4OMWA

Crystal structure of goat beta-lactoglobulin (orthorhombic form)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
162
structure length
162
Chain Sequence
b'IIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGNLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDKEALEKFDKALKALPMHIRLAFNPTQLEGQCHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title Conformational variability of goat beta-lactoglobulin: Crystallographic and thermodynamic studies.
pubmed doi rcsb
molecule tags Transport protein
total genus 42
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4omwA00
1CJ5A 4AZRA 1AVGI 1OEKA 1GX9A 5F6BA 1B0OA 2HYSA 2WUTA 4ZH6A 1IFCA 1X89A 3P6EA 3G7XA 1RBPA 4LZUA 1SXUA 2OZQA 1TVQA 1FELA 1A3YA 3WJDA 4ORUA 3STKA 1NP4A 5HCDC 1ADLA 3ELXA 2FT9A 3ZQ3A 1GT5A 5BVTA 3C77X 4UU3A 3B2JA 4TQ2A 4IB9A 2GJ5A 4R0BA 1JYJA 2LBAA 5L8NA 4HPDA 5KICA 2E4JA 4YGGA 3CBSA 3Q6LA 4BOEA 1X8QA 1I05A 2R73A 2W2AA 4OS3A 4EFGA 1MDCA 4AZMA 4N7CA 1G85A 2IFBA 1RLBE 1BSQA 2FLJA 1BSOA 2A2UA 5DG4A 5H8TA 4QZTA 2JU7A 4YFPA 5H9LA 3AKMA 4TLJA 5D4AA 1CRBA 1DFVA 1EW3A 1ICMA 1ZRYA 1KZWA 3KZAA 4Y0QA 4HPAA 3U03A 4MVKA 1TOWA 3WXQA 1O1UA 1EIIA 3FA6A 2FS6A 3PECA 4AZNA 3APUA 1B8EA 1TOUA 1KT3A 3APVA 3EMMA 1UREA 3CR6A 5HZ6A 4EDEA 4ORSA 4IB7A 1OPAA 5D47A 3WJEA 3PPTA 1IW2A 1QY1A 1LIDA 1BJ7A 1L6MA 2KT4B 3FR4A 2WR6A 5DPQA 5EPQA 2ALLX 2FWVA 1KGLA 1QABE 1FEMA 1S7DA 2OVAA 2WWPA 4NNSA 4ZHCA 5HBSA 1DZPA 1BEBA 5HTDA 4QYPA 2CZTA 4YCHA 1JV4A 5HZ9A 1E00A 4ALOA 1EPAA 1CBRA 3I0AA 1ZNEA 3FR2A 5K06A 2AL0X 3BLGA 2QO4A 3VG6A 2N93A 1OEEA 3P6GA 1N0SA 1GKAA 2X46A 2FTBA 4N7DA 2Q9SA 3NQ9A 4BQUA 1KT5A 2A0AA 4YGZA 1ERXA 1EPBA 1CBQA 2DM5A 3K3LA 2FR2A 5L8OA 1UZ2X 4GKCA 4ALBA 4AW8A 4IAXA 4D6BA 1PMPA 4MVIA 2G78A 2L68A 1S2PA 4GRJA 5EEDA 3ZUOA 3S26A 3P6DA 4NLJA 5H9AA 4LZVA 1QY2A 2HNXA 5IO7A 1DF3A 3C76X 2HZQA 4ORYA 3UEUA 5LJDA 1GGLA 3U9PC 1YIVA 2CBSA 1LIBA 1HBQA 3I17A 1PEEA 2NNDA 3KFGA 1MX8A 1U18A 3VG7A 1LPJA 3BRNA 5KHPA 2RCTA 5IO6A 3D96A 2L5PA 3TGBA 1FTPA 1DZKA 3PP6A 5LJBA 3C78X 3BS2A 2QM9A 1O8VA 4ZGUA 2FRSA 1GT3A 3HWGA 3ZUIA 3WJCA 4TKJA 5H9KA 5F6ZA 4QGWA 2AT5X 4GH7A 2A2GA 2Q2PA 4YGHA 5EZ2A 4YDBA 1X8NA 1PBOA 1SXXA 4M6SA 2FS7A 5D45A 5CE4A 2OVEA 3B2KA 3NX2A 4RUUA 1BRQA 5HZQA 1OBQA 5H9NA 2XSTA 3JSQA 4WFUA 1X71A 2YG2A 2MJIA 3RZYA 5HAEA 2FR3A 3OJYC 4QYNA 1HQPA 1PM1X 5C0NA 4XMDA 1EQDA 1HMSA 2WEWA 4I3DA 4NP1A 2CM4A 2RCQA 3FA9A 1BLRA 3PEDA 1GXAA 3UEWA 4OS8A 1D3SA 1Z24A 3NQ3A 3BSZE 4A1HA 5EDCA 3FR5A 2WQAE 4LKPA 2W2BA 3U0DA 1YWAA 3VG5A 4Y0RA 1OBUA 2WSJA 4AZQA 5F58A 1EUOA 4M7MA 4I9SA 4YCEA 4XMCA 4RUNA 1NGLA 4NYRA 1QWDA 2AKQA 3NADA 1D2UA 4QAEA 1DZMA 3WJGA 1IKJA 1HBPA 1T68X 1YUPA 1DC9A 3PH6A 1I4UA 1MVGA 4YKOA 1JBHA 2O62A 2Q4NA 4XMEA 4XMHA 3STNA 1MUPA 3P6FA 4HPBA 1AB0A 3FELA 3FA8A 1MX7A 1XCAA 1IIUA 2KTDA 3IFBA 3NR3A 4WFVA 1EIOA 2L67A 3F8AA 2Q2MA 5LJEA 4I3BA 1KT6A 5LJHA 4IBAA 4KIIA 1OEJA 2A3FX 1QFVA 3CQRA 3FW5A 4IB6A 1O1VA 5EDBA 3SAOA 2NNQA 5HCCC 4ARHA 4NLIA 3D95A 1SY1A 2NP1A 1XKIA 3APWA 4ES7A 1ZNKA 1TW4A 1HMRA 1ZNGA 1ZNDA 2X45A 3HK1A 1A57A 1AELA 1G7NA 1GT4A 1ACDA 3O2YA 4AZPA 4AYHA 3CQNA 4ZHFA 4YMYA 3ELZA 5LKEA 3UEVA 4QGXA 4ZHHA 1IFBA 1SXYA 3JS1A 5JR8A 2P8GA 1U0XA 1OBPA 4OMXA 1JZUA 4ZFXA 2CZUA 4CK4A 3TGCA 3P6CA 4XMFA 3PH5A 5L8IA 2LB6A 3GAQA 5HCEC 3B2IA 3MVFA 3FEPA 1A2DA 2AT3X 3EM0A 1BRPA 4UU2A 5LJCA 2PY1A 2ASNX 3O19A 3NPOA 1T0VA 1FENA 1FE3A 1ALBA 4ZJ0A 4YFQA 3DTQA 3F9DA 1HN2A 4OS0A 5HTEA 4A1YA 3EBKA 4DQ3A 3O22A 2G79A 1KQWA 1YWDA 4YH0A 3FW4A 3STMX 3CBCA 2JU3A 3APXA 1LKEA 4D6AA 5LJGA 1AQBA 1GX8A 3QKGA 4MVLA 4ORXA 5B27A 3DSZA 2GTFX 2F73A 3T1DA 4ODDA 2MO5A 1KQXA 1KOIA 4IMOA 4Y0SA 5FENA 2AT8X 2OFMX 1EALA 2LKKA 2XKLA 1SA8A 1G74A 2G7BA 1B4MA 2LFOA 2GC9A 3EYCA 1QQSA 3WVMA 4ZHDA 3IA8A 4IMNA 3TZSA 1BBPA 1GM6A 2POAA 1X8UA 1QG5A 1SY0A 2RQ0A 3KFFA 1BWYA 4A60A 2BLGA 3BX8A 3L4RA 3FIQA 3KQ0A 5D8JA 2AT0X 2QO6A 2OFRX 1ERBA 4GNYA 4AZOA 2K62A 3FA7A 4QGVA 5EEEA 1X8OA 3MBTA 2JOZA 3VG4A 1H91A 2A13A 5BVSA 5LKFA 4EEJA 3FEKA 4K19A 2EU7X 3EBWA 1DV9A 4YKMA 4TKBA 2RA6A 5KIDA 4I3CA 2W2FA 4WBKA 1JYDA 1QY0A 2LBVA 4NYQA 4TKHA 1JJJA 1LF7A 2JU8A 4YBPA 1A18A 1P6PA 1VYGA 1KXOA 1BSYA 4GNWA 1IKEA 1CBIA 1YP6A 3HWDA 1B56A 5F1EA 2AT6X 1QFTA 4ZH9A 3NP1A 2RD7C 1GT1A 3CWKA 2R74A 2QO5A 1E06A 3VG3A 1NP1A 3P6HA 5AQ6A 2WEXA 4NNTA 1ZNLA 1KT4A 2JN3A 2QOSC 2CBRA 4ZHGA 1LNMA 4ORRA 5HA1A 4Y0PA 1GKAB 1JJXA 4YBUA 4A8ZA 3B2LA 3BU9A 2ACPX 4DQ4A 4I9RA 2OVDA 2Q39A 3BY0A 5F7GA 4TNNA 3WBGA 4XMGA 3HWEA 5FFHA 4EXZA 3TF6A 1ZNHA 3FLLA 2AMMX 3BDRA 5HA0A 1HMTA 2AH7X 5LJKA 1FDQA 1E02A 5FAZA 1YP7A 3FENA 3WJFA 1ML7A 3BX7A 2ANSA 1EXSA 3KFIA 5HZ8A 3TGAA 1X8PA 3WJBA 5IO5A 1LIFA 2HZRA 1T8VA 4PSQA 2K23A 5BVQA 3D97A 1S44A 4YDAA 1G5WA 4TJZA 1LIEA 3AKNA 1SXWA 4HPCA 1VPRA 4IAWA 2HLVA 1CBSA 4HFOA 1KZXA 1KT7A 3CMPA 3FMZA 4ZR2A 1DZJA 1VYFA 4GETA 2WQ9A 1I04A 1SY3A 3BU1A 2NNEA 4LKTA 1TXLA 2R56A 5B29A 3KFHA 1SY2A 4ORWA 2CM9A 3B2HA 1OPBA 4ZCBA 4GE1A 1YWBA 4O9SA 2ACOA 5D48A 3RSWA 1I06A 3VG2A 3HWFA 1LICA 1U17A 2HMBA 4QZUA 1YWCA 5HZ5A 1BM5A 4OMWA 1ICNA 4BVMA 3NX1A 1E5PA 5HWZA 4IB8A 2L9CA 4YFRA 2MM3A 3UEXA 1LFOA 1R0UA
chains in the Genus database with same CATH superfamily
