3I55 T;  3TU4 K;  3TVT A;  3OMG A;  3V8L A;  3IQL A;  3S3O A;  2MI6 A;  3PVQ A;  2D0N A;  2L3S A;  2QAZ A;  5FWC A;  1JB0 E;  2EFI A;  2DBK A;  1VIE A;  2BE7 D;  3HTR A;  5CKH A;  4XU2 A;  4OB2 B;  2QAS A;  5LJ3 g;  4JDS A;  2LX9 A;  2CP3 A;  1BI1 A;  1D1A A;  1K9A A;  2BZY A;  3I5S A;  3U23 A;  2FZG B;  5A0L A;  2VGN A;  2DIL A;  2O31 A;  3CME A;  5IN1 A;  3CCS T;  5LJ5 g;  3CCL T;  4C0F A;  3FJP A;  3HKS A;  4XK8 E;  1IXD A;  4EMH A;  1U1S A;  1OYX A;  3LWH A;  2KR3 A;  1SG5 A;  2VV5 A;  2CZ0 B;  1JJ2 A;  1X69 A;  2FPD A;  2SRC A;  1GFD A;  2W0Z A;  3BDU A;  3VS3 A;  4M77 E;  1I0C A;  1K8A C;  1E6H A;  1T0H A;  2V8J A;  2RNA A;  1UB4 A;  5KH6 A;  4BE2 A;  4M7D B;  1IRE B;  3H8Z A;  2NUP B;  1IB8 A;  1N9S A;  3ZL7 C;  2K3Y A;  4BI4 A;  3V7S A;  3CBM A;  3MJX A;  1XTD A;  4C92 E;  1FXX A;  1QVP A;  4OB3 B;  1Y96 A;  4M7D F;  1JJ2 S;  4C92 F;  5FU6 B;  4ELY C;  1TTH B;  3CCL A;  3SHW A;  2YLC A;  3CPW S;  2F5K A;  4M75 B;  5KYX A;  5FLX E;  1HSQ A;  3EFO A;  1K8A U;  2HD0 A;  3R6O A;  4X9D A;  3MKD A;  3RKX A;  2IIM A;  3UF4 A;  4JRP A;  1X2K A;  4M77 G;  1T3S A;  2EYW A;  3RDV A;  2Y90 A;  1MGQ A;  3MP8 A;  2HMA A;  1H92 A;  3CCE A;  3RKY A;  1EX4 A;  3JCM J;  4KUL A;  2F5T X;  2B8A A;  2BKD N;  2D8J A;  4C8Q C;  1W2B A;  3SDZ A;  1RAF B;  2OTL Q;  1WHH A;  2CP5 A;  1UGP B;  3QHS A;  4HCK A;  3C4S A;  3JB9 F;  2J05 A;  2X3W D;  1YJN Q;  3MPU B;  4NS5 A;  2D0Q B;  2YDL A;  3TRE A;  5D7U A;  1YIJ A;  2QEX Q;  5IAY A;  1AZG B;  1BK2 A;  1M3C A;  3A8L B;  2DA9 A;  4V2S A;  4JJN K;  3OYG A;  3EHR A;  1WXU A;  1R8O B;  2HQH A;  1YJW A;  3I5R A;  2DVJ A;  5DLQ E;  2QQR A;  2KNB B;  2O01 E;  1IRX A;  9ATC B;  1EFN A;  2PVO B;  1MNE A;  5GMK m;  1QWF A;  3RER A;  2J06 A;  4PJO D;  2V1R A;  3E9F A;  3FRN A;  4D6W A;  1JEG A;  4BDZ A;  1D1C A;  5LJ3 j;  3UA6 A;  2OAW A;  1TOV A;  4CC4 B;  4QQ6 A;  2HCK A;  4KGX B;  1Z9Z A;  3ZFJ A;  2CS7 A;  2A7Y A;  4K11 A;  1Q7Y R;  3JCM f;  1KC8 U;  4BUG A;  4C0Z A;  1VQ9 A;  1BIA A;  1CKA A;  2LJ3 A;  4FYW B;  1YWP A;  1S72 T;  4HXJ A;  4QQG