4OMOA

Crystal structure of the c-src tyrosine kinase sh3 domain mutant q128e
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
b'GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGETGYIPSNYVAPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 13
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4omoA00
1GCQA 1N5ZA 2RN8A 3O5ZA 3EG2A 3UF4A 2YUNA 3THKA 4JJBA 1AZEA 2DILA 2HDAA 2KBTA 3EG3A 1UE9A 2FRWA 2P4RA 4LE9A 2X3WD 3VS7A 1GBQA 2LJ1A 1ZUUA 4OMLA 4HCKA 3VS0A 3M0SA 1AD5A 1FMKA 2PNIA 1UHFA 1NLPC 2HSPA 1OV3A 1X27A 2KR3A 4GLMA 1WXUA 2FPEA 1PKTA 1KIKA 2GNCA 1V1CA 1K4US 2EYWA 1K0SA 1AOJA 1AZGB 2LJ3A 3KFVA 2RPNA 1TUDA 2EGAA 1Z9ZA 3EGUA 4EIKA 3VRYA 2EPDA 4HVVA 1BK2A 2M0YA 2CT4A 1T3LA 1I0CA 4JPBW 4Z8AA 3M0TA 1Y0MA 1SHGA 2CUDA 2DM1A 1B07A 1S1NA 1AWWA 1YNZA 2LNHB 1OPKA 4AFUC 4D8KA 2DRKA 4IIMA 3VS5A 3CQTA 1I1JA 1YWPA 4J9BA 2ROLA 2KXCA 1UDLA 2AZSA 4DEXA 3SHWA 2DL7A 2VVKA 2DMOA 1RUWA 1OPLA 3QWXX 2EBPA 3UATA 3I5RA 1X2KA 2HCKA 2XMFA 1AEYA 2DL3A 5I11A 1WIEA 2J6OA 2W0ZA 2J7IA 2O88A 1FYNA 1ARKA 2DYBA 2I0NA 2K6DA 1UGVA 2KNBB 2DBMA 2EGCA 3PE0A 3UA6A 2IIMA 3A98A 2AKKA 2V1RA 2JW4A 2RNAA 2GQIA 1RLQC 1QWFA 4LUDA 1WDXA 2RMOA 2DJQA 3H0FA 1YP5A 2KYMA 1WI7A 1WXTA 2NWMA 1HSQA 1SHFA 5FWBA 3RBBB 3VS3A 2L3QA 2EYZA 2PTKA 2RF0A 5IHKA 4HXJA 2KRNA 3JV3A 2FG0A 2QDLA 1KJWA 2KE9A 1ABQA 1Z9QA 2DVJA 1GRIA 2W10A 2YDLA 3PVQA 1PRLC 2LQNA 1BU1A 2ABLA 2ESWA 4J9IA 4ZNXA 1EFNA 4RTXA 1B3QA 2J05A 4LNPA 2RQUA 3M0PA 4A63B 2VWFA 2ED0A 2C0TA 4J9HA 2KT8A 2GBQA 3EHRA 2L3SA 5GJVB 2C0IA 2BZXA 2LJ0A 3U23A 2F2VA 1W6XA 2DL5A 1WX6A 2JXBA 4JZ4A 1NEGA 4GBQA 1LCKA 1SEMA 4RUGA 1NEBA 1J3TA 2H8HA 3NHNA 5I22A 4CC2A 1UUEA 1M3CA 1W70A 4RTUA 4RTWA 1AVZC 1M3AA 3M0RA 1MV0B 2JM9A 1H3HA 3SEMA 2YT6A 3VS2A 2JTEA 3I35A 3H0HA 1HD3A 3IQLA 4J9FA 2KGTA 4Z88A 1HJDA 2DNUA 1UG1A 1W1FA 1QKWA 2BZ8A 4RTTA 3RNJA 4RTVA 4K11A 1A0NB 2O31A 1PNJA 2JM8A 1SSHA 3REAB 2NUZA 2CH4A 2OAWA 2F2XA 2EKHA 4OMPA 2LCSA 2LZ6B 1G2BA 4LN2A 1CKBA 1QCFA 4J9DA 4FSSA 3NGPA 4RTYA 2GTJA 1NYFA 1TUCA 1SRMA 4RTZA 4OMOA 1X69A 4J9CA 4AFZC 4OMQA 3VS1A 4R0KA 4CC4B 2G6FX 2L0AA 2O2OA 3I9QA 1JO8A 1NM7A 2E5KA 2YSQA 2JMCA 2L3PA 1ZBJA 1YN8A 4AFSC 2EYXA 1E7OA 1YCSB 2DBKA 2GGRA 3M0QA 4AG1C 1TG0A 1G83A 1SPKA 1JU5C 2EGEA 1QKXA 1YWOA 1ZSGA 4Z89A 1VYTA 1PWTA 3REBB 1UECA 4DEYA 4HVWA 2V1QA 3EG0A 3LH5A 5IHIA 2JS0A 3ULRB 2EW3A 2YUOA 1T0HA 1E6HA 2L2PA 1ZUYA 2DRMA 2ED1A 1UJ0A 2RQWA 2OI3A 3H0IA 2YUPA 5FWCA 3EHQA 1KFZA 2LX7A 1NLOC 5IHNA 2KYBA 2DF6A 2JS2A 2ECZA 2J6FA 2AKLA 4AG2C 5IXBA 5IH2A 4WCIA 2A08A 3TSWA 1JQQA 1M27C 1X6GA 1K76A 1E6GA 3VRZA 2RQVA 4CC3A 2EQIA 4LUEA 5ECAA 2DLPA 1K0XA 2KRSA 1WLPB 1UHCA 2CSQA 5HCKA 1JXOA 2K79A 1T0JA 2DA9A 2X3XD 1UJYA 2KRMA 2LP5A 2M51A 2KXDA 3UA7A 2MIOA 3I5SA 2HBWA 4OMMA 1NG2A 2YUQA 1M30A 2K3BA 5IXFA 2ENMA 2CH4W 3M0UA 3ZL7C 2JMAA 3NMZC 3TVTA 4OMNA 2HEQA 1WXBA 2DE0X 1MV3A 2O9VA 2C0OA 4JJCA 4J9EA 1QLYA 1U3OA 4QT7A 2RQTA 1WYXA 2K2MA 2D0NA 2FEIA 2SEMA 4E6RA 1JXMA 2EYYA 1RLPC 1I07A 1VYUA 1CKAA 1OOTA 2KT1A 4JJDA 1K1ZA 1X2QA 2D1XA 3C0CA 2JT4A 4CC7A 2A37A 2F2WA 4Y92A 1T3SA 1UTIA 2DX1A 2SRCA 1VYVA 1NYGA 4ORZA 1OEBA 4ESRA 1XOVA 3VS4A 2CT3A 1QWEA 1IO6A 2K9GA 1AWOA 4D8DA 3EG1A 2AK5A 2BZYA 1AWXA 4KRTA 2RQRA 1H8KA 1PKSA 1RI9A 2OJ2A 2A28A 1M8MA 2J06A 2VKNA 2CREA 4M4ZA 1KSWA 4AFQC 1PHTA 2D8JA 2LMJA 1VA7A 2O9SA 2DL8A 3FJ5A 4X1VA 5L23A 1WFWA 1M3BA 1BB9A 1WA7A 1ZUKA 1JEGA 1ZX6A 4JZ3A 2CSIA 3VS6A 1K9AA 1GL5A 1MUZA 1AWJA 2A36A 2D8HA 4J9GA 2MOXA 2FO0A 1X6BA 1U5SA 1PRMC 2KROA 3NPFA 1GFCA 1BBZA 3GBQA 1UFFA 1X43A 3R6NA 1GCPA 5GJWB 2MCNA 2FPDA 2CUBA 2GTOA 2CDTA 1H92A 1CSKA 1ABOA 2ROTA 3TSZA 1GBRA 1Y57A 1U06A 2AZVA 5FW9A 5EC7A 2FRYA 2KEAA 3QWYA 4F16A 2LQWA 2BTTA 4F14A 1GFDA 1SRLA 2PZ1A 3PVLA 2B86A 4F17A 1ZLMA 2DL4A 2FPFA 1GCQC 4IIOA 2EVRA 2J6KA 4HVUA 3H41A 2K7AA
chains in the Genus database with same CATH superfamily
4M7DC 4PKCC 3THKA 3AT1B 3QKJA 1N8RC 1I81A 3VS0A 4C5HA 3M0SA 1AD5A 2X51A 1UEBA 1UHFA 3MEUA 1K9MU 1QQJA 1X27A 2DEQA 3CBOA 2HSEB 2HZYA 1VQNA 2CGHA 1K8AC 1AOJA 1AZGB 2ZPEB 3SFMA 2EGAA 3HFNA 3CCSA 1Z9ZA 3T9NA 3OMGA 3CC4T 3VRYA 2PUKB 4HVVA 4PJOG 3CMAA 2CT4A 1VUBA 1Q81U 3MEVA 5GAOm 2HNIA 3OW2P 2ZPGB 3M0TA 4B9XA 2QGGA 5C0MA 2CUDA 4GLKA 4M7AD 1G3YA 1NPPA 1UGQB 3BFMA 2XDBA 3OYEA 1S1NA 4J6XA 3SB2A 3VS5A 2QEXT 2ATCB 1D0YA 1DJ7B 1YFNA 1LPLA 1YWPA 2DD4A 1PM3A 5IN1A 5GMKl 3VV0A 3JCMQ 1YI2T 4DEXA 3CCQT 3CCVA 1KC8U 2EYQA 2VVKA 2GQVA 2DO3A 4Y91A 1X2KA 3CCRT 4J5YA 1WIEA 2VUBA 3MKDA 2MWOA 1IXDA 2J7IA 2O88A 4OB0B 2BUDA 2I0NA 2K6DA 2ZGWA 3PGGA 3JCMJ 3RKXA 2VXEA 1RAFB 3GLXA 2AKKA 1QP2A 2V1RA 2VXFA 2R58A 3LGFA 2GQIA 4QVZA 1RLQC 2E64A 4LUDA 1WDXA 2RMOA 1SF9A 2DJQA 1TUGB 1YP5A 2FB7A 2QA4Q 4C0DC 2NWMA 2RO0A 2MMPA 3M54A 4IUPA 3CD6A 5FWBA 3EFRA 3C12A 4M75B 5GAN4 3ME9A 4M75A 1N8RR 4M77E 2QDLA 2DXBA 1KJWA 1MMDA 3LWIA 1KD1U 2DVJA 1N9SA 3CCJA 2R5AA 5FRMA 3PVQA 4CRIA 1BU1A 7AT1B 1K8AR 2C0TA 3EHRA 2EQUA 2F2VA 1W6XA 1RACB 2DL5A 2JXBA 1VQPQ 4J6WA 4NOYA 1LCKA 2F1LA 3D7SB 3TREA 1J3TA 2XKOC 4CC2A 2QGFB 1UUEA 4FT2A 1W70A 4RTUA 4RTWA 2JM9A 2WACA 1S72T 1IB8A 2E6NA 1ACMB 3RMSA 2F5KA 1KG1A 2CP6A 4J9FA 1YHQQ 1VQ7A 3P8BB 2KGTA 5FU7B 1HJDA 4M78E 3EFSA 2RD1A 3ZEHA 4M77G 3A5ZB 4RMOA 1YJWA 2CZ7B 2EKHA 3PFSA 5KH6A 4M7AF 2LCSA 3CPWP 1G2BA 1JRIA 2OX7A 2GTJA 1BIBA 2K2VA 4RTZA 1R77A 1X01A 4OMOA 5A0GA 2H3EB 5EG2A 3O8VA 3VS1A 4CC4B 2XDDA 2DTHA 2L0AA 4E47A 1JO8A 1NM7A 1PD1A 2YSQA 1ZBJA 1YIJA 3NTKA 3HHTB 3X24B 1E7OA 2DBKA 2GGRA 3TEEA 4M78D 1SPKA 1QKXA 1YWOA 3CMET 1ZSGA 5A2QE 1VYTA 4ZGEB 1K73U 1UECA 2V1QA 3S3NA 5IHIA 1MMAA 3CCLQ 3ULRB 2EW3A 2L2PA 1Y7XA 2BKDN 2DKGA 2DRMA 1UJ0A 3CXCA 5FWCA 1YJNT 4LDWA 2F5TX 3EHQA 2WSCE 1X6OA 1VIEA 4KGZB 2JS2A 2KY9A 2VC8A 1PSFA 2OTLT 2AKLA 2XD0A 4M7AC 3UT1A 5IXBA 4WCIA 3JB9D 2XDPA 2YWWA 4QW2A 2A08A 2HL3A 5GAOp 1JQQA 1M27C 1PCXA 1NJIU 4LDYA 1G5VA 2EAYA 3R6OA 1D3BB 4CC3A 8AT1B 1D3BA 1K0XA 2MWPA 2KRSA 2XICA 3QYHB 3G4ST 4FYVB 4KT0E 3OYCA 1ZA2B 1T0JA 2X3XD 2KRMA 1XJWB 2RB6A 1TSFA 1QW1A 4IURA 1VQ6T 2KXDA 3UA7A 5GAN7 4Y28E 4CI0C 3ZL7C 2JMAA 3TVTA 2HEQA 3JCMb 2JTFA 1MV3A 4JJCA 1UGRB 2QQAA 4J9EA 2MI6A 1X75C 3M56A 2QA4A 2D6FA 3JCMX 3N5BB 