4OMYA

Crystal structure of semet nolr from sinorhizobium fredii in complex with oligo at dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NolR
publication title Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
pubmed doi rcsb
source organism Sinorhizobium fredii
molecule tags Transcription/dna
total genus 31
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4omyA00
3B02A 3T1BA 4WWCA 1MDMA 2IP2A 3EYIA 1I6XA 1IXSB 1R1TA 5J6XA 1QZZA 5FLXK 4M6YA 4OMYA 2PG4A 3FF5A 2QBYB 1HW1A 1HW5A 2P5KA 1RIOH 2H6CA 2QWWA 2DK5A 4YG2F 1S6LA 3E5QA 4WXDA 2VE9A 2PJPA 4PGHA 2E1CA 3VFZA 5FLXZ 3K9TA 1PP8F 3I71A 2ISZA 3R61A 4BHCA 1KQ0A 5FFXA 4ZYHA 3K0LA 4GYIA 4I01A 2X4HA 2DTRA 5JI6A 4ESJA 5F64A 4O5VA 1ONVA 1RNLA 1REPC 4P96A 2KIUA 4IHSA 2Z3YA 2VONA 3BWGA 4LLNA 2MA3A 1J7KA 3E97A 4UUVA 2L4AA 3JSPA 2EFQA 3K1MA 1DDNA 1KU9A 1SD5A 1OYIA 4E70A 1U8RA 3LQRA 2M8EA 6PAXA 4WXHA 1AWCA 4Z2YA 4IF4A 3V8KA 2NYXA 1SD6A 1O3QA 2MBFA 2KRFA 1W5SA 3GW2A 4I02A 4M74A 4HDVA 1ZGAA 4JK1X 1G3YA 2ZMEA 5DDGA 2MC3A 4UVBA 4R8HA 1V4RA 4MQVA 5HOOA 3I58A 5AIQA 3WTZA 2QYOA 4A0YA 2L54A 2BV6A 2FXAA 4UXNA 1HSTA 1XSVA 3KP4A 2OZUA 5K5RA 4P55A 3F23A 2UXXA 1Y0UA 2ZCWA 3EDPA 4HQEA 1IW7F 4GO1A 3HYIA 2F5CA 2ELHA 1P2FA 2Z5UA 4B8XA 2KJCA 2DPDA 2W24A 1B9MA 5FO5A 4A2UA 2YR2A 3J81K 2GIVA 3CUQA 1VTNC 2MD5A 1YS6A 4HQMA 5D6FA 4CICA 1HXDA 2ZBKA 1BIAA 1K78B 5J8CA 3L00A 4G7HF 2JPCA 3MCZA 1S8NA 4AIKA 4KN4X 2MH9A 3V4GA 1FYLA 1EH8A 1IN8A 5LEJA 2VOOA 2A6HF 4ON0A 3L7WA 1LQ1A 2ZMEB 3GX4X 3SZTA 3WTWC 3DKWA 3RJPA 2O0YA 3WG9A 3MZHA 1J2XA 2M5WA 1W7PA 2VT2A 1WKMA 1B6AA 5HLIA 3KETA 1WRJA 3ZN0A 3DQVC 2VT3A 2R7DA 4A5MA 2DK8A 1ZHFA 2P6TA 4A12A 4IRGA 3CTAA 3N4MA 5LRSA 4YFNF 4HOBA 1OMIA 1SFEA 1LVAA 1D8KA 5E1WA 4XLNF 4FX4A 5ICGA 1TNSA 3I4PA 4LG0A 2EV5A 2COMA 1BC8C 1SMTA 1H9GA 3GYHX 3CUQB 4EVIA 4HLYA 4GXOA 3AAFA 1I1GA 1ZG3A 4YFXF 4ZZLA 1R22A 3WE3A 2L3DA 1KQ8A 3I0TA 3HSFA 2V6CA 1FY7A 2ADUA 2ZNYA 5HS9A 4M9ZA 2WV0A 2XV4S 2HFHA 1Z6RA 5DYMA 5ILVA 3TGNA 3REOA 1L0OC 4NB5A 4RAZA 2XGXA 3KEOA 3M8FA 5FD5A 1OYWA 2FA5A 2K7LA 1FP2A 1ON1A 1P4WA 1JHFA 4RB1A 1Z91A 4P9UA 3BP8A 3P9KA 3GZ5A 4A0XA 2H94A 1W7PB 1K79A 1RUOA 1IUYA 2A61A 1IZ1A 2ZXJA 3LA2A 1YW7A 3IKTA 3ISPA 5EEGA 2L02A 2GA2A 1FOKA 2A3SA 3RDIA 2QZ8A 2RGVA 3H92A 5CYVA 1L3LA 3QPTA 3Q9VA 5CVUA 2D1HA 2F5FA 4BXUA 2X0LA 2VXZA 3J7AO 1XGNA 5E8GA 1U5TB 1R1VA 2VE8A 2FNPA 2IT0A 3HRSA 2FBHA 5CVRA 1G3TA 5LGTA 5BPDA 3U1DA 1USSA 4H0EA 3QPHA 1F5TA 2YX7A 1DPUA 3KP6A 2XRNA 3E3VA 3JSOA 3JAMZ 3J80K 1TW2A 4HDUA 3BPVA 2A69F 1OYYA 1Z1DA 2OBPA 2D2WA 3WU1B 3ELKA 2RV8A 3V8JA 3MEXA 1XGSA 4UV8A 5A2QZ 3T5XA 3BDDA 4ESFA 1FPQA 5E8IA 2XVCA 1YO5C 4XLPF 5LEKA 5IT9K 3BJOA 3JW4A 4NQWA 4ZH4F 2P8TA 3L2CA 4U88A 2MLGA 2GXBA 5IT9Z 1GHCA 3F21A 3KE2A 2STTA 4D0PA 2MLKA 3LAPA 4G94A 4S05A 3ECOA 3LSTA 2XAFA 4AWXB 4ETSA 3FZVA 1P6RA 2OA4A 3FX3A 2V1UA 2JZYA 2W85A 1QGPA 2XAQA 2GAUA 3WGHA 4PGGA 3NEUA 5DUKA 2JTVA 4M72A 3R6SA 3O2PE 3G3ZA 1HSJA 2EK5A 4YIIA 1WQ2A 3QRFF 3GWZA 3ZMVA 2UXNA 1EH6A 2M1BA 1XSXA 5CVIA 3T8RA 1Z05A 1ZLKA 4I0BA 3I53A 1QNTA 4HF2A 2O61A 4MTEA 4G8XA 1BOAA 1R5GA 3LA7A 4IPAA 2L01A 3ZN1A 3F6VA 5F1RA 2XHKA 2A68F 3WTSC 5LRRA 2RC4A 2HTJA 4OIOF 1A04A 2IJLA 4Y13A 1WSUA 4U7BA 5BOXA 2VBWA 3V7CA 3TO6A 3F8CA 1TNTA 2XASA 5FB2A 4KMFA 3F8FA 1RI7A 3CO7C 4CXFA 5JFRA 3F72A 4ENMA 3TO7A 1XGMA 5DV5A 3JTHA 3B73A 2PMUA 4OMZA 2FQ3A 4A6DA 1X3UA 2JSCA 2HQRA 2QQBA 3RI4A 2VC1A 2CQKA 3BPXA 2EWNA 1RZ4A 2FU4A 2ZFWA 1ON2A 4JBAA 1V3FA 3F8MA 2BE5F 2GA1A 4MQ9F 2OQGA 4MTDA 5E17F 4KNYA 3GXOA 3CJNA 1K6OA 1ZAOA 1R7JA 1YS7A 2HKOA 2XKPA 3TO9A 1CF7A 5HLHA 2E1NA 1E17A 5EEHA 1KU7A 4PDKA 1LB2A 4KN7X 4KDPA 3HRUA 3BJAA 3ZMUA 3KZZA 4LFUA 1MJAA 3IC7A 2YU3A 1IXRC 3DV8A 3I5UA 2EA4A 2VODA 1T38A 1FC3A 3DPLC 3RKXA 3ULQB 3WGGA 1K78A 4I09A 4ZZDA 5HVQC 1WI9A 5FFZA 3WTUC 2EV0A 3M1EA 3U9GA 4OIPF 2QVOA 4GYGA 4EV0A 2O6GE 1I1SA 4L0YB 3ABTA 1EV7A 4AD9A 2FSWA 1YG2A 3E6MA 5KK1A 1QBJA 2W84A 4HYEA 5HDKA 2HQNA 1AOYA 1S7AA 2Q0OA 1XD7A 4CGZA 1ZG1A 3SQNA 2CGPA 1TTYA 1ZRFA 2QQAA 5D5XB 1LJ9A 3LWFA 5TRDA 4BNCA 4TV7A 2OZ6A 2VC0A 2OAZA 3OOPA 2XIGA 2LF7A 3HSEA 1PDNC 5JHUA 3CDHA 1CF7B 2RDPA 3T8TA 5D5WB 1KU2A 2RKHA 2FF4A 4O6JA 2EB7A 1O7FA 3MFKA 2Z99A 3HHHA 4HV6A 2VOPA 2P4WA 2D45A 4CO8A 3FXUA 2UZKA 4HF0A 3H3UA 2FBKA 4R79A 3ROUA 1G4DA 1W4MA 1BI0A 4ENNA 3VEPA 2XKOA 4MHGA 5FGMA 3K1PA 1GXPA 1LEAA 2DW4A 5BPIA 2CFXA 3IRRA 3E6DA 5E1XA 4M9XA 1D3YA 4AVPA 2K27A 2NNYA 2A6EF 3SZPA 1ZH5A 1R5HA 1LNWA 4XSZF 4EMSA 2EV6A 4RS8A 4Q47A 3HOSA 4OIQF 1BBYA 4HW0A 4MEYF 1FSHA 3ZMZA 3K69A 4BAYA 3ZMDA 2D1VA 2EFOA 4UVAA 2R7FA 5DCFA 4RGXA 4GGGA 4ZYEA 3PFIA 5LHGA 4FX0A 1E2XA 3ZMSA 3Q5FA 1U3EM 3VODA 5D6EA 2LF8A 5DUIA 2EA2A 2OD5A 5ILSA 2WC2A 2K02A 4KIFA 3U2RA 4WCGA 3OV8A 3FMRA 4P9FA 2V1XA 4G9YA 4RGRA 4M73A 4ASNA 1U5TA 2XROA 3CUOA 5AONA 3G73A 2GWRA 4AIHA 2K4JA 2IRFG 3KLNA 2DLLA 1ZN2A 2M45A 5LGUA 1S7OA 4N0BA 1UFMA 3GFMA 1U6GA 2Z9OA 1T0FA 4M6XA 1R36A 1TW3A 2XAHA 1DUXC 1HKTA 4LK0F 5D4SA 2LDUA 3EUHA 4HA8A 5D8LB 5JVTA 2YSRA 1F1ZA 1U2WA 5E20A 2VN2A 1UHWA 2VBZA 3SXYA 2CW0F 2EFNA 4HX4A 3DEUA 4KYWA 2STWA 1IRFA 2IA0A 1FYMA 3GO5A 4Q4ZF 2CYYA 3EETA 4UNOA 2IA1A 2QENA 3GF2A 2PFBA 3RPQA 1KYZA 2G9WA 3L09A 4AIJA 3GFLA 1HKQA 5JR3A 2HYGD 1LDJA 3KP2A 1O3RA 4EJOA 2AS5F 2IW5A 2DT5A 1PP7U 5J8FA 3QU6A 3C7JA 4EM1A 2MH2A 2PBIA 3ZQ7A 3MWMA 4IXAA 1QQIA 3HSRA 3L9FA 3KP3A 3JAMK 3P9IA 1Z7UA 3FXQA 2W25A 2IPQX 3TDZC 2NAZA 3E5XA 2V79A 3QOPA 3IWFA 5DD8A 1T2KA 1S3JA 4G7OF 2AXLA 5HLGA 2FBIA 1TQIA 4LB5A 2J5OA 2O03A 5A2QK 3TDUC 2E7WA 3RKYA 1HW2A 1YW9A 4B09A 5LBQA 2WTEA 2QM3A 3ZMTA 3C3WA 2EJRA 2NNNA 1FLIA 1BI3A 1JHHA 5TJJA 2V1DA 2GQQA 1JGSA 2FRHA 4M71A 4R1HA 1QPMA 4BYYA 2DBBA 2CWEA 1BI2A 4U0VA 2Q8KA 3DPTA 2DO7A 4U0YA 1GVJA 2HKXA 3LQQA 1B4AA 2RN7A 1F9NA 3ML6A 1ZG5A 2PLYA 5DD4A 1W5TA 1DPRA 2XAGA 2KIFA 3GFJA 4ENKA 2V9VA 2Y0MA 1J75A 4BHBA 5L3DA 1MKMA 1G6NA 1FBQA 1QO0D 2OQRA 5L3CA 1MD0A 3JTGA 4G7ZF 4L5JA 2FE3A 2GXGA 4LGWA 3I59A 3K1NA 4KFCA 3N97A 2ESHA 1GXQA 1XDUA 2DQRA 3KP7A 3ABUA 3KFWX 4RB2C 1P4AA 2XAJA 1WWXA 3SFZA 2K4BA 5H20A 2LNBA 3GEZA 2UWMA 3H3ZA 5IT3A 4FHTA 3QAHA 4XSXF 3DP7A 3P7NA 2KKOA 4N9IA 1FT9A 1K7AA 2YPRA 2PEXA 3R0JA 5L3FA 3WTVC 3V7RA 1FYKA 2RVCA 4S04A 4F7ZA 3WTTC 3HTSB 4ZYDA 1B59A 4UHTA 2PMHA 1BIBA 3O3KA 3FXRA 1FBUA 1XCVA 3DFGA 4EM0B 5L3EA 4IHTA 2HR3A 1D5VA 1IN6A 3BZ6A 4NHJA 3GZ6A 1OR7A 2ZKZA 3FWEA 1XMKA 2EFPA 1SMYF 1H9TA 1OKRA 2RNJA 2QLZA 1C0WA 2O3FA 1FNNA 1IN7A 3VOEA 3LFKA 1XMAA 5CJ9A 3I59B 2HEOA 3MQ0A 5CLSA 2H09A 3RYRA 4DQ2A 4OINF 2HWVA 4LLGF 1G3SA 4A5NA 3E5UA 1I27A 5ICCA 3W6JB 1MZBA 2RQPA 1TLHB 3HHGA 1XN7A 3R4KA 1P4XA 1UHMA 1HBXG 3BJ6A 1HKSA 4IRHA 4EJUA 2DU9A 4Q48A 4N9HA 3EYYA 1ZRCA 1R1UA 5D8KB 3WTYC 1XCBA 3IRQA 3ERED 3P9CA 3BROA 4KA4A 4A0ZA 4K2EA 2BYVE 1FSEA 5E18F 5K5QA 3HRTA 2Y48A 2O8XA 3F8NA 2ZO4A 5H6RA 4BQAA 1Z9CA 3FMQA 3M7GA 2P6SA 5ICFA 2CSOA 2W57A 4FT8A 4KIGA 1CGPA 1B1BA 3ZPLA 2JT1A 4L5IA 1ZRDA 4G6QA 5D5UB 4ENJA 3RIRA 3RYPA 1USTA 2EFWA 3FHZA 2CO5A 2F2EA 5HDGA 4XRFA 1KYWA 3GLXA 5CVJA 2H27A 4L9NA 1KGSA 4UV9A 4HV5A 4WF2A 4RAYA 2ZNZA 4WXCA 1ZARA 2NS0A 2DQLA 3QP6A 1MDMB 2VBYA 2C6YA 4IVNA 4OOIA 2ETHA 3KCCA 2CG4A 1U78A 3TQNA 2FMLA 1XSDA 2P5LC 1F4KA 1IRGA 4WX9A 3WE2A 4CYDA 4L9JA 2BGCA 2F5EA 1UB9A 2BBYA 3RKWA 1O7LA 4HBLA 1BI1A 4I2OA 4LB6B 4RB3C 3HIFA 5ERIA 3DXJF 2XUBA 4G6DA 5LHIA 1LDDA 3SHFA 5LHHA 4ESBA 1O3TA 1T6SA 4EGZA 1FX7A 4WK8F 2M87A 4I0AA 3C18A 1YFHA 2PI0A 5BS6A 1O57A 3GUDA 3MAJA 3D5LA 3BY6A 3IHUA 3COAC 3M9AA 3J81Z 3F8BA 4BHPA 3F22A 4EM2A 2IVMA 4LD5A 3VB2A 2P7CB 2FOKA 5HDNA 4YIFA 3TOAA 5K5OA 1MGTA 4KICA 2BEOA 4RGSA 1YTYA 1O3SA 2ISYA 3IL2A 4P5OA 2Z33A 4EQQA 1BC7C 1FBSA 2DI3A 4UVCA 3RPUA 1J9IA 4KIBA 1IXCA 3IKVA 3I64A 1ZREA 3K2ZA 2P5VA 1BM9A 3Q9SA 3RTRA 2Q2EA 2ESNA 2H6BA 4MGRA 3KEQA 4QLCU 4HAMA 2G7HA 1T98A 2KJBA 3O6BB 4LMYA 2WWYA 1PUEE 1SD4A 2JPBA 4DNCA 1R58A 3WTXC 1JXSA 1Z6TA 3I54A 5D5VB 1UCRA 2IA2A 1ODDA 3HOTA 4CDGA 4LLLA 2HYFA 1FZPB 4EJVA 3FMSA 1MJ9A 4RB0A 3WGIA 4Q5SF 1KU3A 3TOBA 2FEZA 3LA3A 2B0LA 1IF1A 2A07F 2QUFA 3FM5A 3C1DA 3CUQC 2FNAA 3LAJA 3V7SA 3HTUA 1SFXA 4QWQA 1JE8A 1LEBA 2HGCA 3F3XA 1TQPA 1IN5A 1YQAA 1DP7P 2L4MA 2K86A 3QP5A 3R0AA 1Q1HA 5HS7A 5DCMA 3M8EA 4CHUA 4JQFA 4I7HA 4OU0A 1R00A 4O3MA 1H0MA 5DEQA 1HQCA 5L3BA 4LG0B 4IJAA 2YX4A 1RUNA 4IRIA 2Y75A 4BH9A 3EQLF 1IAWA 2JRTA 3PQJA 3ECHA 3HUGA 3KP5A 1J59A 3WODF 4KT5C 4MEXF 5ICEA 1XGOA 1ULYA 3KLOA 5LGNA 3GFIA 1KA8A 4Y15A 5BQTA 2F5DA 2HZTA 3W6KB 5AIPA 2HOEA 1SD7A 1U5TC 2DPUA 3J80Z 4MNUA 2LKPA 1QZYA 2HTSA 5F6FA 3D0SA 2M30A 1NHAA 2P7VB 3GVAA 1BJAA 1MJBA 2DAOA 2KIMA 4EJWA 5K1YA 3E6BA 2E7XA 2GZWA 5DCMB 4KMUX 2NRAC 5BMZA 1SFUA 4Y17A 2FMYA 1XB4A 5E1ZB 3PQKA 4OIRF 1FWZA 4PZJA 2J5PA 1KQ9A 4HF1A 5LLQA 4HLXA 3HRMA 3CLOA 2A5YB 2LSOA 2PQ8A 3MZYA 5ED4A 1YLFA 4GCVA 3R60A 4YFKF 3NRVA 2QBYA 3FM3A 3IWZA 1SAXA 1J0RA 2ACJA 4LJZF 3ZP5A 3TKYA 5FD6A 1ZYRF 3QU3A 4CZZA 2PN6A 3BOQA 4KUMA 1OPCA 3WU0A 5H6QA 1BN5A 1T39A 1FP1D 4L9VA 1S29A 4XBFA 1ZLJA 1D8JA 2OU2A 1LDKB 1IN4A 3F6OA 4U7DA 1G3WA 4ZYGA 1I5ZA 2QQ9A 2HS5A 1ZGJA 2R3SA 1YW8A 4L0ZB 4EGYA 1B9NA 3DF8A 3T0YA 1YIOA 5ILUA 4PCQA 1J5YA 4L18B 4RGUA 4U0WA 2ZJ2A 5HS8A 2HDCA 1TQMA 4M9SA 1R23A 5D4RA 1YYVA 4HX8A 4I98B 2DFIA 1XDSA 1EH7A 4HZFA 4EJTA 1STZA 4A6EA 2VBXA 1TBXA 3V8LA 5CVVA 3S2WA 4LK1F 3NQOA 1W7PD 4HX7A 5L3GA 4L9TA 3CO6C 3E6CC 5KVRA 2TDXA 2G7UA 3KZYA 1P92A
chains in the Genus database with same CATH superfamily
3B02A 3T1BA 4WWCA 1MDMA 2IP2A 3EYIA 5J47A 1I6XA 3MKZA 1IXSB 1R1TA 3KYLA 5J6XA 1QZZA 5FLXK 4M6YA 4OMYA 3HOUJ 2EIKH 4BQOA 2PG4A 1YX5A 3FF5A 5IYBJ 2QBYB 2R93J 1WCMJ 1HW1A 1HW5A 2P5KA 4N4NB 5HNHA 1RIOH 2H6CA 1NH3A 2QWWA 3HM5A 2DK5A 4YG2F 1S6LA 3E5QA 4Y52J 2IEKA 5JLXA 2K9NA 4WXDA 2VE9A 2PJPA 4PGHA 2E1CA 3VFZA 5FLXZ 3K9TA 1PP8F 3OSFA 3J7AY 2VKEA 3I71A 4CCOA 3OY9A 3R61A 2ISZA 3CMYA 4BHCA 1KQ0A 5FFXA 4ZYHA 3ZOBA 1A6QA 2M2EA 2X6XA 3K0LA 4GYIA 2HYJA 4I01A 1W36D 2BW3A 3LSGA 4E7KA 2DTZA 3HOXJ 2X4HA 5CKTA 2DTRA 2M9HA 5JI6A 4ESJA 1F43A 1PYVA 5F64A 4O5VA 1ONVA 1RNLA 1P9QC 3FKIJ 5EYRA 1REPC 3JRFA 4P96A 2LREA 1WFXA 2KIUA 5GTIC 2HDWA 4IHSA 2CUFA 2Z3YA 1LFPA 2VONA 5C44J 2KPMA 3BWGA 4LLNA 2MA3A 1J7KA 3E97A 4UUVA 2L4AA 2R5ZB 1BW5A 5JHFA 2KIQA 3JSPA 1VQNI 1WJEA 2EFQA 2CUEA 3C2GA 4XOPA 3K1MA 3MN2A 1ETVA 1DDNA 4MIMA 1KU9A 1SD5A 1OYIA 2E1MB 4E70A 1U8RA 3LQRA 2M8EA 6PAXA 4WXHA 1E3HA 1AWCA 5IP9J 3ABLH 4Z2YA 4IF4A 4PUSA 2R7RA 3V8KA 3JRHA 2NYXA 3JRGA 1SD6A 1O3QA 4NDLA 2MBFA 3CCSI 1JJ8C 2LR8A 2KRFA 5EJCA 1W5SA 3EPZA 3TL4X 3GW2A 4I02A 4M74A 2R0QC 4HDVA 1RETA 1D1AA 1ZGAA 4JK1X 1G3YA 1S9HA 2ZMEA 5DDGA 1V5EA 4BY1J 2MC3A 4UVBA 5FKNA 3FIWA 4V2FA 4R8HA 3PSFA 2Z2SB 3VSLA 1V4RA 4MQVA 3WTZA 3I58A 3BG7A 5AIQA 5HOOA 4XICA 2QYOA 4A0YA 2L54A 5HLTA 2BV6A 2X6WA 3DEWA 2FXAA 3GBGA 4UXNA 1HSTA 1XSVA 4FETA 5IYDJ 1OR7C 1P7JA 2NS7A 1ITYA 3S32A 5F0CA 3KP4A 2JK3A 2OZUA 5K5RA 4P55A 3F23A 3PO2J 3E7LA 1BR2A 2UXXA 3RZOJ 1Y0UA 2K3PA 2X1EA 2XSJC 2ZCWA 2NVYJ 3EDPA 5EDNA 4HQEA 1IW7F 5J4YA 3GTJJ 4GO1A 3HYIA 2BW3B 5M3MJ 4AIDA 2F5CA 4AUXA 1IV8A 1BW6A 2ELHA 4PK4A 1P2FA 2Z5UA 2CUJA 4B8XA 2KJCA 4M3DA 2DPDA 1SANA 4JOMA 3K4BA 2W24A 2CV0A 1G2HA 1B9MA 4OAZA 5FO5A 2YR2A 4A2UA 1IO2A 3J81K 2MW8A 2GIVA 3CUQA 4JX6A 1VTNC 2CJJA 2GOMA 3BG3A 2DMUA 3K4CA 2JA6J 2MD5A 1YS6A 4HQMA 1RR7A 5D6FA 4CICA 1OCTC 1HXDA 4RAGA 2ZBKA 1BIAA 2AHQA 3A1YA 1K78B 1OQYA 5J8CA 4IQJA 3L00A 1JTYA 2JPCA 4G7HF 3MCZA 2V7FA 1S8NA 2V4JC 3S17J 4AIKA 4N4OB 1E3PA 1UJ8A 4KN4X 2HOTA 5GPCA 1BL0A 1OCOH 1XTAA 2DOFA 4CH7A 2MH9A 3SJMA 2X1DA 3HXLA 3V4GA 1FYLA 3GTKJ 1EH8A 3M3YJ 1IN8A 3BR0A 2EPFA 4W1UA 2R7VA 5LEJA 2ZB9A 2VOOA 4BQNA 2XRLA 5E3NA 1BR1A 2A6HF 1X2NA 4ON0A 1R5ID 3L7WA 2UUZA 