4COTA 4AZRA 1CJ5A 1AVGI 1OEKA 1W4TA 1KL3A 1GX9A 5F6BA 1B0OA 2HYSA 4BX7A 1SWGA 2OY1O 2WUTA 2JW1A 4ZH6A 1IFCA 1IJ8A 1VWLB 1X89A 3P6EA 3G7XA 1RBPA 4LZUA 3VU1A 1SXUA 1SWDA 2OZQA 4Y59A 5AJCA 4MEEA 1TVQA 1FELA 1A3YA 3RKGA 3WJDA 4ORUA 1SWSA 2M4LA 2CAMA 2IZBA 2KTSA 3STKA 1JIWI 1NP4A 4BX6A 5HCDC 3RDXA 2FHLA 1ADLA 3SLJA 3ELXA 2FT9A 4GU8A 1GT5A 3ZQ3A 5BVTA 1UYNX 3C77X 1VWMB 4UU3A 3B2JA 4TQ2A 4IB9A 1Y53X 5B11O 2GJ5A 4R0BA 1JYJA 2LBAA 3WZOA 5L8NA 4HPDA 3SZHA 5KICA 4HWMA 2E4JA 4YGGA 3CBSA 3Q6LA 1I9HA 4BOEA 1X8QA 1I05A 2R73A 3PK2A 1SLEB 2W2AA 4OS3A 2OY7A 1MDCA 4AZMA 4EFGA 3VHIA 4GK9A 4N7CA 1G85A 2IFBA 1RLBE 1BSQA 4O3ZA 2FLJA 1BSOA 2F09A 2A2UA 5DG4A 3PQUA 4QZTA 5H8TA 1AVEA 2JU7A 3S5XA 4YFPA 5JD2A 5H9LA 3AKMA 4TLJA 1VWNB 5D4AA 4Z2PA 1CRBA 1DFVA 1EW3A 3WYPA 1ICMA 1ZRYA 1KZWA 1HXLA 3KZAA 1RXKA 4L3RA 4Y0QA 4HPAA 3U03A 4MVKA 3SLOA 4DCBA 2VFCA 1TOWA 3D9WA 3WXQA 1O1UA 1EIIA 1STPA 3LHNA 3FA6A 2QOMA 3V8UA 2FS6A 3PECA 4AZNA 1LDOA 3APUA 1Y0GA 1B8EA 1TOUA 1KT3A 3APVA 3EMMA 1UREA 3CR6A 2FHNX 5HZ6A 4EDEA 4ORSA 4BX5B 4IB7A 1OPAA 5D47A 3WJEA 3PPTA 1IW2A 1QY1A 1LIDA 1BJ7A 1L6MA 2KT4B 3FR4A 2AVIA 2WR6A 3GE2A 2ALLX 3MG5A 5DPQA 2FWVA 5EPQA 1KGLA 1QABE 4ON1A 1JMZA 3H3IA 1FEMA 1S7DA 1SWBA 2OVAA 2WWPA 4NNSA 4ZHCA 5HBSA 1DZPA 1BEBA 2RTFB 1MM9A 4O4OA 4QYPA 2CZTA 3N91A 3VG2A 5HTDA 4YCHA 1SMPI 1JV4A 4CDEA 1W5RA 1MK5A 1E00A 3PDFA 4ALOA 1SREA 1EPAA 1VWEB 5HZ9A 4O4XA 2C1QA 1CBRA 3I0AA 1LCWA 1ZNEA 3FR2A 3WYQA 5K06A 2AL0X 4B55A 1KL4A 3BLGA 2QO4A 3VG6A 2BHVA 1OEEA 2G8CO 2N93A 3P6GA 4GGRA 3VHHA 1N0SA 5B5GA 1SWKA 1GKAA 1VWPB 3P02A 2X46A 3HOEA 2FTBA 4N7DA 1I78A 2Q9SA 2YMSA 3NQ9A 3RWXA 4BQUA 4Z28A 1KT5A 3ZW2A 2A0AA 4GJSA 4YGZA 2G5LA 1ERXA 4U8UM 1EPBA 1CBQA 2DM5A 1SWLA 1VYOA 2ZSCA 1SWQA 2FR2A 3EW2A 3K3LA 1UZ2X 4GKCA 3ZI8A 4ALBA 4AW8A 4BCSA 4IAXA 4D6BA 1PMPA 3S60A 4MVIA 2G78A 2L68A 2C4IA 1S2PA 4GRJA 5CSEA 5EEDA 4ID2A 1SWCA 1FJ1E 2BT9A 2C1SA 3ZUOA 3S26A 4QRLA 3JQOA 1MOYA 3LV4A 5B5FA 3P6DA 4NLJA 5H9AA 4LZVA 1QY2A 2HNXA 5IO7A 1DF3A 3C76X 2HZQA 4ORYA 3UEUA 5LJDA 1GGLA 3U9PC 1YIVA 2CBSA 4PJ2A 1LIBA 4CV7A 1HBQA 2WPUA 2LA7A 5IRWA 3I17A 2AF5A 1PEEA 2NNDA 3KFGA 1MX8A 1U18A 1VWBB 4JO6A 1Y9LA 1SWFA 1LPJA 3VG7A 1LCVA 3RE5A 3BRNA 2RTLA 2GH7A 2RCTA 3SOTA 1KL5A 5IO6A 5KHPA 3D96A 2L5PA 4EKVA 3TGBA 1FTPA 1DZKA 3PP6A 2DJGA 5LJBA 3C78X 3BS2A 2QM9A 1O8VA 4ZGUA 2FRSA 1GT3A 3HWGA 3RDQA 2RTAA 3ZUIA 1VWHB 2IZGB 2GTLM 4IRWA 3WJCA 4TKJA 5H9KA 3RE6A 5F6ZA 2X56A 4QGWA 2DJFA 2AT5X 4GH7A 4L1NA 3ZW0B 4CPHA 3SZIA 1SLDB 2JMBA 2A2GA 2Q2PA 2OL7A 4MVEA 4YGHA 5EZ2A 4BX7B 4YDBA 1X8NA 1GX3A 1PBOA 1SXXA 4M6SA 2FS7A 2OFBA 3OBLA 5CYBA 2IZKA 2OVEA 3B2KA 3NX2A 1BRQA 4RUUA 5D45A 5HZQA 1OBQA 1SRFA 2XSTA 3JSQA 4JHQA 4WFUA 5H9NA 1X71A 2YG2A 3ZW1A 2MJIA 3RZYA 4FGIB 4BX6B 5HAEA 1VWDB 1SWOA 2FR3A 1LCZA 4ZCBA 3OJYC 4QYNA 2BS6A 1N9MA 2RTPB 1HQPA 4FQBB 1LELA 1PM1X 3UAQA 5C0NA 4XMDA 1EQDA 1HMSA 1HY2A 2WEWA 4I3DA 4NP1A 2CM4A 1NQNA 2RCQA 3FA9A 1BLRA 1JJUA 1GXAA 3PEDA 3UEWA 1PBYA 4OS8A 2RTGB 1D3SA 1OSPO 1Z24A 3NQ3A 4EQAC 3BSZE 4A1HA 5EDCA 3FR5A 2WQAE 4GJVA 3T2XA 4LKPA 4CPFA 2W2BA 3L4RA 3U0DA 4O4UA 1YWAA 2FKJA 3VG5A 4Y0RA 1OBUA 1SLFB 2WSJA 5F58A 4AZQA 4BGFA 1EUOA 4CSBA 4M7MA 4I9SA 1JQPA 4YCEA 4XMCA 4RUNA 2QMIA 3KVNA 4CDDA 1NGLA 4NYRA 1QWDA 2AKQA 3NADA 1VWIB 1D2UA 4QAEA 5K68A 1DZMA 3WJGA 1IKJA 1HBPA 1T68X 1N43A 1YUPA 3S5VA 1DC9A 3PH6A 3HOLA 1I4UA 1VWQB 1MVGA 2RN4A 2RTDB 4YKOA 1HQQA 2MHDA 1VWCB 1JBHA 2O62A 2GTLN 2Q4NA 4XMEA 4XMHA 2IZEB 1MUPA 5F2BA 3STNA 3P6FA 4Z6JA 4HPBA 1AB0A 2IZHB 2QCBA 1MX7A 1XCAA 1IIUA 2KTDA 3FA8A 3FELA 3IFBA 3NR3A 4GUZA 4JGLA 3RDSA 3Q34A 5L3YA 4WFVA 3RY1A 1EIOA 2L67A 3F8AA 2Q2MA 5LJEA 4I3BA 1KT6A 2I5ZO 2JGSA 3MX7A 4NV7A 1Y9TA 4IBAA 4I95A 5LJHA 4KIIA 3WZNA 1OEJA 3ZZVA 1QFVA 2A3FX 3CQRA 3FW5A 4IB6A 1O1VA 5EDBA 1VWJB 3QQ2A 1SWAA 2NNQA 2RTKA 3SAOA 5HCCC 3PQSA 4ARHA 1RSTB 4NLIA 4KH8A 4MIRA 1KFFA 3D95A 1SY1A 2NP1A 2UZ2A 1XKIA 4ML7B 3APWA 4I6SA 5IRAA 2X8FA 4ES7A 1ZNKA 1SWNA 1TW4A 4KT5A 1HMRA 1ZNGA 1ZNDA 2A5BA 2X45A 3HK1A 2BSZA 3FDCA 1A57A 1AELA 4KC7A 1G7NA 1GT4A 2VFBA 2IZCB 1ACDA 3O2YA 4Z2VA 4OKAA 3VE2A 2OF9A 4AZPA 2MF6A 4AYHA 4C5PA 3CQNA 4ZHFA 4YMYA 3ELZA 5LKEA 1SLGB 2X32A 4O3YA 3UEVA 2IZDB 4QGXA 4ZHHA 1IFBA 1SXYA 1VWRB 3JS1A 2Z4HA 2X4MA 2P8GA 3OE3A 4QQ1A 1U0XA 2OYBO 3X00A 1OBPA 2RTIB 3OD9A 4OMXA 1JZUA 4ZFXA 4GZVA 1PTSA 2CZUA 4CK4A 2IZIA 3T6FA 1SWPA 3TGCA 3P6CA 5IRUA 1SWUA 4GGTA 2VDFA 4XMFA 3PH5A 1K3BA 5L8IA 2LB6A 3GAQA 1SWTA 5HCEC 3B2IA 3MVFA 3FEPA 3RDOA 2FKGA 1A2DA 2AT3X 1SWEA 1BRPA 3EM0A 4UU2A 5LJCA 2RTCB 2FGSA 2PY1A 2ASNX 3O19A 4INNA 2IZFB 1DF8A 2OY8A 3CKGA 3NPOA 1T0VA 2RTQB 1FENA 1FE3A 2A5CA 1ALBA 1RAVA 3VE1A 4ZJ0A 4YFQA 4FBOA 1NQMA 3DTQA 3F9DA 2PI3O 4FBRA 1HN2A 1SRHA 4OS0A 1LDQA 2OVSA 4CPHB 5HTEA 4A1YA 3EBKA 4DQ3A 3O22A 2G79A 1KQWA 1YWDA 4YH0A 3FW4A 3STMX 3CBCA 1SRJA 2JU3A 3APXA 1LKEA 2OFAA 1VWFB 4U46A 5FQ6E 4D6AA 3SZJA 1SWJA 5B3MO 1HXZA 5LJGA 1AQBA 3ZW1B 1GX8A 3QKGA 4MISA 3D4RA 4MVLA 2I5VO 4ORXA 5B27A 3DSZA 2GTFX 2F73A 3T1DA 4ODDA 2MO5A 1KQXA 1KOIA 1JMXA 2RTEB 3LTWA 4IMOA 4U8UN 4Y0SA 2AT8X 5FENA 3ZW0A 2OFMX 3CKFA 2OL6O 1EALA 1AVDA 2LKKA 5IXGA 2XKLA 1SA8A 1G74A 4GDAA 2G7BA 2IZLB 1B4MA 2LFOA 3EW1A 2GC9A 4CPEA 2X34A 2ZAGA 3EYCA 1QQSA 3WVMA 4ZHDA 3IA8A 1WUBA 4IMNA 3TZSA 1BBPA 2OL8O 1GM6A 1STSB 1X8UA 2POAA 1QG5A 1SY0A 2RQ0A 1E2TA 3KFFA 1BWYA 4A60A 2BLGA 3BX8A 2A8GA 2KW1A 3FIDA 3FIQA 2AT0X 3EC5A 2QO6A 2OFRX 3HTYA 1ERBA 3KQ0A 4GNYA 4U3QA 4AZOA 2K62A 3FA7A 3F6ZB 4QGVA 5EEEA 1X8OA 2Y32A 2JOZA 3MBTA 4JNJA 3VG4A 4QNIA 5D8JA 1H91A 1NC9A 2A13A 2Z4IA 5BVSA 5LKFA 2F01A 1RXJA 4EEJA 2RTRB 1VWAB 2EU7X 3FEKA 3EBWA 4K19A 1DV9A 4CDFA 1SRGA 4CPIA 5AEOA 4YKMA 4TKBA 2RA6A 5KIDA 4I3CA 2W2FA 4WBKA 1JYDA 1QY0A 1RXHA 2LBVA 4NYQA 4TKHA 1JJJA 1LF7A 2JU8A 4YBPA 1A18A 1P6PA 1NBXA 1N4JA 1KXOA 1STRB 1VYGA 4FBVA 1BSYA 4GNWA 1IKEA 3VPJE 1CBIA 1YP6A 3HWDA 5K67A 1B56A 1Y55X 