A;  5KYY B;  4A4K A;  2ZPB B;  5KYW A;  1MMD A;  1NE8 A;  4A63 B;  5IXF A;  4J7F A;  5KYU A;  2L8D A;  2JMC A;  1K0X A;  1VQ4 A;  1D0Y A;  2CT4 A;  2HSP A;  4M78 B;  3CD6 T;  2QQS A;  1RAB B;  2H8H A;  5GAN 6;  3JB9 I;  1U06 A;  2YUN A;  1B3Q A;  3OS5 A;  2KRO A;  1WDX A;  4RCB A;  5GMK l;  2CP2 A;  1PNJ A;  3JCM c;  1IO6 A;  2KBT A;  3EGD A;  3T9N A;  1VQN A;  3OMC A;  3OYY A;  4JRQ A;  4R0K A;  4RUG A;  3QYH B;  3BY7 A;  3SWN B;  3J80 E;  1NPP A;  4BD3 A;  4F04 B;  3E19 A;  5GAN d;  2HZY A;  3H0I A;  3KUF A;  5A2Q E;  4IKF A;  4M77 B;  2K4Y A;  2MIO A;  3QJ6 A;  1YCY A;  2YT6 A;  3A98 A;  1WLP B;  3SEM A;  3A8H B;  3CC7 A;  2B86 A;  2COZ A;  2DL8 A;  1WYX A;  2XK0 A;  2QEX T;  4DA4 A;  3HRT A;  3QYG B;  1YIT A;  4PJO C;  2OTJ T;  1G5V A;  1BI2 A;  1V1C A;  1NYF A;  3CCU T;  5J26 A;  1OPK A;  4OB1 B;  1SPK A;  2CUB A;  3UWN A;  4BY6 B;  3CBP A;  4M75 E;  3JCM h;  1QVG A;  3CEY A;  2JTE A;  2P0Q A;  3CMA T;  2HQE A;  3I56 T;  3M56 A;  2WSE E;  5GAM e;  3L2R A;  1GBR A;  5GAN e;  5CCA A;  1SKU B;  1PG5 B;  4OML A;  2LRQ A;  2CYZ B;  2E5Q A;  4PJL A;  2X9H A;  2PUK B;  1OPL A;  4HCZ A;  2JTF A;  4Z88 A;  4OGC A;  3I56 Q;  1QVF A;  2DE0 X;  2P4T A;  2ZZD A;  4LUD A;  1KQS A;  1TUC A;  4KGV B;  2EIF A;  2GNC A;  3QWY A;  3URG A;  4M75 A;  1VUB A;  1YJ9 Q;  4C8Q E;  3E9G A;  2G6F X;  4PK4 A;  3CCQ A;  4IUQ A;  1WQ7 A;  1N8R R;  5C6S A;  1JRI A;  2GQI A;  2CRE A;  4XU3 A;  4ZTJ A;  2O2O A;  2CGH A;  3CQT A;  1EZZ B;  2KI7 A;  1YJ9 T;  2RJF A;  3RBB B;  3MEU A;  2XDP A;  4RCC A;  3E1S A;  3P8H A;  3OS1 A;  2KRN A;  3F70 A;  1U3O A;  3CC4 A;  1SRL A;  3MEV A;  3VRZ A;  1RLQ C;  2L5Q A;  3OW2 P;  5C0M A;  4QKU A;  3CCE T;  1GCQ C;  2EAY A;  1QW1 A;  3O5Z A;  2X51 A;  3G6E A;  2R5M A;  4II1 A;  1QVG P;  3NGP A;  5LJ5 d;  3EGX A;  5I2S A;  4BB7 A;  2M02 A;  3GF5 A;  4UC4 A;  1PRL C;  3CCV A;  2RF0 A;  5CKB A;  2DRK A;  3RKW A;  1VIF A;  2F69 A;  2YWW A;  2AKK A;  2LCL A;  3PIP A;  1VQ5 Q;  2ATC B;  1WQW A;  4LXC A;  5IH2 A;  2CP6 A;  2EQI A;  2ZCF B;  4TVR A;  1ZHI A;  2KK4 A;  