1LQ1A 4XONA 2BY2A 2O9LA 4ZC3A 2CQNA 2ZMEB 1A5JA 2E60A 2L9VA 4XMYA 2XDVA 2JA8J 3GX4X 3SZTA 3WTWC 3DKWA 3RJPA 2O0YA 3WG9A 2LY9A 2BHZA 3MZHA 1J2XA 2KQRA 1IJWC 2I5UA 3UNGC 2M5WA 1W7PA 2L0KA 2VT2A 1WKMA 1B6AA 5HLIA 2OPTA 3KETA 1WRJA 5FKMA 1LE8A 1E0EA 4AU7A 3ZN0A 3DQVC 2VT3A 2R7DA 3CC7I 4A5MA 5J3LA 1RR8C 2DK8A 1D1BA 2KHMA 1ZHFA 2P6TA 3RKQA 1W0UA 2XF7A 4A12A 4IRGA 3CTAA 3N4MA 5IOZA 2MD0A 4OAYA 4BXFA 5LRSA 2ZXWH 3BCBA 4YFNF 4HOBA 4RBOA 3C2HA 2YU9J 1OMIA 1SFEA 1BR4A 1LVAA 1D8KA 5E1WA 4XLNF 1WJFA 4FX4A 5ICGA 1TNSA 3I4PA 4LG0A 2EV5A 2COMA 3PUFA 1ACIA 1BC8C 2E5NA 1SMTA 2DN0A 3QQAA 1VF9A 2H8WA 1H9GA 2IAIA 5H2FC 2ME0A 3GYHX 3CUQB 2LYCA 2QSGX 2K9MA 2VASA 3ZQGA 4EVIA 4HLYA 4GXOA 4BJTA 2AQEA 1AA7A 2MSYA 3AAFA 3O8HA 2I10A 1I1GA 4BE2A 3IAS2 1ZG3A 4YFXF 4ZZLA 1R22A 3WE3A 4E7IA 2L3DA 1KQ8A 3I0TA 2FD5A 3HSFA 2V6CA 1FY7A 2ADUA 2ZNYA 4BQQA 1YITI 3P5JA 5HS9A 4M9ZA 3SZGA 2WV0A 2L9SA 2EIJH 1T33A 1HDDC 4W97A 2HOSA 1BJZA 4A93J 3AG3H 2XV4S 3VWBA 2HFHA 5F08A 1Z6RA 5DYMA 4KT6A 1B72A 4C30A 3TGNA 5ILVA 2R7UA 3REOA 1JI8A 2VQGA 2ZSHB 1L0OC 4NB5A 4RAZA 2XGXA 3KEOA 4DYQA 3M8FA 4E7ZA 5FD5A 2K9SA 1OYWA 2EBIA 2FA5A 2K7LA 2E35A 1FP2A 2L5QA 1FEXA 1ON1A 1P4WA 1JHFA 3S3OA 1LFUP 4RB1A 4RM2A 4NNJA 3FXJA 5FRNA 1Z91A 1X4PA 1ZR4A 1N75A 1JKOC 4P9UA 3BP8A 1ORKA 3P9KA 3GZ5A 4A0XA 2E2HJ 2H94A 1W7PB 2HQ5A 1K79A 2WB1N 3ZQQA 2KZGA 3FHNA 2DFHA 1LE8B 3X2QH 2WAFA 1RUOA 1IUYA 2A61A 1IZ1A 2CMPA 2ZSIB 2ZXJA 2KT0A 3IUOA 3H9JA 3LA2A 1YW7A 3OYMA 3IKTA 3L2UA 3ISPA 4A3DJ 5EEGA 1MBHA 1UMQA 2W4SA 3G1MA 1FTTA 2VQHA 4E7HA 2AQFA 2L02A 4XN0A 2HPIA 1VI0A 2GA2A 1FOKA 3LNQA 2A3SA 3RDIA 2QZ8A 2L7ZA 3AG2H 2RGVA 3H92A 3RSNA 5CYVA 1L3LA 3AKZA 3QPTA 3Q9VA 2CU7A 5CVUA 2D1HA 4EATA 2F5FA 4DBRA 1MMGA 4BXUA 2Y0SN 1SVOA 1UELB 2X0LA 3RQ4A 3FDYA 1JUPA 2VXZA 3J7AO 2CQ7A 1MSFC 2R7TA 1XGNA 5E8GA 1U5TB 2E2IJ 1X2MA 1R1VA 2VE8A 4AM3A 2FNPA 3MVPA 2IT0A 3S16J 3HRSA 2FBHA 2L9NA 5CVRA 1G3TA 1X1CA 5LGTA 2XAUA 3U1DA 1USSA 5BPDA 2GOXB 2LK2A 4H0EA 1D0XA 3JRDA 1LPQA 3QPHA 1OCRH 1F5TA 2YX7A 1DPUA 3KP6A 1VQ9I 3ESWB 2IGOA 2XRNA 5J1UA 2HZDA 3GTMJ 2YUSA 2JA7J 3E3VA 3JSOA 3JAMZ 3JRCA 3J80K 1TW2A 2LP0A 4HDUA 4RLFA 3BPVA 1B72B 2A69F 1OYYA 3J7ZI 1Z1DA 2OBPA 4G12A 3MKWB 2D2WA 3WU1B 1VQ7I 3ELKA 2RV8A 3WU2C 3V8JA 2LC2A 3TBIA 4XL9A 3KX2A 3MEXA 1W1WE 1XGSA 4UV8A 5A2QZ 4BBSJ 3T5XA 3OYJA 3M8JA 3S14J 2R7QA 4B44A 3BDDA 4ESFA 1FPQA 2QKLB 2XVCA 5E8IA 4XLPF 1YO5C 5LEKA 4D5FA 4AYBN 2F4IA 3BJOA 3WHBA 5IT9K 2E5ZA 3JW4A 3CJQB 1ZGWA 1FOYA 2ZXHA 4NQWA 1DGRM 2QF7A 3MD2A 4XORA 4ZH4F 2P8TA 3L2CA 2WB1A 2Y69H 4U88A 1T0FC 2VJ4A 2MLGA 2GXBA 2CH0A 1D1CA 2Q1ZB 4XKWA 1MH4A 2KFDA 3CCQI 4FCYA 5IT9Z 1PVEA 3A02A 3BG9A 1H88C 1GHCA 1QA6A 3F21A 5IY5H 3KE2A 2OTJI 3CQZJ 2STTA 2IS6A 4D0PA 2HPMA 1Z67A 2MLKA 4G94A 3LAPA 1VQPI 4S05A 3ECOA 3EUHC 3CF5F 3LSTA 3A01A 2X6YA 4IKFA 1O4XA 4F55A 2XAFA 4AWXB 4ETSA 3FZVA 1P6RA 3I56I 2OA4A 3FX3A 2TRTA 2V1UA 5JVGF 1S72I 2DXIA 2JZYA 2E71A 2Y0SA 2W85A 2JWTA 2QSHX 4ZDOA 1QGPA 2XAQA 3W2AA 3LSRA 3CCUI 4QTRA 2GAUA 3WGHA 4PGGA 3HOZJ 3NEUA 5DUKA 2Y9YA 2JTVA 4M72A 1IUFA 3R6SA 1Z21A 3O2PE 4B3XA 3DTEA 3G3ZA 1HSJA 2EK5A 4YIIA 1FTZA 1WQ2A 2VKVA 3QRFF 1H89C 1MH3A 3GWZA 3ZMVA 2UXNA 1S7EA 4ZDPA 4HSTA 1EH6A 1TT0A 1HLVA 3CP2A 4D7NA 2M1BA 1OJLA 1XSXA 3KYDB 1Y8QB 3ZGKA 5CVIA 5J40A 1Z05A 3T8RA 1ZLKA 4I0BA 3K4KA 3I53A 1QNTA 4HF2A 2O61A 4MTEA 4G8XA 1BOAA 3CD6I 4DOZA 1R5GA 3LA7A 1X19A 1YE9A 4IPAA 2L01A 2NOJB 4B4CA 3FXKA 4BGDA 2LOOA 3ZN1A 3F6VA 2M0CA 5F1RA 2ZXIA 4IX7A 1MW7A 1Z77A 2XHKA 1X1PA 3CLQA 2A68F 4Y4RA 3WTSC 2ZJQF 5LRRA 2RC4A 2L2OA 1TWAJ 2HTJA 4OIOF 1K61A 1Z0XA 1A04A 1SAUA 3MMYB 2VUMJ 2IJLA 2DA6A 4Y13A 4U7BA 5BOXA 4FISA 1WSUA 4XN3A 2VBWA 3H0DA 3DCFA 3V7CA 3TO6A 3F8CA 2JVHA 3L2VA 3OMYA 3VPRA 4EEFG 4NQWB 1TNTA 4B3AA 2XASA 5FB2A 4AYBA 2VXDA 4KMFA 3F8FA 1RI7A 3CO7C 3A03A 1U9OA 3OYGA 4CXFA 2BOLA 1TZLA 2DCEA 5JFRA 2ZJPF 3F72A 3HL2A 2G0EA 4ENMA 1I3AA 4IEJA 2JVGA 1JUMA 1XGMA 1Q1VA 5DV5A 3JTHA 2HOAA 3TO7A 3B73A 2PMUA 4OMZA 2FQ3A 2MYSA 4ZTFA 4A6DA 3H3VK 1X3UA 2JSCA 3H1CA 2HQRA 2QQBA 3VYSB 3RI4A 4CA0A 2VC1A 2CQKA 5DM6F 3BPXA 2EWNA 1RZ4A 2FU4A 2ZFWA 1ON2A 3FXOA 4JBAA 2ID6A 1V3FA 5E3OA 3F8MA 2BE5F 3CMMA 2HDDA 2GA1A 3OYAA 1IC8A 1RKTA 4MQ9F 2OQGA 4MTDA 2E2JJ 3S2HJ 5E17F 4KNYA 4HEA2 3GXOA 3CJNA 1HDPA 1K6OA 4YRVA 1MSEC 1ZAOA 1R7JA 1YS7A 2HKOA 2XKPA 3F0CA 3TO9A 5GAHJ 5HLHA 1QVUA 1CF7A 1FOXA 2DA1A 2E1NA 1AKHA 3VYUB 1E17A 5EEHA 1KU7A 4PDKA 1LB2A 1B8IA 4KN7X 3K4LA 4ZYAA 3G2BA 3DPUA 4KDPA 3HRUA 3BJAA 3ZMUA 3KZZA 1ZR2A 4LFUA 2WADA 1MJAA 5LFAA 1D0YA 2NVTJ 3IC7A 2K3FA 2YU3A 3HG9A 3HGGA 2AXTC 1IXRC 3DV8A 3I5UA 5TGTA 4YEJA 2EA4A 2VODA 1T38A 3G6EI 2JN6A 4RAFA 1ETYA 2PX9A 1FC3A 3DKYA 3DPLC 3RKXA 3ULQB 2KZVA 3WGGA 4NUBA 1K78A 2KRHA 4I09A 3NWSA 4XQFA 4ZZDA 5HVQC 1ETXA 1WI9A 4XLHA 5FFZA 3WTUC 2EV0A 3C2BA 3M1EA 3U9GA 1X1BA 4OIPF 4AVZA 4IOAF 2QVOA 2ID3A 4GYGA 4BXXJ 2DA7A 4EV0A 3H5NA 2O6GE 3AG1H 1I1SA 3GTGJ 4L0YB 1MIJA 3ABTA 2EILH 3KZIC 4XIDA 1EV7A 4AD9A 4FE4A 1ZELA 2FX0A 1DGWY 2FSWA 1YG2A 3E6MA 4RM3A 5KK1A 1QBJA 2W84A 4HYEA 5HDKA 1I3QJ 3NARA 2NVUB 1EA3A 4UB8C 2HQNA 1AOYA 2F4OB 1S7AA 2Q0OA 1XD7A 3CCLI 3OL4A 4CGZA 3DU6A 3SQNA 1ZG1A 2CGPA 1TTYA 4CZCA 1A31A 1ZRFA 1UHSA 3ZQIA 4FTHA 1Y1WJ 2QQAA 1YJ9I 5D5XB 1LJ9A 5EG0A 1VQ5I 1ZKGA 4BDYA 3LWFA 5TRDA 2DA4A 4BNCA 4TV7A 1VQMI 2OZ6A 2VC0A 3H5RA 2MG4A 2OAZA 4MLOA 3OOPA 2XIGA 2HXOA 2LF7A 3HSEA 1PDNC 5JHUA 3CDHA 3OYDA 4XR6A 1CF7B 2RDPA 2Y2ZA 3OYHA 1AKHB 3T8TA 2KL4A 1B8IB 3SFIA 5D5WB 4I99C 5FJ8J 2DMTA 1KU2A 2RKHA 4DGWB 2RREA 4RLQA 2FF4A 4O6JA 2EB7A 1WJAA 3CCEI 3TP0A 1O7FA 2OC6A 3W6VA 5GADJ 3MFKA 2Z99A 4F92B 3HHHA 4Z6YA 4HV6A 2VOPA 2P4WA 2D45A 4C3JJ 4CO8A 4BE1A 2K9QA 3FXUA 2UZKA 4HF0A 2W1OA 3H3UA 2FBKA 4R79A 3ROUA 1VQOI 1G4DA 1W4MA 5FRMA 1BI0A 4ENNA 3H35A 3ZR8X 3VEPA 1WI3A 3JRBA 2XKOA 4MHGA 4E7SA 5FGMA 3K1PA 2LKXA 2QKMB 1GXPA 5KAFC 2M4KA 3OS0A 3S2DJ 2A6TA 1LEAA 2DW4A 3LFUA 5BPIA 2CFXA 2M0MA 3IRRA 3E6DA 1MMDA 5E1XA 2JQ7A 4M9XA 1D3YA 4AVPA 3OIQA 2K27A 2XGEA 5DM7F 3BTCA 3HZJA 3QWLA 3IH4A 2NNYA 2A6EF 1Y6IA 2DMPA 2K9LA 3BG6A 4FE7A 4BL0B 1X58A 4BU2A 5EGOA 3SZPA 1ZH5A 1R5HA 3BLYA 1LNWA 4XSZF 2VKDA 3FBIB 3LSJA 4F52A 5J4VA 4HNVA 3BCAA 3SEZA 2BXZA 1HCRA 4BE0A 4EMSA 3ABMH 3PNVA 2EV6A 3BQZA 3B6AA 4RS8A 1P7IA 2ECCA 3ZQCA 4Q47A 3L2RA 2V1NA 3HOSA 4NC7A 4IHWA 4OIQF 1BBYA 4HW0A 4MEYF 2CS3A 1FSHA 3ZMZA 2N8GA 3K69A 4XLEA 3ZMDA 4BAYA 2D1VA 2EFOA 2M7AA 4UVAA 2R7FA 5DCFA 5EG0B 2LY1A 4GGGA 4RGXA 4ZYEA 4D5CA 3PFIA 5LHGA 1PJRA 1X4OA 2IXSA 2L7FP 4FX0A 1E2XA 2VI6A 3KIOA 3PNTA 3ZMSA 4DJAA 3Q5FA 1U3EM 2O8KA 1WVRA 3VODA 4BDZA 5D6EA 4PJ0C 1V54H 2LF8A 3H9QA 1M1EB 5DUIA 3JR9A 2EA2A 2XPWA 4HNTA 4OWRB 2FJ1A 2OD5A 2K85A 5ILSA 1FOWA 2HQAA 4DYCA 3GTPJ 4BY7J 2WC2A 2K02A 2ELJA 4KIFA 3CCJI 3U2RA 4WCGA 3OV8A 3FMRA 3A0BC 2EIMH 4P9FA 2V1XA 4G9YA 2H1LA 4RGRA 2XB5A 3CMAI 4M73A 4ASNA 1SEUA 2JRMA 1U5TA 3BQYA 2XROA 2H1KA 3PL8A 1SVMA 3CUOA 5AONA 3G73A 1YX3A 2GWRA 2W48A 4AIHA 1IGNA 2KLOA 5KCMA 1RPWA 2K4JA 5FLMJ 1N77A 2IRFG 2IS4A 3KLNA 2DLLA 3K70C 5TISC 3S1NJ 5FKOA 2OTLI 1ZN2A 1UG2A 2M45A 1HOMA 2E36A 5LGUA 1S7OA 3TW7A 2LVSA 4N0BA 1VQ6I 1BA5A 1UFMA 4PSXA 3GFMA 4MO7A 1T95A 3MKYB 1U6GA 2Z9OA 1T0FA 2DT7B 4M6XA 1R36A 1OLTA 5J1YA 1TW3A 2JMWA 3ASNH 2XAHA 1DUXC 1HKTA 2WBMA 4Y7NJ 4LK0F 3TP3A 4LG3A 5D4SA 5EGOB 3I55I 1YHQI 2LDUA 3M1CA 4D9JA 1U9NA 3ONQA 3DBHB 1ZK8A 2EZIA 3EUHA 3DBLB 4HA8A 5D8LB 5JVTA 2M4GA 5CPRB 4A3LJ 2YSRA 1F36A 1XG1A 2R5YA 1F1ZA 4CCNA 5JLWA 2OV7A 1U2WA 3OYIA 4C2MJ 5E20A 2VN2A 4PFPA 3W2WA 3V42A 1UHWA 2VBZA 4LIVA 3SXYA 2CW0F 2EFNA 4HX4A 3DEUA 1D5YA 4KYWA 2STWA 1IRFA 3J7YJ 4A3FJ 2IA0A 1FYMA 3GO5A 4Q4ZF 3UKGA 1WH7A 2CYYA 2X9DA 3EETA 4UNOA 3BR1A 5E3LA 2IA1A 2QENA 2VPRA 3GF2A 2ELKA 2PFBA 3RPQA 3DBRB 5K7HA 1KYZA 2G9WA 3L09A 4DIQA 2LFBA 1JGGA 4AIJA 5M5WJ 3GFLA 1HKQA 2DDBA 5JR3A 2X85A 4NC6A 2HYGD 3QOEA 1LDJA 3KP2A 2D5VA 1O3RA 4V19K 4X6AJ 4EJOA 2AS5F 2IW5A 1I39A 2DT5A 2EINH 1PP7U 3ASOH 5J8FA 3Q3SA 3CF2A 3QU6A 3C7JA 4EM1A 2MH2A 2PBIA 3ZQ7A 3MWMA 2ZJRF 3HOWJ 2IGNA 4IXAA 5M5XJ 5HODA 1GV2A 2QCOA 1QQIA 4C2UA 3FKJA 3HSRA 3CMEI 3L9FA 4LITA 4BKXA 3H9GA 3KP3A 3JAMK 3OSGA 3P9IA 3PUBA 1Z7UA 4XK4A 3FXQA 2W25A 3AG4H 1OISA 2IPQX 1MNDA 2COBA 3TDZC 2IS1A 2NAZA 3E5XA 2V79A 3QOPA 3IWFA 5DD8A 1T2KA 2JUCA 1G8XA 2M34A 1S3JA 1KONA 2RAEA 4G7OF 2AXLA 2XF5A 2KISA 5HLGA 2FBIA 1TQIA 3BTIA 2J5OA 2O03A 4II2A 5A2QK 4LB5A 3TDUC 1Y1VJ 2E7WA 2KRCA 3RKYA 1DP3A 1HW2A 2JA2A 1YW9A 4B09A 5LBQA 4C3IJ 5EEAA 2WTEA 2VIXA 2LY2A 2QM3A 4XLFA 4P1WA 5EF6A 3ZMTA 3C3WA 2LRDA 2R5YB 1JJ6C 2EJRA 4RDUA 5F1JA 2NNNA 1TWFJ 1FLIA 1ERDA 1Y39A 1BI3A 1JHHA 5TJJA 2V1DA 2GQQA 1JGSA 2FRHA 2OF7A 4M71A 2BXYA 4CCLA 4R1HA 1QPMA 1IRXA 2ICWG 5EZHA 4XRSG 4BYYA 5F04A 2DBBA 3G1LA 2CWEA 1BI2A 3BR2A 3OR2C 4U0VA 2Q8KA 3DPTA 3CJRB 1FJLA 3K4NA 1K6YA 2ZFUA 2DO7A 4U0YA 1GVJA 2HKXA 3LQQA 1B4AA 2RN7A 1F9NA 3ML6A 1DU6A 3OYFA 4PJMA 1ZG5A 2PLYA 5DD4A 2PMZN 5M5YJ 2F48A 1W5TA 1DPRA 1Y8RB 1FIPA 5IYCJ 3EUKL 2P0WA 2XAGA 3VYTB 2KIFA 3GFJA 4XLAA 2LKSA 4ENKA 2V9VA 2Y0MA 1MBJA 1J75A 4BHBA 5L3DA 1MKMA 1FMVA 1G6NA 3GTOJ 1FBQA 5LD2C 1QO0D 2OQRA 5L3CA 1MD0A 3JTGA 1NK3P 4G7ZF 2ZC2A 3MZ8A 4L5JA 2FE3A 2GXGA 4LGWA 3I59A 3G71I 3GMEA 3K1NA 2R7WA 3S15J 2L7KA 2BY1A 3DTKA 4KFCA 3N97A 1QHHD 1WPKA 1VQLI 2DMQA 2ESHA 3I3LA 1GXQA 1HC8A 1XDUA 3IAM2 2DQRA 3KP7A 2JA5J 3RQIA 3ABUA 3KPHA 3KFWX 4RB2C 1P4AA 4DZPA 2XAJA 1WWXA 3SFZA 5B1AH 2K4BA 4A3EJ 1I6HJ 5H20A 2LNBA 3GEZA 4B47A 1SFOJ 2UWMA 3B6CA 1W0TA 1CQTA 3H3ZA 5IT3A 4FHTA 3UR3C 3QAHA 4XSXF 2JJ7A 4BBRJ 5B3SH 5DTDA 4IOCF 2KDOA 3DP7A 3P7NA 4UUTA 4M3BA 2KKOA 3HPGA 4N9IA 3AL0C 1FT9A 5K7FA 1K7AA 2FQ4A 2YPRA 2PEXA 5B1BH 3R0JA 4G6TB 5L3FA 5KAIC 1U8BA 3WTVC 3PO3J 3V7RA 2NS8A 2BVLA 1RRJA 1FYKA 2VQLA 2X6OA 2R7ZJ 2RVCA 1OCZH 4S04A 2X51A 4F7ZA 1GT0C 3WTTC 4M3FA 3HTSB 1LKXA 4ZYDA 1B59A 4UHTA 2PMHA 1BIBA 2Y9ZA 4ZTJA 3O3KA 2X48A 3HDDA 3FXRA 1FBUA 1XCVA 2LG4A 3DFGA 2WA0A 4PFOA 4BEHA 4EM0B 5L3EA 3PJRA 4IHTA 2HR3A 3HEFA 1TC3C 3PNYA 4IO9F 3GZNB 2V26A 3GCMA 1D5VA 4ANJA 1IN6A 3BZ6A 3S8PA 4NHJA 3JRIA 3M4OJ 2XF6A 3GZ6A 1OR7A 2ZKZA 2CQXA 2VKHA 1YIJI 2HI3A 3FWEA 2WY8Q 1XMKA 2EFPA 1SMYF 3HOVJ 1H9TA 1OKRA 2RNJA 1QRYA 2QLZA 1C0WA 4DBQA 4CCKA 2CFOA 2QA4I 4BUPA 3SDGA 4CUGA 2GM4A 2O3FA 2PMZA 4M3GA 1FNNA 1IN7A 3OYEA 3VOEA 3LFKA 1XMAA 1GUUA 3RCOA 2BZTA 4A3MJ 5CJ9A 1MNMC 3DWLE 3I59B 3RPUD 2HEOA 2Z1DA 2DDAA 3MQ0A 5CLSA 2H09A 3RYRA 4DQ2A 4OINF 4I6ZA 2HWVA 5EZGA 1BOBA 4M6VA 4LLGF 1G3SA 4A5NA 3L2WA 3E5UA 1I27A 5ICCA 5M3FJ 1YRNA 3W6JB 1MZBA 2VLAA 2EQRA 2RQPA 1VNDA 2HVRA 1TLHB 3HHGA 1WGXA 1XN7A 2DFFA 1N25A 3R4KA 5F27A 1P4XA 1QU3A 3CC2I 4PJNA 1UHMA 1HBXG 3BJ6A 3ZQFA 1LUJB 1UZCA 2R4GA 1MBGA 1HKSA 2KMUA 4IRHA 4EJUA 1WJ5A 3U21A 4GDFA 2M7BA 2W7NA 3VSKA 2DU9A 4XKVA 4Q48A 4N9HA 3EYYA 4MFEA 1ZRCA 1R1UA 5D8KB 5E3MA 3WTYC 3CESA 2DA3A 4F93B 1LFBA 1XCBA 3IRQA 3G4SI 3ERED 2EH3A 3P9CA 3BROA 1Y0NA 4KA4A 3DEEA 1MBFA 5F0HA 4A0ZA 4K2EA 2BYVE 1FSEA 5E18F 4AC0A 5K5QA 3ZQHA 3RZDJ 3HRTA 2Y48A 5IOYA 1LVKA 2O8XA 3I4NJ 3F8NA 2ZO4A 2HNHA 5H6RA 4BQAA 4UB6C 1Z9CA 4BEHB 5FKLA 3FMQA 3PIOF 3BZKA 3M7GA 1X1AA 2P6SA 3Q0WA 3VDXA 3OS2A 2GBYA 2DA2A 5ICFA 3FK7A 3L2QA 3A0HC 2QEXI 2CSOA 2DA5A 4A69C 4CCJA 2W57A 4FT8A 1K4SA 2XPVA 3LL7A 3OYLA 4KIGA 1GV5A 3S93A 1CGPA 1B1BA 1R4MB 4C2TA 3ZPLA 1R9TJ 4H4KC 2GLOA 1AHDP 2JT1A 1W5CC 2NVQJ 2P81A 3EUAA 2NXNB 4C9YA 4CYCA 3A4CA 4L5IA 1ZRDA 3K4MA 4G6QA 3PIPF 1APLC 3CC4I 5D5UB 4ENJA 1TP4A 3RIRA 1E3OC 2W00A 2IBDA 3E1SA 3RYPA 1USTA 2V6EA 4QPOA 2EFWA 3FHZA 2ECBA 2CO5A 2F2EA 2VJIA 5HDGA 1ZTRA 4XRFA 1KYWA 3GLXA 1MMSA 3HC7A 5CVJA 3CDLA 2H27A 3D5RC 2Y30A 3CZ6A 1KGSA 1JTXA 4L9NA 4UV9A 4B43A 1QHGA 2GIZA 2XPUA 4HV5A 4F91B 