1VQOT 4XTWA 1WYXA 2K2MA 2FEIA 1TTHB 2SEMA 4M75D 1RLPC 4JRPA 2EQMA 4X9DA 1CKAA 4DOVA 2RHZA 1OOTA 2KT1A 4FW2A 4JRQA 2EKOA 1C6VX 2WSFE 1UTIA 2RI2A 3HFOA 2DX1A 1H641 2DTOA 2PQWA 2E3IA 1OEBA 5LJ3d 4XTZA 1XNIA 2XU8A 2EFIA 3EG1A 1OYXA 1AWXA 5AYFA 3LLRA 3SWNC 4HCCA 5D6XA 1MNEA 1KQSA 2A28A 4IUQA 1VQPA 4XAXB 2CREA 1D09B 5C6SA 2GFUA 2O9SA 1WFWA 1BB9A 4PJOB 1ZX6A 4M78F 4PJOA 2LVMA 4JZ3A 2CSIA 3JCMP 4FIBA 1VOMA 1YHQA 3JCMW 2LCLA 1QP3A 3OYNA 1U5SA 1M2OA 1GFCA 3UDCA 1UFFA 3M4YA 2JZ2A 2CUBA 3PIPA 2CDTA 1VQMQ 2EQJA 3GIBA 5LJ3h 2OTJT 1LJOA 2FRYA 2DVEA 2LQWA 2RH2A 4R56A 5GAMe 4WTOB 1OX8A 1SRLA 1VQ8T 4HA8A 2CS7A 3PVLA 2B86A 5IAYA 2DL4A 3JB9F 4C8QE 1EIFA 2J6KA 2KK4A 1VQ5T 3H41A 2ZPBB 3CC2T 1N5ZA 2RN8A 5CR2A 3H9NA 3EG2A 4OB1B 2YUNA 2DK3A 2RHXA 4JJBA 1AZEA 2KBTA 4KGVB 4JRKA 3OBWA 1ZUUA 5IT9E 3OA6A 1AHJB 1NLPC 2HSPA 3CBPA 3F70A 2LT1A 2COWA 3OQ5A 3I56T 3ZBDA 2X4XA 1WXUA 1JBMA 2VGMA 1PKTA 1SKUB 4A4EA 5HK0A 2EYWA 1K0SA 2LJ3A 3KFVA 3CCLA 5GANg 3EGUA 3G71Q 4BDZA 4L5GA 1BK2A 5HY6A 4JUVA 4JPBW 1K73C 3JCMd 4Z8AA 4A4HA 2DM1A 4M75F 1KQSP 4BY6B 4AT1B 2CP5A 3GP8A 3DLLA 2LNHB 2QXFA 4AFUC 2DRKA 4IIMA 1VQ9T 3V8KA 1WHMA 4C8QG 1I1JA 2X4WA 2ROLA 3FDRA 1RAGB 2KXCA 5KE2A 5CQYA 3PIOA 4BD3A 5DLOA 1XTDA 1RUWA 5GAN8 4XU3A 4OMFB 5GAOq 5LJ5d 4RKUE 1FYNA 4XU2A 3C94A 2LT4A 2KNBB 2DBMA 2EGCA 3FIFA 2HMAA 3PE0A 3JCMh 3LGLA 1Q86U 1QWFA 4M77B 4QKUA 4C5EA 1ZA1B 2QQSA 4M77A 2P0PA 4C5IA 3JSCA 3BDUA 3CC4Q 4MDXA 1HK9A 4RG8A 4M75C 4DBFA 2FVUA 2L3QA 2DXUA 4AMCA 2PTKA 4DQ2A 2LC4A 1M1KU 3JV3A 1Q95G 4C92E 3A8OB 8ATCB 1V29B 1ZSZB 3E19A 4E7IA 1Z9QA 1ZSZA 2QEXQ 2W10A 2DXTA 5FLXE 2E3HA 2LQNA 5LJ5h 4ZNXA 4C0FA 1EFNA 1R0CB 2V26A 4LNPA 1YI2Q 2RQUA 3CCQQ 4OB2B 2IG0A 4A53A 2V8KA 1ZQ1A 3WXMB 2C0IA 4QVCA 2BZXA 2LJ0A 3CCRQ 1K73R 2IPOB 1NEGA 5LJ3j 3RERA 4PJOD 1SEMA 4M78B 5LJ3f 3HL8A 4M78A 5CKFA 2DERA 1MV0B 5GAN6 2YT6A 2RI5A 2RJDA 5GMKm 5FU7C 1W2BS 3I35A 1N6AA 3H0HA 4C0ZA 3VYHB 4Z88A 2I2LA 2ZPHB 1WHKA 3MCAB 1UG1A 2NUTB 1QKWA 1MMNA 1VQMA 3RNJA 4FYYB 2NUTA 4C92G 3E9GA 1PNJA 2JM8A 1BKBA 1SSHA 3REAB 4BACA 3MHXA 1RAAB 3E9FA 2CH4A 5M9OA 4OMPA 2Y4XA 1PD0A 1ZBXA 4LN2A 1QVGA 4FSSA 4LDXA 2DZCA 4N0AA 1TWBA 4ZN3A 1MNDA 3TQ7P 4ATOA 4LDVA 4E7KA 5I2MA 1B7TA 2O2OA 2P4TA 4ZGDB 1M9SA 3OS0A 2L3PA 2Z0WA 3BDLA 1YN8A 2DTIA 4KBMB 2PU9B 1YIJT 1YCSB 2DYIA 1VQ4T 2QG9B 3M0QA 4PL6A 1TG0A 2V8IA 2KQWA 2EGEA 3E1SA 1YJ9Q 3REBB 3CC7Q 2M0OA 1F1BB 3G71A 1KK7A 4B9WA 4HVWA 3OYMA 1S72Q 3LH5A 1IHWA 2JS0A 2CP7A 2YUOA 1E6HA 1ZUYA 2ED1A 2RQWA 3H0IA 2YUPA 3A8HB 3G7ZA 3CCMT 1QVFS 1NLOC 2KYBA 3CBMA 4FYWB 2O01E 2QASA 2K5FA 3TSWA 2E6ZA 4XQ3A 3J7AF 2ZZDA 1Q82U 1JJ2S 3VRZA 2RQVA 2VV5A 2HKQB 1VQKA 3JCMf 4LUEA 2DLPA 5J39A 1UHCA 2AHJB 3RIRA 3MO8A 5HCKA 5GAN3 1KQ2A 4JJNK 2V8JA 3TCJA 1BI0A 5GMKe 3OYHA 2LP5A 3OYBA 3MP6A 2MIOA 1YJ9T 2PVGB 4OMMA 3CC7T 2YUQA 1M30A 2K3BA 5IXFA 2RI3A 2CH4W 3FC3A 1QVGP 2PVOB 4PJOF 4M77D 4KUIA 4JS4A 3CMEQ 2C0OA 5LJ5j 3NTIA 3CC4A 5LJ5f 1C0MA 3MP1A 1QLYA 1U3OA 4QT7A 4RCBA 2RQTA 2NYSA 1M90U 4E6RA 3META 4KH1B 4X9CA 1YJNQ 2KI7A 2COYA 4N4GA 3OYYA 3OYJA 4FSXA 4F7UE 2OTLQ 2JT4A 2QEXA 4NL2A 4A4GA 1O75A 2BE7D 4Y92A 1T3SA 2RJCA 3OMCA 2SRCA 3FRNA 1Q7YU 2RA2A 1VYVA 1RAIB 2IVWA 1YI2A 3CCQA 2DEUA 4XTYA 1QWEA 1IO6A 2DIQA 2VGNA 4D8DA 2AK5A 3MEWA 3J81E 2K4YA 4KRTA 1OU9A 4MZTA 3CCRA 1U1TA 3G4SQ 3OBYA 1TXQA 1RI9A 2M1HA 2OJ2A 1FMVA 2EJGA 2QQ9A 2VKNA 2MF2A 1VQLT 3OS1A 4M4ZA 4AFQC 4FYXB 1VQ6Q 2LMJA 4PJOC 5L23A 3OW2S 1JEGA 5KE3A 1K9MC 3NFCA 1KHIA 3OS5A 2RJEA 1MUZA 1O9SA 2A36A 1I8FA 2CZ1B 2FO0A 4PLIA 3LWHA 2KROA 3QZ9B 3H6ZA 2E4HA 3GBQA 2DPPB 1X43A 5GAN5 5CK9A 2HBPA 1VQOQ 1GCPA 3VKIA 5GJWB 4C8QB 2FPDA 2MPXC 2YLBA 1BI3A 4C8QA 1Q81C 4O6JA 1CSKA 4F7UG 1ABOA 3TSZA 1GBRA 1U06A 3QJYA 3L2UA 3QWYA 2X9HA 4IUVA 5KYNA 2EQKA 3INZA 3MEAA 2PZ1A 2KVQG 2XHCA 4EMKB 4EMKA 3OYGA 2JN0A 5KYYB 5KYYA 3OYFA 2DETA 3O5ZA 3UF4A 3M57A 4MDWA 5GAOr 2QTXA 1UE9A 2FRWA 2WSEE 3OYLA 1KC8C 2X3WD 3VS7A 1TH7A 5CVIA 5A0LA 4XTUA 5FU6B 1Q86R 2PNIA 3DB4A 2EJ9A 3FJPA 1LVKA 2CZ0B 3KBGA 4UC4A 1W2BA 1M4ZA 2KR3A 1RAHB 4M7DE 4GLMA 3LX7A 2FPEA 3OSSC 2F69A 1KIKA 2GNCA 1V1CA 3X20B 1IGUA 2D0QB 2D9TA 2ZCFB 4BI3A 1S72A 1TUDA 4M77F 2DFUA 2VYTA 3I55T 3ASKA 3QDFA 3CCET 1I0CA 1JB0E 3JCMc 1G3SA 4BY6C 3CCUT 1Y0MA 1SHGA 3VUZA 4A4KA 3L2WA 2OTJQ 3PTAA 3RUXA 3CQTA 1G3WA 3G6ET 3GNGA 4J9BA 4Z02A 1VQ8Q 3KUFA 5GANe 2HAXA 1KD1C 2AZSA 3HRSA 1R8OB 1WQ7A 2FL7A 2QK0A 3LH0A 1K9MR 1VQ5Q 1YCYA 3CXCP 3EFOB 3QO3A 2RJFA 3SHWA 2DL7A 4M7DD 3CC2Q 3EFOA 3QPHA 1QMCA 1N8RU 1OPLA 3QWXX 2EBPA 3I5RA 2XMFA 4EMGA 3S3OA 1AEYA 2J6OA 2LNVA 3OSVA 1BCOA 2EWNA 3EAEA 4A54A 1IZ6A 4M7DG 1YITT 4A4FA 4RG2A 3QDRB 1Q81R 1ARKA 2DYBA 3VYGA 4HT9A 5GAMd 1UGVA 3M58A 1K8AU 3EH2A 4ANJA 3UA6A 4C5GA 3CMEA 3I56Q 2HQHA 4B6MA 4XK8E 2A7YA 2JW4A 4M77C 4E7ZA 2RNAA 5CCAA 1FXXA 1BIAA 3NTHA 1OU8A 1D1CA 2XIDA 1RABB 3RMQA 4C92B 3CPWS 4C92A 1AT1B 4MMLA 1WI7A 3V7RA 1YJNA 1HSQA 1SHFA 2BIVA 3VS3A 5FRNA 3QBYA 2EYZA 1KC8R 2RF0A 1BYMA 2OTLA 1ZSZC 5D6WA 3L2ZA 1VQ9Q 2DIGA 1PRLC 3FEOA 1HXDA 2ESWA 4J9IA 2JVVA 1B3QA 1WZOA 3AHUA 3M0PA 2ED0A 2Y4YA 4J9HA 2KT8A 2GBQA 5GAMh 1LNXA 3G4SA 3QYGB 5GJVB 3WVDB 3S3MA 2K5IA 4E7JA 1KQ1A 4ZGJB 2CP3A 1WHHA 3GOXA 1D0XA 1VQ6A 4JZ4A 3C4SA 4M78C 4GBQA 2XG8D 5DY9A 3DB3A 1NEBA 2H8HA 3NHNA 4FT4A 1VQNT 5HKCA 1VIFA 1AVZC 4ELZC 1WJSA 3CCST 1N27A 1HD3A 3OYIA 4C8QD 1KD1R 3CMAT 1VQOA 2HQXA 4E2FB 3OB9A 2DNUA 4PK4A 4FM4B 1W1FA 9ATCB 2YXYA 4RCCA 4RTVA 4ZTFA 3FB9A 2ZAEA 2O31A 2AT1B 5I21A 5CO7A 4OGEA 2A3LA 4N0AC 1CKBA 1EZZB 4EPCA 4KULA 3NGPA 1WQWA 1TUCA 1SRMA 2RHYA 4J9CA 4DA4A 1NJIC 1BI1A 4AFZC 2L8DA 4R0KA 4LXCA 2G6FX 5LJ3g 3CCVT 2E5KA 2KAFA 2HQEA 2JMCA 1FX7A 1R0BG 3DLMA 3MPUB 4M7DF 4WF2A 3ER0A 3OW2A 1WJQA 2H3JA 2R5MA 4AG1C 1G83A 2YLCA 1JU5C 2CP0A 1PWTA 2LQKA 4QVDA 3GPLA 2LDMA 4MZPA 2FZKB 4FL6A 2QI2A 3EG0A 1WGSA 2M9UA 1T0HA 1M1GA 2OI3A 4BUGA 3BY7A 2ZPIB 3CD6T 2LX7A 5IHNA 3OS2A 1Q7YR 2DF6A 1IRXA 2J6FA 2HL5C 2OTJA 3A8LB 3HSBA 1FWZA 5IH2A 5J26A 1VQ8A 2C06A 4E7LA 1X6GA 4R55A 2JJ9A 3CCJT 4LDUA 1SSFA 1VQ5A 2QQBA 4KUDK 4JDSA 3CC2A 5CKEA 3LYIA 4MMKA 1HYOA 3ZFJA 1VQKT 4M7AE 4VUBA 1UJYA 1PSEA 2L5QA 5L8RE 2M51A 3I5SA 2HBWA 4NS5A 3RKWA 4PFZA 