1T3L A;  4HVW A;  1TSF A;  4A4G A;  1JO8 A;  4M78 G;  1WHJ A;  1PHT A;  4LD9 K;  2LVM A;  1TUG B;  4E7H A;  3A5Z B;  3A8O B;  2DX1 A;  4C92 G;  4FSX A;  2HBW A;  3JCM V;  2DXT A;  1LCK A;  1K73 C;  4M78 E;  1RAG B;  2FZK B;  4F7U A;  3CC2 T;  5L8R E;  4DQ2 A;  1FWZ A;  5GAN h;  2V8I A;  2G3R A;  3G6E T;  3M0S A;  2K2V A;  4OB0 B;  3L1A A;  3CCS A;  8AT1 B;  1YNZ A;  2JJ9 A;  3SWN A;  2M1H A;  2RI5 A;  3VUB A;  4EDU A;  4RTU A;  2IG0 A;  4DEX A;  3CPW A;  3UPU A;  1H64 1;  5GAN 2;  3CC4 T;  2O88 A;  3M5A A;  2A0F B;  1UUE A;  1PKS A;  4LUE A;  1KQ1 A;  4ZNX A;  3CCL Q;  3CCR T;  1YJ9 A;  1ABQ A;  2EJG A;  2WSF E;  3I55 A;  1VQP T;  4RMO A;  2CH4 W;  2LX7 A;  1Q86 U;  2HBP A;  3MEA A;  1K73 U;  2O4X A;  1IHW A;  1PM3 A;  1OX8 A;  1HK9 A;  3GIB A;  1WPY A;  3VS2 A;  2LNH B;  1K9M R;  3SWN C;  5CQY A;  1WHG A;  1IGQ A;  2K9G A;  3VS7 A;  2WAC A;  5FU7 B;  3VV0 A;  4RTZ A;  1W4S A;  5GAM d;  4M75 F;  2H3J A;  2CSQ A;  4IUP A;  4KGZ B;  3C95 A;  1AHJ B;  4M7A C;  3CC2 Q;  1HYO A;  1IHV A;  1UEC A;  4IIM A;  2OX7 A;  4JRK A;  1QVF P;  3UDC A;  1MHN A;  4Q5W A;  3EG2 A;  1N8R C;  1YIJ Q;  2YHT A;  3MP6 A;  4ZN1 A;  1RI9 A;  4M7A B;  2AK5 A;  5A0D A;  3I56 A;  5GAO r;  2DZC A;  4PLL A;  2E64 A;  3M9Q A;  2C0O A;  3CCM A;  2YRD A;  1YIT Q;  5KYU B;  3C94 A;  4A4E A;  1W2B P;  2E3H A;  1HJD A;  2GFA A;  5KYY A;  3RR6 A;  4PJN A;  4HCB A;  2OTJ A;  2BE9 B;  2JT4 A;  1D0X A;  1KD1 C;  2XIC A;  5D6X A;  4FYX B;  2D8H A;  2DER A;  1UE9 A;  2DXC A;  3G6E Q;  2F2W A;  1UGV A;  4FM4 B;  3I35 A;  2BUD A;  4BY6 C;  1YJN A;  1RAH B;  3VS1 A;  2HKN A;  3OYI A;  4JPB W;  2F1L A;  3E2U A;  1VQL Q;  2DLP A;  2JMA A;  4J6X A;  4EMG A;  4HCC A;  2XG8 D;  3CC2 A;  2VKN A;  3A1P A;  4RTW A;  3L2U A;  1QCN A;  3VS4 A;  3THK A;  1UGQ B;  4LDW A;  2LJ0 A;  4M7D C;  1Y7X A;  1ZUU A;  3VS6 A;  3GOX A;  1UGR B;  2RK2 A;  1VQM Q;  1OZ3 A;  3EG0 A;  1QVG S;  1GFC A;  1M90 R;  3SD4 A;  4CC7 A;  3C0C A;  4KBM B;  3G4S T;  2E41 A;  4C5G A;  1UG1 A;  2XMF A;  1PD0 A;  1KG1 A;  4C8Q F;  3RMS A;  1K76 A;  3V8J