4WF2A 3MKLA 3IV5A 3CP8A 4HNUA 1V55H 1SC7A 4RAYA 2HVQA 2ZNZA 1FMWA 2BY0A 3SEQA 1YRNB 4WXCA 1JKQC 1GLNA 1ZARA 2NS0A 4BS9A 2DQLA 1Z3YA 3QP6A 1MDMB 2VBYA 3FK6A 2BVMA 4E7JA 2M3AA 2C6YA 2A5WA 2E1MC 4IVNA 3OYBA 2BY3A 4OOIA 2ETHA 2DYSH 3KCCA 3ZQLA 2CG4A 2E1OA 1IRZA 1U78A 1EKEA 2KP6A 3TQNA 1JKRC 3BC8A 3WHCA 2FMLA 1XSDA 1J09A 4QSHA 2P5LC 1F4KA 1IRGA 3HJEA 3KEYA 4PSWA 1Z3XA 4WX9A 1R71A 3WE2A 5KHDA 4CYDA 4L9JA 2BGCA 2F5EA 1POGA 1XC5A 1UB9A 2BBYA 3RKWA 1O7LA 2LBFA 3I9V2 4HBLA 1BI1A 3NWTA 4I2OA 4LB6B 2DFEA 3ABKH 4RB3C 3OYKA 3W3CA 3TMOA 2WV1A 3HIFA 5ERIA 3DXJF 2UV1A 2XUBA 2RQQA 4G6DA 5LHIA 3IH3A 3ZCOA 1RKWA 1LDDA 3LSIA 3SHFA 5LHHA 4ESBA 1O3TA 1T6SA 1XX5A 4EGZA 1FX7A 4WK8F 2M87A 4I0AA 3C18A 4E6KG 5J1RA 2F5VA 4BACA 1YFHA 2PI0A 1TT5B 5BS6A 5IPAA 2IS2A 1O57A 2NOGA 3GUDA 3MAJA 4J19A 3D5LA 5FROA 4BJ6C 4HSRA 3BY6A 5GTHC 3IHUA 3BZCA 4IL6C 3FXLA 1WH5A 2E19A 3COAC 2XC7A 2L9RA 2XB0X 3M9AA 3DKXA 4NBQA 4RMNA 4CYCB 1NG6A 3Q0VA 4QIWN 3J81Z 1HF0A 3F8BA 3L1PA 4BHPA 3F22A 3QYEA 3ZXSA 4EM2A 3D1NI 2K40A 5F0FA 4A3JJ 2IVMA 4J00A 2DJIA 3JRAA 2K5CA 4LD5A 3A2KA 3VB2A 2P7CB 2FOKA 5HDNA 2W82A 4YIFA 1ETOA 2XGDA 3SYTA 4IQ4A 3TOAA 3F9KA 5K5OA 1NG7A 1WJDA 2OJED 3HBLA 1MGTA 4KICA 2BEOA 4RGSA 1YJNI 1VZ0A 1YTYA 2DMNA 1IDYA 2XGCA 1O3SA 2WY7Q 2DODA 4U87A 2ISYA 3AFHA 3IL2A 2R92J 1Y56A 3LSHA 4P5OA 5FLVA 4JX4A 3DTIA 4A3IJ 1YJWI 3S1RJ 1FIAA 2Z33A 4XNFA 1MMNA 1QPIA 9ANTA 4EQQA 2CV1A 1BC7C 4M3EA 2WAEA 1FBSA 2DI3A 4UVCA 3RPUA 1J9IA 4YELA 3QPLA 4KIBA 1XPXA 1IXCA 3IKVA 1X1DA 3I64A 1ZREA 3CJTB 3K2ZA 2P5VA 4HPQA 1BM9A 3K2AA 3Q9SA 3KYCB 1T08B 3QYBA 4Y3OA 3RTRA 3CCRI 1G59A 1TWHJ 4X0GA 2B63J 4XKCA 2LTPA 2E34A 2EZKA 2JUGA 2Q2EA 3S1MJ 4HG2A 3ERMA 2ESNA 2LBFB 2F4MB 2HXIA 4BJ5C 1ETKA 2H6BA 4MGRA 1KZHA 4L5EA 4D1QA 2XSDC 4A3CJ 3OYNA 3BR5A 4IHVA 2R7XA 2ZMEC 3OR1C 1WHUA 3KEQA 1T8IA 4ZDLA 2QSFX 4DZJA 4HAMA 4QLCU 2G7HA 1T98A 2KJBA 3O6BB 4LMYA 2CW8A 2WWYA 2OCCH 1PUEE 1SD4A 2JPBA 3H36A 4XLCA 1R58A 4DNCA 4DW6A 3WTXC 2B9SA 1JXSA 1Z6TA 3I54A 2CUZA 5D5VB 1UCRA 2IA2A 1UAAA 1ODDA 3K4JA 3HOTA 1N78A 3DLAA 4CDGA 4LLLA 4GFBA 3QPSA 1NK2P 4B1RA 4NC8A 3TEDA 4HRIA 2HYFA 1FZPB 4XM3A 4EJVA 2B7EA 3FMSA 4B48A 5GAEJ 1R6RA 4IZZA 2X1CA 1MJ9A 5B66C 2IGKA 4RB0A 3WGIA 2O5RA 4Q5SF 1KU3A 3SDBA 2A05A 3TOBA 3IH2A 2FEZA 3LA3A 2B0LA 2AO9A 5CQGA 1IF1A 1NTCA 3QODA 2A07F 2QUFA 3FM5A 3C1DA 2RNGA 1T56A 1WJBA 3CUQC 2FNAA 4MFDA 3LAJA 3BG5A 3V7SA 2PJRA 3HTUA 2VB6A 3S1QJ 1SFXA 1DQUA 1XMXA 4QWQA 2YS9A 5CQEA 1JE8A 4A3GJ 1LEBA 2HGCA 3F3XA 5HNFA 1TQPA 1IN5A 2MFZA 1K83J 2WAQN 1YQAA 2DYRH 3LSMA 1DP7P 1HA8A 2L4MA 2EZLA 2GXAA 4UUSA 2K86A 1S5LC 4D7MA 3LMMA 2R7OA 2L7MP 5C4JJ 3QP5A 3R0AA 2H8RA 1Q1HA 1ETWA 5HS7A 4LOCA 2DOAA 2LH9A 4S0HB 5KNLA 2Q2EB 5DCMA 1SFKA 2MC4A 3M8EA 4CHUA 4JQFA 2LMDA 4I7HA 4FASD 1WZ2A 2DJNA 4OU0A 3OIOA 1R00A 1V5FA 4O3MA 1R49A 3GLLA 1H0MA 4XRSA 3GTQJ 2FOWA 1RC9A 1UG0A 5DEQA 1HQCA 1MBEA 5L3BA 1TL8A 3BT9A 4IHYA 1PUFA 3CDIA 4IJAA 4LG0B 3LOCA 3CCVI 2YX4A 1RUNA 5IP7J 2DT6A 4IRIA 2Y75A 4BH9A 4RA2A 3EQLF 1IAWA 1DU0A 2JRTA 3PQJA 3ECHA 3HUGA 1VQ4I 3KP5A 1J59A 3OOUA 1A35A 2OUMA 3WODF 2F6CA 4KT5C 1R4NB 4MEXF 1OCPA 5ICEA 1IG7A 2HU9A 2R7SA 1JT0A 1XGOA 1ULYA 2VQCA 3KLOA 3VYRB 5LGNA 3GFIA 1KA8A 1OCCH 4Y15A 3DLLF 5BQTA 2F5DA 3HPHA 2HZTA 3HB9A 3JCUC 2TCTA 2FUG2 2IGMA 1GDTA 4X1EA 4GRIA 5AIPA 3W6KB 1VQ8I 2HOEA 1SD7A 4PJLA 1SVLA 3DU5A 1H8AC 2Y31A 3HKZN 1U5TC 1TWCJ 5GAGJ 5IP6A 5K7ZA 1W36C 2DPUA 2PJRB 4CSWA 3HOYJ 3JREA 3J80Z 3WG7H 3H5AA 4MNUA 2CRGA 2LKPA 4V2GA 5E79C 1QZYA 2HTSA 3TW6A 2DOEA 5F6FA 3Q0UA 3D0SA 2M30A 3PM1A 2VJJA 3CCYA 3W2VA 1NHAA 2QQ8A 2P7VB 3O8GA 3GVAA 3OYCA 2LD5A 3HGYA 4ITVA 1BJAA 2MGQA 1MJBA 2DAOA 4CCMA 4UUSB 2KIMA 2ME6A 4EJWA 5K1YA 2WAQA 3FBNB 3E6BA 3LSPA 2E7XA 2O7OA 2GZWA 1I50J 5DCMB 2KDZA 3LSKA 3PFYA 4KMUX 2NRAC 1OFCX 5BNGA 1A6IA 3AL0B 4JP0A 5BMZA 1SFUA 3FISA 4Y17A 4A3BJ 3FXMA 1V5GA 2FMYA 3S3MA 3K70D 1XB4A 3OWTA 5E1ZB 3PQKA 3CCMI 4OIRF 1FWZA 4PZJA 1A36A 1K4TA 2J5PA 1PUFB 1YI2I 1KQ9A 4HF1A 5GP9A 2OCEA 4A3KJ 1X3ZB 3H0GJ 5LLQA 5C3EJ 4HLXA 4YIRX 3E0JB 3CLOA 2A5YB 1Z7LA 2LSOA 3HRMA 4XKBA 2PQ8A 3K10A 3MZYA 2JSPA 1IDZA 5FKKA 5ED4A 3I4MJ 3HUGB 1YLFA 3BR6A 4GCVA 3R60A 4YFKF 3NRVA 1MNEA 1MBKA 4KJZA 2QBYA 3FM3A 1QVTA 3IWZA 1SAXA 1J0RA 2ACJA 2EZHA 2BHYA 3OIPA 4ABZA 4LJZF 1U0JA 1AU7A 1EJ9A 2Z16A 3ZP5A 3TKYA 1ENHA 5FD6A 1JT6A 2V9PA 1ZYRF 3QU3A 4CZZA 2VL8A 1EF4A 3K7AJ 2PN6A 3G1OA 4II3A 1IV6A 3BOQA 4KUMA 1OPCA 4I76A 3WU0A 5H6QA 1BN5A 4KITB 3OS1A 3BR3A 3M07A 2VJ5A 1T39A 1FP1D 4L9VA 2CV2A 3D5SC 3U1KA 1S29A 2LLKA 4XBFA 1ZLJA 1D8JA 5DS9A 3GTLJ 2OU2A 1LDKB 1IN4A 3F6OA 4FQGA 4U7DA 4JX5A 1MMAA 1G3WA 1JUSA 4E4HA 4QPQA 2M8GX 1RESA 4ZYGA 4LIUA 2HVSA 2I8DA 1I5ZA 2QQ9A 2HS5A 1ZGJA 1VFCA 2R3SA 1JKPC 1ZQ3P 5C4XJ 1YW8A 3HKZA 4L0ZB 2QGUA 1TWGJ 2CQQA 4EGYA 1B9NA 3DF8A 3NAUA 1GVDA 3T0YA 1WJCA 1YIOA 3ZRGA 5ILUA 2CW7A 2R5ZA 4PCQA 1QZEA 1J5YA 4L18B 4RGUA 4U0WA 4E7LA 2ZJ2A 1X3WB 4XRMA 5HS8A 2HDCA 4J01A 3N05A 1TQMA 4M9SA 3S3NA 1XS9A 1R23A 2MABA 2NVXJ 3K6GA 5D4RA 3OL3A 3BTLA 4C3HJ 1YYVA 4HX8A 4I98B 2DFIA 3QYFA 1XDSA 1EH7A 1VQKI 4HZFA 4EJTA 4UY8I 1YOVB 5B5EC 1STZA 4A6EA 2VBXA 4XOTA 4F3QA 1TBXA 3V8LA 1ETQA 5CVVA 1D0ZA 4LK1F 3S2WA 4KISA 3NQOA 1W7PD 3A01B 3PSIA 3BTJA 4HX7A 5L3GA 4Y33A 4ZJZA 4L9TA 3CO6C 3E6CC 3IP4B 4PJJA 4IHXA 4DYRA 2VPLA 5KVRA 2TDXA 2G7UA 3KZYA 4JYKA 5GPAA 2V9KA 1P92A
chains in the Genus database with same CATH topology
3B02A 3T1BA 4WWCA 1MDMA 2IP2A 3EYIA 1I6XA 1IXSB 1R1TA 5J6XA 1QZZA 5FLXK 4M6YA 4OMYA 2PG4A 3FF5A 2QBYB 1HW1A 1HW5A 2P5KA 1RIOH 2H6CA 2QWWA 2DK5A 4YG2F 1S6LA 3E5QA 4WXDA 2VE9A 2PJPA 4PGHA 2E1CA 3VFZA 5FLXZ 3K9TA 1PP8F 3I71A 2ISZA 3R61A 4BHCA 1KQ0A 5FFXA 4ZYHA 3K0LA 4GYIA 4I01A 2X4HA 2DTRA 5JI6A 4ESJA 5F64A 4O5VA 1ONVA 1RNLA 1REPC 4P96A 2KIUA 4IHSA 2Z3YA 2VONA 3BWGA 4LLNA 2MA3A 1J7KA 3E97A 4UUVA 2L4AA 3JSPA 2EFQA 3K1MA 1DDNA 1KU9A 1SD5A 1OYIA 4E70A 1U8RA 3LQRA 2M8EA 6PAXA 4WXHA 1AWCA 4Z2YA 4IF4A 3V8KA 2NYXA 1SD6A 1O3QA 2MBFA 2KRFA 1W5SA 3GW2A 4I02A 4M74A 4HDVA 1ZGAA 4JK1X 1G3YA 2ZMEA 5DDGA 2MC3A 4UVBA 4R8HA 1V4RA 4MQVA 5HOOA 3I58A 5AIQA 3WTZA 2QYOA 4A0YA 2L54A 2BV6A 2FXAA 4UXNA 1HSTA 1XSVA 3KP4A 2OZUA 5K5RA 4P55A 3F23A 2UXXA 1Y0UA 2ZCWA 3EDPA 4HQEA 1IW7F 4GO1A 3HYIA 2F5CA 2ELHA 1P2FA 2Z5UA 4B8XA 2KJCA 2DPDA 2W24A 1B9MA 5FO5A 4A2UA 2YR2A 3J81K 2GIVA 3CUQA 1VTNC 2MD5A 1YS6A 4HQMA 5D6FA 4CICA 1HXDA 2ZBKA 1BIAA 1K78B 5J8CA 3L00A 4G7HF 2JPCA 3MCZA 1S8NA 4AIKA 4KN4X 2MH9A 3V4GA 1FYLA 1EH8A 1IN8A 5LEJA 2VOOA 2A6HF 4ON0A 3L7WA 1LQ1A 2ZMEB 3GX4X 3SZTA 3WTWC 3DKWA 3RJPA 2O0YA 3WG9A 3MZHA 1J2XA 2M5WA 1W7PA 2VT2A 1WKMA 1B6AA 5HLIA 3KETA 1WRJA 3ZN0A 3DQVC 2VT3A 2R7DA 4A5MA 2DK8A 1ZHFA 2P6TA 4A12A 4IRGA 3CTAA 3N4MA 5LRSA 4YFNF 4HOBA 1OMIA 1SFEA 1LVAA 1D8KA 5E1WA 4XLNF 4FX4A 5ICGA 1TNSA 3I4PA 4LG0A 2EV5A 2COMA 1BC8C 1SMTA 1H9GA 3GYHX 3CUQB 4EVIA 4HLYA 4GXOA 3AAFA 1I1GA 1ZG3A 4YFXF 4ZZLA 1R22A 3WE3A 2L3DA 1KQ8A 3I0TA 3HSFA 2V6CA 1FY7A 2ADUA 2ZNYA 5HS9A 4M9ZA 2WV0A 2XV4S 2HFHA 1Z6RA 5DYMA 5ILVA 3TGNA 3REOA 1L0OC 4NB5A 4RAZA 2XGXA 3KEOA 3M8FA 5FD5A 1OYWA 2FA5A 2K7LA 1FP2A 1ON1A 1P4WA 1JHFA 4RB1A 1Z91A 4P9UA 3BP8A 3P9KA 3GZ5A 4A0XA 2H94A 1W7PB 1K79A 1RUOA 1IUYA 2A61A 1IZ1A 2ZXJA 3LA2A 1YW7A 3IKTA 3ISPA 5EEGA 2L02A 2GA2A 1FOKA 2A3SA 3RDIA 2QZ8A 2RGVA 3H92A 5CYVA 1L3LA 3QPTA 3Q9VA 5CVUA 2D1HA 2F5FA 4BXUA 2X0LA 2VXZA 3J7AO 1XGNA 5E8GA 1U5TB 1R1VA 2VE8A 2FNPA 2IT0A 3HRSA 2FBHA 5CVRA 1G3TA 5LGTA 5BPDA 3U1DA 1USSA 4H0EA 3QPHA 1F5TA 2YX7A 1DPUA 3KP6A 2XRNA 3E3VA 3JSOA 3JAMZ 3J80K 1TW2A 4HDUA 3BPVA 2A69F 1OYYA 1Z1DA 2OBPA 2D2WA 3WU1B 3ELKA 2RV8A 3V8JA 3MEXA 1XGSA 4UV8A 5A2QZ 3T5XA 3BDDA 4ESFA 1FPQA 5E8IA 2XVCA 1YO5C 4XLPF 5LEKA 5IT9K 3BJOA 3JW4A 4NQWA 4ZH4F 2P8TA 3L2CA 4U88A 2MLGA 2GXBA 5IT9Z 1GHCA 3F21A 3KE2A 2STTA 4D0PA 2MLKA 3LAPA 4G94A 4S05A 3ECOA 3LSTA 2XAFA 4AWXB 4ETSA 3FZVA 1P6RA 2OA4A 3FX3A 2V1UA 2JZYA 2W85A 1QGPA 2XAQA 2GAUA 3WGHA 4PGGA 3NEUA 5DUKA 2JTVA 4M72A 3R6SA 3O2PE 3G3ZA 1HSJA 2EK5A 4YIIA 1WQ2A 3QRFF 3GWZA 3ZMVA 2UXNA 1EH6A 2M1BA 1XSXA 5CVIA 3T8RA 1Z05A 1ZLKA 4I0BA 3I53A 1QNTA 4HF2A 2O61A 4MTEA 4G8XA 1BOAA 1R5GA 3LA7A 4IPAA 2L01A 3ZN1A 3F6VA 5F1RA 2XHKA 2A68F 3WTSC 5LRRA 2RC4A 2HTJA 4OIOF 1A04A 2IJLA 4Y13A 1WSUA 4U7BA 5BOXA 2VBWA 3V7CA 3TO6A 3F8CA 1TNTA 2XASA 5FB2A 4KMFA 3F8FA 1RI7A 3CO7C 4CXFA 5JFRA 3F72A 4ENMA 3TO7A 1XGMA 5DV5A 3JTHA 3B73A 2PMUA 4OMZA 2FQ3A 4A6DA 1X3UA 2JSCA 2HQRA 2QQBA 3RI4A 2VC1A 2CQKA 3BPXA 2EWNA 1RZ4A 2FU4A 2ZFWA 1ON2A 4JBAA 1V3FA 3F8MA 2BE5F 2GA1A 4MQ9F 2OQGA 4MTDA 5E17F 4KNYA 3GXOA 3CJNA 1K6OA 1ZAOA 1R7JA 1YS7A 2HKOA 2XKPA 3TO9A 1CF7A 5HLHA 2E1NA 1E17A 5EEHA 1KU7A 4PDKA 1LB2A 4KN7X 4KDPA 3HRUA 3BJAA 3ZMUA 3KZZA 4LFUA 1MJAA 3IC7A 2YU3A 1IXRC 3DV8A 3I5UA 2EA4A 2VODA 1T38A 1FC3A 3DPLC 3RKXA 3ULQB 3WGGA 1K78A 4I09A 4ZZDA 5HVQC 1WI9A 5FFZA 3WTUC 2EV0A 3M1EA 3U9GA 4OIPF 2QVOA 4GYGA 4EV0A 2O6GE 1I1SA 4L0YB 3ABTA 1EV7A 4AD9A 2FSWA 1YG2A 3E6MA 5KK1A 1QBJA 2W84A 4HYEA 5HDKA 2HQNA 1AOYA 1S7AA 2Q0OA 1XD7A 4CGZA 1ZG1A 3SQNA 2CGPA 1TTYA 1ZRFA 2QQAA 5D5XB 1LJ9A 3LWFA 5TRDA 4BNCA 4TV7A 2OZ6A 2VC0A 2OAZA 3OOPA 2XIGA 2LF7A 3HSEA 1PDNC 5JHUA 3CDHA 1CF7B 2RDPA 3T8TA 5D5WB 1KU2A 2RKHA 2FF4A 4O6JA 2EB7A 1O7FA 3MFKA 2Z99A 3HHHA 4HV6A 2VOPA 2P4WA 2D45A 4CO8A 3FXUA 2UZKA 4HF0A 3H3UA 2FBKA 4R79A 3ROUA 1G4DA 1W4MA 1BI0A 4ENNA 3VEPA 2XKOA 4MHGA 5FGMA 3K1PA 1GXPA 1LEAA 2DW4A 5BPIA 2CFXA 3IRRA 3E6DA 5E1XA 4M9XA 1D3YA 4AVPA 2K27A 2NNYA 2A6EF 3SZPA 1ZH5A 1R5HA 1LNWA 4XSZF 4EMSA 2EV6A 4RS8A 4Q47A 3HOSA 4OIQF 1BBYA 4HW0A 4MEYF 1FSHA 3ZMZA 3K69A 4BAYA 3ZMDA 2D1VA 2EFOA 4UVAA 2R7FA 5DCFA 4RGXA 4GGGA 4ZYEA 3PFIA 5LHGA 4FX0A 1E2XA 3ZMSA 3Q5FA 1U3EM 3VODA 5D6EA 2LF8A 5DUIA 2EA2A 2OD5A 5ILSA 2WC2A 2K02A 4KIFA 3U2RA 4WCGA 3OV8A 3FMRA 4P9FA 2V1XA 4G9YA 4RGRA 4M73A 4ASNA 1U5TA 2XROA 3CUOA 5AONA 3G73A 2GWRA 4AIHA 2K4JA 2IRFG 3KLNA 2DLLA 1ZN2A 2M45A 5LGUA 1S7OA 4N0BA 1UFMA 3GFMA 1U6GA 2Z9OA 1T0FA 4M6XA 1R36A 1TW3A 2XAHA 1DUXC 1HKTA 4LK0F 5D4SA 2LDUA 3EUHA 4HA8A 5D8LB 5JVTA 2YSRA 1F1ZA 1U2WA 5E20A 2VN2A 1UHWA 2VBZA 3SXYA 2CW0F 2EFNA 4HX4A 3DEUA 4KYWA 2STWA 1IRFA 2IA0A 1FYMA 3GO5A 4Q4ZF 2CYYA 3EETA 4UNOA 2IA1A 2QENA 3GF2A 2PFBA 3RPQA 1KYZA 2G9WA 3L09A 4AIJA 3GFLA 1HKQA 5JR3A 2HYGD 1LDJA 3KP2A 1O3RA 4EJOA 2AS5F 2IW5A 2DT5A 1PP7U 5J8FA 3QU6A 3C7JA 4EM1A 2MH2A 2PBIA 3ZQ7A 3MWMA 4IXAA 1QQIA 3HSRA 3L9FA 3KP3A 3JAMK 3P9IA 1Z7UA 3FXQA 2W25A 2IPQX 3TDZC 2NAZA 3E5XA 2V79A 3QOPA 3IWFA 5DD8A 1T2KA 1S3JA 4G7OF 2AXLA 5HLGA 2FBIA 1TQIA 4LB5A 2J5OA 2O03A 5A2QK 3TDUC 2E7WA 3RKYA 1HW2A 1YW9A 4B09A 5LBQA 2WTEA 2QM3A 3ZMTA 3C3WA 2EJRA 2NNNA 1FLIA 1BI3A 1JHHA 5TJJA 2V1DA 2GQQA 1JGSA 2FRHA 4M71A 4R1HA 1QPMA 4BYYA 2DBBA 2CWEA 1BI2A 4U0VA 2Q8KA 3DPTA 2DO7A 4U0YA 1GVJA 2HKXA 3LQQA 1B4AA 2RN7A 1F9NA 3ML6A 1ZG5A 2PLYA 5DD4A 1W5TA 1DPRA 2XAGA 2KIFA 3GFJA 4ENKA 2V9VA 2Y0MA 1J75A 4BHBA 5L3DA 1MKMA 1G6NA 1FBQA 1QO0D 2OQRA 5L3CA 1MD0A 3JTGA 4G7ZF 4L5JA 2FE3A 2GXGA 4LGWA 3I59A 3K1NA 4KFCA 3N97A 2ESHA 1GXQA 1XDUA 2DQRA 3KP7A 3ABUA 3KFWX 4RB2C 1P4AA 2XAJA 1WWXA 3SFZA 2K4BA 5H20A 2LNBA 3GEZA 2UWMA 3H3ZA 5IT3A 4FHTA 3QAHA 4XSXF 3DP7A 3P7NA 2KKOA 4N9IA 1FT9A 1K7AA 2YPRA 2PEXA 3R0JA 5L3FA 3WTVC 3V7RA 1FYKA 2RVCA 4S04A 4F7ZA 3WTTC 3HTSB 4ZYDA 1B59A 4UHTA 2PMHA 1BIBA 3O3KA 3FXRA 1FBUA 1XCVA 3DFGA 4EM0B 5L3EA 4IHTA 2HR3A 1D5VA 1IN6A 3BZ6A 4NHJA 3GZ6A 1OR7A 2ZKZA 3FWEA 1XMKA 2EFPA 1SMYF 1H9TA 1OKRA 2RNJA 2QLZA 1C0WA 2O3FA 1FNNA 1IN7A 3VOEA 3LFKA 1XMAA 5CJ9A 3I59B 2HEOA 3MQ0A 5CLSA 2H09A 3RYRA 4DQ2A 4OINF 2HWVA 4LLGF 1G3SA 4A5NA 3E5UA 1I27A 5ICCA 3W6JB 1MZBA 2RQPA 1TLHB 3HHGA 1XN7A 3R4KA 1P4XA 1UHMA 1HBXG 3BJ6A 1HKSA 