1YIJQ 3CEYA 2HKNA 2BE9B 1QCOA 1VQ4Q 3QJ6A 3NMZC 3I56A 2M02A 2JNGA 4C92D 5A0DA 3M55A 2DE0X 4DBHA 1RL2A 2DZ9A 4F7UB 1VQ7T 4F7UA 1I4K1 3V7SA 1NJIR 4FU6A 2D0NA 5GAMj 1JXMA 4ZN1A 3X28B 4C8QF 1N9RA 4ZTJA 1SG5A 1I07A 3JCMg 1VYUA 3FLGA 4PJMA 5GAMf 3QUIA 3CCMQ 3A8MB 1K1ZA 1X2QA 1YJWT 3C0CA 2KSSA 1VQ9A 5DLQE 4V2SA 3MP8A 4MZMA 1H3ZA 3A8GB 3P8DA 3QZ5B 4ORZA 2QAZA 4ME7A 3PMIA 4M7AG 1BI2A 3VS4A 2CT3A 3M9QA 4FW1A 2K9GA 1G3TA 4OP0A 4JS5A 1PG5B 4IUTA 5GAOl 2RQRA 2NUPB 1H8KA 2NUPA 2GF7A 1NZ9A 2RK1A 1GXIE 1NPRA 5LJ5g 2O4XB 2YHTA 3RDVA 2O4XA 4QQDA 1PHTA 2D8JA 2DL8A 3FJ5A 4X1VA 1BCMA 4YTLA 1M3BA 5AT1B 3S6WA 3CPWA 3JB9H 4PLLA 1KQSS 2L3RA 1GL5A 1XQHA 3URGA 2RHIA 2Y90A 3OYKA 3NPFA 2XI9A 3V7CA 4PFPA 4C8QC 1BBZA 3PNWC 3R6NA 2L89A 4BI8B 2MCNA 2LX9A 2JUFA 1G8XA 2ROTA 1Y57A 2AZVA 4JRIA 2E65A 3BE3A 1TU0B 4F16A 5KYUB 1M8VA 2BTTA 5KYUA 4F14A 4EMKC 1GFDA 2E41A 4F17A 4KH0B 4IIOA 2EVRA 2VB6A 3J80E 2K7AA 2X4YA 1GCQA 4FCYA 1NBEB 4IUUA 4M7DB 4N4HA 2DILA 2HDAA 4M7DA 5FU6C 3EG3A 5I2SA 2P4RA 3L1AA 4LE9A 1GBQA 2LJ1A 4OMLA 3JRZA 5DM7R 4HCKA 3JAME 2XK0A 2RM4A 1FMKA 5D6YA 1OV3A 1C1AA 1VQLQ 2FZCB 3DKMA 3GF5A 2MAMA 3OY9A 4JLIA 4OVAA 1K4US 1Y96B 1M5Q1 1U1SA 3RKYA 1Y96A 5GMKh 2RPNA 4C92F 3M53A 1IGQA 4D6WA 2YRDA 4EIKA 1Q86C 2EPDA 4F04B 2QA4T 2M0YA 2QTVA 1D0ZA 5CIUA 2E70A 3KXTA 1OI1A 1T3LA 2CP2A 2LRQA 2K3YA 2NLUA 5KCHA 1B07A 2VASA 4QQGA 1AWWA 2DAQA 5GMKi 1YNZA 1OPKA 1MGQA 2FHDA 4D8KA 5CKBA 1M1KC 4J6YA 2CZ6B 2MK5A 1UDLA 4Q5WA 1Y07A 2YRCA 4LD6A 3QXEB 1UGPB 1TS9A 3EGXB 2FYKA 2DMOA 3EGXA 3HRUA 3UATA 2HCKA 1IREB 2DL3A 5I11A 2W0ZA 1VQPT 1RI0A 1VQ4A 3CPFA 4PJNA 1OQKA 2IIMA 2E10A 3A98A 1IHVA 4C92C 4BI4A 5FROA 1YHQT 3LW5E 1EX4A 1ZHIA 3A1PA 3H8ZA 3H0FA 3I55Q 3VJPA 4M78G 3UPUA 2KYMA 1WXTA 1OZ3A 3CCEQ 3RBBB 2KMTA 3CCMA 1YBYA 4C0DB 3M5AA 4PJJA 3CCUQ 4BE2A 3EH1A 5IHKA 2HD0A 4HXJA 4O5VA 4ELYC 2KRNA 4OGCA 2FG0A 1OULA 1RAEB 5KCOA 2KE9A 1ABQA 2R57A 4EMHA 1GRIA 1OZ2A 2EIFA 2QDYB 3G6EQ 2YDLA 2LQ8A 2B8AA 2ABLA 5KYWB 3X26B 5KYWA 1D1AA 4J7IA 1RADB 1P92A 4M75E 4RTXA 2J05A 2AIRB 4A63B 2VWFA 4J83A 3SD4A 3JB9G 2L3SA 2K57A 2JTMA 5GAN2 3X25B 3U23A 1QCNA 2CYZB 2CKKA 2K3XA 1WX6A 1QVPA 1YJ9A 1MHNA 2E1HA 3CC7A 4HKEA 4RUGA 1YITQ 1I5OB 3M4GA 3L2VA 3P8HA 4L59A 5I22A 3JB9I 4DBQA 1M3CA 1M3AA 3M0RA 1M1KR 1H3HA 3SEMA 3G1JA 5GANd 3CCLT 3VS2A 2JTEA 2OAUA 6AT1B 2DXCA 3UWNA 4XU1A 1M1FA 3IQLA 2RK2A 3HRTA 5CKDA 1I5LA 1W4SA 3PT9A 4P5NA 2BZ8A 4RTTA 4K11A 4IKFA 1A0NB 5KYXB 2LTOA 5KYXA 4BB7A 3BW1A 2NUZA 4II1A 2OAWA 2F2XA 1WPYA 2LZ6B 4XU0A 2YRVA 1QCFA 4J9DA 1UGSB 3L2RA 4RTYA 1NYFA 4M75G 4PFOA 3JCMV 1X69A 4E7HA 5HK3A 4OMQA 1Q82C 3TU4K 2MYSA 5GMKj 2M16A 3I9QA 4C0GA 1D1BA 1WHGA 3Q1JA 3MJXA 1QVGS 4J7FA 2COZA 1B34B 1B34A 4XTVA 4AFSC 3QSUA 2EYXA 4N4IA 4X34A 3SDZA 5GANh 2E5QA 3HKSA 1UB4A 1VQLA 4LD9K 5LL6S 1OX9A 2E12A 3QG1A 4Z89A 1QVFA 2GFAA 1VQNQ 5LJ3e 4DEYA 3E2UA 4BE0A 4F7UF 2KDSA 2LCCA 3CCSQ 3CMAQ 1KFZA 2GCXA 3HP9A 1M90C 1JJ2A 3QIIA 2ECZA 2P0QA 5CAIA 4AG2C 1W2BP 4BE1A 2A0FB 4M7AB 1FMWA 3OYAA 4M7AA 1WNLA 1K76A 1E6GA 1WHJA 5J3BA 2EQIA 5ECAA 1Q7YC 4DOWA 1KHCA 2QQRA 1WLPB 3V8LA 3HPWA 1MMGA 3CCVQ 2CSQA 1M2VB 1U8RA 1M2VA 4HCBA 1JXOA 2K79A 3V8JA 2DA9A 4PNOA 2P84A 3WVEB 2G3RA 1NG2A 2P0KA 4E7SA 3QHSA 1LOJA 2ENMA 3M0UA 3JB9J 4OMNA 2PUOB 1WXBA 1PC0A 2O9VA 2DD5A 3I55A 5GAOn 3GNFB 1Q82R 3CCEA 4OB3B 2EYYA 2K5LA 4BDYA 3HTRA 4J8OA 1VQMT 3CCUA 3CD6Q 1WJRA 4JJDA 2D1XA 1Y71A 4GY5A 4CC7A 2A37A 2F2WA 3G6EA 3M59A 3OYDA 1QVFP 2ZPFB 1NYGA 3CCJQ 3C95A 4QQ6A 4ESRA 2QYZA 1XOVA 2RHUA 1AWOA 4OF1A 2BZYA 3JCMe 1NE8A 2JOYA 1VQKQ 5D7UA 1PKSA 5CQXA 3EGDB 2X35A 1M8MA 3EGDA 3SWNB 4DBRA 1JJ2P 4NL3A 3SWNA 2J06A 3L2QA 1YITA 1M90R 1KSWA 1VA7A 5GAMg 1WA7A 1ZUKA 3EG9B 3VU3C 3RESA 3EG9A 3VS6A 1TOVA 1K9AA 1V76A 3VUBA 1AWJA 2D8HA 3G71T 4J9GA 2MOXA 2PVDB 1WHLA 1X6BA 2DJZA 1PRMC 1VQ7Q 4L6V5 5LJ5e 4XTXA 4PJOE 2GTOA 4JLGA 1H92A 5CKHA 4TVRA 5FW9A 2FZGB 5GANj 5EC7A 2KEAA 3CXCS 4HT8A 4PJLA 1YJWQ 5GANf 4KGXB 4HCZA 4EDUA 3L42A 2EJFA 2X4JA 1ZLMA 2FPFA 3PMTA 1GCQC 3RR6A 4HVUA
chains in the Genus database with same CATH topology
1GCQA 1N5ZA 2RN8A 3O5ZA 3EG2A 3UF4A 2YUNA 3THKA 4JJBA 1AZEA 2DILA 2HDAA 2KBTA 3EG3A 1UE9A 2FRWA 2P4RA 4LE9A 2X3WD 3VS7A 1GBQA 2LJ1A 1ZUUA 4OMLA 4HCKA 3VS0A 3M0SA 1AD5A 1FMKA 2PNIA 1UHFA 1NLPC 2HSPA 1OV3A 1X27A 2KR3A 4GLMA 1WXUA 2FPEA 1PKTA 1KIKA 2GNCA 1V1CA 1K4US 2EYWA 1K0SA 1AOJA 1AZGB 2LJ3A 3KFVA 2RPNA 1TUDA 2EGAA 1Z9ZA 3EGUA 4EIKA 3VRYA 2EPDA 4HVVA 1BK2A 2M0YA 2CT4A 1T3LA 1I0CA 4JPBW 4Z8AA 3M0TA 1Y0MA 1SHGA 2CUDA 2DM1A 1B07A 1S1NA 1AWWA 1YNZA 2LNHB 1OPKA 4AFUC 4D8KA 2DRKA 4IIMA 3VS5A 3CQTA 1I1JA 1YWPA 4J9BA 2ROLA 2KXCA 1UDLA 2AZSA 4DEXA 3SHWA 2DL7A 2VVKA 2DMOA 1RUWA 1OPLA 3QWXX 2EBPA 3UATA 3I5RA 1X2KA 2HCKA 2XMFA 1AEYA 2DL3A 5I11A 1WIEA 2J6OA 2W0ZA 2J7IA 2O88A 1FYNA 1ARKA 2DYBA 2I0NA 2K6DA 1UGVA 2KNBB 2DBMA 2EGCA 3PE0A 3UA6A 2IIMA 3A98A 2AKKA 2V1RA 2JW4A 2RNAA 2GQIA 1RLQC 1QWFA 4LUDA 1WDXA 2RMOA 2DJQA 3H0FA 1YP5A 2KYMA 1WI7A 1WXTA 2NWMA 1HSQA 1SHFA 5FWBA 3RBBB 3VS3A 2L3QA 2EYZA 2PTKA 2RF0A 5IHKA 4HXJA 2KRNA 3JV3A 2FG0A 2QDLA 1KJWA 2KE9A 1ABQA 1Z9QA 2DVJA 1GRIA 2W10A 2YDLA 3PVQA 1PRLC 2LQNA 1BU1A 2ABLA 2ESWA 4J9IA 4ZNXA 1EFNA 4RTXA 1B3QA 2J05A 4LNPA 2RQUA 3M0PA 4A63B 2VWFA 2ED0A 2C0TA 4J9HA 2KT8A 2GBQA 3EHRA 2L3SA 5GJVB 2C0IA 2BZXA 2LJ0A 3U23A 2F2VA 1W6XA 2DL5A 1WX6A 2JXBA 4JZ4A 1NEGA 4GBQA 1LCKA 1SEMA 4RUGA 1NEBA 1J3TA 2H8HA 3NHNA 5I22A 4CC2A 1UUEA 1M3CA 1W70A 4RTUA 4RTWA 1AVZC 1M3AA 3M0RA 1MV0B 2JM9A 1H3HA 3SEMA 2YT6A 3VS2A 2JTEA 3I35A 3H0HA 1HD3A 3IQLA 4J9FA 2KGTA 4Z88A 1HJDA 2DNUA 1UG1A 1W1FA 1QKWA 2BZ8A 4RTTA 3RNJA 4RTVA 4K11A 1A0NB 2O31A 1PNJA 2JM8A 1SSHA 3REAB 2NUZA 2CH4A 2OAWA 2F2XA 2EKHA 4OMPA 2LCSA 2LZ6B 1G2BA 4LN2A 1CKBA 1QCFA 4J9DA 4FSSA 3NGPA 4RTYA 2GTJA 1NYFA 1TUCA 1SRMA 4RTZA 4OMOA 1X69A 4J9CA 4AFZC 4OMQA 3VS1A 4R0KA 4CC4B 2G6FX 2L0AA 2O2OA 3I9QA 1JO8A 1NM7A 2E5KA 2YSQA 2JMCA 2L3PA 1ZBJA 1YN8A 4AFSC 2EYXA 1E7OA 1YCSB 2DBKA 2GGRA 3M0QA 4AG1C 1TG0A 1G83A 1SPKA 1JU5C 2EGEA 1QKXA 1YWOA 1ZSGA 4Z89A 1VYTA 1PWTA 3REBB 1UECA 4DEYA 4HVWA 2V1QA 3EG0A 3LH5A 5IHIA 2JS0A 3ULRB 2EW3A 2YUOA 1T0HA 1E6HA 2L2PA 1ZUYA 