A;  1YI2 Q;  2LQW A;  2RI2 A;  5FU6 C;  3RES A;  3LW5 E;  4E6R A;  3HHT B;  1VQ9 T;  3J7A F;  4AFU C;  1BU1 A;  3LGL A;  5FU7 C;  2ZPF B;  1U8R A;  2PUO B;  3OYC A;  2LQ8 A;  3G71 T;  3M0R A;  3EGX B;  2A08 A;  2EQK A;  5CIU A;  1ZSZ B;  2JN0 A;  1LJO A;  4C0D B;  3ER0 A;  2OTL T;  4PFO A;  2RQR A;  1MMN A;  4RG8 A;  4OF1 A;  4AT1 B;  1ZQ1 A;  2M9U A;  1FMK A;  3REB B;  2RI3 A;  4JRI A;  1W2B S;  4KUD K;  2DZ9 A;  4M77 C;  4M7A D;  2PTK A;  2KQW A;  4M78 D;  1XJW B;  2LT1 A;  3OYB A;  1H3H A;  4ORZ A;  1AOJ A;  2VYT A;  4ESR A;  3CPF A;  1G3W A;  4EMK C;  2FEI A;  3M0T A;  1WNL A;  1D0Z A;  2CDT A;  1OU8 A;  2J6F A;  2O9V A;  3MEW A;  4MML A;  4XAX B;  3X24 B;  4DOW A;  3OYJ A;  3JCM b;  2EW3 A;  1GL5 A;  1KQS S;  3CCE Q;  1PSF A;  1ABO A;  2MCN A;  3CXC A;  1GBQ A;  1K1Z A;  1NZ9 A;  4L6V 5;  5GMK e;  1I07 A;  4PJM A;  1B34 A;  4CC2 A;  2DTI A;  2HAX A;  3HP9 A;  4M4Z A;  2VWF A;  5D6Y A;  3CMA Q;  1G8X A;  5GAN j;  1NJI R;  2R58 A;  4D8D A;  4DBQ A;  3QXE B;  1VQ7 Q;  2K57 A;  5AT1 B;  4PJO B;  1IZ6 A;  1OX9 A;  1VYT A;  3VS5 A;  3QO3 A;  4X9C A;  2OTL A;  3H6Z A;  3LLR A;  3FDR A;  3HRS A;  1UJ0 A;  1MV0 B;  3A8G B;  3PE0 A;  2NUT B;  1Q86 R;  4PJJ A;  1B7T A;  4JUV A;  5DY9 A;  4A54 A;  5HK3 A;  1D3B A;  4JLG A;  3FJ5 A;  1PC0 A;  2DXB A;  1NYG A;  3VRY A;  1I1J A;  4AMC A;  3CCU A;  1VQO A;  1QCF A;  2OI3 A;  2YUQ A;  2VXE A;  1I8F A;  1VQK T;  2OJ2 A;  1G3T A;  2ENM A;  4BE0 A;  5FRO A;  2GF7 A;  2MWP A;  1WI7 A;  3H0H A;  1C6V X;  2MPX C;  4C8Q D;  4J6Y A;  4MDW A;  5I2M A;  4J9E A;  4GLK A;  2RB6 A;  1U5S A;  2IPO B;  2HL3 A;  2JOY A;  2YUP A;  1G83 A;  2BZX A;  1JJ2 P;  3GNF B;  1VQN T;  1WJQ A;  1P92 A;  4M75 G;  2CSI A;  1UHF A;  2J6K A;  4M77 F;  1WJR A;  1SF9 A;  2L2P A;  1X27 A;  2L3P A;  4CRI A;  4RTV A;  1LNX A;  2FRY A;  1Q81 C;  3PIO A;  1QKX A;  3CCS Q;  1O75 A;  1RAE B;  3BW1 A;  3GP8 A;  1JXO A;  2KVQ G;  5GAM g;  3QDF A;  1ARK A;  1MND A;  2NLU A;  1NLP C;  5DLO A;  4YTL A;  2ZGW A;  4OVA A;  4E7Z A;  3UAT A;  2GTO A;  1BB9 A;  1VQO T;  4FT4 A;  1S72 