5F1EA 1VWOB 2AT6X 1QFTA 3FYFA 4YVBA 4Z27A 1MEPA 4ZH9A 4U8UO 3NP1A 2RD7C 1GT1A 3CWKA 1W6FA 2R74A 2RTHB 5BYPA 4IABA 3RY2A 2QO5A 1E06A 4O3XB 3VG3A 1NP1A 4U9CA 3AUMO 3P6HA 5AQ6A 2WEXA 4NNTA 4O49A 1ZNLA 1Y52X 1KT4A 1LUQA 2JN3A 1EI5A 2QOSC 2CBRA 4I60A 1LNMA 4BX5A 4DNEA 4ZHGA 4ORRA 5HA1A 3HPEA 4ZGFA 4Y0PA 1GKAB 2RTJA 5AJBA 4BBOA 1JJXA 4YBUA 3WZPA 3B2LA 2X8SA 3BU9A 2ACPX 3WOVA 4A8ZA 4DQ4A 3NQKA 4I9RA 2OVDA 2Q39A 3BY0A 4CDCA 2X8TA 2IZJA 5F7GA 2IZAA 2HKDA 2UYWA 4GD9A 4NW4A 4NV8A 4O3WA 4TNNA 3WBGA 4XMGA 3HWEA 5B10O 5FFHA 4EXZA 3TF6A 3WZQA 1ZNHA 3FLLA 3T6LA 2AMMX 3BDRA 5HA0A 1HMTA 2AH7X 3P24A 3RBYA 5LJKA 1FDQA 1E02A 5FAZA 3VGWA 2BS5A 3NBXX 3T2WA 1YP7A 3FENA 3WJFA 1ML7A 3BX7A 2ANSA 1EXSA 3KFIA 4KC8A 4BJ8A 5HZ8A 3TGAA 1X8PA 3WJBA 5IO5A 2GTLO 1LIFA 2HZRA 1T8VA 3E3CA 2K23A 1UYOX 4PSQA 5BVQA 3D97A 1S44A 4YDAA 5CE4A 1VWKB 1G5WA 4TJZA 2RTBB 3RDMA 1LIEA 3AKNA 2ZAIA 1SXWA 4HPCA 5JR8A 1VPRA 3MM0A 4IAWA 2HLVA 1N7YA 1VWGB 2RTOB 1CBSA 4HFOA 3VHMA 3ZWEA 1KZXA 2MWHA 1KT7A 3CMPA 1SRIA 2Y3FA 3FMZA 3SLTA 1N9YA 4LQZA 4ZR2A 1DZJA 4GGZA 4GDZA 1NDJA 1VYFA 4GETA 2BC3A 2WQ9A 1I04A 5L8OA 1SY3A 3BU1A 4WHIA 2NNEA 4LKTA 1TXLA 1SWHA 2R56A 3KFHA 5FQ8E 5B29A 1SY2A 1SWRA 4OELA 2CM9A 4ORWA 5CHKA 3B2HA 1OPBA 2OF8A 4GE1A 1YWBA 4O9SA 2ACOA 4OEMA 5D48A 1I06A 5FQ7E 3HWFA 3RSWA 1LICA 1U17A 4Z2OA 2HMBA 4QZUA 1WBIA 1YWCA 4KCAA 4O4SA 2KD2A 3RDUA 4Y5DA 5HZ5A 1BM5A 2X55A 2RTNB 1K24A 4OMWA 1ICNA 4BVMA 3AEHA 3NX1A 1E5PA 5HWZA 4IB8A 5B2AO 2Y3EA 1RSUB 2L9CA 4YFRA 2MM3A 2OY5O 3UEXA 1LFOA 2RTMA 1R0UA
chains in the Genus database with same CATH topology
4COTA 4AZRA 1CJ5A 1AVGI 1OEKA 1GX9A 5F6BA 1B0OA 2HYSA 2WUTA 4ZH6A 2JW1A 1IFCA 1X89A 3P6EA 3G7XA 1RBPA 4LZUA 3VU1A 1SXUA 2OZQA 5AJCA 1TVQA 1FELA 1A3YA 3RKGA 3WJDA 4ORUA 2M4LA 2KTSA 3STKA 1JIWI 1NP4A 5HCDC 1ADLA 3ELXA 2FT9A 4GU8A 1GT5A 3ZQ3A 5BVTA 3C77X 4UU3A 3B2JA 4TQ2A 4IB9A 2GJ5A 4R0BA 1JYJA 2LBAA 5L8NA 4HPDA 5KICA 4HWMA 2E4JA 4YGGA 3CBSA 3Q6LA 4BOEA 1X8QA 1I05A 2R73A 2W2AA 4OS3A 4EFGA 1MDCA 4AZMA 4GK9A 4N7CA 1G85A 2IFBA 1RLBE 1BSQA 4O3ZA 2FLJA 1BSOA 2F09A 2A2UA 5DG4A 3PQUA 4QZTA 5H8TA 2JU7A 3S5XA 4YFPA 5H9LA 3AKMA 4TLJA 5D4AA 1CRBA 1DFVA 1EW3A 1ICMA 1ZRYA 1KZWA 3KZAA 4L3RA 4Y0QA 4HPAA 3U03A 4MVKA 1TOWA 3WXQA 1O1UA 1EIIA 3LHNA 3FA6A 3V8UA 2FS6A 3PECA 4AZNA 3APUA 1B8EA 1TOUA 1KT3A 3APVA 3EMMA 1UREA 3CR6A 5HZ6A 4EDEA 4ORSA 4IB7A 1OPAA 5D47A 3WJEA 3PPTA 2KT4B 1IW2A 1QY1A 1LIDA 1BJ7A 1L6MA 3FR4A 2WR6A 3GE2A 5DPQA 2ALLX 5EPQA 2FWVA 1KGLA 1QABE 4ON1A 3H3IA 1FEMA 1S7DA 2OVAA 2WWPA 4NNSA 4ZHCA 5HBSA 1DZPA 1BEBA 4O4OA 4QYPA 3VG2A 5HTDA 2CZTA 3N91A 4YCHA 1SMPI 1JV4A 5HZ9A 1E00A 4ALOA 1EPAA 4O4XA 1CBRA 3I0AA 1ZNEA 3FR2A 5K06A 2AL0X 3BLGA 2QO4A 3VG6A 2BHVA 1OEEA 2N93A 3P6GA 1N0SA 1GKAA 3P02A 2X46A 3HOEA 2FTBA 4N7DA 2Q9SA 2YMSA 3NQ9A 4BQUA 1KT5A 3ZW2A 2A0AA 4YGZA 4U8UM 1ERXA 1EPBA 1CBQA 2DM5A 3K3LA 3ZI8A 2FR2A 5L8OA 1UZ2X 4GKCA 4ALBA 4AW8A 4IAXA 4D6BA 1PMPA 3S60A 4MVIA 2G78A 2L68A 1S2PA 4GRJA 5EEDA 4ID2A 2BT9A 3ZUOA 3S26A 4QRLA 3JQOA 3LV4A 3P6DA 4NLJA 5H9AA 4LZVA 1QY2A 2HNXA 5IO7A 1DF3A 3C76X 2HZQA 4ORYA 3UEUA 5LJDA 1GGLA 3U9PC 1YIVA 2CBSA 4PJ2A 1LIBA 4CV7A 1HBQA 2LA7A 3I17A 1PEEA 2NNDA 3KFGA 1MX8A 1U18A 3VG7A 1Y9LA 1LPJA 3BRNA 3SOTA 2RCTA 5KHPA 5IO6A 3D96A 2L5PA 3TGBA 1FTPA 1DZKA 3PP6A 5LJBA 3C78X 3BS2A 2QM9A 1O8VA 4ZGUA 2FRSA 1GT3A 3HWGA 3ZUIA 2GTLM 3WJCA 4TKJA 5H9KA 5F6ZA 4QGWA 2AT5X 4GH7A 4L1NA 3ZW0B 2JMBA 2A2GA 2Q2PA 4MVEA 4YGHA 5EZ2A 4YDBA 1X8NA 1PBOA 1SXXA 4M6SA 2FS7A 5CYBA 3OBLA 5D45A 2OVEA 3B2KA 3NX2A 4RUUA 1BRQA 5HZQA 3RWXA 1OBQA 5H9NA 2XSTA 3JSQA 4WFUA 3ZW1A 1X71A 2YG2A 2MJIA 3RZYA 4FGIB 5HAEA 2FR3A 3OJYC 4QYNA 2BS6A 4FQBB 1HQPA 1PM1X 3UAQA 5C0NA 4XMDA 1EQDA 1HMSA 2WEWA 4I3DA 4NP1A 2CM4A 2RCQA 3FA9A 1BLRA 3PEDA 1GXAA 3UEWA 4OS8A 1D3SA 1Z24A 3NQ3A 4EQAC 3BSZE 4A1HA 5EDCA 3FR5A 2WQAE 4LKPA 2W2BA 3U0DA 4O4UA 1YWAA 3VG5A 4Y0RA 1OBUA 2WSJA 4AZQA 5F58A 1EUOA 4CSBA 4M7MA 4I9SA 4YCEA 4XMCA 4RUNA 2QMIA 1NGLA 4NYRA 1QWDA 2AKQA 3NADA 1D2UA 4QAEA 1DZMA 3WJGA 1IKJA 1HBPA 1T68X 3S5VA 1YUPA 1DC9A 3PH6A 3HOLA 1I4UA 2RN4A 1MVGA 4YKOA 2MHDA 1JBHA 2O62A 2GTLN 2Q4NA 4XMEA 4XMHA 3STNA 1MUPA 3P6FA 4HPBA 1AB0A 3FELA 3FA8A 1MX7A 2KTDA 1IIUA 1XCAA 3IFBA 3NR3A 4JGLA 4WFVA 1EIOA 2L67A 3F8AA 2Q2MA 5LJEA 4I3BA 1KT6A 3MX7A 1Y9TA 4IBAA 4I95A 5LJHA 4KIIA 1OEJA 3ZZVA 2A3FX 1QFVA 3CQRA 3FW5A 4IB6A 1O1VA 5EDBA 3SAOA 2NNQA 5HCCC 3PQSA 4ARHA 4NLIA 4KH8A 4MIRA 3D95A 1SY1A 2NP1A 1XKIA 4ML7B 3APWA 4I6SA 4ES7A 2X8FA 1ZNKA 1TW4A 4KT5A 1HMRA 1ZNGA 1ZNDA 2X45A 3HK1A 1A57A 1AELA 4KC7A 1G7NA 1GT4A 1ACDA 3O2YA 3VE2A 4AZPA 4AYHA 3CQNA 4ZHFA 4YMYA 3ELZA 5LKEA 4O3YA 3UEVA 4QGXA 4ZHHA 1IFBA 1SXYA 3JS1A 3OE3A 2Z4HA 4QQ1A 2P8GA 5JR8A 1U0XA 1OBPA 3OD9A 4OMXA 1JZUA 4ZFXA 4GZVA 2CZUA 4CK4A 3TGCA 3P6CA 4XMFA 3PH5A 5L8IA 2LB6A 3GAQA 5HCEC 3B2IA 3MVFA 3FEPA 1A2DA 2AT3X 3EM0A 1BRPA 4UU2A 5LJCA 2PY1A 2ASNX 3O19A 4INNA 3NPOA 1T0VA 1FENA 1FE3A 1ALBA 4ZJ0A 3VE1A 4YFQA 4FBOA 3DTQA 3F9DA 4FBRA 1HN2A 4OS0A 2OVSA 5HTEA 4A1YA 3EBKA 4DQ3A 3O22A 2G79A 1KQWA 1YWDA 4YH0A 3FW4A 3STMX 3CBCA 2JU3A 3APXA 1LKEA 5FQ6E 4D6AA 5LJGA 1AQBA 3ZW1B 1GX8A 3QKGA 4MISA 3D4RA 4MVLA 4ORXA 5B27A 3DSZA 2GTFX 2F73A 3T1DA 4ODDA 2MO5A 1KQXA 1KOIA 4U8UN 4IMOA 4Y0SA 5FENA 2AT8X 3ZW0A 2OFMX 1EALA 2LKKA 2XKLA 1SA8A 1G74A 2G7BA 1B4MA 2LFOA 2GC9A 2ZAGA 3EYCA 1QQSA 3WVMA 4ZHDA 3IA8A 4IMNA 3TZSA 1BBPA 1GM6A 2POAA 1X8UA 1QG5A 1SY0A 2RQ0A 3KFFA 1BWYA 4A60A 2BLGA 3BX8A 2KW1A 3FIQA 3HTYA 3KQ0A 2AT0X 3L4RA 2QO6A 2OFRX 1ERBA 4GNYA 4AZOA 4U3QA 