2DRMA 2ED1A 1UJ0A 2RQWA 2OI3A 3H0IA 2YUPA 5FWCA 3EHQA 1KFZA 2LX7A 1NLOC 5IHNA 2KYBA 2DF6A 2JS2A 2ECZA 2J6FA 2AKLA 4AG2C 5IXBA 5IH2A 4WCIA 2A08A 3TSWA 1JQQA 1M27C 1X6GA 1K76A 1E6GA 3VRZA 2RQVA 4CC3A 2EQIA 4LUEA 5ECAA 2DLPA 1K0XA 2KRSA 1WLPB 1UHCA 2CSQA 5HCKA 1JXOA 2K79A 1T0JA 2DA9A 2X3XD 1UJYA 2KRMA 2LP5A 2M51A 2KXDA 3UA7A 2MIOA 3I5SA 2HBWA 4OMMA 1NG2A 2YUQA 1M30A 2K3BA 5IXFA 2ENMA 2CH4W 3M0UA 3ZL7C 2JMAA 3NMZC 3TVTA 4OMNA 2HEQA 1WXBA 2DE0X 1MV3A 2O9VA 2C0OA 4JJCA 4J9EA 1QLYA 1U3OA 4QT7A 2RQTA 1WYXA 2K2MA 2D0NA 2FEIA 2SEMA 4E6RA 1JXMA 2EYYA 1RLPC 1I07A 1VYUA 1CKAA 1OOTA 2KT1A 4JJDA 1K1ZA 1X2QA 2D1XA 3C0CA 2JT4A 4CC7A 2A37A 2F2WA 4Y92A 1T3SA 1UTIA 2DX1A 2SRCA 1VYVA 1NYGA 4ORZA 1OEBA 4ESRA 1XOVA 3VS4A 2CT3A 1QWEA 1IO6A 2K9GA 1AWOA 4D8DA 3EG1A 2AK5A 2BZYA 1AWXA 4KRTA 2RQRA 1H8KA 1PKSA 1RI9A 2OJ2A 2A28A 1M8MA 2J06A 2VKNA 2CREA 4M4ZA 1KSWA 4AFQC 1PHTA 2D8JA 2LMJA 1VA7A 2O9SA 2DL8A 3FJ5A 4X1VA 5L23A 1WFWA 1M3BA 1BB9A 1WA7A 1ZUKA 1JEGA 1ZX6A 4JZ3A 2CSIA 3VS6A 1K9AA 1GL5A 1MUZA 1AWJA 2A36A 2D8HA 4J9GA 2MOXA 2FO0A 1X6BA 1U5SA 1PRMC 2KROA 3NPFA 1GFCA 1BBZA 3GBQA 1UFFA 1X43A 3R6NA 1GCPA 5GJWB 2MCNA 2FPDA 2CUBA 2GTOA 2CDTA 1H92A 1CSKA 1ABOA 2ROTA 3TSZA 1GBRA 1Y57A 1U06A 2AZVA 5FW9A 5EC7A 2FRYA 2KEAA 3QWYA 4F16A 2LQWA 2BTTA 4F14A 1GFDA 1SRLA 2PZ1A 3PVLA 2B86A 4F17A 1ZLMA 2DL4A 2FPFA 1GCQC 4IIOA 2EVRA 2J6KA 4HVUA 3H41A 2K7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GCQ A;  1N5Z A;  2RN8 A;  3O5Z A;  3EG2 A;  3UF4 A;  2YUN A;  3THK A;  4JJB A;  1AZE A;  2DIL A;  2HDA A;  2KBT A;  3EG3 A;  1UE9 A;  2FRW A;  2P4R A;  4LE9 A;  2X3W D;  3VS7 A;  1GBQ A;  2LJ1 A;  1ZUU A;  4OML A;  4HCK A;  3VS0 A;  3M0S A;  1AD5 A;  1FMK A;  2PNI A;  1UHF A;  1NLP C;  2HSP A;  1OV3 A;  1X27 A;  2KR3 A;  4GLM A;  1WXU A;  2FPE A;  1PKT A;  1KIK A;  2GNC A;  1V1C A;  1K4U S;  2EYW A;  1K0S A;  1AOJ A;  1AZG B;  2LJ3 A;  3KFV A;  2RPN A;  1TUD A;  2EGA A;  1Z9Z A;  3EGU A;  4EIK A;  3VRY A;  2EPD A;  4HVV A;  1BK2 A;  2M0Y A;  2CT4 A;  1T3L A;  1I0C A;  4JPB W;  4Z8A A;  3M0T A;  1Y0M A;  1SHG A;  2CUD A;  2DM1 A;  1B07 A;  1S1N A;  1AWW A;  1YNZ A;  2LNH B;  1OPK A;  4AFU C;  4D8K A;  2DRK A;  4IIM A;  3VS5 A;  3CQT A;  1I1J A;  1YWP A;  4J9B A;  2ROL A;  2KXC A;  1UDL A;  2AZS A;  4DEX A;  3SHW A;  2DL7 A;  2VVK A;  2DMO A;  1RUW A;  1OPL A;  3QWX X;  2EBP A;  3UAT A;  3I5R A;  1X2K A;  2HCK A;  2XMF A;  1AEY A;  2DL3 A;  5I11 A;  1WIE A;  2J6O A;  2W0Z A;  2J7I A;  2O88 A;  1FYN A;  1ARK A;  2DYB A;  2I0N A;  2K6D A;  1UGV A;  2KNB B;  2DBM A;  2EGC A;  3PE0 A;  3UA6 A;  2IIM A;  3A98 A;  2AKK A;  2V1R A;  2JW4 A;  2RNA A;  2GQI A;  1RLQ C;  1QWF A;  4LUD A;  1WDX A;  2RMO A;  2DJQ A;  3H0F A;  1YP5 A;  2KYM A;  1WI7 A;  1WXT A;  2NWM A;  1HSQ A;  1SHF A;  5FWB A;  3RBB B;  3VS3 A;  2L3Q A;  2EYZ A;  2PTK A;  2RF0 A;  5IHK A;  4HXJ A;  2KRN A;  3JV3 A;  2FG0 A;  2QDL A;  1KJW A;  2KE9 A;  1ABQ A;  1Z9Q A;  2DVJ A;  1GRI A;  2W10 A;  2YDL A;  3PVQ A;  1PRL C;  2LQN A;  1BU1 A;  2ABL A;  2ESW A;  4J9I A;  4ZNX A;  1EFN A;  4RTX A;  1B3Q A;  2J05 A;  4LNP A;  2RQU A;  3M0P A;  4A63 B;  2VWF A;  2ED0 A;  2C0T A;  4J9H A;  2KT8 A;  2GBQ A;  3EHR A;  2L3S A;  5GJV B;  2C0I A;  2BZX A;  2LJ0 A;  3U23 A;  2F2V A;  1W6X A;  2DL5 A;  1WX6 A;  2JXB A;  4JZ4 A;  1NEG A;  4GBQ A;  1LCK A;  1SEM A;  4RUG A;  1NEB A;  1J3T A;  2H8H A;  3NHN A;  5I22 A;  4CC2 A;  1UUE A;  1M3C A;  1W70 A;  4RTU A;  4RTW A;  1AVZ C;  1M3A A;  3M0R A;  1MV0 B;  2JM9 A;  1H3H A;  3SEM A;  2YT6 A;  3VS2 A;  2JTE A;  3I35 A;  3H0H A;  1HD3 A;  3IQL A;  4J9F A;  2KGT A;  4Z88 A;  1HJD A;  2DNU A;  1UG1 A;  1W1F A;  1QKW A;  2BZ8 A;  4RTT A;  3RNJ A;  4RTV A;  4K11 A;  1A0N B;  2O31 A;  1PNJ A;  2JM8 A;  1SSH A;  3REA B;  2NUZ A;  2CH4 A;  2OAW A;  2F2X A;  2EKH A;  4OMP A;  2LCS A;  2LZ6 B;  1G2B A;  4LN2 A;  1CKB A;  1QCF A;  4J9D A;  4FSS A;  3NGP A;  4RTY A;  2GTJ A;  1NYF A;  1TUC A;  1SRM A;  4RTZ A;  4OMO A;  1X69 A;  4J9C A;  4AFZ C;  4OMQ A;  3VS1 A;  4R0K A;  4CC4 B;  2G6F X;  2L0A A;  2O2O A;  3I9Q A;  1JO8 A;  1NM7 A;  2E5K A;  2YSQ A;  2JMC A;  2L3P A;  1ZBJ A;  1YN8 A;  4AFS C;  2EYX A;  1E7O A;  1YCS B;  2DBK A;  2GGR A;  3M0Q A;  4AG1 C;  1TG0 A;  1G83 A;  1SPK A;  1JU5 C;  2EGE A;  1QKX A;  1YWO A;  1ZSG A;  4Z89 A;  1VYT A;  1PWT A;  3REB B;  1UEC A;  4DEY A;  4HVW A;  2V1Q A;  3EG0 A;  3LH5 A;  5IHI A;  2JS0 A;  3ULR B;  2EW3 A;  2YUO A;  1T0H A;  1E6H A;  2L2P A;  1ZUY A;  2DRM A;  2ED1 A;  1UJ0 A;  2RQW A;  2OI3 A;  3H0I A;  2YUP A;  5FWC A;  3EHQ A;  1KFZ A;  2LX7 A;  1NLO C;  5IHN A;  2KYB A;  2DF6 A;  2JS2 A;  2ECZ A;  2J6F A;  2AKL A;  4AG2 C;  5IXB A;  5IH2 A;  4WCI A;  2A08 A;  3TSW A;  1JQQ A;  1M27 C;  1X6G A;  1K76 A;  1E6G A;  3VRZ A;  2RQV A;  4CC3 A;  2EQI A;  4LUE A;  5ECA A;  2DLP A;  1K0X A;  2KRS A;  1WLP B;  1UHC A;  2CSQ A;  5HCK A;  1JXO A;  2K79 A;  1T0J A;  2DA9 A;  2X3X D;  1UJY A;  2KRM A;  2LP5 A;  2M51 A;  2KXD A;  3UA7 A;  2MIO A;  3I5S A;  2HBW A;  4OMM A;  1NG2 A;  2YUQ A;  1M30 A;  2K3B A;  5IXF A;  2ENM A;  2CH4 W;  3M0U A;  3ZL7 C;  2JMA A;  3NMZ C;  3TVT A;  4OMN A;  2HEQ A;  1WXB A;  2DE0 X;  1MV3 A;  2O9V A;  2C0O A;  4JJC A;  4J9E A;  1QLY A;  1U3O A;  4QT7 A;  2RQT A;  1WYX A;  2K2M A;  2D0N A;  2FEI A;  2SEM A;  4E6R A;  1JXM A;  2EYY A;  1RLP C;  1I07 A;  1VYU A;  1CKA A;  1OOT A;  2KT1 A;  4JJD A;  1K1Z A;  1X2Q A;  2D1X A;  3C0C A;  2JT4 A;  4CC7 A;  2A37 A;  2F2W A;  4Y92 A;  1T3S A;  1UTI A;  2DX1 A;  2SRC A;  1VYV A;  1NYG A;  4ORZ A;  1OEB A;  4ESR A;  1XOV A;  3VS4 A;  2CT3 A;  1QWE A;  1IO6 A;  2K9G A;  1AWO A;  4D8D A;  3EG1 A;  2AK5 A;  2BZY A;  1AWX A;  4KRT A;  2RQR A;  1H8K A;  1PKS A;  1RI9 A;  2OJ2 A;  2A28 A;  1M8M A;  2J06 A;  2VKN A;  2CRE A;  4M4Z A;  1KSW A;  4AFQ C;  1PHT A;  2D8J A;  2LMJ A;  1VA7 A;  2O9S A;  2DL8 A;  3FJ5 A;  4X1V A;  5L23 A;  1WFW A;  1M3B A;  1BB9 A;  1WA7 A;  1ZUK A;  1JEG A;  1ZX6 A;  4JZ3 A;  2CSI A;  3VS6 A;  1K9A A;  1GL5 A;  1MUZ A;  1AWJ A;  2A36 A;  2D8H A;  4J9G A;  2MOX A;  2FO0 A;  1X6B A;  1U5S A;  1PRM C;  2KRO A;  3NPF A;  1GFC A;  1BBZ A;  3GBQ A;  1UFF A;  1X43 A;  3R6N A;  1GCP A;  5GJW B;  2MCN A;  2FPD A;  2CUB A;  2GTO A;  2CDT A;  1H92 A;  1CSK A;  1ABO A;  2ROT A;  3TSZ A;  1GBR A;  1Y57 A;  1U06 A;  2AZV A;  5FW9 A;  5EC7 A;  2FRY A;  2KEA A;  3QWY A;  4F16 A;  2LQW A;  2BTT A;  4F14 A;  1GFD A;  1SRL A;  2PZ1 A;  3PVL A;  2B86 A;  4F17 A;  1ZLM A;  2DL4 A;  2FPF A;  1GCQ C;  4IIO A;  2EVR A;  2J6K A;  4HVU A;  3H41 A;  2K7A A; 