A;  4J9D A;  1WZO A;  2EQU A;  1NBE B;  3D7S B;  4M78 F;  5CR2 A;  3M53 A;  4WF2 A;  1TU0 B;  5FWB A;  3NTK A;  4FW1 A;  3QZ5 B;  1M1K C;  2JVV A;  3VUZ A;  1V29 B;  2HDA A;  3CCJ Q;  1UGS B;  1UEB A;  2KY9 A;  1VQ5 A;  1K4U S;  4N4G A;  2FO0 A;  2KMT A;  2COW A;  2FZC B;  5GAN 8;  1KQS P;  2C0T A;  2ZPE B;  2XI9 A;  1ACM B;  1AEY A;  4OMO A;  1LVK A;  2O9S A;  1CSK A;  1M2O A;  2L0A A;  3I55 Q;  1QMC A;  4M77 D;  1NJI C;  2K5F A;  2ECZ A;  1AVZ C;  1ZBX A;  1YJW T;  3NTI A;  4C8Q B;  4KH1 B;  2QGF B;  2KDS A;  1WJS A;  1VQK Q;  1VYU A;  1SSF A;  2KGT A;  2EYZ A;  2Y4X A;  3CC4 Q;  4GY5 A;  3S6W A;  2V1Q A;  1VQ8 T;  1JQQ A;  2LJ1 A;  4X1V A;  1MMG A;  2JS2 A;  1KD1 U;  2X4X A;  2K3X A;  5I11 A;  1ZSZ C;  1E6G A;  2KRS A;  4AFZ C;  2QQ9 A;  2RPN A;  1M1K R;  1YFN A;  1D3B B;  3UT1 A;  4MZP A;  1R0C B;  2CT3 A;  1TH7 A;  3RNJ A;  4QVC A;  3ULR B;  1FYN A;  1AZE A;  2DO3 A;  2M0Y A;  3PMT A;  2MF2 A;  2GTJ A;  5KYN A;  3FC3 A;  2FL7 A;  1KK7 A;  3H0F A;  2BZ8 A;  3JRZ A;  2BIV A;  4EMK B;  2QDY B;  3OS2 A;  1BBZ A;  2DFU A;  4KUI A;  1YHQ T;  4C92 A;  4FYY B;  3NTH A;  4J5Y A;  2VGM A;  3M0Q A;  2L3R A;  3BFM A;  4PJO E;  1TXQ A;  2EKO A;  3JCM W;  2W10 A;  4CC3 A;  4LN2 A;  1B34 B;  1M9S A;  2Z0W A;  4F7U G;  2MAM A;  1Z9Q A;  1VYV A;  3O8V A;  4E7L A;  4XTV A;  2IVW A;  3G71 Q;  5HKC A;  1NJI U;  1X6O A;  2EJF A;  4QW2 A;  3JCM d;  2FG0 A;  1O9S A;  3PTA A;  2CP0 A;  3ME9 A;  2QTX A;  2VVK A;  3EH1 A;  3X20 B;  4M78 C;  3JCM Q;  4AFQ C;  1AWX A;  2YXY A;  3OSV A;  1OZ2 A;  3VYG A;  1M2V B;  1BI3 A;  3BE3 A;  1N27 A;  3AT1 B;  4PFP A;  2JM9 A;  2RHZ A;  5LL6 S;  5GAN 3;  1M90 C;  2EGE A;  2O4X B;  3V7R A;  3CCV T;  1HXD A;  1G2B A;  5GJW B;  2LQN A;  1GXI E;  3EAE A;  4OMM A;  2JUF A;  4J6W A;  2AHJ B;  1JU5 C;  2AIR B;  4L59 A;  3M57 A;  1Y57 A;  1YJN T;  2R57 A;  4PL6 A;  1TG0 A;  1X43 A;  3L2Q A;  2EVR A;  1PCX A;  1BI0 A;  2X4Y A;  1VQP Q;  4OMP A;  3QUI A;  5GAN 5;  1AWJ A;  2DEU A;  3QZ9 B;  3Q1J A;  3JCM g;  1Q7Y C;  1GCQ A;  1IGU A;  5LJ3 f;  5IT9 E;  2F2X A;  