2K62A 3FA7A 3F6ZB 4QGVA 5EEEA 1X8OA 3MBTA 2JOZA 3VG4A 4QNIA 5D8JA 1H91A 2A13A 5BVSA 2Z4IA 5LKFA 4EEJA 3FEKA 4K19A 2EU7X 3EBWA 1DV9A 5AEOA 4YKMA 4TKBA 2RA6A 5KIDA 4I3CA 2W2FA 4WBKA 1JYDA 1QY0A 2LBVA 4NYQA 4TKHA 1JJJA 1LF7A 2JU8A 4YBPA 1A18A 1P6PA 1VYGA 4FBVA 1KXOA 1BSYA 4GNWA 1IKEA 3VPJE 1CBIA 1YP6A 3HWDA 1B56A 5F1EA 2AT6X 1QFTA 3FYFA 4ZH9A 4U8UO 3NP1A 2RD7C 1GT1A 3CWKA 2R74A 5BYPA 4IABA 2QO5A 1E06A 4O3XB 3VG3A 1NP1A 4U9CA 3P6HA 5AQ6A 2WEXA 4NNTA 4O49A 1ZNLA 1KT4A 2JN3A 1EI5A 2QOSC 2CBRA 4ZHGA 1LNMA 4ORRA 5HA1A 4ZGFA 4Y0PA 1GKAB 5AJBA 1JJXA 4YBUA 4A8ZA 3B2LA 2X8SA 3BU9A 2ACPX 3WOVA 4DQ4A 3NQKA 4I9RA 2OVDA 2Q39A 3BY0A 2X8TA 5F7GA 4O3WA 4NW4A 4TNNA 3WBGA 4XMGA 3HWEA 5FFHA 4EXZA 3TF6A 1ZNHA 3FLLA 2AMMX 3BDRA 5HA0A 1HMTA 2AH7X 3P24A 3RBYA 5LJKA 1FDQA 1E02A 5FAZA 2BS5A 3NBXX 1YP7A 3FENA 3WJFA 1ML7A 3BX7A 2ANSA 1EXSA 3KFIA 4KC8A 5HZ8A 3TGAA 1X8PA 3WJBA 5IO5A 2GTLO 1LIFA 2HZRA 1T8VA 3E3CA 2K23A 4PSQA 5BVQA 3D97A 1S44A 4YDAA 5CE4A 1G5WA 4TJZA 1LIEA 3AKNA 2ZAIA 1SXWA 4HPCA 1VPRA 4IAWA 2HLVA 3ZWEA 1CBSA 4HFOA 1KZXA 2MWHA 1KT7A 3CMPA 3FMZA 4LQZA 4ZR2A 1DZJA 4GDZA 1VYFA 4GETA 2WQ9A 1I04A 1SY3A 3BU1A 4WHIA 2NNEA 4LKTA 1TXLA 2R56A 5FQ8E 3KFHA 5B29A 1SY2A 4ORWA 2CM9A 3B2HA 1OPBA 4ZCBA 4GE1A 1YWBA 4O9SA 2ACOA 5D48A 5FQ7E 1I06A 3RSWA 3HWFA 1LICA 1U17A 2HMBA 4QZUA 1YWCA 4KCAA 4O4SA 2KD2A 5HZ5A 1BM5A 4OMWA 1ICNA 4BVMA 3NX1A 1E5PA 5HWZA 4IB8A 2L9CA 4YFRA 2MM3A 3UEXA 1LFOA 1R0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJ5 A;  4AZR A;  1AVG I;  1OEK A;  1GX9 A;  5F6B A;  1B0O A;  2HYS A;  2WUT A;  4ZH6 A;  1IFC A;  1X89 A;  3P6E A;  3G7X A;  1RBP A;  4LZU A;  1SXU A;  2OZQ A;  1TVQ A;  1FEL A;  1A3Y A;  3WJD A;  4ORU A;  3STK A;  1NP4 A;  5HCD C;  1ADL A;  3ELX A;  2FT9 A;  3ZQ3 A;  1GT5 A;  5BVT A;  3C77 X;  4UU3 A;  3B2J A;  4TQ2 A;  4IB9 A;  2GJ5 A;  4R0B A;  1JYJ A;  2LBA A;  5L8N A;  4HPD A;  5KIC A;  2E4J A;  4YGG A;  3CBS A;  3Q6L A;  4BOE A;  1X8Q A;  1I05 A;  2R73 A;  2W2A A;  4OS3 A;  4EFG A;  1MDC A;  4AZM A;  4N7C A;  1G85 A;  2IFB A;  1RLB E;  1BSQ A;  2FLJ A;  1BSO A;  2A2U A;  5DG4 A;  5H8T A;  4QZT A;  2JU7 A;  4YFP A;  5H9L A;  3AKM A;  4TLJ A;  5D4A A;  1CRB A;  1DFV A;  1EW3 A;  1ICM A;  1ZRY A;  1KZW A;  3KZA A;  4Y0Q A;  4HPA A;  3U03 A;  4MVK A;  1TOW A;  3WXQ A;  1O1U A;  1EII A;  3FA6 A;  2FS6 A;  3PEC A;  4AZN A;  3APU A;  1B8E A;  1TOU A;  1KT3 A;  3APV A;  3EMM A;  1URE A;  3CR6 A;  5HZ6 A;  4EDE A;  4ORS A;  4IB7 A;  1OPA A;  5D47 A;  3WJE A;  3PPT A;  1IW2 A;  1QY1 A;  1LID A;  1BJ7 A;  1L6M A;  2KT4 B;  3FR4 A;  2WR6 A;  5DPQ A;  5EPQ A;  2ALL X;  2FWV A;  1KGL A;  1QAB E;  1FEM A;  1S7D A;  2OVA A;  2WWP A;  4NNS A;  4ZHC A;  5HBS A;  1DZP A;  1BEB A;  5HTD A;  4QYP A;  2CZT A;  4YCH A;  1JV4 A;  5HZ9 A;  1E00 A;  4ALO A;  1EPA A;  1CBR A;  3I0A A;  1ZNE A;  3FR2 A;  5K06 A;  2AL0 X;  3BLG A;  2QO4 A;  3VG6 A;  2N93 A;  1OEE A;  3P6G A;  1N0S A;  1GKA A;  2X46 A;  2FTB A;  4N7D A;  2Q9S A;  3NQ9 A;  4BQU A;  1KT5 A;  2A0A A;  4YGZ A;  1ERX A;  1EPB A;  1CBQ A;  2DM5 A;  3K3L A;  2FR2 A;  5L8O A;  1UZ2 X;  4GKC A;  4ALB A;  4AW8 A;  4IAX A;  4D6B A;  1PMP A;  4MVI A;  2G78 A;  2L68 A;  1S2P A;  4GRJ A;  5EED A;  3ZUO A;  3S26 A;  3P6D A;  4NLJ A;  5H9A A;  4LZV A;  1QY2 A;  2HNX A;  5IO7 A;  1DF3 A;  3C76 X;  2HZQ A;  4ORY A;  3UEU A;  5LJD A;  1GGL A;  3U9P C;  1YIV A;  2CBS A;  1LIB A;  1HBQ A;  3I17 A;  1PEE A;  2NND A;  3KFG A;  1MX8 A;  1U18 A;  3VG7 A;  1LPJ A;  3BRN A;  5KHP A;  2RCT A;  5IO6 A;  3D96 A;  2L5P A;  3TGB A;  1FTP A;  1DZK A;  3PP6 A;  5LJB A;  3C78 X;  3BS2 A;  2QM9 A;  1O8V A;  4ZGU A;  2FRS A;  1GT3 A;  3HWG A;  3ZUI A;  3WJC A;  4TKJ A;  5H9K A;  5F6Z A;  4QGW A;  2AT5 X;  4GH7 A;  2A2G A;  2Q2P A;  4YGH A;  5EZ2 A;  4YDB A;  1X8N A;  1PBO A;  1SXX A;  4M6S A;  2FS7 A;  5D45 A;  5CE4 A;  2OVE A;  3B2K A;  3NX2 A;  4RUU A;  1BRQ A;  5HZQ A;  1OBQ A;  5H9N A;  2XST A;  3JSQ A;  4WFU A;  1X71 A;  2YG2 A;  2MJI A;  3RZY A;  5HAE A;  2FR3 A;  3OJY C;  4QYN A;  1HQP A;  1PM1 X;  5C0N A;  4XMD A;  1EQD A;  1HMS A;  2WEW A;  4I3D A;  4NP1 A;  2CM4 A;  2RCQ A;  3FA9 A;  1BLR A;  3PED A;  1GXA A;  3UEW A;  4OS8 A;  1D3S A;  1Z24 A;  3NQ3 A;  3BSZ E;  4A1H A;  5EDC A;  3FR5 A;  2WQA E;  4LKP A;  2W2B A;  3U0D A;  1YWA A;  3VG5 A;  4Y0R A;  1OBU A;  2WSJ A;  4AZQ A;  5F58 A;  1EUO A;  4M7M A;  4I9S A;  4YCE A;  4XMC A;  4RUN A;  1NGL A;  4NYR A;  1QWD A;  2AKQ A;  3NAD A;  1D2U A;  4QAE A;  1DZM A;  3WJG A;  1IKJ A;  1HBP A;  1T68 X;  1YUP A;  1DC9 A;  3PH6 A;  1I4U A;  1MVG A;  4YKO A;  1JBH A;  2O62 A;  2Q4N A;  4XME A;  4XMH A;  3STN A;  1MUP A;  3P6F A;  4HPB A;  1AB0 A;  3FEL A;  3FA8 A;  1MX7 A;  1XCA A;  1IIU A;  2KTD A;  3IFB A;  3NR3 A;  4WFV A;  1EIO A;  2L67 A;  3F8A A;  2Q2M A;  5LJE A;  4I3B A;  1KT6 A;  5LJH A;  4IBA A;  4KII A;  1OEJ A;  2A3F X;  1QFV A;  3CQR A;  3FW5 A;  4IB6 A;  1O1V A;  5EDB A;  3SAO A;  2NNQ A;  5HCC C;  4ARH A;  4NLI A;  3D95 A;  1SY1 A;  2NP1 A;  1XKI A;  3APW A;  4ES7 A;  1ZNK A;  1TW4 A;  1HMR A;  1ZNG A;  1ZND A;  2X45 A;  3HK1 A;  1A57 A;  1AEL A;  1G7N A;  1GT4 A;  1ACD A;  3O2Y A;  4AZP A;  4AYH A;  3CQN A;  4ZHF A;  4YMY A;  3ELZ A;  5LKE A;  3UEV A;  4QGX A;  4ZHH A;  1IFB A;  1SXY A;  3JS1 A;  5JR8 A;  2P8G A;  1U0X A;  1OBP A;  4OMX A;  1JZU A;  4ZFX A;  2CZU A;  4CK4 A;  3TGC A;  3P6C A;  4XMF A;  3PH5 A;  5L8I A;  2LB6 A;  3GAQ A;  5HCE C;  