#chains in the Genus database with same CATH topology
 4M7D C;  4PKC C;  3THK A;  3AT1 B;  3QKJ A;  1N8R C;  1I81 A;  3VS0 A;  4C5H A;  3M0S A;  1AD5 A;  2X51 A;  1UEB A;  1UHF A;  3MEU A;  1K9M U;  1QQJ A;  1X27 A;  2DEQ A;  3CBO A;  2HSE B;  2HZY A;  1VQN A;  2CGH A;  1K8A C;  1AOJ A;  1AZG B;  2ZPE B;  3SFM A;  2EGA A;  3HFN A;  3CCS A;  1Z9Z A;  3T9N A;  3OMG A;  3CC4 T;  3VRY A;  2PUK B;  4HVV A;  4PJO G;  3CMA A;  2CT4 A;  1VUB A;  1Q81 U;  3MEV A;  5GAO m;  2HNI A;  3OW2 P;  2ZPG B;  3M0T A;  4B9X A;  2QGG A;  5C0M A;  2CUD A;  4GLK A;  4M7A D;  1G3Y A;  1NPP A;  1UGQ B;  3BFM A;  2XDB A;  3OYE A;  1S1N A;  4J6X A;  3SB2 A;  3VS5 A;  2QEX T;  2ATC B;  1D0Y A;  1DJ7 B;  1YFN A;  1LPL A;  1YWP A;  2DD4 A;  1PM3 A;  5IN1 A;  5GMK l;  3VV0 A;  3JCM Q;  1YI2 T;  4DEX A;  3CCQ T;  3CCV A;  1KC8 U;  2EYQ A;  2VVK A;  2GQV A;  2DO3 A;  4Y91 A;  1X2K A;  3CCR T;  4J5Y A;  1WIE A;  2VUB A;  3MKD A;  2MWO A;  1IXD A;  2J7I A;  2O88 A;  4OB0 B;  2BUD A;  2I0N A;  2K6D A;  2ZGW A;  3PGG A;  3JCM J;  3RKX A;  2VXE A;  1RAF B;  3GLX A;  2AKK A;  1QP2 A;  2V1R A;  2VXF A;  2R58 A;  3LGF A;  2GQI A;  4QVZ A;  1RLQ C;  2E64 A;  4LUD A;  1WDX A;  2RMO A;  1SF9 A;  2DJQ A;  1TUG B;  1YP5 A;  2FB7 A;  2QA4 Q;  4C0D C;  2NWM A;  2RO0 A;  2MMP A;  3M54 A;  4IUP A;  3CD6 A;  5FWB A;  3EFR A;  3C12 A;  4M75 B;  5GAN 4;  3ME9 A;  4M75 A;  1N8R R;  4M77 E;  2QDL A;  2DXB A;  1KJW A;  1MMD A;  3LWI A;  1KD1 U;  2DVJ A;  1N9S A;  3CCJ A;  2R5A A;  5FRM A;  3PVQ A;  4CRI A;  1BU1 A;  7AT1 B;  1K8A R;  2C0T A;  3EHR A;  2EQU A;  2F2V A;  1W6X A;  1RAC B;  2DL5 A;  2JXB A;  1VQP Q;  4J6W A;  4NOY A;  1LCK A;  2F1L A;  3D7S B;  3TRE A;  1J3T A;  2XKO C;  4CC2 A;  2QGF B;  1UUE A;  4FT2 A;  1W70 A;  4RTU A;  4RTW A;  2JM9 A;  2WAC A;  1S72 T;  1IB8 A;  2E6N A;  1ACM B;  3RMS A;  2F5K A;  1KG1 A;  2CP6 A;  4J9F A;  1YHQ Q;  1VQ7 A;  3P8B B;  2KGT A;  5FU7 B;  1HJD A;  4M78 E;  3EFS A;  2RD1 A;  3ZEH A;  4M77 G;  3A5Z B;  4RMO A;  1YJW A;  2CZ7 B;  2EKH A;  3PFS A;  5KH6 A;  4M7A F;  2LCS A;  3CPW P;  1G2B A;  1JRI A;  2OX7 A;  2GTJ A;  1BIB A;  2K2V A;  4RTZ A;  1R77 A;  1X01 A;  4OMO A;  5A0G A;  2H3E B;  5EG2 A;  3O8V A;  3VS1 A;  4CC4 B;  2XDD A;  2DTH A;  2L0A A;  4E47 A;  1JO8 A;  1NM7 A;  1PD1 A;  2YSQ A;  1ZBJ A;  1YIJ A;  3NTK A;  3HHT B;  3X24 B;  1E7O A;  2DBK A;  2GGR A;  3TEE A;  4M78 D;  1SPK A;  1QKX A;  1YWO A;  3CME T;  1ZSG A;  5A2Q E;  1VYT A;  4ZGE B;  1K73 U;  1UEC A;  2V1Q A;  3S3N A;  5IHI A;  1MMA A;  3CCL Q;  3ULR B;  2EW3 A;  2L2P A;  1Y7X A;  2BKD N;  2DKG A;  2DRM A;  1UJ0 A;  3CXC A;  5FWC A;  1YJN T;  4LDW A;  2F5T X;  3EHQ A;  2WSC E;  1X6O A;  1VIE A;  4KGZ B;  2JS2 A;  2KY9 A;  2VC8 A;  1PSF A;  2OTL T;  2AKL A;  2XD0 A;  4M7A C;  3UT1 A;  5IXB A;  4WCI A;  3JB9 D;  2XDP A;  2YWW A;  4QW2 A;  2A08 A;  2HL3 A;  5GAO p;  1JQQ A;  1M27 C;  1PCX A;  1NJI U;  4LDY A;  1G5V A;  2EAY A;  3R6O A;  1D3B B;  4CC3 A;  8AT1 B;  1D3B A;  1K0X A;  2MWP A;  2KRS A;  2XIC A;  3QYH B;  3G4S T;  4FYV B;  4KT0 E;  3OYC A;  1ZA2 B;  1T0J A;  2X3X D;  2KRM A;  1XJW B;  2RB6 A;  1TSF A;  1QW1 A;  4IUR A;  1VQ6 T;  2KXD A;  3UA7 A;  5GAN 7;  4Y28 E;  4CI0 C;  3ZL7 C;  2JMA A;  3TVT A;  2HEQ A;  3JCM b;  2JTF A;  1MV3 A;  4JJC A;  1UGR B;  2QQA A;  4J9E A;  2MI6 A;  1X75 C;  3M56 A;  2QA4 A;  2D6F A;  3JCM X;  3N5B B;  1VQO T;  4XTW A;  1WYX A;  2K2M A;  2FEI A;  1TTH B;  2SEM A;  4M75 D;  1RLP C;  4JRP A;  2EQM A;  4X9D A;  1CKA A;  4DOV A;  2RHZ A;  1OOT A;  2KT1 A;  4FW2 A;  4JRQ A;  2EKO A;  1C6V X;  2WSF E;  1UTI A;  2RI2 A;  3HFO A;  2DX1 A;  1H64 1;  2DTO A;  2PQW A;  2E3I A;  1OEB A;  5LJ3 d;  4XTZ A;  1XNI A;  2XU8 A;  2EFI A;  3EG1 A;  1OYX A;  1AWX A;  5AYF A;  3LLR A;  3SWN C;  4HCC A;  5D6X A;  1MNE A;  1KQS A;  2A28 A;  4IUQ A;  1VQP A;  4XAX B;  2CRE A;  1D09 B;  5C6S A;  2GFU A;  2O9S A;  1WFW A;  1BB9 A;  4PJO B;  1ZX6 A;  4M78 F;  4PJO A;  2LVM A;  4JZ3 A;  2CSI A;  3JCM P;  4FIB A;  1VOM A;  1YHQ A;  3JCM W;  2LCL A;  1QP3 A;  3OYN A;  1U5S A;  1M2O A;  1GFC A;  3UDC A;  1UFF A;  3M4Y A;  2JZ2 A;  2CUB A;  3PIP A;  2CDT A;  1VQM Q;  2EQJ A;  3GIB A;  5LJ3 h;  2OTJ T;  1LJO A;  2FRY A;  2DVE A;  2LQW A;  2RH2 A;  4R56 A;  5GAM e;  4WTO B;  1OX8 A;  1SRL A;  1VQ8 T;  4HA8 A;  2CS7 A;  3PVL A;  2B86 A;  5IAY A;  2DL4 A;  3JB9 F;  4C8Q E;  1EIF A;  2J6K A;  2KK4 A;  1VQ5 T;  3H41 A;  2ZPB B;  3CC2 T;  1N5Z A;  2RN8 A;  5CR2 A;  3H9N A;  3EG2 A;  4OB1 B;  2YUN A;  2DK3 A;  2RHX A;  4JJB A;  1AZE A;  2KBT A;  4KGV B;  4JRK A;  3OBW A;  1ZUU A;  5IT9 E;  3OA6 A;  1AHJ B;  1NLP C;  2HSP A;  3CBP A;  3F70 A;  2LT1 A;  2COW A;  3OQ5 A;  3I56 T;  3ZBD A;  2X4X A;  1WXU A;  1JBM A;  2VGM A;  1PKT A;  1SKU B;  4A4E A;  5HK0 A;  2EYW A;  1K0S A;  2LJ3 A;  3KFV A;  3CCL A;  5GAN g;  3EGU A;  3G71 Q;  4BDZ A;  4L5G A;  1BK2 A;  5HY6 A;  4JUV A;  4JPB W;  1K73 C;  3JCM d;  4Z8A A;  4A4H A;  2DM1 A;  4M75 F;  1KQS P;  4BY6 B;  4AT1 B;  2CP5 A;  3GP8 A;  3DLL A;  2LNH B;  2QXF A;  4AFU C;  2DRK A;  4IIM A;  1VQ9 T;  3V8K A;  1WHM A;  4C8Q G;  1I1J A;  2X4W A;  2ROL A;  3FDR A;  1RAG B;  2KXC A;  5KE2 A;  5CQY A;  3PIO A;  4BD3 A;  5DLO A;  1XTD A;  1RUW A;  5GAN 8;  4XU3 A;  4OMF B;  5GAO q;  5LJ5 d;  4RKU E;  1FYN A;  4XU2 A;  3C94 A;  2LT4 A;  2KNB B;  2DBM A;  2EGC A;  3FIF A;  2HMA A;  3PE0 A;  3JCM h;  3LGL A;  1Q86 U;  1QWF A;  4M77 B;  4QKU A;  4C5E A;  1ZA1 B;  2QQS A;  4M77 A;  2P0P A;  4C5I