1OUL A;  3HSB A;  4IUU A;  5IHK A;  2RK1 A;  3MET A;  2XD0 A;  1QKW A;  2DTO A;  3JCM X;  1LOJ A;  2MOX A;  3ZEH A;  1PD1 A;  1WHM A;  4J8O A;  2DJZ A;  4KH0 B;  1H3Z A;  4HKE A;  3TCJ A;  2WSC E;  2VB6 A;  2K5I A;  3V7C A;  3RMQ A;  4M75 D;  5ECA A;  1X6B A;  1XQH A;  1WHL A;  5LJ5 j;  1VQL T;  5M9O A;  2KAF A;  3AHU A;  2MMP A;  4E2F B;  5GAO p;  4LE9 A;  4RTT A;  1VQM T;  2JM8 A;  3OSS C;  2V26 A;  2ABL A;  4BAC A;  5GAO l;  2QI2 A;  3M4G A;  1NEG A;  1UHC A;  2ZPH B;  2DET A;  2KSS A;  2DD4 A;  1SHF A;  2J7I A;  1SHG A;  2KE9 A;  3P8B B;  2AZV A;  2JS0 A;  2P84 A;  2QK0 A;  3OQ5 A;  1ZUK A;  5DM7 R;  4L5G A;  4IUT A;  2RJE A;  1CKB A;  1U1T A;  1NLO C;  2DIG A;  1EIF A;  3CMA A;  2XDB A;  4NL3 A;  3QII A;  4DBF A;  1YN8 A;  3BDL A;  4ME7 A;  4EPC A;  4RKU E;  2LNV A;  1PRM C;  3EGU A;  3EG1 A;  2XHC A;  1PWT A;  2LC4 A;  4OMQ A;  3CCR A;  2I2L A;  3G4S A;  2DL7 A;  4Z02 A;  4C5H A;  3M0U A;  1QWE A;  1Q82 C;  1QVF S;  2QEX A;  2RD1 A;  1RLP C;  1YWO A;  5EC7 A; 
#chains in the Genus database with same CATH homology
 2M51 A;  1PNJ A;  1IO6 A;  2KBT A;  4ESR A;  1WX6 A;  2FEI A;  3M0T A;  2YSQ A;  2CDT A;  2KYB A;  2J6F A;  4R0K A;  4RUG A;  2O9V A;  1KSW A;  2A28 A;  2F2V A;  3NPF A;  1ZUY A;  3H0I A;  2K7A A;  2EW3 A;  2YUO A;  4RTY A;  1GL5 A;  1NG2 A;  2KEA A;  2ROL A;  1GCP A;  4F17 A;  1KJW A;  2KXC A;  1ABO A;  2MCN A;  1GBQ A;  1K1Z A;  2MIO A;  2YT6 A;  3A98 A;  3LH5 A;  2KT8 A;  1I07 A;  4CC2 A;  1K0S A;  1WLP B;  2EKH A;  3SEM A;  1B07 A;  2K2M A;  2DNU A;  2D1X A;  4M4Z A;  2DL4 A;  2VWF A;  2B86 A;  2DL8 A;  4JJB A;  1WYX A;  4AG2 C;  1W1F A;  2KT1 A;  2EGC A;  1WIE A;  1AOJ A;  3PVL A;  4Y92 A;  1V1C A;  4D8D A;  1NYF A;  4EIK A;  1OPK A;  2LMJ A;  1SPK A;  1ZLM A;  2RQV A;  1SSH A;  2CUB A;  1VYT A;  3VS5 A;  5I22 A;  3GBQ A;  3EG3 A;  2JW4 A;  2RQW A;  2K6D A;  1UJ0 A;  2JTE A;  1MV0 B;  1UTI A;  3PE0 A;  1GBR A;  4J9I A;  3FJ5 A;  2DL5 A;  4OML A;  1ZSG A;  3JV3 A;  2DJQ A;  1NYG A;  3VRY A;  1I1J A;  1PKT A;  1QCF A;  1UJY A;  2OI3 A;  2YUQ A;  3TSW