4IRHA 4EJUA 2DU9A 4Q48A 4N9HA 3EYYA 1ZRCA 1R1UA 5D8KB 3WTYC 1XCBA 3IRQA 3ERED 3P9CA 3BROA 4KA4A 4A0ZA 4K2EA 2BYVE 1FSEA 5E18F 5K5QA 3HRTA 2Y48A 2O8XA 3F8NA 2ZO4A 5H6RA 4BQAA 1Z9CA 3FMQA 3M7GA 2P6SA 5ICFA 2CSOA 2W57A 4FT8A 4KIGA 1CGPA 1B1BA 3ZPLA 2JT1A 4L5IA 1ZRDA 4G6QA 5D5UB 4ENJA 3RIRA 3RYPA 1USTA 2EFWA 3FHZA 2CO5A 2F2EA 5HDGA 4XRFA 1KYWA 3GLXA 5CVJA 2H27A 4L9NA 1KGSA 4UV9A 4HV5A 4WF2A 4RAYA 2ZNZA 4WXCA 1ZARA 2NS0A 2DQLA 3QP6A 1MDMB 2VBYA 2C6YA 4IVNA 4OOIA 2ETHA 3KCCA 2CG4A 1U78A 3TQNA 2FMLA 1XSDA 2P5LC 1F4KA 1IRGA 4WX9A 3WE2A 4CYDA 4L9JA 2BGCA 2F5EA 1UB9A 2BBYA 3RKWA 1O7LA 4HBLA 1BI1A 4I2OA 4LB6B 4RB3C 3HIFA 5ERIA 3DXJF 2XUBA 4G6DA 5LHIA 1LDDA 3SHFA 5LHHA 4ESBA 1O3TA 1T6SA 4EGZA 1FX7A 4WK8F 2M87A 4I0AA 3C18A 1YFHA 2PI0A 5BS6A 1O57A 3GUDA 3MAJA 3D5LA 3BY6A 3IHUA 3COAC 3M9AA 3J81Z 3F8BA 4BHPA 3F22A 4EM2A 2IVMA 4LD5A 3VB2A 2P7CB 2FOKA 5HDNA 4YIFA 3TOAA 5K5OA 1MGTA 4KICA 2BEOA 4RGSA 1YTYA 1O3SA 2ISYA 3IL2A 4P5OA 2Z33A 4EQQA 1BC7C 1FBSA 2DI3A 4UVCA 3RPUA 1J9IA 4KIBA 1IXCA 3IKVA 3I64A 1ZREA 3K2ZA 2P5VA 1BM9A 3Q9SA 3RTRA 2Q2EA 2ESNA 2H6BA 4MGRA 3KEQA 4QLCU 4HAMA 2G7HA 1T98A 2KJBA 3O6BB 4LMYA 2WWYA 1PUEE 1SD4A 2JPBA 4DNCA 1R58A 3WTXC 1JXSA 1Z6TA 3I54A 5D5VB 1UCRA 2IA2A 1ODDA 3HOTA 4CDGA 4LLLA 2HYFA 1FZPB 4EJVA 3FMSA 1MJ9A 4RB0A 3WGIA 4Q5SF 1KU3A 3TOBA 2FEZA 3LA3A 2B0LA 1IF1A 2A07F 2QUFA 3FM5A 3C1DA 3CUQC 2FNAA 3LAJA 3V7SA 3HTUA 1SFXA 4QWQA 1JE8A 1LEBA 2HGCA 3F3XA 1TQPA 1IN5A 1YQAA 1DP7P 2L4MA 2K86A 3QP5A 3R0AA 1Q1HA 5HS7A 5DCMA 3M8EA 4CHUA 4JQFA 4I7HA 4OU0A 1R00A 4O3MA 1H0MA 5DEQA 1HQCA 5L3BA 4LG0B 4IJAA 2YX4A 1RUNA 4IRIA 2Y75A 4BH9A 3EQLF 1IAWA 2JRTA 3PQJA 3ECHA 3HUGA 3KP5A 1J59A 3WODF 4KT5C 4MEXF 5ICEA 1XGOA 1ULYA 3KLOA 5LGNA 3GFIA 1KA8A 4Y15A 5BQTA 2F5DA 2HZTA 3W6KB 5AIPA 2HOEA 1SD7A 1U5TC 2DPUA 3J80Z 4MNUA 2LKPA 1QZYA 2HTSA 5F6FA 3D0SA 2M30A 1NHAA 2P7VB 3GVAA 1BJAA 1MJBA 2DAOA 2KIMA 4EJWA 5K1YA 3E6BA 2E7XA 2GZWA 5DCMB 4KMUX 2NRAC 5BMZA 1SFUA 4Y17A 2FMYA 1XB4A 5E1ZB 3PQKA 4OIRF 1FWZA 4PZJA 2J5PA 1KQ9A 4HF1A 5LLQA 4HLXA 3HRMA 3CLOA 2A5YB 2LSOA 2PQ8A 3MZYA 5ED4A 1YLFA 4GCVA 3R60A 4YFKF 3NRVA 2QBYA 3FM3A 3IWZA 1SAXA 1J0RA 2ACJA 4LJZF 3ZP5A 3TKYA 5FD6A 1ZYRF 3QU3A 4CZZA 2PN6A 3BOQA 4KUMA 1OPCA 3WU0A 5H6QA 1BN5A 1T39A 1FP1D 4L9VA 1S29A 4XBFA 1ZLJA 1D8JA 2OU2A 1LDKB 1IN4A 3F6OA 4U7DA 1G3WA 4ZYGA 1I5ZA 2QQ9A 2HS5A 1ZGJA 2R3SA 1YW8A 4L0ZB 4EGYA 1B9NA 3DF8A 3T0YA 1YIOA 5ILUA 4PCQA 1J5YA 4L18B 4RGUA 4U0WA 2ZJ2A 5HS8A 2HDCA 1TQMA 4M9SA 1R23A 5D4RA 1YYVA 4HX8A 4I98B 2DFIA 1XDSA 1EH7A 4HZFA 4EJTA 1STZA 4A6EA 2VBXA 1TBXA 3V8LA 5CVVA 3S2WA 4LK1F 3NQOA 1W7PD 4HX7A 5L3GA 4L9TA 3CO6C 3E6CC 5KVRA 2TDXA 2G7UA 3KZYA 1P92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B02 A;  3T1B A;  4WWC A;  1MDM A;  2IP2 A;  3EYI A;  1I6X A;  1IXS B;  1R1T A;  5J6X A;  1QZZ A;  5FLX K;  4M6Y A;  4OMY A;  2PG4 A;  3FF5 A;  2QBY B;  1HW1 A;  1HW5 A;  2P5K A;  1RIO H;  2H6C A;  2QWW A;  2DK5 A;  4YG2 F;  1S6L A;  3E5Q A;  4WXD A;  2VE9 A;  2PJP A;  4PGH A;  2E1C A;  3VFZ A;  5FLX Z;  3K9T A;  1PP8 F;  3I71 A;  2ISZ A;  3R61 A;  4BHC A;  1KQ0 A;  5FFX A;  4ZYH A;  3K0L A;  4GYI A;  4I01 A;  2X4H A;  2DTR A;  5JI6 A;  4ESJ A;  5F64 A;  4O5V A;  1ONV A;  1RNL A;  1REP C;  4P96 A;  2KIU A;  4IHS A;  2Z3Y A;  2VON A;  3BWG A;  4LLN A;  2MA3 A;  1J7K A;  3E97 A;  4UUV A;  2L4A A;  3JSP A;  2EFQ A;  3K1M A;  1DDN A;  1KU9 A;  1SD5 A;  1OYI A;  4E70 A;  1U8R A;  3LQR A;  2M8E A;  6PAX A;  4WXH A;  1AWC A;  4Z2Y A;  4IF4 A;  3V8K A;  2NYX A;  1SD6 A;  1O3Q A;  2MBF A;  2KRF A;  1W5S A;  3GW2 A;  4I02 A;  4M74 A;  4HDV A;  1ZGA A;  4JK1 X;  1G3Y A;  2ZME A;  5DDG A;  2MC3 A;  4UVB A;  4R8H A;  1V4R A;  4MQV A;  5HOO A;  3I58 A;  5AIQ A;  3WTZ A;  2QYO A;  4A0Y A;  2L54 A;  2BV6 A;  2FXA A;  4UXN A;  1HST A;  1XSV A;  3KP4 A;  2OZU A;  5K5R A;  4P55 A;  3F23 A;  2UXX A;  1Y0U A;  2ZCW A;  3EDP A;  4HQE A;  1IW7 F;  4GO1 A;  3HYI A;  2F5C A;  2ELH A;  1P2F A;  2Z5U A;  4B8X A;  2KJC A;  2DPD A;  2W24 A;  1B9M A;  5FO5 A;  4A2U A;  2YR2 A;  3J81 K;  2GIV A;  3CUQ A;  1VTN C;  2MD5 A;  1YS6 A;  4HQM A;  5D6F A;  4CIC A;  1HXD A;  2ZBK A;  1BIA A;  1K78 B;  5J8C A;  3L00 A;  4G7H F;  2JPC A;  3MCZ A;  1S8N A;  4AIK A;  4KN4 X;  2MH9 A;  3V4G A;  1FYL A;  1EH8 A;  1IN8 A;  5LEJ A;  2VOO A;  2A6H F;  4ON0 A;  3L7W A;  1LQ1 A;  2ZME B;  3GX4 X;  3SZT A;  3WTW C;  3DKW A;  3RJP A;  2O0Y A;  3WG9 A;  3MZH A;  1J2X A;  2M5W A;  1W7P A;  2VT2 A;  1WKM A;  1B6A A;  5HLI A;  3KET A;  1WRJ A;  3ZN0 A;  3DQV C;  2VT3 A;  2R7D A;  4A5M A;  2DK8 A;  1ZHF A;  2P6T A;  4A12 A;  4IRG A;  3CTA A;  3N4M A;  5LRS A;  4YFN F;  4HOB A;  1OMI A;  1SFE A;  1LVA A;  1D8K A;  5E1W A;  4XLN F;  4FX4 A;  5ICG A;  1TNS A;  3I4P A;  4LG0 A;  2EV5 A;  2COM A;  1BC8 C;  1SMT A;  1H9G A;  3GYH X;  3CUQ B;  4EVI A;  4HLY A;  4GXO A;  3AAF A;  1I1G A;  1ZG3 A;  4YFX F;  4ZZL A;  1R22 A;  3WE3 A;  2L3D A;  1KQ8 A;  3I0T A;  3HSF A;  2V6C A;  1FY7 A;  2ADU A;  2ZNY A;  5HS9 A;  4M9Z A;  2WV0 A;  2XV4 S;  2HFH A;  1Z6R A;  5DYM A;  5ILV A;  3TGN A;  3REO A;  1L0O C;  4NB5 A;  4RAZ A;  2XGX A;  3KEO A;  3M8F A;  5FD5 A;  1OYW A;  2FA5 A;  2K7L A;  1FP2 A;  1ON1 A;  1P4W A;  1JHF A;  4RB1 A;  1Z91 A;  4P9U A;  3BP8 A;  3P9K A;  3GZ5 A;  4A0X A;  2H94 A;  1W7P B;  1K79 A;  1RUO A;  1IUY A;  2A61 A;  1IZ1 A;  2ZXJ A;  3LA2 A;  1YW7 A;  3IKT A;  3ISP A;  5EEG A;  2L02 A;  2GA2 A;  1FOK A;  2A3S A;  3RDI A;  2QZ8 A;  2RGV A;  3H92 A;  5CYV A;  1L3L A;  3QPT A;  3Q9V A;  5CVU A;  2D1H A;  2F5F A;  4BXU A;  2X0L A;  2VXZ A;  3J7A O;  1XGN A;  5E8G A;  1U5T B;  1R1V A;  2VE8 A;  2FNP A;  2IT0 A;  3HRS A;  2FBH A;  5CVR A;  1G3T A;  5LGT A;  5BPD A;  3U1D A;  1USS A;  4H0E A;  3QPH A;  1F5T A;  2YX7 A;  1DPU A;  3KP6 A;  2XRN A;  3E3V A;  3JSO A;  3JAM Z;  3J80 K;  1TW2 A;  4HDU A;  3BPV A;  2A69 F;  1OYY A;  1Z1D A;  2OBP A;  2D2W A;  3WU1 B;  3ELK A;  2RV8 A;  3V8J A;  3MEX A;  1XGS A;  4UV8 A;  5A2Q Z;  3T5X A;  3BDD A;  4ESF A;  1FPQ A;  5E8I A;  2XVC A;  1YO5 C;  4XLP F;  5LEK A;  5IT9 K;  3BJO A;  3JW4 A;  4NQW A;  4ZH4 F;  2P8T A;  3L2C A;  4U88 A;  2MLG A;  2GXB A;  5IT9 Z;  1GHC A;  3F21 A;  3KE2 A;  2STT A;  4D0P A;  2MLK A;  3LAP A;  4G94 A;  4S05 A;  3ECO A;  3LST A;  2XAF A;  4AWX B;  4ETS A;  3FZV A;  1P6R A;  2OA4 A;  3FX3 A;  2V1U A;  2JZY A;  2W85 A;  1QGP A;  2XAQ A;  2GAU A;  3WGH A;  4PGG A;  3NEU A;  5DUK A;  2JTV A;  4M72 A;  3R6S A;  3O2P E;  3G3Z A;  1HSJ A;  2EK5 A;  4YII A;  1WQ2 A;  3QRF F;  3GWZ A;  3ZMV A;  2UXN A;  1EH6 A;  2M1B A;  1XSX A;  5CVI A;  3T8R A;  1Z05 A;  1ZLK A;  4I0B A;  3I53 A;  1QNT A;  4HF2 A;  2O61 A;  4MTE A;  4G8X A;  1BOA A;  1R5G A;  3LA7 A;  4IPA A;  2L01 A;  3ZN1 A;  3F6V A;  5F1R A;  2XHK A;  2A68 F;  3WTS C;  5LRR A;  2RC4 A;  2HTJ A;  4OIO F;  1A04 A;  2IJL A;  4Y13 A;  1WSU A;  4U7B A;  5BOX A;  2VBW A;  3V7C A;  3TO6 A;  3F8C A;  1TNT A;  2XAS A;  5FB2 A;  4KMF A;  3F8F A;  1RI7 A;  3CO7 C;  4CXF A;  5JFR A;  3F72 A;  4ENM A;  3TO7 A;  1XGM A;  5DV5 A;  3JTH A;  3B73 A;  2PMU A;  4OMZ A;  2FQ3 A;  4A6D A;  1X3U A;  2JSC A;  2HQR A;  2QQB A;  3RI4 A;  2VC1 A;  2CQK A;  3BPX A;  2EWN A;  1RZ4 A;  2FU4 A;  2ZFW A;  1ON2 A;  4JBA A;  1V3F A;  3F8M A;  2BE5 F;  2GA1 A;  4MQ9 F;  2OQG A;  4MTD A;  5E17 F;  4KNY A;  3GXO A;  3CJN A;  1K6O A;  1ZAO A;  1R7J A;  1YS7 A;  2HKO A;  2XKP A;  3TO9 A;  1CF7 A;  5HLH A;  2E1N A;  1E17 A;  5EEH A;  1KU7 A;  4PDK A;  1LB2 A;  4KN7 X;  4KDP A;  3HRU A;  3BJA A;  3ZMU A;  3KZZ A;  4LFU A;  1MJA A;  3IC7 A;  2YU3 A;  1IXR C;  3DV8 A;  3I5U A;  2EA4 A;  2VOD A;  1T38 A;  1FC3 A;  3DPL C;  3RKX A;  3ULQ B;  3WGG A;  1K78 A;  4I09 A;  4ZZD A;  5HVQ C;  1WI9 A;  5FFZ A;  3WTU C;  2EV0 A;  3M1E A;  3U9G A;  4OIP F;  2QVO A;  4GYG A;  4EV0 A;  2O6G E;  1I1S A;  4L0Y B;  3ABT A;  1EV7 A;  4AD9 A;  2FSW A;  1YG2 A;  3E6M A;  5KK1 A;  1QBJ A;  2W84 A;  4HYE A;  5HDK A;  2HQN A;  1AOY A;  1S7A A;  2Q0O A;  1XD7 A;  4CGZ A;  1ZG1 A;  3SQN A;  2CGP A;  1TTY A;  1ZRF A;  2QQA A;  5D5X B;  1LJ9 A;  3LWF A;  5TRD A;  4BNC A;  4TV7 A;  2OZ6 A;  2VC0 A;  2OAZ A;  3OOP A;  2XIG A;  2LF7 A;  3HSE A;  1PDN C;  5JHU A;  3CDH A;  1CF7 B;  2RDP A;  3T8T A;  5D5W B;  1KU2 A;  2RKH A;  2FF4 A;  4O6J A;  2EB7 A;  1O7F A;  3MFK A;  2Z99 A;  3HHH A;  4HV6 A;  2VOP A;  2P4W A;  2D45 A;  4CO8 A;  3FXU A;  2UZK A;  4HF0 A;  3H3U A;  2FBK A;  4R79 A;  3ROU A;  1G4D A;  1W4M A;  1BI0 A;  4ENN A;  3VEP A;  2XKO A;  4MHG A;  5FGM A;  3K1P A;  1GXP A;  1LEA A;  2DW4 A;  5BPI A;  2CFX A;  3IRR A;  3E6D A;  5E1X A;  4M9X A;  1D3Y A;  4AVP A;  2K27 A;  2NNY A;  2A6E F;  3SZP A;  1ZH5 A;  1R5H A;  1LNW A;  4XSZ F;  4EMS A;  2EV6 A;  4RS8 A;  4Q47 A;  3HOS A;  4OIQ F;  1BBY A;  4HW0 A;  4MEY F;  1FSH A;  3ZMZ A;  3K69 A;  4BAY A;  3ZMD A;  2D1V A;  2EFO A;  4UVA A;  2R7F A;  5DCF A;  4RGX A;  4GGG A;  4ZYE A;  3PFI A;  5LHG A;  4FX0 A;  1E2X A;  3ZMS A;  3Q5F A;  1U3E M;  3VOD A;  5D6E A;  2LF8 A;  5DUI A;  2EA2 A;  2OD5 A;  5ILS A;  2WC2 A;  2K02 A;  4KIF A;  3U2R A;  4WCG A;  3OV8 A;  3FMR A;  4P9F A;  2V1X A;  4G9Y A;  4RGR A;  4M73 A;  4ASN A;  1U5T A;  2XRO A;  3CUO A;  5AON A;  3G73 A;  2GWR A;  4AIH A;  2K4J A;  2IRF G;  3KLN A;  2DLL A;  1ZN2 A;  2M45 A;  5LGU A;  1S7O A;  4N0B A;  1UFM A;  3GFM A;  1U6G A;  2Z9O A;  1T0F A;  4M6X A;  1R36 A;  1TW3 A;  2XAH A;  1DUX C;  1HKT A;  4LK0 F;  5D4S A;  2LDU A;  3EUH A;  4HA8 A;  5D8L B;  5JVT A;  2YSR A;  1F1Z A;  1U2W A;  5E20 A;  2VN2 A;  1UHW A;  2VBZ A;  3SXY A;  2CW0 F;  2EFN A;  4HX4 A;  3DEU A;  4KYW A;  2STW A;  1IRF A;  2IA0 A;  1FYM A;  3GO5 A;  4Q4Z F;  2CYY A;  3EET A;  4UNO A;  2IA1 A;  2QEN A;  3GF2 A;  2PFB A;  3RPQ A;  1KYZ A;  2G9W A;  3L09 A;  4AIJ A;  3GFL A;  1HKQ A;  5JR3 A;  2HYG D;  1LDJ A;  3KP2 A;  1O3R A;  4EJO A;  2AS5 F;  2IW5 A;  2DT5 A;  1PP7 U;  5J8F A;  3QU6 A;  3C7J A;  4EM1 A;  2MH2 A;  2PBI A;  3ZQ7 A;  3MWM A;  4IXA A;  1QQI A;  3HSR A;  3L9F A;  3KP3 A;  3JAM K;  3P9I A;  1Z7U A;  3FXQ A;  2W25 A;  2IPQ X;  3TDZ C;  2NAZ A;  3E5X A;  2V79 A;  3QOP A;  3IWF A;  5DD8 A;  1T2K A;  1S3J A;  4G7O F;  2AXL A;  5HLG A;  2FBI A;  1TQI A;  4LB5 A;  2J5O A;  2O03 A;  5A2Q K;  3TDU C;  2E7W A;  3RKY A;  1HW2 A;  1YW9 A;  4B09 A;  5LBQ A;  2WTE A;  2QM3 A;  3ZMT A;  3C3W A;  2EJR A;  2NNN A;  1FLI A;  1BI3 A;  1JHH A;  5TJJ A;  2V1D A;  2GQQ A;  1JGS A;  2FRH A;  4M71 A;  4R1H A;  1QPM A;  4BYY A;  2DBB A;  2CWE A;  1BI2 A;  4U0V A;  2Q8K A;  3DPT A;  2DO7 A;  4U0Y A;  1GVJ A;  2HKX A;  3LQQ A;  1B4A A;  2RN7 A;  1F9N A;  3ML6 A;  1ZG5 A;  2PLY A;  5DD4 A;  1W5T A;  1DPR A;  2XAG A;  2KIF A;  3GFJ A;  4ENK A;  2V9V A;  2Y0M A;  1J75 A;  4BHB A;  5L3D A;  1MKM A;  1G6N A;  1FBQ A;  1QO0 D;  2OQR A;  5L3C A;  1MD0 A;  3JTG A;  4G7Z F;  4L5J A;  2FE3 A;  2GXG A;  4LGW A;  3I59 A;  3K1N A;  4KFC A;  3N97 A;  2ESH A;  1GXQ A;  1XDU A;  2DQR A;  3KP7 A;  3ABU A;  3KFW X;  4RB2 C;  1P4A A;  2XAJ A;  1WWX A;  3SFZ A;  2K4B A;  5H20 A;  2LNB A;  3GEZ A;  2UWM A;  3H3Z A;  5IT3 A;  4FHT A;  3QAH A;  4XSX F;  3DP7 A;  3P7N A;  2KKO A;  4N9I A;  1FT9 A;  1K7A A;  2YPR A;  2PEX A;  3R0J A;  5L3F A;  3WTV C;  3V7R A;  1FYK A;  2RVC A;  4S04 A;  4F7Z A;  3WTT C;  3HTS B;  4ZYD A;  1B59 A;  4UHT A;  2PMH A;  1BIB A;  3O3K A;  3FXR A;  1FBU A;  1XCV A;  3DFG A;  4EM0 B;  5L3E A;  4IHT A;  2HR3 A;  1D5V A;  