A;  3JSC A;  3BDU A;  3CC4 Q;  4MDX A;  1HK9 A;  4RG8 A;  4M75 C;  4DBF A;  2FVU A;  2L3Q A;  2DXU A;  4AMC A;  2PTK A;  4DQ2 A;  2LC4 A;  1M1K U;  3JV3 A;  1Q95 G;  4C92 E;  3A8O B;  8ATC B;  1V29 B;  1ZSZ B;  3E19 A;  4E7I A;  1Z9Q A;  1ZSZ A;  2QEX Q;  2W10 A;  2DXT A;  5FLX E;  2E3H A;  2LQN A;  5LJ5 h;  4ZNX A;  4C0F A;  1EFN A;  1R0C B;  2V26 A;  4LNP A;  1YI2 Q;  2RQU A;  3CCQ Q;  4OB2 B;  2IG0 A;  4A53 A;  2V8K A;  1ZQ1 A;  3WXM B;  2C0I A;  4QVC A;  2BZX A;  2LJ0 A;  3CCR Q;  1K73 R;  2IPO B;  1NEG A;  5LJ3 j;  3RER A;  4PJO D;  1SEM A;  4M78 B;  5LJ3 f;  3HL8 A;  4M78 A;  5CKF A;  2DER A;  1MV0 B;  5GAN 6;  2YT6 A;  2RI5 A;  2RJD A;  5GMK m;  5FU7 C;  1W2B S;  3I35 A;  1N6A A;  3H0H A;  4C0Z A;  3VYH B;  4Z88 A;  2I2L A;  2ZPH B;  1WHK A;  3MCA B;  1UG1 A;  2NUT B;  1QKW A;  1MMN A;  1VQM A;  3RNJ A;  4FYY B;  2NUT A;  4C92 G;  3E9G A;  1PNJ A;  2JM8 A;  1BKB A;  1SSH A;  3REA B;  4BAC A;  3MHX A;  1RAA B;  3E9F A;  2CH4 A;  5M9O A;  4OMP A;  2Y4X A;  1PD0 A;  1ZBX A;  4LN2 A;  1QVG A;  4FSS A;  4LDX A;  2DZC A;  4N0A A;  1TWB A;  4ZN3 A;  1MND A;  3TQ7 P;  4ATO A;  4LDV A;  4E7K A;  5I2M A;  1B7T A;  2O2O A;  2P4T A;  4ZGD B;  1M9S A;  3OS0 A;  2L3P A;  2Z0W A;  3BDL A;  1YN8 A;  2DTI A;  4KBM B;  2PU9 B;  1YIJ T;  1YCS B;  2DYI A;  1VQ4 T;  2QG9 B;  3M0Q A;  4PL6 A;  1TG0 A;  2V8I A;  2KQW A;  2EGE A;  3E1S A;  1YJ9 Q;  3REB B;  3CC7 Q;  2M0O A;  1F1B B;  3G71 A;  1KK7 A;  4B9W A;  4HVW A;  3OYM A;  1S72 Q;  3LH5 A;  1IHW A;  2JS0 A;  2CP7 A;  2YUO A;  1E6H A;  1ZUY A;  2ED1 A;  2RQW A;  3H0I A;  2YUP A;  3A8H B;  3G7Z A;  3CCM T;  1QVF S;  1NLO C;  2KYB A;  3CBM A;  4FYW B;  2O01 E;  2QAS A;  2K5F A;  3TSW A;  2E6Z A;  4XQ3 A;  3J7A F;  2ZZD A;  1Q82 U;  1JJ2 S;  3VRZ A;  2RQV A;  2VV5 A;  2HKQ B;  1VQK A;  3JCM f;  4LUE A;  2DLP A;  5J39 A;  1UHC A;  2AHJ B;  3RIR A;  3MO8 A;  5HCK A;  5GAN 3;  1KQ2 A;  4JJN K;  2V8J A;  3TCJ A;  1BI0 A;  5GMK e;  3OYH A;  2LP5 A;  3OYB A;  3MP6 A;  2MIO A;  1YJ9 T;  2PVG B;  4OMM A;  3CC7 T;  2YUQ A;  1M30 A;  2K3B A;  5IXF A;  2RI3 A;  2CH4 W;  3FC3 A;  1QVG P;  2PVO B;  4PJO F;  4M77 D;  4KUI A;  4JS4 A;  3CME Q;  2C0O A;  5LJ5 j;  3NTI A;  3CC4 A;  5LJ5 f;  1C0M A;  3MP1 A;  1QLY A;  1U3O A;  4QT7 A;  4RCB A;  2RQT A;  2NYS A;  1M90 U;  4E6R A;  3MET A;  4KH1 B;  4X9C A;  1YJN Q;  2KI7 A;  2COY A;  4N4G A;  3OYY A;  3OYJ A;  4FSX A;  4F7U E;  2OTL Q;  2JT4 A;  2QEX A;  4NL2 A;  4A4G A;  1O75 A;  2BE7 D;  4Y92 A;  1T3S A;  2RJC A;  3OMC A;  2SRC A;  3FRN A;  1Q7Y U;  2RA2 A;  1VYV A;  1RAI B;  2IVW A;  1YI2 A;  3CCQ A;  2DEU A;  4XTY A;  1QWE A;  1IO6 A;  2DIQ A;  2VGN A;  4D8D A;  2AK5 A;  3MEW A;  3J81 E;  2K4Y A;  4KRT A;  1OU9 A;  4MZT A;  3CCR A;  1U1T A;  3G4S Q;  3OBY A;  1TXQ A;  1RI9 A;  2M1H A;  2OJ2 A;  1FMV A;  2EJG A;  2QQ9 A;  2VKN A;  2MF2 A;  1VQL T;  3OS1 A;  4M4Z A;  4AFQ C;  4FYX B;  1VQ6 Q;  2LMJ A;  4PJO C;  5L23 A;  3OW2 S;  1JEG A;  5KE3 A;  1K9M C;  3NFC A;  1KHI A;  3OS5 A;  2RJE A;  1MUZ A;  1O9S A;  2A36 A;  1I8F A;  2CZ1 B;  2FO0 A;  4PLI A;  3LWH A;  2KRO A;  3QZ9 B;  3H6Z A;  2E4H A;  3GBQ A;  2DPP B;  1X43 A;  5GAN 5;  5CK9 A;  2HBP A;  1VQO Q;  1GCP A;  3VKI A;  5GJW B;  4C8Q B;  2FPD A;  2MPX C;  2YLB A;  1BI3 A;  4C8Q A;  1Q81 C;  4O6J A;  1CSK A;  4F7U G;  1ABO A;  3TSZ A;  1GBR A;  1U06 A;  3QJY A;  3L2U A;  3QWY A;  2X9H A;  4IUV A;  5KYN A;  2EQK A;  3INZ A;  3MEA A;  2PZ1 A;  2KVQ G;  2XHC A;  4EMK B;  4EMK A;  3OYG A;  2JN0 A;  5KYY B;  5KYY A;  3OYF A;  2DET A;  3O5Z A;  3UF4 A;  3M57 A;  4MDW A;  5GAO r;  2QTX A;  1UE9 A;  2FRW A;  2WSE E;  3OYL A;  1KC8 C;  2X3W D;  3VS7 A;  1TH7 A;  5CVI A;  5A0L A;  4XTU A;  5FU6 B;  1Q86 R;  2PNI A;  3DB4 A;  2EJ9 A;  3FJP A;  1LVK A;  2CZ0 B;  3KBG A;  4UC4 A;  1W2B A;  1M4Z A;  2KR3 A;  1RAH B;  4M7D E;  4GLM A;  3LX7 A;  2FPE A;  3OSS C;  2F69 A;  1KIK A;  2GNC A;  1V1C A;  3X20 B;  1IGU A;  2D0Q B;  2D9T A;  2ZCF B;  4BI3 A;  1S72 A;  1TUD A;  4M77 F;  2DFU A;  2VYT A;  3I55 T;  3ASK A;  3QDF A;  3CCE T;  1I0C A;  1JB0 E;  3JCM c;  1G3S A;  4BY6 C;  3CCU T;  1Y0M A;  1SHG A;  3VUZ A;  4A4K A;  3L2W A;  2OTJ Q;  3PTA A;  3RUX A;  3CQT A;  1G3W A;  3G6E T;  3GNG A;  4J9B A;  4Z02 A;  1VQ8 Q;  3KUF A;  5GAN e;  2HAX A;  1KD1 C;  2AZS A;  3HRS A;  1R8O B;  1WQ7 A;  2FL7 A;  2QK0 A;  3LH0 A;  1K9M R;  1VQ5 Q;  1YCY A;  3CXC P;  3EFO B;  3QO3 A;  2RJF A;  3SHW A;  2DL7 A;  4M7D D;  3CC2 Q;  3EFO A;  3QPH A;  1QMC A;  1N8R U;  1OPL A;  3QWX X;  2EBP A;  3I5R A;  2XMF A;  4EMG A;  3S3O A;  1AEY A;  2J6O A;  2LNV A;  3OSV A;  1BCO A;  2EWN A;  3EAE A;  4A54 A;  1IZ6 A;  4M7D G;  1YIT T;  4A4F A;  4RG2 A;  3QDR B;  1Q81 R;  1ARK A;  2DYB A;  3VYG A;  4HT9 A;  5GAM d;  1UGV A;  3M58 A;  1K8A U;  3EH2 A;  4ANJ A;  3UA6 A;  4C5G A;  3CME A;  3I56 Q;  2HQH A;  4B6M A;  4XK8 E;  2A7Y A;  2JW4 A;  4M77 C;  4E7Z A;  2RNA A;  5CCA A;  1FXX A;  1BIA A;  3NTH A;  1OU8 A;  1D1C A;  2XID A;  1RAB B;  3RMQ A;  4C92 B;  3CPW S;  4C92 A;  1AT1 B;  4MML A;  1WI7 A;  3V7R A;  1YJN A;  1HSQ A;  1SHF A;  2BIV A;  3VS3 A;  5FRN A;  3QBY A;  2EYZ A;  1KC8 R;  2RF0 A;  1BYM A;  2OTL A;  1ZSZ C;  5D6W A;  3L2Z A;  1VQ9 Q;  2DIG A;  1PRL C;  3FEO A;  1HXD A;  2ESW A;  4J9I A;  2JVV A;  1B3Q A;  1WZO A;  3AHU A;  3M0P A;  2ED0 A;  2Y4Y A;  4J9H A;  2KT8 A;  2GBQ A;  5GAM h;  1LNX A;  3G4S A;  3QYG B;  5GJV B;  3WVD B;  3S3M A;  2K5I A;  4E7J A;  1KQ1 A;  4ZGJ B;  2CP3 A;  1WHH A;  3GOX A;  1D0X A;  1VQ6 A;  4JZ4 A;  3C4S A;  4M78 C;  4GBQ A;  2XG8 D;  5DY9 A;  3DB3 A;  1NEB A;  2H8H A;  3NHN A;  4FT4 A;  1VQN T;  5HKC A;  1VIF A;  1AVZ C;  4ELZ C;  1WJS A;  3CCS T;  1N27 A;  1HD3 A;  3OYI A;  4C8Q D;  1KD1 R;  3CMA T;  1VQO A;  2HQX A;  4E2F B;  3OB9 A;  2DNU A;  4PK4 A;  4FM4 B;  1W1F A;  9ATC B;  2YXY A;  4RCC A;  4RTV A;  4ZTF A;  3FB9 A;  2ZAE A;  2O31 A;  2AT1 B;  5I21 A;  5CO7 A;  4OGE A;  2A3L A;  4N0A C;  1CKB A;  1EZZ B;  4EPC A;  4KUL A;  3NGP A;  1WQW A;  1TUC A;  1SRM A;  