A;  2RQU A;  4LNP A;  1OPL A;  1M3A A;  2OJ2 A;  4Z88 A;  2ENM A;  2EGA A;  2DE0 X;  4LUD A;  5FW9 A;  2J6O A;  2EYY A;  1TUC A;  2DF6 A;  2BTT A;  2GNC A;  3QWY A;  1WI7 A;  3H0H A;  2G6F X;  1A0N B;  1KIK A;  3VS0 A;  4J9E A;  2LZ6 B;  2K79 A;  2GQI A;  2CRE A;  1U5S A;  2YUP A;  2O2O A;  1G83 A;  2LCS A;  2BZX A;  3CQT A;  3KFV A;  2FPE A;  1N5Z A;  1TUD A;  3REA B;  2CSI A;  1UHF A;  2J6K A;  2KYM A;  3RBB B;  2NWM A;  2L2P A;  1W70 A;  1X27 A;  2L3P A;  4RTV A;  3H41 A;  2KRN A;  4J9B A;  2AKL A;  2FRY A;  1U3O A;  1QKX A;  1SRL A;  3VRZ A;  4AG1 C;  1JXO A;  5IHN A;  2EPD A;  2DM1 A;  1RLQ C;  1KFZ A;  2RQT A;  2DYB A;  1ARK A;  1WXB A;  1M3B A;  4OMN A;  2DMO A;  4GLM A;  3R6N A;  1RUW A;  1NLP C;  4F14 A;  1W6X A;  1GCQ C;  3O5Z A;  2ESW A;  4DEY A;  2SEM A;  3UAT A;  4FSS A;  2GTO A;  1BB9 A;  3NGP A;  2ROT A;  4J9D A;  5GJV B;  2ED0 A;  2AZS A;  4Z8A A;  3UA7 A;  1VA7 A;  1PRL C;  5FWB A;  2RF0 A;  2RMO A;  2DRK A;  2L3Q A;  1GRI A;  1Y0M A;  2AKK A;  2KRM A;  1S1N A;  2HDA A;  2JXB A;  1K4U S;  2GBQ A;  5IH2 A;  2FO0 A;  2EQI A;  4HVW A;  1T3L A;  2C0T A;  4AFS C;  2I0N A;  1JO8 A;  3NHN A;  1PHT A;  2P4R A;  4HVU A;  4WCI A;  2DL3 A;  1YCS B;  2CH4 A;  1NM7 A;  4JZ3 A;  1AWO A;  1AEY A;  2HEQ A;  4IIO A;  4OMO A;  4JJC A;  2DX1 A;  2O9S A;  1XOV A;  1CSK A;  2HBW A;  3M0P A;  4J9H A;  2L0A A;  5IXB A;  2ED1 A;  1LCK A;  4J9F A;  1X2Q A;  1OOT A;  2ECZ A;  1ZX6 A;  1AVZ C;  1E7O A;  2KXD A;  1X6G A;  4QT7 A;  4GBQ A;  1OEB A;  2PNI A;  1NEB A;  2A36 A;  1VYU A;  2KGT A;  3M0S A;  2EYZ A;  1UFF A;  2V1Q A;  1YNZ A;  1JQQ A;  2LJ1 A;  4X1V A;  1WFW A;  2JS2 A;  3TVT A;  3IQL A;  1WXT A;  3TSZ A;  4RTU A;  5I11 A;  3PVQ A;  2D0N A;  2L3S A;  1E6G A;  2KRS A;  4DEX A;  5FWC A;  4AFZ C;  2O88 A;  2RPN A;  1UUE A;  2CT3 A;  2DBK A;  3RNJ A;  1PKS A;  3ULR B;  4LUE A;  1FYN A;  1T0J A;  1AZE A;  4ZNX A;  2M0Y A;  2GGR A;  2GTJ A;  1K9A A;  3H0F A;  2BZ8 A;  2BZY A;  3I5S A;  3U23 A;  3EHQ A;  4KRT A;  1ABQ A;  3NMZ C;  1M8M A;  1BBZ A;  2DIL A;  2O31 A;  2CH4 W;  