3B2I A;  3MVF A;  3FEP A;  1A2D A;  2AT3 X;  3EM0 A;  1BRP A;  4UU2 A;  5LJC A;  2PY1 A;  2ASN X;  3O19 A;  3NPO A;  1T0V A;  1FEN A;  1FE3 A;  1ALB A;  4ZJ0 A;  4YFQ A;  3DTQ A;  3F9D A;  1HN2 A;  4OS0 A;  5HTE A;  4A1Y A;  3EBK A;  4DQ3 A;  3O22 A;  2G79 A;  1KQW A;  1YWD A;  4YH0 A;  3FW4 A;  3STM X;  3CBC A;  2JU3 A;  3APX A;  1LKE A;  4D6A A;  5LJG A;  1AQB A;  1GX8 A;  3QKG A;  4MVL A;  4ORX A;  5B27 A;  3DSZ A;  2GTF X;  2F73 A;  3T1D A;  4ODD A;  2MO5 A;  1KQX A;  1KOI A;  4IMO A;  4Y0S A;  5FEN A;  2AT8 X;  2OFM X;  1EAL A;  2LKK A;  2XKL A;  1SA8 A;  1G74 A;  2G7B A;  1B4M A;  2LFO A;  2GC9 A;  3EYC A;  1QQS A;  3WVM A;  4ZHD A;  3IA8 A;  4IMN A;  3TZS A;  1BBP A;  1GM6 A;  2POA A;  1X8U A;  1QG5 A;  1SY0 A;  2RQ0 A;  3KFF A;  1BWY A;  4A60 A;  2BLG A;  3BX8 A;  3L4R A;  3FIQ A;  3KQ0 A;  5D8J A;  2AT0 X;  2QO6 A;  2OFR X;  1ERB A;  4GNY A;  4AZO A;  2K62 A;  3FA7 A;  4QGV A;  5EEE A;  1X8O A;  3MBT A;  2JOZ A;  3VG4 A;  1H91 A;  2A13 A;  5BVS A;  5LKF A;  4EEJ A;  3FEK A;  4K19 A;  2EU7 X;  3EBW A;  1DV9 A;  4YKM A;  4TKB A;  2RA6 A;  5KID A;  4I3C A;  2W2F A;  4WBK A;  1JYD A;  1QY0 A;  2LBV A;  4NYQ A;  4TKH A;  1JJJ A;  1LF7 A;  2JU8 A;  4YBP A;  1A18 A;  1P6P A;  1VYG A;  1KXO A;  1BSY A;  4GNW A;  1IKE A;  1CBI A;  1YP6 A;  3HWD A;  1B56 A;  5F1E A;  2AT6 X;  1QFT A;  4ZH9 A;  3NP1 A;  2RD7 C;  1GT1 A;  3CWK A;  2R74 A;  2QO5 A;  1E06 A;  3VG3 A;  1NP1 A;  3P6H A;  5AQ6 A;  2WEX A;  4NNT A;  1ZNL A;  1KT4 A;  2JN3 A;  2QOS C;  2CBR A;  4ZHG A;  1LNM A;  4ORR A;  5HA1 A;  4Y0P A;  1GKA B;  1JJX A;  4YBU A;  4A8Z A;  3B2L A;  3BU9 A;  2ACP X;  4DQ4 A;  4I9R A;  2OVD A;  2Q39 A;  3BY0 A;  5F7G A;  4TNN A;  3WBG A;  4XMG A;  3HWE A;  5FFH A;  4EXZ A;  3TF6 A;  1ZNH A;  3FLL A;  2AMM X;  3BDR A;  5HA0 A;  1HMT A;  2AH7 X;  5LJK A;  1FDQ A;  1E02 A;  5FAZ A;  1YP7 A;  3FEN A;  3WJF A;  1ML7 A;  3BX7 A;  2ANS A;  1EXS A;  3KFI A;  5HZ8 A;  3TGA A;  1X8P A;  3WJB A;  5IO5 A;  1LIF A;  2HZR A;  1T8V A;  4PSQ A;  2K23 A;  5BVQ A;  3D97 A;  1S44 A;  4YDA A;  1G5W A;  4TJZ A;  1LIE A;  3AKN A;  1SXW A;  4HPC A;  1VPR A;  4IAW A;  2HLV A;  1CBS A;  4HFO A;  1KZX A;  1KT7 A;  3CMP A;  3FMZ A;  4ZR2 A;  1DZJ A;  1VYF A;  4GET A;  2WQ9 A;  1I04 A;  1SY3 A;  3BU1 A;  2NNE A;  4LKT A;  1TXL A;  2R56 A;  5B29 A;  3KFH A;  1SY2 A;  4ORW A;  2CM9 A;  3B2H A;  1OPB A;  4ZCB A;  4GE1 A;  1YWB A;  4O9S A;  2ACO A;  5D48 A;  3RSW A;  1I06 A;  3VG2 A;  3HWF A;  1LIC A;  1U17 A;  2HMB A;  4QZU A;  1YWC A;  5HZ5 A;  1BM5 A;  4OMW A;  1ICN A;  4BVM A;  3NX1 A;  1E5P A;  5HWZ A;  4IB8 A;  2L9C A;  4YFR A;  2MM3 A;  3UEX A;  1LFO A;  1R0U A; 
#chains in the Genus database with same CATH topology
 4COT A;  4AZR A;  1CJ5 A;  1AVG I;  1OEK A;  1W4T A;  1KL3 A;  1GX9 A;  5F6B A;  1B0O A;  2HYS A;  4BX7 A;  1SWG A;  2OY1 O;  2WUT A;  2JW1 A;  4ZH6 A;  1IFC A;  1IJ8 A;  1VWL B;  1X89 A;  3P6E A;  3G7X A;  1RBP A;  4LZU A;  3VU1 A;  1SXU A;  1SWD A;  2OZQ A;  4Y59 A;  5AJC A;  4MEE A;  1TVQ A;  1FEL A;  1A3Y A;  3RKG A;  3WJD A;  4ORU A;  1SWS A;  2M4L A;  2CAM A;  2IZB A;  2KTS A;  3STK A;  1JIW I;  1NP4 A;  4BX6 A;  5HCD C;  3RDX A;  2FHL A;  1ADL A;  3SLJ A;  3ELX A;  2FT9 A;  4GU8 A;  1GT5 A;  3ZQ3 A;  5BVT A;  1UYN X;  3C77 X;  1VWM B;  4UU3 A;  3B2J A;  4TQ2 A;  4IB9 A;  1Y53 X;  5B11 O;  2GJ5 A;  4R0B A;  1JYJ A;  2LBA A;  3WZO A;  5L8N A;  4HPD A;  3SZH A;  5KIC A;  4HWM A;  2E4J A;  4YGG A;  3CBS A;  3Q6L A;  1I9H A;  4BOE A;  1X8Q A;  1I05 A;  2R73 A;  3PK2 A;  1SLE B;  2W2A A;  4OS3 A;  2OY7 A;  1MDC A;  4AZM A;  4EFG A;  3VHI A;  4GK9 A;  4N7C A;  1G85 A;  2IFB A;  1RLB E;  1BSQ A;  4O3Z A;  2FLJ A;  1BSO A;  2F09 A;  2A2U A;  5DG4 A;  3PQU A;  4QZT A;  5H8T A;  1AVE A;  2JU7 A;  3S5X A;  4YFP A;  5JD2 A;  5H9L A;  3AKM A;  4TLJ A;  1VWN B;  5D4A A;  4Z2P A;  1CRB A;  1DFV A;  1EW3 A;  3WYP A;  1ICM A;  1ZRY A;  1KZW A;  1HXL A;  3KZA A;  1RXK A;  4L3R A;  4Y0Q A;  4HPA A;  3U03 A;  4MVK A;  3SLO A;  4DCB A;  2VFC A;  1TOW A;  3D9W A;  3WXQ A;  1O1U A;  1EII A;  1STP A;  3LHN A;  3FA6 A;  2QOM A;  3V8U A;  2FS6 A;  3PEC A;  4AZN A;  1LDO A;  3APU A;  1Y0G A;  1B8E A;  1TOU A;  1KT3 A;  3APV A;  3EMM A;  1URE A;  3CR6 A;  2FHN X;  5HZ6 A;  4EDE A;  4ORS A;  4BX5 B;  4IB7 A;  1OPA A;  5D47 A;  3WJE A;  3PPT A;  1IW2 A;  1QY1 A;  1LID A;  1BJ7 A;  1L6M A;  2KT4 B;  3FR4 A;  2AVI A;  2WR6 A;  3GE2 A;  2ALL X;  3MG5 A;  5DPQ A;  2FWV A;  5EPQ A;  1KGL A;  1QAB E;  4ON1 A;  1JMZ A;  3H3I A;  1FEM A;  1S7D A;  1SWB A;  2OVA A;  2WWP A;  4NNS A;  4ZHC A;  5HBS A;  1DZP A;  1BEB A;  2RTF B;  1MM9 A;  4O4O A;  4QYP A;  2CZT A;  3N91 A;  3VG2 A;  5HTD A;  4YCH A;  1SMP I;  1JV4 A;  4CDE A;  1W5R A;  1MK5 A;  1E00 A;  3PDF A;  4ALO A;  1SRE A;  1EPA A;  1VWE B;  5HZ9 A;  4O4X A;  2C1Q A;  1CBR A;  3I0A A;  1LCW A;  1ZNE A;  3FR2 A;  3WYQ A;  5K06 A;  2AL0 X;  4B55 A;  1KL4 A;  3BLG A;  2QO4 A;  3VG6 A;  2BHV A;  1OEE A;  2G8C O;  2N93 A;  3P6G A;  4GGR A;  3VHH A;  1N0S A;  5B5G A;  1SWK A;  1GKA A;  1VWP B;  3P02 A;  2X46 A;  3HOE A;  2FTB A;  4N7D A;  1I78 A;  2Q9S A;  2YMS A;  3NQ9 A;  3RWX A;  4BQU A;  4Z28 A;  1KT5 A;  3ZW2 A;  2A0A A;  4GJS A;  4YGZ A;  2G5L A;  1ERX A;  4U8U M;  1EPB A;  1CBQ A;  2DM5 A;  1SWL A;  1VYO A;  2ZSC A;  1SWQ A;  2FR2 A;  3EW2 A;  3K3L A;  1UZ2 X;  4GKC A;  3ZI8 A;  4ALB A;  4AW8 A;  4BCS A;  4IAX A;  4D6B A;  