2RHY A;  4J9C A;  4DA4 A;  1NJI C;  1BI1 A;  4AFZ C;  2L8D A;  4R0K A;  4LXC A;  2G6F X;  5LJ3 g;  3CCV T;  2E5K A;  2KAF A;  2HQE A;  2JMC A;  1FX7 A;  1R0B G;  3DLM A;  3MPU B;  4M7D F;  4WF2 A;  3ER0 A;  3OW2 A;  1WJQ A;  2H3J A;  2R5M A;  4AG1 C;  1G83 A;  2YLC A;  1JU5 C;  2CP0 A;  1PWT A;  2LQK A;  4QVD A;  3GPL A;  2LDM A;  4MZP A;  2FZK B;  4FL6 A;  2QI2 A;  3EG0 A;  1WGS A;  2M9U A;  1T0H A;  1M1G A;  2OI3 A;  4BUG A;  3BY7 A;  2ZPI B;  3CD6 T;  2LX7 A;  5IHN A;  3OS2 A;  1Q7Y R;  2DF6 A;  1IRX A;  2J6F A;  2HL5 C;  2OTJ A;  3A8L B;  3HSB A;  1FWZ A;  5IH2 A;  5J26 A;  1VQ8 A;  2C06 A;  4E7L A;  1X6G A;  4R55 A;  2JJ9 A;  3CCJ T;  4LDU A;  1SSF A;  1VQ5 A;  2QQB A;  4KUD K;  4JDS A;  3CC2 A;  5CKE A;  3LYI A;  4MMK A;  1HYO A;  3ZFJ A;  1VQK T;  4M7A E;  4VUB A;  1UJY A;  1PSE A;  2L5Q A;  5L8R E;  2M51 A;  3I5S A;  2HBW A;  4NS5 A;  3RKW A;  4PFZ A;  1YIJ Q;  3CEY A;  2HKN A;  2BE9 B;  1QCO A;  1VQ4 Q;  3QJ6 A;  3NMZ C;  3I56 A;  2M02 A;  2JNG A;  4C92 D;  5A0D A;  3M55 A;  2DE0 X;  4DBH A;  1RL2 A;  2DZ9 A;  4F7U B;  1VQ7 T;  4F7U A;  1I4K 1;  3V7S A;  1NJI R;  4FU6 A;  2D0N A;  5GAM j;  1JXM A;  4ZN1 A;  3X28 B;  4C8Q F;  1N9R A;  4ZTJ A;  1SG5 A;  1I07 A;  3JCM g;  1VYU A;  3FLG A;  4PJM A;  5GAM f;  3QUI A;  3CCM Q;  3A8M B;  1K1Z A;  1X2Q A;  1YJW T;  3C0C A;  2KSS A;  1VQ9 A;  5DLQ E;  4V2S A;  3MP8 A;  4MZM A;  1H3Z A;  3A8G B;  3P8D A;  3QZ5 B;  4ORZ A;  2QAZ A;  4ME7 A;  3PMI A;  4M7A G;  1BI2 A;  3VS4 A;  2CT3 A;  3M9Q A;  4FW1 A;  2K9G A;  1G3T A;  4OP0 A;  4JS5 A;  1PG5 B;  4IUT A;  5GAO l;  2RQR A;  2NUP B;  1H8K A;  2NUP A;  2GF7 A;  1NZ9 A;  2RK1 A;  1GXI E;  1NPR A;  5LJ5 g;  2O4X B;  2YHT A;  3RDV A;  2O4X A;  4QQD A;  1PHT A;  2D8J A;  2DL8 A;  3FJ5 A;  4X1V A;  1BCM A;  4YTL A;  1M3B A;  5AT1 B;  3S6W A;  3CPW A;  3JB9 H;  4PLL A;  1KQS S;  2L3R A;  1GL5 A;  1XQH A;  3URG A;  2RHI A;  2Y90 A;  3OYK A;  3NPF A;  2XI9 A;  3V7C A;  4PFP A;  4C8Q C;  1BBZ A;  3PNW C;  3R6N A;  2L89 A;  4BI8 B;  2MCN A;  2LX9 A;  2JUF A;  1G8X A;  2ROT A;  1Y57 A;  2AZV A;  4JRI A;  2E65 A;  3BE3 A;  1TU0 B;  4F16 A;  5KYU B;  1M8V A;  2BTT A;  5KYU A;  4F14 A;  4EMK C;  1GFD A;  2E41 A;  4F17 A;  4KH0 B;  4IIO A;  2EVR A;  2VB6 A;  3J80 E;  2K7A A;  2X4Y A;  1GCQ A;  4FCY A;  1NBE B;  4IUU A;  4M7D B;  4N4H A;  2DIL A;  2HDA A;  4M7D A;  5FU6 C;  3EG3 A;  5I2S A;  2P4R A;  3L1A A;  4LE9 A;  1GBQ A;  2LJ1 A;  4OML A;  3JRZ A;  5DM7 R;  4HCK A;  3JAM E;  2XK0 A;  2RM4 A;  1FMK A;  5D6Y A;  1OV3 A;  1C1A A;  1VQL Q;  2FZC B;  3DKM A;  3GF5 A;  2MAM A;  3OY9 A;  4JLI A;  4OVA A;  1K4U S;  1Y96 B;  1M5Q 1;  1U1S A;  3RKY A;  1Y96 A;  5GMK h;  2RPN A;  4C92 F;  3M53 A;  1IGQ A;  4D6W A;  2YRD A;  4EIK A;  1Q86 C;  2EPD A;  4F04 B;  2QA4 T;  2M0Y A;  2QTV A;  1D0Z A;  5CIU A;  2E70 A;  3KXT A;  1OI1 A;  1T3L A;  2CP2 A;  2LRQ A;  2K3Y A;  2NLU A;  5KCH A;  1B07 A;  2VAS A;  4QQG A;  1AWW A;  2DAQ A;  5GMK i;  1YNZ A;  1OPK A;  1MGQ A;  2FHD A;  4D8K A;  5CKB A;  1M1K C;  4J6Y A;  2CZ6 B;  2MK5 A;  1UDL A;  4Q5W A;  1Y07 A;  2YRC A;  4LD6 A;  3QXE B;  1UGP B;  1TS9 A;  3EGX B;  2FYK A;  2DMO A;  3EGX A;  3HRU A;  3UAT A;  2HCK A;  1IRE B;  2DL3 A;  5I11 A;  2W0Z A;  1VQP T;  1RI0 A;  1VQ4 A;  3CPF A;  4PJN A;  1OQK A;  2IIM A;  2E10 A;  3A98 A;  1IHV A;  4C92 C;  4BI4 A;  5FRO A;  1YHQ T;  3LW5 E;  1EX4 A;  1ZHI A;  3A1P A;  3H8Z A;  3H0F A;  3I55 Q;  3VJP A;  4M78 G;  3UPU A;  2KYM A;  1WXT A;  1OZ3 A;  3CCE Q;  3RBB B;  2KMT A;  3CCM A;  1YBY A;  4C0D B;  3M5A A;  4PJJ A;  3CCU Q;  4BE2 A;  3EH1 A;  5IHK A;  2HD0 A;  4HXJ A;  4O5V A;  4ELY C;  2KRN A;  4OGC A;  2FG0 A;  1OUL A;  1RAE B;  5KCO A;  2KE9 A;  1ABQ A;  2R57 A;  4EMH A;  1GRI A;  1OZ2 A;  2EIF A;  2QDY B;  3G6E Q;  2YDL A;  2LQ8 A;  2B8A A;  2ABL A;  5KYW B;  3X26 B;  5KYW A;  1D1A A;  4J7I A;  1RAD B;  1P92 A;  4M75 E;  4RTX A;  2J05 A;  2AIR B;  4A63 B;  2VWF A;  4J83 A;  3SD4 A;  3JB9 G;  2L3S A;  2K57 A;  2JTM A;  5GAN 2;  3X25 B;  3U23 A;  1QCN A;  2CYZ B;  2CKK A;  2K3X A;  1WX6 A;  1QVP A;  1YJ9 A;  1MHN A;  2E1H A;  3CC7 A;  4HKE A;  4RUG A;  1YIT Q;  1I5O B;  3M4G A;  3L2V A;  3P8H A;  4L59 A;  5I22 A;  3JB9 I;  4DBQ A;  1M3C A;  1M3A A;  3M0R A;  1M1K R;  1H3H A;  3SEM A;  3G1J A;  5GAN d;  3CCL T;  3VS2 A;  2JTE A;  2OAU A;  6AT1 B;  2DXC A;  3UWN A;  4XU1 A;  1M1F A;  3IQL A;  2RK2 A;  3HRT A;  5CKD A;  1I5L A;  1W4S A;  3PT9 A;  4P5N A;  2BZ8 A;  4RTT A;  4K11 A;  4IKF A;  1A0N B;  5KYX B;  2LTO A;  5KYX A;  4BB7 A;  3BW1 A;  2NUZ A;  4II1 A;  2OAW A;  2F2X A;  1WPY A;  2LZ6 B;  4XU0 A;  2YRV A;  1QCF A;  4J9D A;  1UGS B;  3L2R A;  4RTY A;  1NYF A;  4M75 G;  4PFO A;  3JCM V;  1X69 A;  4E7H A;  5HK3 A;  4OMQ A;  1Q82 C;  3TU4 K;  2MYS A;  5GMK j;  2M16 A;  3I9Q A;  4C0G A;  1D1B A;  1WHG A;  3Q1J A;  3MJX A;  1QVG S;  4J7F A;  2COZ A;  1B34 B;  1B34 A;  4XTV A;  4AFS C;  3QSU A;  2EYX A;  4N4I A;  4X34 A;  3SDZ A;  5GAN h;  2E5Q A;  3HKS A;  1UB4 A;  1VQL A;  4LD9 K;  5LL6 S;  1OX9 A;  2E12 A;  3QG1 A;  4Z89 A;  1QVF A;  2GFA A;  1VQN Q;  5LJ3 e;  4DEY A;  3E2U A;  4BE0 A;  4F7U F;  2KDS A;  2LCC A;  3CCS Q;  3CMA Q;  1KFZ A;  2GCX A;  3HP9 A;  1M90 C;  1JJ2 A;  3QII A;  2ECZ A;  2P0Q A;  5CAI A;  4AG2 C;  1W2B P;  4BE1 A;  2A0F B;  4M7A B;  1FMW A;  3OYA A;  4M7A A;  1WNL A;  1K76 A;  1E6G A;  1WHJ A;  5J3B A;  2EQI A;  5ECA A;  1Q7Y C;  4DOW A;  1KHC A;  2QQR A;  1WLP B;  3V8L A;  3HPW A;  1MMG A;  3CCV Q;  2CSQ A;  1M2V B;  1U8R A;  1M2V A;  4HCB A;  1JXO A;  2K79 A;  3V8J A;  2DA9 A;  4PNO A;  2P84 A;  3WVE B;  2G3R A;  1NG2 A;  2P0K A;  4E7S A;  3QHS A;  1LOJ A;  2ENM A;  3M0U A;  3JB9 J;  4OMN A;  2PUO B;  1WXB A;  1PC0 A;  2O9V A;  2DD5 A;  3I55 A;  5GAO n;  3GNF B;  1Q82 R;  3CCE A;  4OB3 B;  2EYY A;  2K5L A;  4BDY A;  3HTR A;  4J8O A;  1VQM T;  3CCU A;  3CD6 Q;  1WJR A;  4JJD A;  2D1X A;  1Y71 A;  4GY5 A;  4CC7 A;  2A37 A;  2F2W A;  3G6E A;  3M59 A;  3OYD A;  1QVF P;  2ZPF B;  1NYG A;  3CCJ Q;  3C95 A;  4QQ6 A;  4ESR A;  2QYZ A;  1XOV A;  2RHU A;  1AWO A;  4OF1 A;  2BZY A;  3JCM e;  1NE8 A;  2JOY A;  1VQK Q;  5D7U A;  1PKS A;  5CQX A;  3EGD B;  2X35 A;  1M8M A;  3EGD A;  3SWN B;  4DBR A;  1JJ2 P;  4NL3 A;  3SWN A;  2J06 A;  3L2Q A;  1YIT A;  1M90 R;  1KSW A;  1VA7 A;  5GAM g;  1WA7 A;  1ZUK A;  3EG9 B;  3VU3 C;  3RES A;  3EG9 A;  3VS6 A;  1TOV A;  1K9A A;  1V76 A;  3VUB A;  1AWJ A;  2D8H A;  3G71 T;  4J9G A;  2MOX A;  2PVD B;  1WHL A;  1X6B A;  2DJZ A;  1PRM C;  1VQ7 Q;  4L6V 5;  5LJ5 e;  4XTX A;  4PJO E;  2GTO A;  4JLG A;  1H92 A;  5CKH A;  4TVR A;  5FW9 A;  2FZG B;  5GAN j;  5EC7 A;  2KEA A;  3CXC S;  4HT8 A;  4PJL A;  1YJW Q;  5GAN f;  4KGX B;  4HCZ A;  4EDU A;  3L42 A;  2EJF A;  2X4J A;  1ZLM A;  2FPF A;  3PMT A;  1GCQ C;  3RR6 A;  4HVU A; 