1IN6 A;  3BZ6 A;  4NHJ A;  3GZ6 A;  1OR7 A;  2ZKZ A;  3FWE A;  1XMK A;  2EFP A;  1SMY F;  1H9T A;  1OKR A;  2RNJ A;  2QLZ A;  1C0W A;  2O3F A;  1FNN A;  1IN7 A;  3VOE A;  3LFK A;  1XMA A;  5CJ9 A;  3I59 B;  2HEO A;  3MQ0 A;  5CLS A;  2H09 A;  3RYR A;  4DQ2 A;  4OIN F;  2HWV A;  4LLG F;  1G3S A;  4A5N A;  3E5U A;  1I27 A;  5ICC A;  3W6J B;  1MZB A;  2RQP A;  1TLH B;  3HHG A;  1XN7 A;  3R4K A;  1P4X A;  1UHM A;  1HBX G;  3BJ6 A;  1HKS A;  4IRH A;  4EJU A;  2DU9 A;  4Q48 A;  4N9H A;  3EYY A;  1ZRC A;  1R1U A;  5D8K B;  3WTY C;  1XCB A;  3IRQ A;  3ERE D;  3P9C A;  3BRO A;  4KA4 A;  4A0Z A;  4K2E A;  2BYV E;  1FSE A;  5E18 F;  5K5Q A;  3HRT A;  2Y48 A;  2O8X A;  3F8N A;  2ZO4 A;  5H6R A;  4BQA A;  1Z9C A;  3FMQ A;  3M7G A;  2P6S A;  5ICF A;  2CSO A;  2W57 A;  4FT8 A;  4KIG A;  1CGP A;  1B1B A;  3ZPL A;  2JT1 A;  4L5I A;  1ZRD A;  4G6Q A;  5D5U B;  4ENJ A;  3RIR A;  3RYP A;  1UST A;  2EFW A;  3FHZ A;  2CO5 A;  2F2E A;  5HDG A;  4XRF A;  1KYW A;  3GLX A;  5CVJ A;  2H27 A;  4L9N A;  1KGS A;  4UV9 A;  4HV5 A;  4WF2 A;  4RAY A;  2ZNZ A;  4WXC A;  1ZAR A;  2NS0 A;  2DQL A;  3QP6 A;  1MDM B;  2VBY A;  2C6Y A;  4IVN A;  4OOI A;  2ETH A;  3KCC A;  2CG4 A;  1U78 A;  3TQN A;  2FML A;  1XSD A;  2P5L C;  1F4K A;  1IRG A;  4WX9 A;  3WE2 A;  4CYD A;  4L9J A;  2BGC A;  2F5E A;  1UB9 A;  2BBY A;  3RKW A;  1O7L A;  4HBL A;  1BI1 A;  4I2O A;  4LB6 B;  4RB3 C;  3HIF A;  5ERI A;  3DXJ F;  2XUB A;  4G6D A;  5LHI A;  1LDD A;  3SHF A;  5LHH A;  4ESB A;  1O3T A;  1T6S A;  4EGZ A;  1FX7 A;  4WK8 F;  2M87 A;  4I0A A;  3C18 A;  1YFH A;  2PI0 A;  5BS6 A;  1O57 A;  3GUD A;  3MAJ A;  3D5L A;  3BY6 A;  3IHU A;  3COA C;  3M9A A;  3J81 Z;  3F8B A;  4BHP A;  3F22 A;  4EM2 A;  2IVM A;  4LD5 A;  3VB2 A;  2P7C B;  2FOK A;  5HDN A;  4YIF A;  3TOA A;  5K5O A;  1MGT A;  4KIC A;  2BEO A;  4RGS A;  1YTY A;  1O3S A;  2ISY A;  3IL2 A;  4P5O A;  2Z33 A;  4EQQ A;  1BC7 C;  1FBS A;  2DI3 A;  4UVC A;  3RPU A;  1J9I A;  4KIB A;  1IXC A;  3IKV A;  3I64 A;  1ZRE A;  3K2Z A;  2P5V A;  1BM9 A;  3Q9S A;  3RTR A;  2Q2E A;  2ESN A;  2H6B A;  4MGR A;  3KEQ A;  4QLC U;  4HAM A;  2G7H A;  1T98 A;  2KJB A;  3O6B B;  4LMY A;  2WWY A;  1PUE E;  1SD4 A;  2JPB A;  4DNC A;  1R58 A;  3WTX C;  1JXS A;  1Z6T A;  3I54 A;  5D5V B;  1UCR A;  2IA2 A;  1ODD A;  3HOT A;  4CDG A;  4LLL A;  2HYF A;  1FZP B;  4EJV A;  3FMS A;  1MJ9 A;  4RB0 A;  3WGI A;  4Q5S F;  1KU3 A;  3TOB A;  2FEZ A;  3LA3 A;  2B0L A;  1IF1 A;  2A07 F;  2QUF A;  3FM5 A;  3C1D A;  3CUQ C;  2FNA A;  3LAJ A;  3V7S A;  3HTU A;  1SFX A;  4QWQ A;  1JE8 A;  1LEB A;  2HGC A;  3F3X A;  1TQP A;  1IN5 A;  1YQA A;  1DP7 P;  2L4M A;  2K86 A;  3QP5 A;  3R0A A;  1Q1H A;  5HS7 A;  5DCM A;  3M8E A;  4CHU A;  4JQF A;  4I7H A;  4OU0 A;  1R00 A;  4O3M A;  1H0M A;  5DEQ A;  1HQC A;  5L3B A;  4LG0 B;  4IJA A;  2YX4 A;  1RUN A;  4IRI A;  2Y75 A;  4BH9 A;  3EQL F;  1IAW A;  2JRT A;  3PQJ A;  3ECH A;  3HUG A;  3KP5 A;  1J59 A;  3WOD F;  4KT5 C;  4MEX F;  5ICE A;  1XGO A;  1ULY A;  3KLO A;  5LGN A;  3GFI A;  1KA8 A;  4Y15 A;  5BQT A;  2F5D A;  2HZT A;  3W6K B;  5AIP A;  2HOE A;  1SD7 A;  1U5T C;  2DPU A;  3J80 Z;  4MNU A;  2LKP A;  1QZY A;  2HTS A;  5F6F A;  3D0S A;  2M30 A;  1NHA A;  2P7V B;  3GVA A;  1BJA A;  1MJB A;  2DAO A;  2KIM A;  4EJW A;  5K1Y A;  3E6B A;  2E7X A;  2GZW A;  5DCM B;  4KMU X;  2NRA C;  5BMZ A;  1SFU A;  4Y17 A;  2FMY A;  1XB4 A;  5E1Z B;  3PQK A;  4OIR F;  1FWZ A;  4PZJ A;  2J5P A;  1KQ9 A;  4HF1 A;  5LLQ A;  4HLX A;  3HRM A;  3CLO A;  2A5Y B;  2LSO A;  2PQ8 A;  3MZY A;  5ED4 A;  1YLF A;  4GCV A;  3R60 A;  4YFK F;  3NRV A;  2QBY A;  3FM3 A;  3IWZ A;  1SAX A;  1J0R A;  2ACJ A;  4LJZ F;  3ZP5 A;  3TKY A;  5FD6 A;  1ZYR F;  3QU3 A;  4CZZ A;  2PN6 A;  3BOQ A;  4KUM A;  1OPC A;  3WU0 A;  5H6Q A;  1BN5 A;  1T39 A;  1FP1 D;  4L9V A;  1S29 A;  4XBF A;  1ZLJ A;  1D8J A;  2OU2 A;  1LDK B;  1IN4 A;  3F6O A;  4U7D A;  1G3W A;  4ZYG A;  1I5Z A;  2QQ9 A;  2HS5 A;  1ZGJ A;  2R3S A;  1YW8 A;  4L0Z B;  4EGY A;  1B9N A;  3DF8 A;  3T0Y A;  1YIO A;  5ILU A;  4PCQ A;  1J5Y A;  4L18 B;  4RGU A;  4U0W A;  2ZJ2 A;  5HS8 A;  2HDC A;  1TQM A;  4M9S A;  1R23 A;  5D4R A;  1YYV A;  4HX8 A;  4I98 B;  2DFI A;  1XDS A;  1EH7 A;  4HZF A;  4EJT A;  1STZ A;  4A6E A;  2VBX A;  1TBX A;  3V8L A;  5CVV A;  3S2W A;  4LK1 F;  3NQO A;  1W7P D;  4HX7 A;  5L3G A;  4L9T A;  3CO6 C;  3E6C C;  5KVR A;  2TDX A;  2G7U A;  3KZY A;  1P92 A; 
#chains in the Genus database with same CATH topology
 3B02 A;  3T1B A;  4WWC A;  1MDM A;  2IP2 A;  3EYI A;  5J47 A;  1I6X A;  3MKZ A;  1IXS B;  1R1T A;  3KYL A;  5J6X A;  1QZZ A;  5FLX K;  4M6Y A;  4OMY A;  3HOU J;  2EIK H;  4BQO A;  2PG4 A;  1YX5 A;  3FF5 A;  5IYB J;  2QBY B;  2R93 J;  1WCM J;  1HW1 A;  1HW5 A;  2P5K A;  4N4N B;  5HNH A;  1RIO H;  2H6C A;  1NH3 A;  2QWW A;  3HM5 A;  2DK5 A;  4YG2 F;  1S6L A;  3E5Q A;  4Y52 J;  2IEK A;  5JLX A;  2K9N A;  4WXD A;  2VE9 A;  2PJP A;  4PGH A;  2E1C A;  3VFZ A;  5FLX Z;  3K9T A;  1PP8 F;  3OSF A;  3J7A Y;  2VKE A;  3I71 A;  4CCO A;  3OY9 A;  3R61 A;  2ISZ A;  3CMY A;  4BHC A;  1KQ0 A;  5FFX A;  4ZYH A;  3ZOB A;  1A6Q A;  2M2E A;  2X6X A;  3K0L A;  4GYI A;  2HYJ A;  4I01 A;  1W36 D;  2BW3 A;  3LSG A;  4E7K A;  2DTZ A;  3HOX J;  2X4H A;  5CKT A;  2DTR A;  2M9H A;  5JI6 A;  4ESJ A;  1F43 A;  1PYV A;  5F64 A;  4O5V A;  1ONV A;  1RNL A;  1P9Q C;  3FKI J;  5EYR A;  1REP C;  3JRF A;  4P96 A;  2LRE A;  1WFX A;  2KIU A;  5GTI C;  2HDW A;  4IHS A;  2CUF A;  2Z3Y A;  1LFP A;  2VON A;  5C44 J;  2KPM A;  3BWG A;  4LLN A;  2MA3 A;  1J7K A;  3E97 A;  4UUV A;  2L4A A;  2R5Z B;  1BW5 A;  5JHF A;  2KIQ A;  3JSP A;  1VQN I;  1WJE A;  2EFQ A;  2CUE A;  3C2G A;  4XOP A;  3K1M A;  3MN2 A;  1ETV A;  1DDN A;  4MIM A;  1KU9 A;  1SD5 A;  1OYI A;  2E1M B;  4E70 A;  1U8R A;  3LQR A;  2M8E A;  6PAX A;  4WXH A;  1E3H A;  1AWC A;  5IP9 J;  3ABL H;  4Z2Y A;  4IF4 A;  4PUS A;  2R7R A;  3V8K A;  3JRH A;  2NYX A;  3JRG A;  1SD6 A;  1O3Q A;  4NDL A;  2MBF A;  3CCS I;  1JJ8 C;  2LR8 A;  2KRF A;  5EJC A;  1W5S A;  3EPZ A;  3TL4 X;  3GW2 A;  4I02 A;  4M74 A;  2R0Q C;  4HDV A;  1RET A;  1D1A A;  1ZGA A;  4JK1 X;  1G3Y A;  1S9H A;  2ZME A;  5DDG A;  1V5E A;  4BY1 J;  2MC3 A;  4UVB A;  5FKN A;  3FIW A;  4V2F A;  4R8H A;  3PSF A;  2Z2S B;  3VSL A;  1V4R A;  4MQV A;  3WTZ A;  3I58 A;  3BG7 A;  5AIQ A;  5HOO A;  4XIC A;  2QYO A;  4A0Y A;  2L54 A;  5HLT A;  2BV6 A;  2X6W A;  3DEW A;  2FXA A;  3GBG A;  4UXN A;  1HST A;  1XSV A;  4FET A;  5IYD J;  1OR7 C;  1P7J A;  2NS7 A;  1ITY A;  3S32 A;  5F0C A;  3KP4 A;  2JK3 A;  2OZU A;  5K5R A;  4P55 A;  3F23 A;  3PO2 J;  3E7L A;  1BR2 A;  2UXX A;  3RZO J;  1Y0U A;  2K3P A;  2X1E A;  2XSJ C;  2ZCW A;  2NVY J;  3EDP A;  5EDN A;  4HQE A;  1IW7 F;  5J4Y A;  3GTJ J;  4GO1 A;  3HYI A;  2BW3 B;  5M3M J;  4AID A;  2F5C A;  4AUX A;  1IV8 A;  1BW6 A;  2ELH A;  4PK4 A;  1P2F A;  2Z5U A;  2CUJ A;  4B8X A;  2KJC A;  4M3D A;  2DPD A;  1SAN A;  4JOM A;  3K4B A;  2W24 A;  2CV0 A;  1G2H A;  1B9M A;  4OAZ A;  5FO5 A;  2YR2 A;  4A2U A;  1IO2 A;  3J81 K;  2MW8 A;  2GIV A;  3CUQ A;  4JX6 A;  1VTN C;  2CJJ A;  2GOM A;  3BG3 A;  2DMU A;  3K4C A;  2JA6 J;  2MD5 A;  1YS6 A;  4HQM A;  1RR7 A;  5D6F A;  4CIC A;  1OCT C;  1HXD A;  4RAG A;  2ZBK A;  1BIA A;  2AHQ A;  3A1Y A;  1K78 B;  1OQY A;  5J8C A;  4IQJ A;  3L00 A;  1JTY A;  2JPC A;  4G7H F;  3MCZ A;  2V7F A;  1S8N A;  2V4J C;  3S17 J;  4AIK A;  4N4O B;  1E3P A;  1UJ8 A;  4KN4 X;  2HOT A;  5GPC A;  1BL0 A;  1OCO H;  1XTA A;  2DOF A;  4CH7 A;  2MH9 A;  3SJM A;  2X1D A;  3HXL A;  3V4G A;  1FYL A;  3GTK J;  1EH8 A;  3M3Y J;  1IN8 A;  3BR0 A;  2EPF A;  4W1U A;  2R7V A;  5LEJ A;  2ZB9 A;  2VOO A;  4BQN A;  2XRL A;  5E3N A;  1BR1 A;  2A6H F;  1X2N A;  4ON0 A;  1R5I D;  3L7W A;  2UUZ A;  1LQ1 A;  4XON A;  2BY2 A;  2O9L A;  4ZC3 A;  2CQN A;  2ZME B;  1A5J A;  2E60 A;  2L9V A;  4XMY A;  2XDV A;  2JA8 J;  3GX4 X;  3SZT A;  3WTW C;  3DKW A;  3RJP A;  2O0Y A;  3WG9 A;  2LY9 A;  2BHZ A;  3MZH A;  1J2X A;  2KQR A;  1IJW C;  2I5U A;  3UNG C;  2M5W A;  1W7P A;  2L0K A;  2VT2 A;  1WKM A;  1B6A A;  5HLI A;  2OPT A;  3KET A;  1WRJ A;  5FKM A;  1LE8 A;  1E0E A;  4AU7 A;  3ZN0 A;  3DQV C;  2VT3 A;  2R7D A;  3CC7 I;  4A5M A;  5J3L A;  1RR8 C;  2DK8 A;  1D1B A;  2KHM A;  1ZHF A;  2P6T A;  3RKQ A;  1W0U A;  2XF7 A;  4A12 A;  4IRG A;  3CTA A;  3N4M A;  5IOZ A;  2MD0 A;  4OAY A;  4BXF A;  5LRS A;  2ZXW H;  3BCB A;  4YFN F;  4HOB A;  4RBO A;  3C2H A;  2YU9 J;  1OMI A;  1SFE A;  1BR4 A;  1LVA A;  1D8K A;  5E1W A;  4XLN F;  1WJF A;  4FX4 A;  5ICG A;  1TNS A;  3I4P A;  4LG0 A;  2EV5 A;  2COM A;  3PUF A;  1ACI A;  1BC8 C;  2E5N A;  1SMT A;  2DN0 A;  3QQA A;  1VF9 A;  2H8W A;  1H9G A;  2IAI A;  5H2F C;  2ME0 A;  3GYH X;  3CUQ B;  2LYC A;  2QSG X;  2K9M A;  2VAS A;  3ZQG A;  4EVI A;  4HLY A;  4GXO A;  4BJT A;  2AQE A;  1AA7 A;  2MSY A;  3AAF A;  3O8H A;  2I10 A;  1I1G A;  4BE2 A;  3IAS 2;  1ZG3 A;  4YFX F;  4ZZL A;  1R22 A;  3WE3 A;  4E7I A;  2L3D A;  1KQ8 A;  3I0T A;  2FD5 A;  3HSF A;  2V6C A;  1FY7 A;  2ADU A;  2ZNY A;  4BQQ A;  1YIT I;  3P5J A;  5HS9 A;  4M9Z A;  3SZG A;  2WV0 A;  2L9S A;  2EIJ H;  1T33 A;  1HDD C;  4W97 A;  2HOS A;  1BJZ A;  4A93 J;  3AG3 H;  2XV4 S;  3VWB A;  2HFH A;  5F08 A;  1Z6R A;  5DYM A;  4KT6 A;  1B72 A;  4C30 A;  3TGN A;  5ILV A;  2R7U A;  3REO A;  1JI8 A;  2VQG A;  2ZSH B;  1L0O C;  4NB5 A;  4RAZ A;  2XGX A;  3KEO A;  4DYQ A;  3M8F A;  4E7Z A;  5FD5 A;  2K9S A;  1OYW A;  2EBI A;  2FA5 A;  2K7L A;  2E35 A;  1FP2 A;  2L5Q A;  1FEX A;  1ON1 A;  1P4W A;  1JHF A;  3S3O A;  1LFU P;  4RB1 A;  4RM2 A;  4NNJ A;  3FXJ A;  5FRN A;  1Z91 A;  1X4P A;  1ZR4 A;  1N75 A;  1JKO C;  4P9U A;  3BP8 A;  1ORK A;  3P9K A;  3GZ5 A;  4A0X A;  2E2H J;  2H94 A;  1W7P B;  2HQ5 A;  1K79 A;  2WB1 N;  3ZQQ A;  2KZG A;  3FHN A;  2DFH A;  1LE8 B;  3X2Q H;  2WAF A;  1RUO A;  1IUY A;  2A61 A;  1IZ1 A;  2CMP A;  2ZSI B;  2ZXJ A;  2KT0 A;  3IUO A;  3H9J A;  3LA2 A;  1YW7 A;  3OYM A;  3IKT A;  3L2U A;  3ISP A;  4A3D J;  5EEG A;  1MBH A;  1UMQ A;  2W4S A;  3G1M A;  1FTT A;  2VQH A;  4E7H A;  2AQF A;  2L02 A;  4XN0 A;  2HPI A;  1VI0 A;  2GA2 A;  1FOK A;  3LNQ A;  2A3S A;  3RDI A;  2QZ8 A;  2L7Z A;  3AG2 H;  2RGV A;  3H92 A;  3RSN A;  5CYV A;  1L3L A;  3AKZ A;  3QPT A;  3Q9V A;  2CU7 A;  5CVU A;  2D1H A;  4EAT A;  2F5F A;  4DBR A;  1MMG A;  4BXU A;  2Y0S N;  1SVO A;  1UEL B;  2X0L A;  3RQ4 A;  3FDY A;  1JUP A;  2VXZ A;  3J7A O;  2CQ7 A;  1MSF C;  2R7T A;  1XGN A;  5E8G A;  1U5T B;  2E2I J;  1X2M A;  1R1V A;  2VE8 A;  4AM3 A;  2FNP A;  3MVP A;  2IT0 A;  3S16 J;  3HRS A;  2FBH A;  2L9N A;  5CVR A;  1G3T A;  1X1C A;  5LGT A;  2XAU A;  3U1D A;  1USS A;  5BPD A;  2GOX B;  2LK2 A;  4H0E A;  1D0X A;  3JRD A;  1LPQ A;  3QPH A;  1OCR H;  1F5T A;  2YX7 A;  1DPU A;  3KP6 A;  1VQ9 I;  3ESW B;  2IGO A;  2XRN A;  5J1U A;  2HZD A;  3GTM J;  2YUS A;  2JA7 J;  3E3V A;  3JSO A;  3JAM Z;  3JRC A;  3J80 K;  1TW2 A;  2LP0 A;  4HDU A;  4RLF A;  3BPV A;  1B72 B;  2A69 F;  1OYY A;  3J7Z I;  1Z1D A;  2OBP A;  4G12 A;  3MKW B;  2D2W A;  3WU1 B;  1VQ7 I;  3ELK A;  2RV8 A;  3WU2 C;  3V8J A;  2LC2 A;  3TBI A;  4XL9 A;  3KX2 A;  3MEX A;  1W1W E;  1XGS A;  4UV8 A;  5A2Q Z;  4BBS J;  3T5X A;  3OYJ A;  3M8J A;  3S14 J;  2R7Q A;  4B44 A;  3BDD A;  4ESF A;  1FPQ A;  2QKL B;  2XVC A;  5E8I A;  4XLP F;  1YO5 C;  5LEK A;  4D5F A;  4AYB N;  2F4I A;  3BJO A;  3WHB