2LX7 A;  3M0Q A;  2DRM A;  2W10 A;  4CC3 A;  3VS2 A;  4J9G A;  2LNH B;  4LN2 A;  2K9G A;  5HCK A;  3VS7 A;  2KR3 A;  4RTZ A;  2DBM A;  1HD3 A;  1X69 A;  1VYV A;  1Z9Q A;  2FPD A;  2LP5 A;  2SRC A;  1GFD A;  2W0Z A;  2NUZ A;  3VS3 A;  1I0C A;  5IHI A;  1E6H A;  1T0H A;  2RNA A;  2CSQ A;  3ZL7 C;  2QDL A;  1ZBJ A;  2FG0 A;  1OV3 A;  2K3B A;  1UEC A;  4IIM A;  2VVK A;  3EG2 A;  1QLY A;  4AFQ C;  1AWX A;  1RI9 A;  4J9C A;  2AK5 A;  1SRM A;  1WA7 A;  1YP5 A;  3SHW A;  2X3X D;  2RN8 A;  2JM9 A;  2C0O A;  1HSQ A;  2EGE A;  1G2B A;  5GJW B;  2LQN A;  2EYX A;  2IIM A;  2A37 A;  2CUD A;  3UF4 A;  4JZ4 A;  4OMM A;  3QWX X;  1X2K A;  4F16 A;  1T3S A;  5L23 A;  2EYW A;  1H8K A;  1HJD A;  1JU5 C;  1H92 A;  1Y57 A;  2JT4 A;  1TG0 A;  2FPF A;  1X43 A;  4JJD A;  2D8J A;  2EVR A;  2D8H A;  4OMP A;  4D8K A;  1UE9 A;  4HCK A;  1AWJ A;  2J05 A;  2F2W A;  2X3W D;  1UGV A;  3I35 A;  1GCQ A;  3VS1 A;  2F2X A;  2FRW A;  2YDL A;  4JPB W;  3I9Q A;  2DLP A;  2JMA A;  1MV3 A;  5IHK A;  1M27 C;  1AZG B;  1BK2 A;  1M3C A;  2DA9 A;  1QKW A;  2VKN A;  2MOX A;  4RTW A;  2EBP A;  3EHR A;  3VS4 A;  1WXU A;  3THK A;  1UDL A;  2LJ0 A;  3I5R A;  1ZUU A;  3VS6 A;  2DVJ A;  3EG0 A;  1GFC A;  2KNB B;  1EFN A;  4CC7 A;  5ECA A;  1X6B A;  3C0C A;  1QWF A;  1UG1 A;  2J06 A;  2V1R A;  2XMF A;  1JEG A;  1JXM A;  2E5K A;  4LE9 A;  4RTT A;  2JM8 A;  2ABL A;  3UA6 A;  1K76 A;  1M30 A;  1NEG A;  1UHC A;  2OAW A;  2LQW A;  4CC4 B;  1SHF A;  4E6R A;  2J7I A;  2HCK A;  1SHG A;  1Z9Z A;  2C0I A;  2KE9 A;  4AFU C;  2AZV A;  2JS0 A;  1BU1 A;  4K11 A;  1ZUK A;  1J3T A;  2LJ3 A;  1CKA A;  1AD5 A;  1YWP A;  1CKB A;  3M0R A;  4HXJ A;  2A08 A;  1NLO C;  1MUZ A;  4HVV A;  4A63 B;  1YN8 A;  5IXF A;  1PRM C;  2RQR A;  3EGU A;  2JMC A;  3EG1 A;  1AWW A;  1K0X A;  1FMK A;  2CT4 A;  4RTX A;  1PWT A;  2HSP A;  3REB B;  4OMQ A;  4Z89 A;  2H8H A;  2DL7 A;  1SEM A;  1U06 A;  2YUN A;  1B3Q A;  2KRO A;  2PTK A;  1WDX A;  3M0U A;  2PZ1 A;  1QWE A;  1H3H A;  4ORZ A;  1RLP C;  1YWO A;  5EC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...