1PMP A;  3S60 A;  4MVI A;  2G78 A;  2L68 A;  2C4I A;  1S2P A;  4GRJ A;  5CSE A;  5EED A;  4ID2 A;  1SWC A;  1FJ1 E;  2BT9 A;  2C1S A;  3ZUO A;  3S26 A;  4QRL A;  3JQO A;  1MOY A;  3LV4 A;  5B5F A;  3P6D A;  4NLJ A;  5H9A A;  4LZV A;  1QY2 A;  2HNX A;  5IO7 A;  1DF3 A;  3C76 X;  2HZQ A;  4ORY A;  3UEU A;  5LJD A;  1GGL A;  3U9P C;  1YIV A;  2CBS A;  4PJ2 A;  1LIB A;  4CV7 A;  1HBQ A;  2WPU A;  2LA7 A;  5IRW A;  3I17 A;  2AF5 A;  1PEE A;  2NND A;  3KFG A;  1MX8 A;  1U18 A;  1VWB B;  4JO6 A;  1Y9L A;  1SWF A;  1LPJ A;  3VG7 A;  1LCV A;  3RE5 A;  3BRN A;  2RTL A;  2GH7 A;  2RCT A;  3SOT A;  1KL5 A;  5IO6 A;  5KHP A;  3D96 A;  2L5P A;  4EKV A;  3TGB A;  1FTP A;  1DZK A;  3PP6 A;  2DJG A;  5LJB A;  3C78 X;  3BS2 A;  2QM9 A;  1O8V A;  4ZGU A;  2FRS A;  1GT3 A;  3HWG A;  3RDQ A;  2RTA A;  3ZUI A;  1VWH B;  2IZG B;  2GTL M;  4IRW A;  3WJC A;  4TKJ A;  5H9K A;  3RE6 A;  5F6Z A;  2X56 A;  4QGW A;  2DJF A;  2AT5 X;  4GH7 A;  4L1N A;  3ZW0 B;  4CPH A;  3SZI A;  1SLD B;  2JMB A;  2A2G A;  2Q2P A;  2OL7 A;  4MVE A;  4YGH A;  5EZ2 A;  4BX7 B;  4YDB A;  1X8N A;  1GX3 A;  1PBO A;  1SXX A;  4M6S A;  2FS7 A;  2OFB A;  3OBL A;  5CYB A;  2IZK A;  2OVE A;  3B2K A;  3NX2 A;  1BRQ A;  4RUU A;  5D45 A;  5HZQ A;  1OBQ A;  1SRF A;  2XST A;  3JSQ A;  4JHQ A;  4WFU A;  5H9N A;  1X71 A;  2YG2 A;  3ZW1 A;  2MJI A;  3RZY A;  4FGI B;  4BX6 B;  5HAE A;  1VWD B;  1SWO A;  2FR3 A;  1LCZ A;  4ZCB A;  3OJY C;  4QYN A;  2BS6 A;  1N9M A;  2RTP B;  1HQP A;  4FQB B;  1LEL A;  1PM1 X;  3UAQ A;  5C0N A;  4XMD A;  1EQD A;  1HMS A;  1HY2 A;  2WEW A;  4I3D A;  4NP1 A;  2CM4 A;  1NQN A;  2RCQ A;  3FA9 A;  1BLR A;  1JJU A;  1GXA A;  3PED A;  3UEW A;  1PBY A;  4OS8 A;  2RTG B;  1D3S A;  1OSP O;  1Z24 A;  3NQ3 A;  4EQA C;  3BSZ E;  4A1H A;  5EDC A;  3FR5 A;  2WQA E;  4GJV A;  3T2X A;  4LKP A;  4CPF A;  2W2B A;  3L4R A;  3U0D A;  4O4U A;  1YWA A;  2FKJ A;  3VG5 A;  4Y0R A;  1OBU A;  1SLF B;  2WSJ A;  5F58 A;  4AZQ A;  4BGF A;  1EUO A;  4CSB A;  4M7M A;  4I9S A;  1JQP A;  4YCE A;  4XMC A;  4RUN A;  2QMI A;  3KVN A;  4CDD A;  1NGL A;  4NYR A;  1QWD A;  2AKQ A;  3NAD A;  1VWI B;  1D2U A;  4QAE A;  5K68 A;  1DZM A;  3WJG A;  1IKJ A;  1HBP A;  1T68 X;  1N43 A;  1YUP A;  3S5V A;  1DC9 A;  3PH6 A;  3HOL A;  1I4U A;  1VWQ B;  1MVG A;  2RN4 A;  2RTD B;  4YKO A;  1HQQ A;  2MHD A;  1VWC B;  1JBH A;  2O62 A;  2GTL N;  2Q4N A;  4XME A;  4XMH A;  2IZE B;  1MUP A;  5F2B A;  3STN A;  3P6F A;  4Z6J A;  4HPB A;  1AB0 A;  2IZH B;  2QCB A;  1MX7 A;  1XCA A;  1IIU A;  2KTD A;  3FA8 A;  3FEL A;  3IFB A;  3NR3 A;  4GUZ A;  4JGL A;  3RDS A;  3Q34 A;  5L3Y A;  4WFV A;  3RY1 A;  1EIO A;  2L67 A;  3F8A A;  2Q2M A;  5LJE A;  4I3B A;  1KT6 A;  2I5Z O;  2JGS A;  3MX7 A;  4NV7 A;  1Y9T A;  4IBA A;  4I95 A;  5LJH A;  4KII A;  3WZN A;  1OEJ A;  3ZZV A;  1QFV A;  2A3F X;  3CQR A;  3FW5 A;  4IB6 A;  1O1V A;  5EDB A;  1VWJ B;  3QQ2 A;  1SWA A;  2NNQ A;  2RTK A;  3SAO A;  5HCC C;  3PQS A;  4ARH A;  1RST B;  4NLI A;  4KH8 A;  4MIR A;  1KFF A;  3D95 A;  1SY1 A;  2NP1 A;  2UZ2 A;  1XKI A;  4ML7 B;  3APW A;  4I6S A;  5IRA A;  2X8F A;  4ES7 A;  1ZNK A;  1SWN A;  1TW4 A;  4KT5 A;  1HMR A;  1ZNG A;  1ZND A;  2A5B A;  2X45 A;  3HK1 A;  2BSZ A;  3FDC A;  1A57 A;  1AEL A;  4KC7 A;  1G7N A;  1GT4 A;  2VFB A;  2IZC B;  1ACD A;  3O2Y A;  4Z2V A;  4OKA A;  3VE2 A;  2OF9 A;  4AZP A;  2MF6 A;  4AYH A;  4C5P A;  3CQN A;  4ZHF A;  4YMY A;  3ELZ A;  5LKE A;  1SLG B;  2X32 A;  4O3Y A;  3UEV A;  2IZD B;  4QGX A;  4ZHH A;  1IFB A;  1SXY A;  1VWR B;  3JS1 A;  2Z4H A;  2X4M A;  2P8G A;  3OE3 A;  4QQ1 A;  1U0X A;  2OYB O;  3X00 A;  1OBP A;  2RTI B;  3OD9 A;  4OMX A;  1JZU A;  4ZFX A;  4GZV A;  1PTS A;  2CZU A;  4CK4 A;  2IZI A;  3T6F A;  1SWP A;  3TGC A;  3P6C A;  5IRU A;  1SWU A;  4GGT A;  2VDF A;  4XMF A;  3PH5 A;  1K3B A;  5L8I A;  2LB6 A;  3GAQ A;  1SWT A;  5HCE C;  3B2I A;  3MVF A;  3FEP A;  3RDO A;  2FKG A;  1A2D A;  2AT3 X;  1SWE A;  1BRP A;  3EM0 A;  4UU2 A;  5LJC A;  2RTC B;  2FGS A;  2PY1 A;  2ASN X;  3O19 A;  4INN A;  2IZF B;  1DF8 A;  2OY8 A;  3CKG A;  3NPO A;  1T0V A;  2RTQ B;  1FEN A;  1FE3 A;  2A5C A;  1ALB A;  1RAV A;  3VE1 A;  4ZJ0 A;  4YFQ A;  4FBO A;  1NQM A;  3DTQ A;  3F9D A;  2PI3 O;  4FBR A;  1HN2 A;  1SRH A;  4OS0 A;  1LDQ A;  2OVS A;  4CPH B;  5HTE A;  4A1Y A;  3EBK A;  4DQ3 A;  3O22 A;  2G79 A;  1KQW A;  1YWD A;  4YH0 A;  3FW4 A;  3STM X;  3CBC A;  1SRJ A;  2JU3 A;  3APX A;  1LKE A;  2OFA A;  1VWF B;  4U46 A;  5FQ6 E;  4D6A A;  3SZJ A;  1SWJ A;  5B3M O;  1HXZ A;  5LJG A;  1AQB A;  3ZW1 B;  1GX8 A;  3QKG A;  4MIS A;  3D4R A;  4MVL A;  2I5V O;  4ORX A;  5B27 A;  3DSZ A;  2GTF X;  2F73 A;  3T1D A;  4ODD A;  2MO5 A;  1KQX A;  1KOI A;  1JMX A;  2RTE B;  3LTW A;  4IMO A;  4U8U N;  4Y0S A;  2AT8 X;  5FEN A;  3ZW0 A;  2OFM X;  3CKF A;  2OL6 O;  1EAL A;  1AVD A;  2LKK A;  5IXG A;  2XKL A;  1SA8 A;  1G74 A;  4GDA A;  2G7B A;  2IZL B;  1B4M A;  2LFO A;  3EW1 A;  2GC9 A;  4CPE A;  2X34 A;  2ZAG A;  3EYC A;  1QQS A;  3WVM A;  4ZHD A;  3IA8 A;  1WUB A;  4IMN A;  3TZS A;  1BBP A;  2OL8 O;  1GM6 A;  1STS B;  1X8U A;  2POA A;  1QG5 A;  1SY0 A;  2RQ0 A;  1E2T A;  3KFF A;  1BWY A;  4A60 A;  2BLG A;  3BX8 A;  2A8G A;  2KW1 A;  3FID A;  3FIQ A;  2AT0 X;  3EC5 A;  2QO6 A;  2OFR X;  3HTY A;  1ERB A;  3KQ0 A;  4GNY A;  4U3Q A;  4AZO A;  2K62 A;  3FA7 A;  3F6Z B;  4QGV A;  5EEE A;  1X8O A;  2Y32 A;  2JOZ A;  3MBT A;  4JNJ A;  3VG4 A;  