#chains in the Genus database with same CATH homology
 1GCQ A;  1N5Z A;  2RN8 A;  3O5Z A;  3EG2 A;  3UF4 A;  2YUN A;  3THK A;  4JJB A;  1AZE A;  2DIL A;  2HDA A;  2KBT A;  3EG3 A;  1UE9 A;  2FRW A;  2P4R A;  4LE9 A;  2X3W D;  3VS7 A;  1GBQ A;  2LJ1 A;  1ZUU A;  4OML A;  4HCK A;  3VS0 A;  3M0S A;  1AD5 A;  1FMK A;  2PNI A;  1UHF A;  1NLP C;  2HSP A;  1OV3 A;  1X27 A;  2KR3 A;  4GLM A;  1WXU A;  2FPE A;  1PKT A;  1KIK A;  2GNC A;  1V1C A;  1K4U S;  2EYW A;  1K0S A;  1AOJ A;  1AZG B;  2LJ3 A;  3KFV A;  2RPN A;  1TUD A;  2EGA A;  1Z9Z A;  3EGU A;  4EIK A;  3VRY A;  2EPD A;  4HVV A;  1BK2 A;  2M0Y A;  2CT4 A;  1T3L A;  1I0C A;  4JPB W;  4Z8A A;  3M0T A;  1Y0M A;  1SHG A;  2CUD A;  2DM1 A;  1B07 A;  1S1N A;  1AWW A;  1YNZ A;  2LNH B;  1OPK A;  4AFU C;  4D8K A;  2DRK A;  4IIM A;  3VS5 A;  3CQT A;  1I1J A;  1YWP A;  4J9B A;  2ROL A;  2KXC A;  1UDL A;  2AZS A;  4DEX A;  3SHW A;  2DL7 A;  2VVK A;  2DMO A;  1RUW A;  1OPL A;  3QWX X;  2EBP A;  3UAT A;  3I5R A;  1X2K A;  2HCK A;  2XMF A;  1AEY A;  2DL3 A;  5I11 A;  1WIE A;  2J6O A;  2W0Z A;  2J7I A;  2O88 A;  1FYN A;  1ARK A;  2DYB A;  2I0N A;  2K6D A;  1UGV A;  2KNB B;  2DBM A;  2EGC A;  3PE0 A;  3UA6 A;  2IIM A;  3A98 A;  2AKK A;  2V1R A;  2JW4 A;  2RNA A;  2GQI A;  1RLQ C;  1QWF A;  4LUD A;  1WDX A;  2RMO A;  2DJQ A;  3H0F A;  1YP5 A;  2KYM A;  1WI7 A;  1WXT A;  2NWM A;  1HSQ A;  1SHF A;  5FWB A;  3RBB B;  3VS3 A;  2L3Q A;  2EYZ A;  2PTK A;  2RF0 A;  5IHK A;  4HXJ A;  2KRN A;  3JV3 A;  2FG0 A;  2QDL A;  1KJW A;  2KE9 A;  1ABQ A;  1Z9Q A;  2DVJ A;  1GRI A;  2W10 A;  2YDL A;  3PVQ A;  1PRL C;  2LQN A;  1BU1 A;  2ABL A;  2ESW A;  4J9I A;  4ZNX A;  1EFN A;  4RTX A;  1B3Q A;  2J05 A;  4LNP A;  2RQU A;  3M0P A;  4A63 B;  2VWF A;  2ED0 A;  2C0T A;  4J9H A;  2KT8 A;  2GBQ A;  3EHR A;  2L3S A;  5GJV B;  2C0I A;  2BZX A;  2LJ0 A;  3U23 A;  2F2V A;  1W6X A;  2DL5 A;  1WX6 A;  2JXB A;  4JZ4 A;  1NEG A;  4GBQ A;  1LCK A;  1SEM A;  4RUG A;  1NEB A;  1J3T A;  2H8H A;  3NHN A;  5I22 A;  4CC2 A;  1UUE A;  1M3C A;  1W70 A;  4RTU A;  4RTW A;  1AVZ C;  1M3A A;  3M0R A;  1MV0 B;  2JM9 A;  1H3H A;  3SEM A;  2YT6 A;  3VS2 A;  2JTE A;  3I35 A;  3H0H A;  1HD3 A;  3IQL A;  4J9F A;  2KGT A;  4Z88 A;  1HJD A;  2DNU A;  1UG1 A;  1W1F A;  1QKW A;  2BZ8 A;  4RTT A;  3RNJ A;  4RTV A;  4K11 A;  1A0N B;  2O31 A;  1PNJ A;  2JM8 A;  1SSH A;  3REA B;  2NUZ A;  2CH4 A;  2OAW A;  2F2X A;  2EKH A;  4OMP A;  2LCS A;  2LZ6 B;  1G2B A;  4LN2 A;  1CKB A;  1QCF A;  4J9D A;  4FSS A;  3NGP A;  4RTY A;  2GTJ A;  1NYF A;  1TUC A;  1SRM A;  4RTZ A;  4OMO A;  1X69 A;  4J9C A;  4AFZ C;  4OMQ A;  3VS1 A;  4R0K A;  4CC4 B;  2G6F X;  2L0A A;  2O2O A;  3I9Q A;  1JO8 A;  1NM7 A;  2E5K A;  2YSQ A;  2JMC A;  2L3P A;  1ZBJ A;  1YN8 A;  4AFS C;  2EYX A;  1E7O A;  1YCS B;  2DBK A;  2GGR A;  3M0Q A;  4AG1 C;  1TG0 A;  1G83 A;  1SPK A;  1JU5 C;  2EGE A;  1QKX A;  1YWO A;  1ZSG A;  4Z89 A;  1VYT A;  1PWT A;  3REB B;  1UEC A;  4DEY A;  4HVW A;  2V1Q A;  3EG0 A;  3LH5 A;  5IHI A;  2JS0 A;  3ULR B;  2EW3 A;  2YUO A;  1T0H A;  1E6H A;  2L2P A;  1ZUY A;  2DRM A;  2ED1 A;  1UJ0 A;  2RQW A;  2OI3 A;  3H0I A;  2YUP A;  5FWC A;  3EHQ A;  1KFZ A;  2LX7 A;  1NLO C;  5IHN A;  2KYB A;  2DF6 A;  2JS2 A;  2ECZ A;  2J6F A;  2AKL A;  4AG2 C;  5IXB A;  5IH2 A;  4WCI A;  2A08 A;  3TSW A;  1JQQ A;  1M27 C;  1X6G A;  1K76 A;  1E6G A;  3VRZ A;  2RQV A;  4CC3 A;  2EQI A;  4LUE A;  5ECA A;  2DLP A;  1K0X A;  2KRS A;  1WLP B;  1UHC A;  2CSQ A;  5HCK A;  1JXO A;  2K79 A;  1T0J A;  2DA9 A;  2X3X D;  1UJY A;  2KRM A;  2LP5 A;  2M51 A;  2KXD A;  3UA7 A;  2MIO A;  3I5S A;  2HBW A;  4OMM A;  1NG2 A;  2YUQ A;  1M30 A;  2K3B A;  5IXF A;  2ENM A;  2CH4 W;  3M0U A;  3ZL7 C;  2JMA A;  3NMZ C;  3TVT A;  4OMN A;  2HEQ A;  1WXB A;  2DE0 X;  1MV3 A;  2O9V A;  2C0O A;  4JJC A;  4J9E A;  1QLY A;  1U3O A;  4QT7 A;  2RQT A;  1WYX A;  2K2M A;  2D0N A;  2FEI A;  2SEM A;  4E6R A;  1JXM A;  2EYY A;  1RLP C;  1I07 A;  1VYU A;  1CKA A;  1OOT A;  2KT1 A;  4JJD A;  1K1Z A;  1X2Q A;  2D1X A;  3C0C A;  2JT4 A;  4CC7 A;  2A37 A;  2F2W A;  4Y92 A;  1T3S A;  1UTI A;  2DX1 A;  2SRC A;  1VYV A;  1NYG A;  4ORZ A;  1OEB A;  4ESR A;  1XOV A;  3VS4 A;  2CT3 A;  1QWE A;  1IO6 A;  2K9G A;  1AWO A;  4D8D A;  3EG1 A;  2AK5 A;  2BZY A;  1AWX A;  4KRT A;  2RQR A;  1H8K A;  1PKS A;  1RI9 A;  2OJ2 A;  2A28 A;  1M8M A;  2J06 A;  2VKN A;  2CRE A;  4M4Z A;  1KSW A;  4AFQ C;  1PHT A;  2D8J A;  2LMJ A;  1VA7 A;  2O9S A;  2DL8 A;  3FJ5 A;  4X1V A;  5L23 A;  1WFW A;  1M3B A;  1BB9 A;  1WA7 A;  1ZUK A;  1JEG A;  1ZX6 A;  4JZ3 A;  2CSI A;  3VS6 A;  1K9A A;  1GL5 A;  1MUZ A;  1AWJ A;  2A36 A;  2D8H A;  4J9G A;  2MOX A;  2FO0 A;  1X6B A;  1U5S A;  1PRM C;  2KRO A;  3NPF A;  1GFC A;  1BBZ A;  3GBQ A;  1UFF A;  1X43 A;  3R6N A;  1GCP A;  5GJW B;  2MCN A;  2FPD A;  2CUB A;  2GTO A;  2CDT A;  1H92 A;  1CSK A;  1ABO A;  2ROT A;  3TSZ A;  1GBR A;  1Y57 A;  1U06 A;  2AZV A;  5FW9 A;  5EC7 A;  2FRY A;  2KEA A;  3QWY A;  4F16 A;  2LQW A;  2BTT A;  4F14 A;  1GFD A;  1SRL A;  2PZ1 A;  3PVL A;  2B86 A;  4F17 A;  1ZLM A;  2DL4 A;  2FPF A;  1GCQ C;  4IIO A;  2EVR A;  2J6K A;  4HVU A;  3H41 A;  2K7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...