A;  5IT9 K;  2E5Z A;  3JW4 A;  3CJQ B;  1ZGW A;  1FOY A;  2ZXH A;  4NQW A;  1DGR M;  2QF7 A;  3MD2 A;  4XOR A;  4ZH4 F;  2P8T A;  3L2C A;  2WB1 A;  2Y69 H;  4U88 A;  1T0F C;  2VJ4 A;  2MLG A;  2GXB A;  2CH0 A;  1D1C A;  2Q1Z B;  4XKW A;  1MH4 A;  2KFD A;  3CCQ I;  4FCY A;  5IT9 Z;  1PVE A;  3A02 A;  3BG9 A;  1H88 C;  1GHC A;  1QA6 A;  3F21 A;  5IY5 H;  3KE2 A;  2OTJ I;  3CQZ J;  2STT A;  2IS6 A;  4D0P A;  2HPM A;  1Z67 A;  2MLK A;  4G94 A;  3LAP A;  1VQP I;  4S05 A;  3ECO A;  3EUH C;  3CF5 F;  3LST A;  3A01 A;  2X6Y A;  4IKF A;  1O4X A;  4F55 A;  2XAF A;  4AWX B;  4ETS A;  3FZV A;  1P6R A;  3I56 I;  2OA4 A;  3FX3 A;  2TRT A;  2V1U A;  5JVG F;  1S72 I;  2DXI A;  2JZY A;  2E71 A;  2Y0S A;  2W85 A;  2JWT A;  2QSH X;  4ZDO A;  1QGP A;  2XAQ A;  3W2A A;  3LSR A;  3CCU I;  4QTR A;  2GAU A;  3WGH A;  4PGG A;  3HOZ J;  3NEU A;  5DUK A;  2Y9Y A;  2JTV A;  4M72 A;  1IUF A;  3R6S A;  1Z21 A;  3O2P E;  4B3X A;  3DTE A;  3G3Z A;  1HSJ A;  2EK5 A;  4YII A;  1FTZ A;  1WQ2 A;  2VKV A;  3QRF F;  1H89 C;  1MH3 A;  3GWZ A;  3ZMV A;  2UXN A;  1S7E A;  4ZDP A;  4HST A;  1EH6 A;  1TT0 A;  1HLV A;  3CP2 A;  4D7N A;  2M1B A;  1OJL A;  1XSX A;  3KYD B;  1Y8Q B;  3ZGK A;  5CVI A;  5J40 A;  1Z05 A;  3T8R A;  1ZLK A;  4I0B A;  3K4K A;  3I53 A;  1QNT A;  4HF2 A;  2O61 A;  4MTE A;  4G8X A;  1BOA A;  3CD6 I;  4DOZ A;  1R5G A;  3LA7 A;  1X19 A;  1YE9 A;  4IPA A;  2L01 A;  2NOJ B;  4B4C A;  3FXK A;  4BGD A;  2LOO A;  3ZN1 A;  3F6V A;  2M0C A;  5F1R A;  2ZXI A;  4IX7 A;  1MW7 A;  1Z77 A;  2XHK A;  1X1P A;  3CLQ A;  2A68 F;  4Y4R A;  3WTS C;  2ZJQ F;  5LRR A;  2RC4 A;  2L2O A;  1TWA J;  2HTJ A;  4OIO F;  1K61 A;  1Z0X A;  1A04 A;  1SAU A;  3MMY B;  2VUM J;  2IJL A;  2DA6 A;  4Y13 A;  4U7B A;  5BOX A;  4FIS A;  1WSU A;  4XN3 A;  2VBW A;  3H0D A;  3DCF A;  3V7C A;  3TO6 A;  3F8C A;  2JVH A;  3L2V A;  3OMY A;  3VPR A;  4EEF G;  4NQW B;  1TNT A;  4B3A A;  2XAS A;  5FB2 A;  4AYB A;  2VXD A;  4KMF A;  3F8F A;  1RI7 A;  3CO7 C;  3A03 A;  1U9O A;  3OYG A;  4CXF A;  2BOL A;  1TZL A;  2DCE A;  5JFR A;  2ZJP F;  3F72 A;  3HL2 A;  2G0E A;  4ENM A;  1I3A A;  4IEJ A;  2JVG A;  1JUM A;  1XGM A;  1Q1V A;  5DV5 A;  3JTH A;  2HOA A;  3TO7 A;  3B73 A;  2PMU A;  4OMZ A;  2FQ3 A;  2MYS A;  4ZTF A;  4A6D A;  3H3V K;  1X3U A;  2JSC A;  3H1C A;  2HQR A;  2QQB A;  3VYS B;  3RI4 A;  4CA0 A;  2VC1 A;  2CQK A;  5DM6 F;  3BPX A;  2EWN A;  1RZ4 A;  2FU4 A;  2ZFW A;  1ON2 A;  3FXO A;  4JBA A;  2ID6 A;  1V3F A;  5E3O A;  3F8M A;  2BE5 F;  3CMM A;  2HDD A;  2GA1 A;  3OYA A;  1IC8 A;  1RKT A;  4MQ9 F;  2OQG A;  4MTD A;  2E2J J;  3S2H J;  5E17 F;  4KNY A;  4HEA 2;  3GXO A;  3CJN A;  1HDP A;  1K6O A;  4YRV A;  1MSE C;  1ZAO A;  1R7J A;  1YS7 A;  2HKO A;  2XKP A;  3F0C A;  3TO9 A;  5GAH J;  5HLH A;  1QVU A;  1CF7 A;  1FOX A;  2DA1 A;  2E1N A;  1AKH A;  3VYU B;  1E17 A;  5EEH A;  1KU7 A;  4PDK A;  1LB2 A;  1B8I A;  4KN7 X;  3K4L A;  4ZYA A;  3G2B A;  3DPU A;  4KDP A;  3HRU A;  3BJA A;  3ZMU A;  3KZZ A;  1ZR2 A;  4LFU A;  2WAD A;  1MJA A;  5LFA A;  1D0Y A;  2NVT J;  3IC7 A;  2K3F A;  2YU3 A;  3HG9 A;  3HGG A;  2AXT C;  1IXR C;  3DV8 A;  3I5U A;  5TGT A;  4YEJ A;  2EA4 A;  2VOD A;  1T38 A;  3G6E I;  2JN6 A;  4RAF A;  1ETY A;  2PX9 A;  1FC3 A;  3DKY A;  3DPL C;  3RKX A;  3ULQ B;  2KZV A;  3WGG A;  4NUB A;  1K78 A;  2KRH A;  4I09 A;  3NWS A;  4XQF A;  4ZZD A;  5HVQ C;  1ETX A;  1WI9 A;  4XLH A;  5FFZ A;  3WTU C;  2EV0 A;  3C2B A;  3M1E A;  3U9G A;  1X1B A;  4OIP F;  4AVZ A;  4IOA F;  2QVO A;  2ID3 A;  4GYG A;  4BXX J;  2DA7 A;  4EV0 A;  3H5N A;  2O6G E;  3AG1 H;  1I1S A;  3GTG J;  4L0Y B;  1MIJ A;  3ABT A;  2EIL H;  3KZI C;  4XID A;  1EV7 A;  4AD9 A;  4FE4 A;  1ZEL A;  2FX0 A;  1DGW Y;  2FSW A;  1YG2 A;  3E6M A;  4RM3 A;  5KK1 A;  1QBJ A;  2W84 A;  4HYE A;  5HDK A;  1I3Q J;  3NAR A;  2NVU B;  1EA3 A;  4UB8 C;  2HQN A;  1AOY A;  2F4O B;  1S7A A;  2Q0O A;  1XD7 A;  3CCL I;  3OL4 A;  4CGZ A;  3DU6 A;  3SQN A;  1ZG1 A;  2CGP A;  1TTY A;  4CZC A;  1A31 A;  1ZRF A;  1UHS A;  3ZQI A;  4FTH A;  1Y1W J;  2QQA A;  1YJ9 I;  5D5X B;  1LJ9 A;  5EG0 A;  1VQ5 I;  1ZKG A;  4BDY A;  3LWF A;  5TRD A;  2DA4 A;  4BNC A;  4TV7 A;  1VQM I;  2OZ6 A;  2VC0 A;  3H5R A;  2MG4 A;  2OAZ A;  4MLO A;  3OOP A;  2XIG A;  2HXO A;  2LF7 A;  3HSE A;  1PDN C;  5JHU A;  3CDH A;  3OYD A;  4XR6 A;  1CF7 B;  2RDP A;  2Y2Z A;  3OYH A;  1AKH B;  3T8T A;  2KL4 A;  1B8I B;  3SFI A;  5D5W B;  4I99 C;  5FJ8 J;  2DMT A;  1KU2 A;  2RKH A;  4DGW B;  2RRE A;  4RLQ A;  2FF4 A;  4O6J A;  2EB7 A;  1WJA A;  3CCE I;  3TP0 A;  1O7F A;  2OC6 A;  3W6V A;  5GAD J;  3MFK A;  2Z99 A;  4F92 B;  3HHH A;  4Z6Y A;  4HV6 A;  2VOP A;  2P4W A;  2D45 A;  4C3J J;  4CO8 A;  4BE1 A;  2K9Q A;  3FXU A;  2UZK A;  4HF0 A;  2W1O A;  3H3U A;  2FBK A;  4R79 A;  3ROU A;  1VQO I;  1G4D A;  1W4M A;  5FRM A;  1BI0 A;  4ENN A;  3H35 A;  3ZR8 X;  3VEP A;  1WI3 A;  3JRB A;  2XKO A;  4MHG A;  4E7S A;  5FGM A;  3K1P A;  2LKX A;  2QKM B;  1GXP A;  5KAF C;  2M4K A;  3OS0 A;  3S2D J;  2A6T A;  1LEA A;  2DW4 A;  3LFU A;  5BPI A;  2CFX A;  2M0M A;  3IRR A;  3E6D A;  1MMD A;  5E1X A;  2JQ7 A;  4M9X A;  1D3Y A;  4AVP A;  3OIQ A;  2K27 A;  2XGE A;  5DM7 F;  3BTC A;  3HZJ A;  3QWL A;  3IH4 A;  2NNY A;  2A6E F;  1Y6I A;  2DMP A;  2K9L A;  3BG6 A;  4FE7 A;  4BL0 B;  1X58 A;  4BU2 A;  5EGO A;  3SZP A;  1ZH5 A;  1R5H A;  3BLY A;  1LNW A;  4XSZ F;  2VKD A;  3FBI B;  3LSJ A;  4F52 A;  5J4V A;  4HNV A;  3BCA A;  3SEZ A;  2BXZ A;  1HCR A;  4BE0 A;  4EMS A;  3ABM H;  3PNV A;  2EV6 A;  3BQZ A;  3B6A A;  4RS8 A;  1P7I A;  2ECC A;  3ZQC A;  4Q47 A;  3L2R A;  2V1N A;  3HOS A;  4NC7 A;  4IHW A;  4OIQ F;  1BBY A;  4HW0 A;  4MEY F;  2CS3 A;  1FSH A;  3ZMZ A;  2N8G A;  3K69 A;  4XLE A;  3ZMD A;  4BAY A;  2D1V A;  2EFO A;  2M7A A;  4UVA A;  2R7F A;  5DCF A;  5EG0 B;  2LY1 A;  4GGG A;  4RGX A;  4ZYE A;  4D5C A;  3PFI A;  5LHG A;  1PJR A;  1X4O A;  2IXS A;  2L7F P;  4FX0 A;  1E2X A;  2VI6 A;  3KIO A;  3PNT A;  3ZMS A;  4DJA A;  3Q5F A;  1U3E M;  2O8K A;  1WVR A;  3VOD A;  4BDZ A;  5D6E A;  4PJ0 C;  1V54 H;  2LF8 A;  3H9Q A;  1M1E B;  5DUI A;  3JR9 A;  2EA2 A;  2XPW A;  4HNT A;  4OWR B;  2FJ1 A;  2OD5 A;  2K85 A;  5ILS A;  1FOW A;  2HQA A;  4DYC A;  3GTP J;  4BY7 J;  2WC2 A;  2K02 A;  2ELJ A;  4KIF A;  3CCJ I;  3U2R A;  4WCG A;  3OV8 A;  3FMR A;  3A0B C;  2EIM H;  4P9F A;  2V1X A;  4G9Y A;  2H1L A;  4RGR A;  2XB5 A;  3CMA I;  4M73 A;  4ASN A;  1SEU A;  2JRM A;  1U5T A;  3BQY A;  2XRO A;  2H1K A;  3PL8 A;  1SVM A;  3CUO A;  5AON A;  3G73 A;  1YX3 A;  2GWR A;  2W48 A;  4AIH A;  1IGN A;  2KLO A;  5KCM A;  1RPW A;  2K4J A;  5FLM J;  1N77 A;  2IRF G;  2IS4 A;  3KLN A;  2DLL A;  3K70 C;  5TIS C;  3S1N J;  5FKO A;  2OTL I;  1ZN2 A;  1UG2 A;  2M45 A;  1HOM A;  2E36 A;  5LGU A;  1S7O A;  3TW7 A;  2LVS A;  4N0B A;  1VQ6 I;  1BA5 A;  1UFM A;  4PSX A;  3GFM A;  4MO7 A;  1T95 A;  3MKY B;  1U6G A;  2Z9O A;  1T0F A;  2DT7 B;  4M6X A;  1R36 A;  1OLT A;  5J1Y A;  1TW3 A;  2JMW A;  3ASN H;  2XAH A;  1DUX C;  1HKT A;  2WBM A;  4Y7N J;  4LK0 F;  3TP3 A;  4LG3 A;  5D4S A;  5EGO B;  3I55 I;  1YHQ I;  2LDU A;  3M1C A;  4D9J A;  1U9N A;  3ONQ A;  3DBH B;  1ZK8 A;  2EZI A;  3EUH A;  3DBL B;  4HA8 A;  5D8L B;  5JVT A;  2M4G A;  5CPR B;  4A3L J;  2YSR A;  1F36 A;  1XG1 A;  2R5Y A;  1F1Z A;  4CCN A;  5JLW A;  2OV7 A;  1U2W A;  3OYI A;  4C2M J;  5E20 A;  2VN2 A;  4PFP A;  3W2W A;  3V42 A;  1UHW A;  2VBZ A;  4LIV A;  3SXY A;  2CW0 F;  2EFN A;  4HX4 A;  3DEU A;  1D5Y A;  4KYW A;  2STW A;  1IRF A;  3J7Y J;  4A3F J;  2IA0 A;  1FYM A;  3GO5 A;  4Q4Z F;  3UKG A;  1WH7 A;  2CYY A;  2X9D A;  3EET A;  4UNO A;  3BR1 A;  5E3L A;  2IA1 A;  2QEN A;  2VPR A;  3GF2 A;  2ELK A;  2PFB A;  3RPQ A;  3DBR B;  5K7H A;  1KYZ A;  2G9W A;  3L09 A;  4DIQ A;  2LFB A;  1JGG A;  4AIJ A;  5M5W J;  3GFL A;  1HKQ A;  2DDB A;  5JR3 A;  2X85 A;  4NC6 A;  2HYG D;  3QOE A;  1LDJ A;  3KP2 A;  2D5V A;  1O3R A;  4V19 K;  4X6A J;  4EJO A;  2AS5 F;  2IW5 A;  1I39 A;  2DT5 A;  2EIN H;  1PP7 U;  3ASO H;  5J8F A;  3Q3S A;  3CF2 A;  3QU6 A;  3C7J A;  4EM1 A;  2MH2 A;  2PBI A;  3ZQ7 A;  3MWM A;  2ZJR F;  3HOW J;  2IGN A;  4IXA A;  5M5X J;  5HOD A;  1GV2 A;  2QCO A;  1QQI A;  4C2U A;  3FKJ A;  3HSR A;  3CME I;  3L9F A;  4LIT A;  4BKX A;  3H9G A;  3KP3 A;  3JAM K;  3OSG A;  3P9I A;  3PUB A;  1Z7U A;  4XK4 A;  3FXQ A;  2W25 A;  3AG4 H;  1OIS A;  2IPQ X;  1MND A;  2COB A;  3TDZ C;  2IS1 A;  2NAZ A;  3E5X A;  2V79 A;  3QOP A;  3IWF A;  5DD8 A;  1T2K A;  2JUC A;  1G8X A;  2M34 A;  1S3J A;  1KON A;  2RAE A;  4G7O F;  2AXL A;  2XF5 A;  2KIS A;  5HLG A;  2FBI A;  1TQI A;  3BTI A;  2J5O A;  2O03 A;  4II2 A;  5A2Q K;  4LB5 A;  3TDU C;  1Y1V J;  2E7W A;  2KRC A;  3RKY A;  1DP3 A;  1HW2 A;  2JA2 A;  1YW9 A;  4B09 A;  5LBQ A;  4C3I J;  5EEA A;  2WTE A;  2VIX A;  2LY2 A;  2QM3 A;  4XLF A;  4P1W A;  5EF6 A;  3ZMT A;  3C3W A;  2LRD A;  2R5Y B;  1JJ6 C;  2EJR A;  4RDU A;  5F1J A;  2NNN A;  1TWF J;  1FLI A;  1ERD A;  1Y39 A;  1BI3 A;  1JHH A;  5TJJ A;  2V1D A;  2GQQ A;  1JGS A;  2FRH A;  2OF7 A;  4M71 A;  2BXY A;  4CCL A;  4R1H A;  1QPM A;  1IRX A;  2ICW G;  5EZH A;  4XRS G;  4BYY A;  5F04 A;  2DBB A;  3G1L A;  2CWE A;  1BI2 A;  3BR2 A;  3OR2 C;  4U0V A;  2Q8K A;  3DPT A;  3CJR B;  1FJL A;  3K4N A;  1K6Y A;  2ZFU A;  2DO7 A;  4U0Y A;  1GVJ A;  2HKX A;  3LQQ A;  1B4A A;  2RN7 A;  1F9N A;  3ML6 A;  1DU6 A;  3OYF A;  4PJM A;  1ZG5 A;  2PLY A;  5DD4 A;  2PMZ N;  5M5Y J;  2F48 A;  1W5T A;  1DPR A;  1Y8R B;  1FIP A;  5IYC J;  3EUK L;  2P0W A;  2XAG A;  3VYT B;  2KIF A;  3GFJ A;  4XLA A;  2LKS A;  4ENK A;  2V9V A;  2Y0M A;  1MBJ A;  1J75 A;  4BHB A;  5L3D A;  1MKM A;  1FMV A;  1G6N A;  3GTO J;  1FBQ A;  5LD2 C;  1QO0 D;  2OQR A;  5L3C A;  1MD0 A;  3JTG A;  1NK3 P;  4G7Z F;  2ZC2 A;  3MZ8 A;  4L5J A;  2FE3 A;  2GXG A;  4LGW A;  3I59 A;  3G71 I;  3GME A;  3K1N A;  2R7W A;  3S15 J;  2L7K A;  2BY1 A;  3DTK A;  4KFC A;  3N97 A;  1QHH D;  1WPK A;  1VQL I;  2DMQ A;  2ESH A;  3I3L A;  1GXQ A;  1HC8 A;  1XDU A;  3IAM 2;  2DQR A;  3KP7 A;  2JA5 J;  3RQI A;  3ABU A;  3KPH A;  3KFW X;  4RB2 C;  1P4A A;  4DZP A;  2XAJ A;  1WWX A;  3SFZ A;  5B1A H;  2K4B A;  4A3E J;  1I6H J;  5H20 A;  2LNB A;  3GEZ A;  4B47 A;  1SFO J;  2UWM A;  3B6C A;  1W0T A;  1CQT A;  3H3Z A;  5IT3 A;  4FHT A;  3UR3 C;  3QAH A;  4XSX F;  2JJ7 A;  4BBR J;  5B3S H;  5DTD A;  4IOC F;  2KDO A;  3DP7 A;  3P7N A;  4UUT A;  4M3B A;  2KKO A;  3HPG A;  4N9I A;  3AL0 C;  1FT9 A;  5K7F A;  1K7A A;  2FQ4 A;  2YPR A;  2PEX A;  5B1B H;  3R0J A;  4G6T B;  5L3F A;  5KAI C;  1U8B A;  3WTV C;  3PO3 J;  3V7R A;  2NS8 A;  2BVL A;  1RRJ A;  1FYK A;  2VQL A;  2X6O A;  2R7Z J;  2RVC A;  1OCZ H;  4S04 A;  2X51 A;  4F7Z A;  1GT0 C;  3WTT C;  4M3F A;  3HTS B;  1LKX A;  4ZYD A;  1B59 A;  4UHT A;  2PMH A;  1BIB A;  2Y9Z A;  4ZTJ A;  3O3K A;  2X48 A;  3HDD A;  3FXR A;  1FBU A;  1XCV A;  2LG4 A;  3DFG A;  2WA0 A;  4PFO A;  4BEH A;  4EM0 B;  5L3E A;  3PJR A;  4IHT A;  2HR3 A;  3HEF A;  1TC3 C;  3PNY A;  4IO9 F;  3GZN B;  2V26 A;  3GCM A;  1D5V A;  4ANJ A;  1IN6 A;  3BZ6 A;  3S8P A;  4NHJ A;  3JRI A;  3M4O J;  2XF6 A;  3GZ6 A;  1OR7 A;  2ZKZ A;  2CQX A;  2VKH A;  1YIJ I;  2HI3 A;  3FWE A;  2WY8 Q;  1XMK A;  2EFP A;  1SMY F;  3HOV J;  1H9T A;  1OKR A;  2RNJ A;  1QRY A;  2QLZ A;  1C0W A;  4DBQ A;  4CCK A;  2CFO A;  2QA4 I;  4BUP A;  3SDG A;  4CUG A;  2GM4 A;  2O3F A;  2PMZ A;  4M3G