4QNI A;  5D8J A;  1H91 A;  1NC9 A;  2A13 A;  2Z4I A;  5BVS A;  5LKF A;  2F01 A;  1RXJ A;  4EEJ A;  2RTR B;  1VWA B;  2EU7 X;  3FEK A;  3EBW A;  4K19 A;  1DV9 A;  4CDF A;  1SRG A;  4CPI A;  5AEO A;  4YKM A;  4TKB A;  2RA6 A;  5KID A;  4I3C A;  2W2F A;  4WBK A;  1JYD A;  1QY0 A;  1RXH A;  2LBV A;  4NYQ A;  4TKH A;  1JJJ A;  1LF7 A;  2JU8 A;  4YBP A;  1A18 A;  1P6P A;  1NBX A;  1N4J A;  1KXO A;  1STR B;  1VYG A;  4FBV A;  1BSY A;  4GNW A;  1IKE A;  3VPJ E;  1CBI A;  1YP6 A;  3HWD A;  5K67 A;  1B56 A;  1Y55 X;  5F1E A;  1VWO B;  2AT6 X;  1QFT A;  3FYF A;  4YVB A;  4Z27 A;  1MEP A;  4ZH9 A;  4U8U O;  3NP1 A;  2RD7 C;  1GT1 A;  3CWK A;  1W6F A;  2R74 A;  2RTH B;  5BYP A;  4IAB A;  3RY2 A;  2QO5 A;  1E06 A;  4O3X B;  3VG3 A;  1NP1 A;  4U9C A;  3AUM O;  3P6H A;  5AQ6 A;  2WEX A;  4NNT A;  4O49 A;  1ZNL A;  1Y52 X;  1KT4 A;  1LUQ A;  2JN3 A;  1EI5 A;  2QOS C;  2CBR A;  4I60 A;  1LNM A;  4BX5 A;  4DNE A;  4ZHG A;  4ORR A;  5HA1 A;  3HPE A;  4ZGF A;  4Y0P A;  1GKA B;  2RTJ A;  5AJB A;  4BBO A;  1JJX A;  4YBU A;  3WZP A;  3B2L A;  2X8S A;  3BU9 A;  2ACP X;  3WOV A;  4A8Z A;  4DQ4 A;  3NQK A;  4I9R A;  2OVD A;  2Q39 A;  3BY0 A;  4CDC A;  2X8T A;  2IZJ A;  5F7G A;  2IZA A;  2HKD A;  2UYW A;  4GD9 A;  4NW4 A;  4NV8 A;  4O3W A;  4TNN A;  3WBG A;  4XMG A;  3HWE A;  5B10 O;  5FFH A;  4EXZ A;  3TF6 A;  3WZQ A;  1ZNH A;  3FLL A;  3T6L A;  2AMM X;  3BDR A;  5HA0 A;  1HMT A;  2AH7 X;  3P24 A;  3RBY A;  5LJK A;  1FDQ A;  1E02 A;  5FAZ A;  3VGW A;  2BS5 A;  3NBX X;  3T2W A;  1YP7 A;  3FEN A;  3WJF A;  1ML7 A;  3BX7 A;  2ANS A;  1EXS A;  3KFI A;  4KC8 A;  4BJ8 A;  5HZ8 A;  3TGA A;  1X8P A;  3WJB A;  5IO5 A;  2GTL O;  1LIF A;  2HZR A;  1T8V A;  3E3C A;  2K23 A;  1UYO X;  4PSQ A;  5BVQ A;  3D97 A;  1S44 A;  4YDA A;  5CE4 A;  1VWK B;  1G5W A;  4TJZ A;  2RTB B;  3RDM A;  1LIE A;  3AKN A;  2ZAI A;  1SXW A;  4HPC A;  5JR8 A;  1VPR A;  3MM0 A;  4IAW A;  2HLV A;  1N7Y A;  1VWG B;  2RTO B;  1CBS A;  4HFO A;  3VHM A;  3ZWE A;  1KZX A;  2MWH A;  1KT7 A;  3CMP A;  1SRI A;  2Y3F A;  3FMZ A;  3SLT A;  1N9Y A;  4LQZ A;  4ZR2 A;  1DZJ A;  4GGZ A;  4GDZ A;  1NDJ A;  1VYF A;  4GET A;  2BC3 A;  2WQ9 A;  1I04 A;  5L8O A;  1SY3 A;  3BU1 A;  4WHI A;  2NNE A;  4LKT A;  1TXL A;  1SWH A;  2R56 A;  3KFH A;  5FQ8 E;  5B29 A;  1SY2 A;  1SWR A;  4OEL A;  2CM9 A;  4ORW A;  5CHK A;  3B2H A;  1OPB A;  2OF8 A;  4GE1 A;  1YWB A;  4O9S A;  2ACO A;  4OEM A;  5D48 A;  1I06 A;  5FQ7 E;  3HWF A;  3RSW A;  1LIC A;  1U17 A;  4Z2O A;  2HMB A;  4QZU A;  1WBI A;  1YWC A;  4KCA A;  4O4S A;  2KD2 A;  3RDU A;  4Y5D A;  5HZ5 A;  1BM5 A;  2X55 A;  2RTN B;  1K24 A;  4OMW A;  1ICN A;  4BVM A;  3AEH A;  3NX1 A;  1E5P A;  5HWZ A;  4IB8 A;  5B2A O;  2Y3E A;  1RSU B;  2L9C A;  4YFR A;  2MM3 A;  2OY5 O;  3UEX A;  1LFO A;  2RTM A;  1R0U A; 
#chains in the Genus database with same CATH homology
 4COT A;  4AZR A;  1CJ5 A;  1AVG I;  1OEK A;  1GX9 A;  5F6B A;  1B0O A;  2HYS A;  2WUT A;  4ZH6 A;  2JW1 A;  1IFC A;  1X89 A;  3P6E A;  3G7X A;  1RBP A;  4LZU A;  3VU1 A;  1SXU A;  2OZQ A;  5AJC A;  1TVQ A;  1FEL A;  1A3Y A;  3RKG A;  3WJD A;  4ORU A;  2M4L A;  2KTS A;  3STK A;  1JIW I;  1NP4 A;  5HCD C;  1ADL A;  3ELX A;  2FT9 A;  4GU8 A;  1GT5 A;  3ZQ3 A;  5BVT A;  3C77 X;  4UU3 A;  3B2J A;  4TQ2 A;  4IB9 A;  2GJ5 A;  4R0B A;  1JYJ A;  2LBA A;  5L8N A;  4HPD A;  5KIC A;  4HWM A;  2E4J A;  4YGG A;  3CBS A;  3Q6L A;  4BOE A;  1X8Q A;  1I05 A;  2R73 A;  2W2A A;  4OS3 A;  4EFG A;  1MDC A;  4AZM A;  4GK9 A;  4N7C A;  1G85 A;  2IFB A;  1RLB E;  1BSQ A;  4O3Z A;  2FLJ A;  1BSO A;  2F09 A;  2A2U A;  5DG4 A;  3PQU A;  4QZT A;  5H8T A;  2JU7 A;  3S5X A;  4YFP A;  5H9L A;  3AKM A;  4TLJ A;  5D4A A;  1CRB A;  1DFV A;  1EW3 A;  1ICM A;  1ZRY A;  1KZW A;  3KZA A;  4L3R A;  4Y0Q A;  4HPA A;  3U03 A;  4MVK A;  1TOW A;  3WXQ A;  1O1U A;  1EII A;  3LHN A;  3FA6 A;  3V8U A;  2FS6 A;  3PEC A;  4AZN A;  3APU A;  1B8E A;  1TOU A;  1KT3 A;  3APV A;  3EMM A;  1URE A;  3CR6 A;  5HZ6 A;  4EDE A;  4ORS A;  4IB7 A;  1OPA A;  5D47 A;  3WJE A;  3PPT A;  2KT4 B;  1IW2 A;  1QY1 A;  1LID A;  1BJ7 A;  1L6M A;  3FR4 A;  2WR6 A;  3GE2 A;  5DPQ A;  2ALL X;  5EPQ A;  2FWV A;  1KGL A;  1QAB E;  4ON1 A;  3H3I A;  1FEM A;  1S7D A;  2OVA A;  2WWP A;  4NNS A;  4ZHC A;  5HBS A;  1DZP A;  1BEB A;  4O4O A;  4QYP A;  3VG2 A;  5HTD A;  2CZT A;  3N91 A;  4YCH A;  1SMP I;  1JV4 A;  5HZ9 A;  1E00 A;  4ALO A;  1EPA A;  4O4X A;  1CBR A;  3I0A A;  1ZNE A;  3FR2 A;  5K06 A;  2AL0 X;  3BLG A;  2QO4 A;  3VG6 A;  2BHV A;  1OEE A;  2N93 A;  3P6G A;  1N0S A;  1GKA A;  3P02 A;  2X46 A;  3HOE A;  2FTB A;  4N7D A;  2Q9S A;  2YMS A;  3NQ9 A;  4BQU A;  1KT5 A;  3ZW2 A;  2A0A A;  4YGZ A;  4U8U M;  1ERX A;  1EPB A;  1CBQ A;  2DM5 A;  3K3L A;  3ZI8 A;  2FR2 A;  5L8O A;  1UZ2 X;  4GKC A;  4ALB A;  4AW8 A;  4IAX A;  4D6B A;  1PMP A;  3S60 A;  4MVI A;  2G78 A;  2L68 A;  1S2P A;  4GRJ A;  5EED A;  4ID2 A;  2BT9 A;  3ZUO A;  3S26 A;  4QRL A;  3JQO A;  3LV4 A;  3P6D A;  4NLJ A;  5H9A A;  4LZV A;  1QY2 A;  2HNX A;  5IO7 A;  1DF3 A;  3C76 X;  2HZQ A;  4ORY A;  3UEU A;  5LJD A;  1GGL A;  3U9P C;  1YIV A;  2CBS A;  4PJ2 A;  1LIB A;  4CV7 A;  1HBQ A;  2LA7 A;  3I17 A;  1PEE A;  2NND A;  3KFG A;  1MX8 A;  1U18 A;  3VG7 A;  1Y9L A;  1LPJ A;  3BRN A;  3SOT A;  2RCT A;  5KHP A;  5IO6 A;  3D96 A;  2L5P A;  3TGB A;  1FTP A;  1DZK A;  3PP6 A;  5LJB A;  3C78 X;  3BS2 A;  2QM9 A;  1O8V A;  4ZGU A;  2FRS A;  1GT3 A;  3HWG A;  3ZUI A;  2GTL M;  3WJC A;  4TKJ A;  5H9K A;  5F6Z A;  4QGW A;  2AT5 X;  4GH7 A;  4L1N A;  3ZW0 B;  2JMB A;  2A2G A;  2Q2P A;  4MVE A;  4YGH A;  5EZ2 A;  4YDB A;  1X8N A;  1PBO A;  1SXX A;  4M6S A;  2FS7 A;  5CYB A;  3OBL A;  5D45 A;  2OVE A;  3B2K A;  3NX2 A;  4RUU A;  1BRQ A;  5HZQ A;  3RWX A;  1OBQ A;  5H9N A;  2XST A;  3JSQ A;  4WFU A;  3ZW1 A;  1X71 A;  2YG2 A;  2MJI A;  3RZY A;  4FGI B;  5HAE A;  2FR3 A;  3OJY C;  4QYN A;  2BS6 A;  4FQB B;  1HQP A;  1PM1 X;  3UAQ A;  5C0N A;  4XMD A;  1EQD A;  1HMS A;  2WEW A;  4I3D A;  4NP1 A;  2CM4 A;  2RCQ A;  3FA9 A;  1BLR A;  3PED A;  1GXA A;  3UEW A;  4OS8 A;  1D3S A;  1Z24 A;  3NQ3 A;  4EQA C;  3BSZ E;  4A1H A;  5EDC A;  3FR5 A;  2WQA E;  4LKP A;  2W2B A;  3U0D A;  4O4U A;  1YWA A;  3VG5 A;  4Y0R A;  1OBU A;  2WSJ A;  4AZQ A;  5F58 A;  1EUO A;  4CSB A;  4M7M A;  4I9S A;  4YCE A;  4XMC A;  4RUN A;  2QMI A;  1NGL A;  4NYR A;  1QWD A;  2AKQ A;  3NAD A;  1D2U A;  4QAE A;  1DZM A;  3WJG A;  1IKJ A;  1HBP A;  1T68 X;  3S5V A;  1YUP A;  1DC9 A;  3PH6 A;  3HOL A;  1I4U A;  2RN4 A;  1MVG A;  4YKO A;  2MHD A;  1JBH A;  2O62 A;  2GTL N;  2Q4N A;  4XME A;  4XMH A;  3STN A;  1MUP A;  3P6F A;  4HPB A;  1AB0 A;  3FEL A;  3FA8 A;  1MX7 A;  2KTD A;  1IIU A;  1XCA A;  3IFB A;  3NR3 A;  4JGL A;  4WFV A;  1EIO A;  2L67 A;  3F8A A;  2Q2M A;  5LJE A;  4I3B A;  1KT6 A;  3MX7 A;  1Y9T A;  4IBA A;  4I95 A;  5LJH A;  4KII A;  1OEJ A;  3ZZV A;  2A3F X;  1QFV A;  3CQR A;  3FW5 A;  4IB6 A;  1O1V A;  5EDB A;  3SAO A;  2NNQ A;  5HCC C;  3PQS A;  4ARH A;  4NLI A;  4KH8 A;  4MIR A;  3D95 A;  1SY1 A;  2NP1 A;  1XKI A;  4ML7 B;  3APW A;  4I6S A;  4ES7 A;  2X8F A;  1ZNK A;  1TW4 A;  4KT5 A;  1HMR A;  1ZNG A;  1ZND A;  2X45 A;  3HK1 A;  1A57 A;  1AEL A;  4KC7 A;  1G7N A;  1GT4 A;  1ACD A;  3O2Y A;  3VE2 A;  4AZP A;  4AYH A;  3CQN A;  4ZHF A;  4YMY A;  3ELZ A;  5LKE A;  4O3Y A;  3UEV A;  4QGX A;  4ZHH A;  1IFB A;  1SXY A;  3JS1 A;  3OE3 A;  2Z4H A;  4QQ1 A;  2P8G A;  5JR8 A;  1U0X A;  1OBP A;  3OD9 A;  4OMX A;  1JZU A;  4ZFX A;  4GZV A;  2CZU A;  4CK4 A;  3TGC A;  3P6C A;  4XMF A;  3PH5 A;  5L8I A;  2LB6 A;  3GAQ A;  5HCE C;  3B2I A;  3MVF A;  3FEP A;  1A2D A;  2AT3 X;  3EM0 A;  1BRP A;  4UU2 A;  5LJC A;  2PY1 A;  2ASN X;  3O19 A;  4INN A;  3NPO A;  1T0V A;  1FEN A;  1FE3 A;  1ALB A;  4ZJ0 A;  3VE1 A;  4YFQ A;  4FBO A;  3DTQ A;  3F9D A;  4FBR A;  1HN2 A;  4OS0 A;  2OVS A;  5HTE A;  4A1Y A;  3EBK A;  4DQ3 A;  3O22 A;  2G79 A;  1KQW A;  1YWD A;  4YH0 A;  3FW4 A;  3STM X;  3CBC A;  2JU3 A;  3APX A;  1LKE A;  5FQ6 E;  4D6A A;  5LJG A;  1AQB A;  3ZW1 B;  1GX8 A;  3QKG A;  4MIS A;  3D4R A;  4MVL A;  4ORX A;  5B27 A;  3DSZ A;  2GTF X;  2F73 A;  3T1D A;  4ODD A;  2MO5 A;  1KQX A;  1KOI A;  4U8U N;  4IMO A;  4Y0S A;  5FEN A;  2AT8 X;  3ZW0 A;  2OFM X;  1EAL A;  2LKK A;  2XKL A;  1SA8 A;  1G74 A;  2G7B A;  1B4M A;  2LFO A;  2GC9 A;  2ZAG A;  3EYC A;  1QQS A;  3WVM A;  4ZHD A;  3IA8 A;  4IMN A;  3TZS A;  1BBP A;  1GM6 A;  2POA A;  1X8U A;  1QG5 A;  1SY0 A;  2RQ0 A;  3KFF A;  1BWY A;  4A60 A;  2BLG A;  3BX8 A;  2KW1 A;  3FIQ A;  3HTY A;  3KQ0 A;  2AT0 X;  3L4R A;  2QO6 A;  2OFR X;  1ERB A;  4GNY A;  4AZO A;  4U3Q A;  2K62 A;  3FA7 A;  3F6Z B;  4QGV A;  5EEE A;  1X8O A;  3MBT A;  2JOZ A;  3VG4 A;  4QNI A;  5D8J A;  1H91 A;  2A13 A;  5BVS A;  2Z4I A;  5LKF A;  4EEJ A;  3FEK A;  4K19 A;  2EU7 X;  3EBW A;  1DV9 A;  5AEO A;  4YKM A;  4TKB A;  2RA6 A;  5KID A;  4I3C A;  2W2F A;  4WBK A;  1JYD A;  1QY0 A;  2LBV A;  4NYQ A;  4TKH A;  1JJJ A;  1LF7 A;  2JU8 A;  4YBP A;  1A18 A;  1P6P A;  1VYG A;  4FBV A;  1KXO A;  1BSY A;  4GNW A;  1IKE A;  3VPJ E;  1CBI A;  1YP6 A;  3HWD A;  1B56 A;  5F1E A;  2AT6 X;  1QFT A;  3FYF A;  4ZH9 A;  4U8U O;  3NP1 A;  2RD7 C;  1GT1 A;  3CWK A;  2R74 A;  5BYP A;  4IAB A;  2QO5 A;  1E06 A;  4O3X B;  3VG3 A;  1NP1 A;  4U9C A;  3P6H A;  5AQ6 A;  2WEX A;  4NNT A;  4O49 A;  1ZNL A;  1KT4 A;  2JN3 A;  1EI5 A;  2QOS C;  2CBR A;  4ZHG A;  1LNM A;  4ORR A;  5HA1 A;  4ZGF A;  4Y0P A;  1GKA B;  5AJB A;  1JJX A;  4YBU A;  4A8Z A;  3B2L A;  2X8S A;  3BU9 A;  2ACP X;  3WOV A;  4DQ4 A;  3NQK A;  4I9R A;  2OVD A;  2Q39 A;  3BY0 A;  2X8T A;  5F7G A;  4O3W A;  4NW4 A;  4TNN A;  3WBG A;  4XMG A;  3HWE A;  5FFH A;  4EXZ A;  3TF6 A;  1ZNH A;  3FLL A;  2AMM X;  3BDR A;  5HA0 A;  1HMT A;  2AH7 X;  3P24 A;  3RBY A;  5LJK A;  1FDQ A;  1E02 A;  5FAZ A;  2BS5 A;  3NBX X;  1YP7 A;  3FEN A;  3WJF A;  1ML7 A;  3BX7 A;  2ANS A;  1EXS A;  3KFI A;  4KC8 A;  5HZ8 A;  3TGA A;  1X8P A;  3WJB A;  5IO5 A;  2GTL O;  1LIF A;  2HZR A;  1T8V A;  3E3C A;  2K23 A;  4PSQ A;  5BVQ A;  3D97 A;  1S44 A;  4YDA A;  5CE4 A;  1G5W A;  4TJZ A;  1LIE A;  3AKN A;  2ZAI A;  1SXW A;  4HPC A;  1VPR A;  4IAW A;  2HLV A;  3ZWE A;  1CBS A;  4HFO A;  1KZX A;  2MWH A;  1KT7 A;  3CMP A;  3FMZ A;  4LQZ A;  4ZR2 A;  1DZJ A;  4GDZ A;  1VYF A;  4GET A;  2WQ9 A;  1I04 A;  1SY3 A;  3BU1 A;  4WHI A;  2NNE A;  4LKT A;  1TXL A;  2R56 A;  5FQ8 E;  3KFH A;  5B29 A;  1SY2 A;  4ORW A;  2CM9 A;  3B2H A;  1OPB A;  4ZCB A;  4GE1 A;  1YWB A;  4O9S A;  2ACO A;  5D48 A;  5FQ7 E;  1I06 A;  3RSW A;  3HWF A;  1LIC A;  1U17 A;  2HMB A;  4QZU A;  1YWC A;  4KCA A;  4O4S A;  2KD2 A;  5HZ5 A;  1BM5 A;  4OMW A;  1ICN A;  4BVM A;  3NX1 A;  1E5P A;  5HWZ A;  4IB8 A;  2L9C A;  4YFR A;  2MM3 A;  3UEX A;  1LFO A;  1R0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...