A;  1FNN A;  1IN7 A;  3OYE A;  3VOE A;  3LFK A;  1XMA A;  1GUU A;  3RCO A;  2BZT A;  4A3M J;  5CJ9 A;  1MNM C;  3DWL E;  3I59 B;  3RPU D;  2HEO A;  2Z1D A;  2DDA A;  3MQ0 A;  5CLS A;  2H09 A;  3RYR A;  4DQ2 A;  4OIN F;  4I6Z A;  2HWV A;  5EZG A;  1BOB A;  4M6V A;  4LLG F;  1G3S A;  4A5N A;  3L2W A;  3E5U A;  1I27 A;  5ICC A;  5M3F J;  1YRN A;  3W6J B;  1MZB A;  2VLA A;  2EQR A;  2RQP A;  1VND A;  2HVR A;  1TLH B;  3HHG A;  1WGX A;  1XN7 A;  2DFF A;  1N25 A;  3R4K A;  5F27 A;  1P4X A;  1QU3 A;  3CC2 I;  4PJN A;  1UHM A;  1HBX G;  3BJ6 A;  3ZQF A;  1LUJ B;  1UZC A;  2R4G A;  1MBG A;  1HKS A;  2KMU A;  4IRH A;  4EJU A;  1WJ5 A;  3U21 A;  4GDF A;  2M7B A;  2W7N A;  3VSK A;  2DU9 A;  4XKV A;  4Q48 A;  4N9H A;  3EYY A;  4MFE A;  1ZRC A;  1R1U A;  5D8K B;  5E3M A;  3WTY C;  3CES A;  2DA3 A;  4F93 B;  1LFB A;  1XCB A;  3IRQ A;  3G4S I;  3ERE D;  2EH3 A;  3P9C A;  3BRO A;  1Y0N A;  4KA4 A;  3DEE A;  1MBF A;  5F0H A;  4A0Z A;  4K2E A;  2BYV E;  1FSE A;  5E18 F;  4AC0 A;  5K5Q A;  3ZQH A;  3RZD J;  3HRT A;  2Y48 A;  5IOY A;  1LVK A;  2O8X A;  3I4N J;  3F8N A;  2ZO4 A;  2HNH A;  5H6R A;  4BQA A;  4UB6 C;  1Z9C A;  4BEH B;  5FKL A;  3FMQ A;  3PIO F;  3BZK A;  3M7G A;  1X1A A;  2P6S A;  3Q0W A;  3VDX A;  3OS2 A;  2GBY A;  2DA2 A;  5ICF A;  3FK7 A;  3L2Q A;  3A0H C;  2QEX I;  2CSO A;  2DA5 A;  4A69 C;  4CCJ A;  2W57 A;  4FT8 A;  1K4S A;  2XPV A;  3LL7 A;  3OYL A;  4KIG A;  1GV5 A;  3S93 A;  1CGP A;  1B1B A;  1R4M B;  4C2T A;  3ZPL A;  1R9T J;  4H4K C;  2GLO A;  1AHD P;  2JT1 A;  1W5C C;  2NVQ J;  2P81 A;  3EUA A;  2NXN B;  4C9Y A;  4CYC A;  3A4C A;  4L5I A;  1ZRD A;  3K4M A;  4G6Q A;  3PIP F;  1APL C;  3CC4 I;  5D5U B;  4ENJ A;  1TP4 A;  3RIR A;  1E3O C;  2W00 A;  2IBD A;  3E1S A;  3RYP A;  1UST A;  2V6E A;  4QPO A;  2EFW A;  3FHZ A;  2ECB A;  2CO5 A;  2F2E A;  2VJI A;  5HDG A;  1ZTR A;  4XRF A;  1KYW A;  3GLX A;  1MMS A;  3HC7 A;  5CVJ A;  3CDL A;  2H27 A;  3D5R C;  2Y30 A;  3CZ6 A;  1KGS A;  1JTX A;  4L9N A;  4UV9 A;  4B43 A;  1QHG A;  2GIZ A;  2XPU A;  4HV5 A;  4F91 B;  4WF2 A;  3MKL A;  3IV5 A;  3CP8 A;  4HNU A;  1V55 H;  1SC7 A;  4RAY A;  2HVQ A;  2ZNZ A;  1FMW A;  2BY0 A;  3SEQ A;  1YRN B;  4WXC A;  1JKQ C;  1GLN A;  1ZAR A;  2NS0 A;  4BS9 A;  2DQL A;  1Z3Y A;  3QP6 A;  1MDM B;  2VBY A;  3FK6 A;  2BVM A;  4E7J A;  2M3A A;  2C6Y A;  2A5W A;  2E1M C;  4IVN A;  3OYB A;  2BY3 A;  4OOI A;  2ETH A;  2DYS H;  3KCC A;  3ZQL A;  2CG4 A;  2E1O A;  1IRZ A;  1U78 A;  1EKE A;  2KP6 A;  3TQN A;  1JKR C;  3BC8 A;  3WHC A;  2FML A;  1XSD A;  1J09 A;  4QSH A;  2P5L C;  1F4K A;  1IRG A;  3HJE A;  3KEY A;  4PSW A;  1Z3X A;  4WX9 A;  1R71 A;  3WE2 A;  5KHD A;  4CYD A;  4L9J A;  2BGC A;  2F5E A;  1POG A;  1XC5 A;  1UB9 A;  2BBY A;  3RKW A;  1O7L A;  2LBF A;  3I9V 2;  4HBL A;  1BI1 A;  3NWT A;  4I2O A;  4LB6 B;  2DFE A;  3ABK H;  4RB3 C;  3OYK A;  3W3C A;  3TMO A;  2WV1 A;  3HIF A;  5ERI A;  3DXJ F;  2UV1 A;  2XUB A;  2RQQ A;  4G6D A;  5LHI A;  3IH3 A;  3ZCO A;  1RKW A;  1LDD A;  3LSI A;  3SHF A;  5LHH A;  4ESB A;  1O3T A;  1T6S A;  1XX5 A;  4EGZ A;  1FX7 A;  4WK8 F;  2M87 A;  4I0A A;  3C18 A;  4E6K G;  5J1R A;  2F5V A;  4BAC A;  1YFH A;  2PI0 A;  1TT5 B;  5BS6 A;  5IPA A;  2IS2 A;  1O57 A;  2NOG A;  3GUD A;  3MAJ A;  4J19 A;  3D5L A;  5FRO A;  4BJ6 C;  4HSR A;  3BY6 A;  5GTH C;  3IHU A;  3BZC A;  4IL6 C;  3FXL A;  1WH5 A;  2E19 A;  3COA C;  2XC7 A;  2L9R A;  2XB0 X;  3M9A A;  3DKX A;  4NBQ A;  4RMN A;  4CYC B;  1NG6 A;  3Q0V A;  4QIW N;  3J81 Z;  1HF0 A;  3F8B A;  3L1P A;  4BHP A;  3F22 A;  3QYE A;  3ZXS A;  4EM2 A;  3D1N I;  2K40 A;  5F0F A;  4A3J J;  2IVM A;  4J00 A;  2DJI A;  3JRA A;  2K5C A;  4LD5 A;  3A2K A;  3VB2 A;  2P7C B;  2FOK A;  5HDN A;  2W82 A;  4YIF A;  1ETO A;  2XGD A;  3SYT A;  4IQ4 A;  3TOA A;  3F9K A;  5K5O A;  1NG7 A;  1WJD A;  2OJE D;  3HBL A;  1MGT A;  4KIC A;  2BEO A;  4RGS A;  1YJN I;  1VZ0 A;  1YTY A;  2DMN A;  1IDY A;  2XGC A;  1O3S A;  2WY7 Q;  2DOD A;  4U87 A;  2ISY A;  3AFH A;  3IL2 A;  2R92 J;  1Y56 A;  3LSH A;  4P5O A;  5FLV A;  4JX4 A;  3DTI A;  4A3I J;  1YJW I;  3S1R J;  1FIA A;  2Z33 A;  4XNF A;  1MMN A;  1QPI A;  9ANT A;  4EQQ A;  2CV1 A;  1BC7 C;  4M3E A;  2WAE A;  1FBS A;  2DI3 A;  4UVC A;  3RPU A;  1J9I A;  4YEL A;  3QPL A;  4KIB A;  1XPX A;  1IXC A;  3IKV A;  1X1D A;  3I64 A;  1ZRE A;  3CJT B;  3K2Z A;  2P5V A;  4HPQ A;  1BM9 A;  3K2A A;  3Q9S A;  3KYC B;  1T08 B;  3QYB A;  4Y3O A;  3RTR A;  3CCR I;  1G59 A;  1TWH J;  4X0G A;  2B63 J;  4XKC A;  2LTP A;  2E34 A;  2EZK A;  2JUG A;  2Q2E A;  3S1M J;  4HG2 A;  3ERM A;  2ESN A;  2LBF B;  2F4M B;  2HXI A;  4BJ5 C;  1ETK A;  2H6B A;  4MGR A;  1KZH A;  4L5E A;  4D1Q A;  2XSD C;  4A3C J;  3OYN A;  3BR5 A;  4IHV A;  2R7X A;  2ZME C;  3OR1 C;  1WHU A;  3KEQ A;  1T8I A;  4ZDL A;  2QSF X;  4DZJ A;  4HAM A;  4QLC U;  2G7H A;  1T98 A;  2KJB A;  3O6B B;  4LMY A;  2CW8 A;  2WWY A;  2OCC H;  1PUE E;  1SD4 A;  2JPB A;  3H36 A;  4XLC A;  1R58 A;  4DNC A;  4DW6 A;  3WTX C;  2B9S A;  1JXS A;  1Z6T A;  3I54 A;  2CUZ A;  5D5V B;  1UCR A;  2IA2 A;  1UAA A;  1ODD A;  3K4J A;  3HOT A;  1N78 A;  3DLA A;  4CDG A;  4LLL A;  4GFB A;  3QPS A;  1NK2 P;  4B1R A;  4NC8 A;  3TED A;  4HRI A;  2HYF A;  1FZP B;  4XM3 A;  4EJV A;  2B7E A;  3FMS A;  4B48 A;  5GAE J;  1R6R A;  4IZZ A;  2X1C A;  1MJ9 A;  5B66 C;  2IGK A;  4RB0 A;  3WGI A;  2O5R A;  4Q5S F;  1KU3 A;  3SDB A;  2A05 A;  3TOB A;  3IH2 A;  2FEZ A;  3LA3 A;  2B0L A;  2AO9 A;  5CQG A;  1IF1 A;  1NTC A;  3QOD A;  2A07 F;  2QUF A;  3FM5 A;  3C1D A;  2RNG A;  1T56 A;  1WJB A;  3CUQ C;  2FNA A;  4MFD A;  3LAJ A;  3BG5 A;  3V7S A;  2PJR A;  3HTU A;  2VB6 A;  3S1Q J;  1SFX A;  1DQU A;  1XMX A;  4QWQ A;  2YS9 A;  5CQE A;  1JE8 A;  4A3G J;  1LEB A;  2HGC A;  3F3X A;  5HNF A;  1TQP A;  1IN5 A;  2MFZ A;  1K83 J;  2WAQ N;  1YQA A;  2DYR H;  3LSM A;  1DP7 P;  1HA8 A;  2L4M A;  2EZL A;  2GXA A;  4UUS A;  2K86 A;  1S5L C;  4D7M A;  3LMM A;  2R7O A;  2L7M P;  5C4J J;  3QP5 A;  3R0A A;  2H8R A;  1Q1H A;  1ETW A;  5HS7 A;  4LOC A;  2DOA A;  2LH9 A;  4S0H B;  5KNL A;  2Q2E B;  5DCM A;  1SFK A;  2MC4 A;  3M8E A;  4CHU A;  4JQF A;  2LMD A;  4I7H A;  4FAS D;  1WZ2 A;  2DJN A;  4OU0 A;  3OIO A;  1R00 A;  1V5F A;  4O3M A;  1R49 A;  3GLL A;  1H0M A;  4XRS A;  3GTQ J;  2FOW A;  1RC9 A;  1UG0 A;  5DEQ A;  1HQC A;  1MBE A;  5L3B A;  1TL8 A;  3BT9 A;  4IHY A;  1PUF A;  3CDI A;  4IJA A;  4LG0 B;  3LOC A;  3CCV I;  2YX4 A;  1RUN A;  5IP7 J;  2DT6 A;  4IRI A;  2Y75 A;  4BH9 A;  4RA2 A;  3EQL F;  1IAW A;  1DU0 A;  2JRT A;  3PQJ A;  3ECH A;  3HUG A;  1VQ4 I;  3KP5 A;  1J59 A;  3OOU A;  1A35 A;  2OUM A;  3WOD F;  2F6C A;  4KT5 C;  1R4N B;  4MEX F;  1OCP A;  5ICE A;  1IG7 A;  2HU9 A;  2R7S A;  1JT0 A;  1XGO A;  1ULY A;  2VQC A;  3KLO A;  3VYR B;  5LGN A;  3GFI A;  1KA8 A;  1OCC H;  4Y15 A;  3DLL F;  5BQT A;  2F5D A;  3HPH A;  2HZT A;  3HB9 A;  3JCU C;  2TCT A;  2FUG 2;  2IGM A;  1GDT A;  4X1E A;  4GRI A;  5AIP A;  3W6K B;  1VQ8 I;  2HOE A;  1SD7 A;  4PJL A;  1SVL A;  3DU5 A;  1H8A C;  2Y31 A;  3HKZ N;  1U5T C;  1TWC J;  5GAG J;  5IP6 A;  5K7Z A;  1W36 C;  2DPU A;  2PJR B;  4CSW A;  3HOY J;  3JRE A;  3J80 Z;  3WG7 H;  3H5A A;  4MNU A;  2CRG A;  2LKP A;  4V2G A;  5E79 C;  1QZY A;  2HTS A;  3TW6 A;  2DOE A;  5F6F A;  3Q0U A;  3D0S A;  2M30 A;  3PM1 A;  2VJJ A;  3CCY A;  3W2V A;  1NHA A;  2QQ8 A;  2P7V B;  3O8G A;  3GVA A;  3OYC A;  2LD5 A;  3HGY A;  4ITV A;  1BJA A;  2MGQ A;  1MJB A;  2DAO A;  4CCM A;  4UUS B;  2KIM A;  2ME6 A;  4EJW A;  5K1Y A;  2WAQ A;  3FBN B;  3E6B A;  3LSP A;  2E7X A;  2O7O A;  2GZW A;  1I50 J;  5DCM B;  2KDZ A;  3LSK A;  3PFY A;  4KMU X;  2NRA C;  1OFC X;  5BNG A;  1A6I A;  3AL0 B;  4JP0 A;  5BMZ A;  1SFU A;  3FIS A;  4Y17 A;  4A3B J;  3FXM A;  1V5G A;  2FMY A;  3S3M A;  3K70 D;  1XB4 A;  3OWT A;  5E1Z B;  3PQK A;  3CCM I;  4OIR F;  1FWZ A;  4PZJ A;  1A36 A;  1K4T A;  2J5P A;  1PUF B;  1YI2 I;  1KQ9 A;  4HF1 A;  5GP9 A;  2OCE A;  4A3K J;  1X3Z B;  3H0G J;  5LLQ A;  5C3E J;  4HLX A;  4YIR X;  3E0J B;  3CLO A;  2A5Y B;  1Z7L A;  2LSO A;  3HRM A;  4XKB A;  2PQ8 A;  3K10 A;  3MZY A;  2JSP A;  1IDZ A;  5FKK A;  5ED4 A;  3I4M J;  3HUG B;  1YLF A;  3BR6 A;  4GCV A;  3R60 A;  4YFK F;  3NRV A;  1MNE A;  1MBK A;  4KJZ A;  2QBY A;  3FM3 A;  1QVT A;  3IWZ A;  1SAX A;  1J0R A;  2ACJ A;  2EZH A;  2BHY A;  3OIP A;  4ABZ A;  4LJZ F;  1U0J A;  1AU7 A;  1EJ9 A;  2Z16 A;  3ZP5 A;  3TKY A;  1ENH A;  5FD6 A;  1JT6 A;  2V9P A;  1ZYR F;  3QU3 A;  4CZZ A;  2VL8 A;  1EF4 A;  3K7A J;  2PN6 A;  3G1O A;  4II3 A;  1IV6 A;  3BOQ A;  4KUM A;  1OPC A;  4I76 A;  3WU0 A;  5H6Q A;  1BN5 A;  4KIT B;  3OS1 A;  3BR3 A;  3M07 A;  2VJ5 A;  1T39 A;  1FP1 D;  4L9V A;  2CV2 A;  3D5S C;  3U1K A;  1S29 A;  2LLK A;  4XBF A;  1ZLJ A;  1D8J A;  5DS9 A;  3GTL J;  2OU2 A;  1LDK B;  1IN4 A;  3F6O A;  4FQG A;  4U7D A;  4JX5 A;  1MMA A;  1G3W A;  1JUS A;  4E4H A;  4QPQ A;  2M8G X;  1RES A;  4ZYG A;  4LIU A;  2HVS A;  2I8D A;  1I5Z A;  2QQ9 A;  2HS5 A;  1ZGJ A;  1VFC A;  2R3S A;  1JKP C;  1ZQ3 P;  5C4X J;  1YW8 A;  3HKZ A;  4L0Z B;  2QGU A;  1TWG J;  2CQQ A;  4EGY A;  1B9N A;  3DF8 A;  3NAU A;  1GVD A;  3T0Y A;  1WJC A;  1YIO A;  3ZRG A;  5ILU A;  2CW7 A;  2R5Z A;  4PCQ A;  1QZE A;  1J5Y A;  4L18 B;  4RGU A;  4U0W A;  4E7L A;  2ZJ2 A;  1X3W B;  4XRM A;  5HS8 A;  2HDC A;  4J01 A;  3N05 A;  1TQM A;  4M9S A;  3S3N A;  1XS9 A;  1R23 A;  2MAB A;  2NVX J;  3K6G A;  5D4R A;  3OL3 A;  3BTL A;  4C3H J;  1YYV A;  4HX8 A;  4I98 B;  2DFI A;  3QYF A;  1XDS A;  1EH7 A;  1VQK I;  4HZF A;  4EJT A;  4UY8 I;  1YOV B;  5B5E C;  1STZ A;  4A6E A;  2VBX A;  4XOT A;  4F3Q A;  1TBX A;  3V8L A;  1ETQ A;  5CVV A;  1D0Z A;  4LK1 F;  3S2W A;  4KIS A;  3NQO A;  1W7P D;  3A01 B;  3PSI A;  3BTJ A;  4HX7 A;  5L3G A;  4Y33 A;  4ZJZ A;  4L9T A;  3CO6 C;  3E6C C;  3IP4 B;  4PJJ A;  4IHX A;  4DYR A;  2VPL A;  5KVR A;  2TDX A;  2G7U A;  3KZY A;  4JYK A;  5GPA A;  2V9K A;  1P92 A; 
#chains in the Genus database with same CATH homology
 3B02 A;  3T1B A;  4WWC A;  1MDM A;  2IP2 A;  3EYI A;  1I6X A;  1IXS B;  1R1T A;  5J6X A;  1QZZ A;  5FLX K;  4M6Y A;  4OMY A;  2PG4 A;  3FF5 A;  2QBY B;  1HW1 A;  1HW5 A;  2P5K A;  1RIO H;  2H6C A;  2QWW A;  2DK5 A;  4YG2 F;  1S6L A;  3E5Q A;  4WXD A;  2VE9 A;  2PJP A;  4PGH A;  2E1C A;  3VFZ A;  5FLX Z;  3K9T A;  1PP8 F;  3I71 A;  2ISZ A;  3R61 A;  4BHC A;  1KQ0 A;  5FFX A;  4ZYH A;  3K0L A;  4GYI A;  4I01 A;  2X4H A;  2DTR A;  5JI6 A;  4ESJ A;  5F64 A;  4O5V A;  1ONV A;  1RNL A;  1REP C;  4P96 A;  2KIU A;  4IHS A;  2Z3Y A;  2VON A;  3BWG A;  4LLN A;  2MA3 A;  1J7K A;  3E97 A;  4UUV A;  2L4A A;  3JSP A;  2EFQ A;  3K1M A;  1DDN A;  1KU9 A;  1SD5 A;  1OYI A;  4E70 A;  1U8R A;  3LQR A;  2M8E A;  6PAX A;  4WXH A;  1AWC A;  4Z2Y A;  4IF4 A;  3V8K A;  2NYX A;  1SD6 A;  1O3Q A;  2MBF A;  2KRF A;  1W5S A;  3GW2 A;  4I02 A;  4M74 A;  4HDV A;  1ZGA A;  4JK1 X;  1G3Y A;  2ZME A;  5DDG A;  2MC3 A;  4UVB A;  4R8H A;  1V4R A;  4MQV A;  5HOO A;  3I58 A;  5AIQ A;  3WTZ A;  2QYO A;  4A0Y A;  2L54 A;  2BV6 A;  2FXA A;  4UXN A;  1HST A;  1XSV A;  3KP4 A;  2OZU A;  5K5R A;  4P55 A;  3F23 A;  2UXX A;  1Y0U A;  2ZCW A;  3EDP A;  4HQE A;  1IW7 F;  4GO1 A;  3HYI A;  2F5C A;  2ELH A;  1P2F A;  2Z5U A;  4B8X A;  2KJC A;  2DPD A;  2W24 A;  1B9M A;  5FO5 A;  4A2U A;  2YR2 A;  3J81 K;  2GIV A;  3CUQ A;  1VTN C;  2MD5 A;  1YS6 A;  4HQM A;  5D6F A;  4CIC A;  1HXD A;  2ZBK A;  1BIA A;  1K78 B;  5J8C A;  3L00 A;  4G7H F;  2JPC A;  3MCZ A;  1S8N A;  4AIK A;  4KN4 X;  2MH9 A;  3V4G A;  1FYL A;  1EH8 A;  1IN8 A;  5LEJ A;  2VOO A;  2A6H F;  4ON0 A;  3L7W A;  1LQ1 A;  2ZME B;  3GX4 X;  3SZT A;  3WTW C;  3DKW A;  3RJP A;  2O0Y A;  3WG9 A;  3MZH A;  1J2X A;  2M5W A;  1W7P A;  2VT2 A;  1WKM A;  1B6A A;  5HLI A;  3KET A;  1WRJ A;  3ZN0 A;  3DQV C;  2VT3 A;  2R7D A;  4A5M A;  2DK8 A;  1ZHF A;  2P6T A;  4A12 A;  4IRG A;  3CTA A;  3N4M A;  5LRS A;  4YFN F;  4HOB A;  1OMI A;  1SFE A;  1LVA A;  1D8K A;  5E1W A;  4XLN F;  4FX4 A;  5ICG A;  1TNS A;  3I4P A;  4LG0 A;  2EV5 A;  2COM A;  1BC8 C;  1SMT A;  1H9G A;  3GYH X;  3CUQ B;  4EVI A;  4HLY A;  4GXO A;  3AAF A;  1I1G A;  1ZG3 A;  4YFX F;  4ZZL A;  1R22 A;  3WE3 A;  2L3D A;  1KQ8 A;  3I0T A;  3HSF A;  2V6C A;  1FY7 A;  2ADU A;  2ZNY A;  5HS9 A;  4M9Z A;  2WV0 A;  2XV4 S;  2HFH A;  1Z6R A;  5DYM A;  5ILV A;  3TGN A;  3REO A;  1L0O C;  4NB5 A;  4RAZ A;  2XGX A;  3KEO A;  3M8F A;  5FD5 A;  1OYW A;  2FA5 A;  2K7L A;  1FP2 A;  1ON1 A;  1P4W A;  1JHF A;  4RB1 A;  1Z91 A;  4P9U A;  3BP8 A;  3P9K A;  3GZ5 A;  4A0X A;  2H94 A;  1W7P B;  1K79 A;  1RUO A;  1IUY A;  2A61 A;  1IZ1 A;  2ZXJ A;  3LA2 A;  1YW7 A;  3IKT A;  3ISP A;  5EEG A;  2L02 A;  2GA2 A;  1FOK A;  2A3S A;  3RDI A;  2QZ8 A;  2RGV A;  3H92 A;  5CYV A;  1L3L A;  3QPT A;  3Q9V A;  5CVU A;  2D1H A;  2F5F A;  4BXU A;  2X0L A;  2VXZ A;  3J7A O;  1XGN A;  5E8G A;  1U5T B;  1R1V A;  2VE8 A;  2FNP A;  2IT0 A;  3HRS A;  2FBH A;  5CVR A;  1G3T A;  5LGT A;  5BPD A;  3U1D A;  1USS A;  4H0E A;  3QPH A;  1F5T A;  2YX7 A;  1DPU A;  3KP6 A;  2XRN A;  3E3V A;  3JSO A;  3JAM Z;  3J80 K;  1TW2 A;  4HDU A;  3BPV A;  2A69 F;  1OYY A;  1Z1D A;  2OBP A;  2D2W A;  3WU1 B;  3ELK A;  2RV8 A;  3V8J A;  3MEX A;  1XGS A;  4UV8 A;  5A2Q Z;  3T5X A;  3BDD A;  4ESF A;  1FPQ A;  5E8I A;  2XVC A;  1YO5 C;  4XLP F;  5LEK A;  5IT9 K;  3BJO A;  3JW4 A;  4NQW A;  4ZH4 F;  2P8T A;  3L2C A;  4U88 A;  2MLG A;  2GXB A;  5IT9 Z;  1GHC A;  3F21 A;  3KE2 A;  2STT A;  4D0P A;  2MLK A;  3LAP A;  4G94 A;  4S05 A;  3ECO A;  3LST A;  2XAF A;  4AWX B;  4ETS A;  3FZV A;  1P6R A;  2OA4 A;  3FX3 A;  2V1U A;  2JZY A;  2W85 A;  1QGP A;  2XAQ A;  2GAU A;  3WGH A;  4PGG A;  3NEU A;  5DUK A;  2JTV A;  4M72 A;  3R6S A;  3O2P E;  3G3Z A;  1HSJ A;  2EK5 A;  4YII A;  1WQ2 A;  3QRF F;  3GWZ A;  3ZMV A;  2UXN A;  1EH6 A;  2M1B A;  1XSX A;  5CVI A;  3T8R A;  1Z05 A;  1ZLK A;  4I0B A;  3I53 A;  1QNT A;  4HF2 A;  2O61 A;  4MTE A;  4G8X A;  1BOA A;  1R5G A;  3LA7 A;  4IPA A;  2L01 A;  3ZN1 A;  3F6V A;  5F1R A;  2XHK A;  2A68 F;  3WTS C;  5LRR A;  2RC4 A;  2HTJ A;  4OIO F;  1A04 A;  2IJL A;  4Y13 A;  1WSU A;  4U7B A;  5BOX A;  2VBW A;  3V7C A;  3TO6 A;  3F8C A;  1TNT A;  2XAS A;  5FB2 A;  4KMF A;  3F8F A;  1RI7 A;  3CO7 C;  4CXF A;  5JFR A;  3F72 A;  4ENM A;  3TO7 A;  1XGM A;  5DV5 A;  3JTH A;  3B73 A;  2PMU A;  4OMZ A;  2FQ3 A;  4A6D A;  1X3U A;  2JSC A;  2HQR A;  2QQB A;  3RI4 A;  2VC1 A;  2CQK A;  3BPX A;  2EWN A;  1RZ4 A;  2FU4 A;  2ZFW A;  1ON2 A;  4JBA A;  1V3F A;  3F8M A;  2BE5 F;  2GA1 A;  4MQ9 F;  2OQG A;  4MTD A;  5E17 F;  4KNY A;  3GXO A;  3CJN A;  1K6O A;  1ZAO A;  1R7J A;  1YS7 A;  2HKO A;  2XKP A;  3TO9 A;  1CF7 A;  5HLH A;  2E1N A;  1E17 A;  5EEH A;  1KU7 A;  4PDK A;  1LB2 A;  4KN7 X;  4KDP A;  3HRU A;  3BJA A;  3ZMU A;  3KZZ A;  4LFU A;  1MJA A;  3IC7 A;  2YU3 A;  1IXR C;  3DV8 A;  3I5U A;  2EA4 A;  2VOD A;  1T38 A;  1FC3 A;  3DPL C;  3RKX A;  3ULQ B;  3WGG A;  1K78 A;  4I09 A;  4ZZD A;  5HVQ C;  1WI9 A;  5FFZ A;  3WTU C;  2EV0 A;  3M1E A;  3U9G A;  4OIP F;  2QVO A;  4GYG A;  4EV0 A;  2O6G E;  1I1S A;  4L0Y B;  3ABT A;  1EV7 A;  4AD9 A;  2FSW A;  1YG2 A;  3E6M A;  5KK1 A;  1QBJ A;  2W84 A;  4HYE A;  5HDK A;  2HQN A;  1AOY A;  1S7A A;  2Q0O A;  1XD7 A;  4CGZ A;  1ZG1 A;  3SQN A;  2CGP A;  1TTY A;  1ZRF A;  2QQA A;  5D5X B;  1LJ9 A;  3LWF A;  5TRD A;  4BNC A;  4TV7 A;  2OZ6 A;  2VC0 A;  2OAZ A;  3OOP A;  2XIG A;  2LF7 A;  3HSE A;  1PDN C;  5JHU A;  3CDH A;  1CF7 B;  2RDP A;  3T8T A;  5D5W B;  1KU2 A;  2RKH A;  2FF4 A;  4O6J A;  2EB7 A;  1O7F A;  3MFK A;  2Z99 A;  3HHH A;  4HV6 A;  2VOP A;  2P4W A;  2D45 A;  4CO8 A;  3FXU A;  2UZK A;  4HF0 A;  3H3U A;  2FBK A;  4R79 A;  3ROU A;  1G4D A;  1W4M A;  1BI0 A;  4ENN A;  3VEP A;  2XKO A;  4MHG A;  5FGM A;  3K1P A;  1GXP A;  1LEA A;  2DW4 A;  5BPI A;  2CFX A;  3IRR A;  3E6D A;  5E1X A;  4M9X A;  1D3Y A;  4AVP A;  2K27 A;  2NNY A;  2A6E F;  3SZP A;  1ZH5 A;  1R5H A;  1LNW A;  4XSZ F;  4EMS A;  2EV6 A;  4RS8 A;  4Q47 A;  3HOS A;  4OIQ F;  1BBY A;  4HW0 A;  4MEY F;  1FSH A;  3ZMZ A;  3K69 A;  4BAY A;  3ZMD A;  2D1V A;  2EFO A;  4UVA A;  2R7F A;  5DCF A;  4RGX A;  4GGG A;  4ZYE A;  3PFI A;  5LHG A;  4FX0 A;  1E2X A;  3ZMS A;  3Q5F A;  1U3E M;  3VOD A;  5D6E A;  2LF8 A;  5DUI A;  2EA2 A;  2OD5 A;  5ILS A;  2WC2 A;  2K02 A;  4KIF A;  3U2R A;  4WCG A;  3OV8 A;  3FMR A;  4P9F A;  2V1X A;  4G9Y A;  4RGR A;  4M73 A;  4ASN A;  1U5T A;  2XRO A;  3CUO A;  5AON A;  3G73 A;  2GWR A;  4AIH A;  2K4J A;  2IRF G;  3KLN A;  2DLL A;  1ZN2 A;  2M45 A;  5LGU A;  1S7O A;  4N0B A;  1UFM A;  3GFM A;  1U6G A;  2Z9O A;  1T0F A;  4M6X A;  1R36 A;  1TW3 A;  2XAH A;  1DUX C;  1HKT A;  4LK0 F;  5D4S A;  2LDU A;  3EUH A;  4HA8 A;  5D8L B;  5JVT A;  2YSR A;  1F1Z A;  1U2W A;  5E20 A;  2VN2 A;  1UHW A;  2VBZ A;  3SXY A;  2CW0 F;  2EFN A;  4HX4 A;  3DEU A;  4KYW A;  2STW A;  1IRF A;  2IA0 A;  1FYM A;  3GO5 A;  4Q4Z F;  2CYY A;  3EET A;  4UNO A;  2IA1 A;  2QEN A;  3GF2 A;  2PFB A;  3RPQ A;  1KYZ A;  2G9W A;  3L09 A;  4AIJ A;  3GFL A;  1HKQ A;  5JR3 A;  2HYG D;  1LDJ A;  3KP2 A;  1O3R A;  4EJO A;  2AS5 F;  2IW5 A;  2DT5 A;  1PP7 U;  5J8F A;  3QU6 A;  3C7J A;  4EM1 A;  2MH2 A;  2PBI A;  3ZQ7 A;  3MWM A;  4IXA A;  1QQI A;  3HSR A;  3L9F A;  3KP3 A;  3JAM K;  3P9I A;  1Z7U A;  3FXQ A;  2W25 A;  2IPQ X;  3TDZ C;  2NAZ A;  3E5X A;  2V79 A;  3QOP A;  3IWF A;  5DD8 A;  1T2K A;  1S3J A;  4G7O F;  2AXL A;  5HLG A;  2FBI A;  1TQI A;  4LB5 A;  2J5O A;  2O03 A;  5A2Q K;  3TDU C;  2E7W A;  3RKY A;  1HW2 A;  1YW9 A;  4B09 A;  5LBQ A;  2WTE A;  2QM3 A;  3ZMT A;  3C3W A;  2EJR A;  2NNN A;  1FLI A;  1BI3 A;  1JHH A;  5TJJ A;  2V1D A;  2GQQ A;  1JGS A;  2FRH A;  4M71 A;  4R1H A;  1QPM A;  4BYY A;  2DBB A;  2CWE A;  1BI2 A;  4U0V A;  2Q8K A;  3DPT A;  2DO7 A;  4U0Y A;  1GVJ A;  2HKX A;  3LQQ A;  1B4A A;  2RN7 A;  1F9N A;  3ML6 A;  1ZG5 A;  2PLY A;  5DD4 A;  1W5T A;  1DPR A;  2XAG A;  2KIF A;  3GFJ A;  4ENK A;  2V9V A;  2Y0M A;  1J75 A;  4BHB A;  5L3D A;  1MKM A;  1G6N A;  1FBQ A;  1QO0 D;  2OQR A;  5L3C A;  1MD0 A;  3JTG A;  4G7Z F;  4L5J A;  2FE3 A;  2GXG A;  4LGW A;  3I59 A;  3K1N A;  4KFC A;  3N97 A;  2ESH A;  1GXQ A;  1XDU A;  2DQR A;  3KP7 A;  3ABU A;  3KFW X;  4RB2 C;  1P4A A;  2XAJ A;  1WWX A;  3SFZ A;  2K4B A;  5H20 A;  2LNB A;  3GEZ A;  2UWM A;  3H3Z A;  5IT3 A;  4FHT A;  3QAH A;  4XSX F;  3DP7 A;  3P7N A;  2KKO A;  4N9I A;  1FT9 A;  1K7A A;  2YPR A;  2PEX A;  3R0J A;  5L3F A;  3WTV C;  3V7R A;  1FYK A;  2RVC A;  4S04 A;  4F7Z A;  3WTT C;  3HTS B;  4ZYD A;  1B59 A;  4UHT A;  2PMH A;  1BIB A;  3O3K A;  3FXR A;  1FBU A;  1XCV A;  3DFG A;  4EM0 B;  5L3E A;  4IHT A;  2HR3 A;  1D5V A;  1IN6 A;  3BZ6 A;  4NHJ A;  3GZ6 A;  1OR7 A;  2ZKZ A;  3FWE A;  1XMK A;  2EFP A;  1SMY F;  1H9T A;  1OKR A;  2RNJ A;  2QLZ A;  1C0W A;  2O3F A;  1FNN A;  1IN7 A;  3VOE A;  3LFK A;  1XMA A;  5CJ9 A;  3I59 B;  2HEO A;  3MQ0 A;  5CLS A;  2H09 A;  3RYR A;  4DQ2 A;  4OIN F;  2HWV A;  4LLG F;  1G3S A;  4A5N A;  3E5U A;  1I27 A;  5ICC A;  3W6J B;  1MZB A;  2RQP A;  1TLH B;  3HHG A;  1XN7 A;  3R4K A;  1P4X A;  1UHM A;  1HBX G;  3BJ6 A;  1HKS A;  4IRH A;  4EJU A;  2DU9 A;  4Q48 A;  4N9H A;  3EYY A;  1ZRC A;  1R1U A;  5D8K B;  3WTY C;  1XCB A;  3IRQ A;  3ERE D;  3P9C A;  3BRO A;  4KA4 A;  4A0Z A;  4K2E A;  2BYV E;  1FSE A;  5E18 F;  5K5Q A;  3HRT A;  2Y48 A;  2O8X A;  3F8N A;  2ZO4 A;  5H6R A;  4BQA A;  1Z9C A;  3FMQ A;  3M7G A;  2P6S A;  5ICF A;  2CSO A;  2W57 A;  4FT8 A;  4KIG A;  1CGP A;  1B1B A;  3ZPL A;  2JT1 A;  4L5I A;  1ZRD A;  4G6Q A;  5D5U B;  4ENJ A;  3RIR A;  3RYP A;  1UST A;  2EFW A;  3FHZ A;  2CO5 A;  2F2E A;  5HDG A;  4XRF A;  1KYW A;  3GLX A;  5CVJ A;  2H27 A;  4L9N A;  1KGS A;  4UV9 A;  4HV5 A;  4WF2 A;  4RAY A;  2ZNZ A;  4WXC A;  1ZAR A;  2NS0 A;  2DQL A;  3QP6 A;  1MDM B;  2VBY A;  2C6Y A;  4IVN A;  4OOI A;  2ETH A;  3KCC A;  2CG4 A;  1U78 A;  3TQN A;  2FML A;  1XSD A;  2P5L C;  1F4K A;  1IRG A;  4WX9 A;  3WE2 A;  4CYD A;  4L9J A;  2BGC A;  2F5E A;  1UB9 A;  2BBY A;  3RKW A;  1O7L A;  4HBL A;  1BI1 A;  4I2O A;  4LB6 B;  4RB3 C;  3HIF A;  5ERI A;  3DXJ F;  2XUB A;  4G6D A;  5LHI A;  1LDD A;  3SHF A;  5LHH A;  4ESB A;  1O3T A;  1T6S A;  4EGZ A;  1FX7 A;  4WK8 F;  2M87 A;  4I0A A;  3C18 A;  1YFH A;  2PI0 A;  5BS6 A;  1O57 A;  3GUD A;  3MAJ A;  3D5L A;  3BY6 A;  3IHU A;  3COA C;  3M9A A;  3J81 Z;  3F8B A;  4BHP A;  3F22 A;  4EM2 A;  2IVM A;  4LD5 A;  3VB2 A;  2P7C B;  2FOK A;  5HDN A;  4YIF A;  3TOA A;  5K5O A;  1MGT A;  4KIC A;  2BEO A;  4RGS A;  1YTY A;  1O3S A;  2ISY A;  3IL2 A;  4P5O A;  2Z33 A;  4EQQ A;  1BC7 C;  1FBS A;  2DI3 A;  4UVC A;  3RPU A;  1J9I A;  4KIB A;  1IXC A;  3IKV A;  3I64 A;  1ZRE A;  3K2Z A;  2P5V A;  1BM9 A;  3Q9S A;  3RTR A;  2Q2E A;  2ESN A;  2H6B A;  4MGR A;  3KEQ A;  4QLC U;  4HAM A;  2G7H A;  1T98 A;  2KJB A;  3O6B B;  4LMY A;  2WWY A;  1PUE E;  1SD4 A;  2JPB A;  4DNC A;  1R58 A;  3WTX C;  1JXS A;  1Z6T A;  3I54 A;  5D5V B;  1UCR A;  2IA2 A;  1ODD A;  3HOT A;  4CDG A;  4LLL A;  2HYF A;  1FZP B;  4EJV A;  3FMS A;  1MJ9 A;  4RB0 A;  3WGI A;  4Q5S F;  1KU3 A;  3TOB A;  2FEZ A;  3LA3 A;  2B0L A;  1IF1 A;  2A07 F;  2QUF A;  3FM5 A;  3C1D A;  3CUQ C;  2FNA A;  3LAJ A;  3V7S A;  3HTU A;  1SFX A;  4QWQ A;  1JE8 A;  1LEB A;  2HGC A;  3F3X A;  1TQP A;  1IN5 A;  1YQA A;  1DP7 P;  2L4M A;  2K86 A;  3QP5 A;  3R0A A;  1Q1H A;  5HS7 A;  5DCM A;  3M8E A;  4CHU A;  4JQF A;  4I7H A;  4OU0 A;  1R00 A;  4O3M A;  1H0M A;  5DEQ A;  1HQC A;  5L3B A;  4LG0 B;  4IJA A;  2YX4 A;  1RUN A;  4IRI A;  2Y75 A;  4BH9 A;  3EQL F;  1IAW A;  2JRT A;  3PQJ A;  3ECH A;  3HUG A;  3KP5 A;  1J59 A;  3WOD F;  4KT5 C;  4MEX F;  5ICE A;  1XGO A;  1ULY A;  3KLO A;  5LGN A;  3GFI A;  1KA8 A;  4Y15 A;  5BQT A;  2F5D A;  2HZT A;  3W6K B;  5AIP A;  2HOE A;  1SD7 A;  1U5T C;  2DPU A;  3J80 Z;  4MNU A;  2LKP A;  1QZY A;  2HTS A;  5F6F A;  3D0S A;  2M30 A;  1NHA A;  2P7V B;  3GVA A;  1BJA A;  1MJB A;  2DAO A;  2KIM A;  4EJW A;  5K1Y A;  3E6B A;  2E7X A;  2GZW A;  5DCM B;  4KMU X;  2NRA C;  5BMZ A;  1SFU A;  4Y17 A;  2FMY A;  1XB4 A;  5E1Z B;  3PQK A;  4OIR F;  1FWZ A;  4PZJ A;  2J5P A;  1KQ9 A;  4HF1 A;  5LLQ A;  4HLX A;  3HRM A;  3CLO A;  2A5Y B;  2LSO A;  2PQ8 A;  3MZY A;  5ED4 A;  1YLF A;  4GCV A;  3R60 A;  4YFK F;  3NRV A;  2QBY A;  3FM3 A;  3IWZ A;  1SAX A;  1J0R A;  2ACJ A;  4LJZ F;  3ZP5 A;  3TKY A;  5FD6 A;  1ZYR F;  3QU3 A;  4CZZ A;  2PN6 A;  3BOQ A;  4KUM A;  1OPC A;  3WU0 A;  5H6Q A;  1BN5 A;  1T39 A;  1FP1 D;  4L9V A;  1S29 A;  4XBF A;  1ZLJ A;  1D8J A;  2OU2 A;  1LDK B;  1IN4 A;  3F6O A;  4U7D A;  1G3W A;  4ZYG A;  1I5Z A;  2QQ9 A;  2HS5 A;  1ZGJ A;  2R3S A;  1YW8 A;  4L0Z B;  4EGY A;  1B9N A;  3DF8 A;  3T0Y A;  1YIO A;  5ILU A;  4PCQ A;  1J5Y A;  4L18 B;  4RGU A;  4U0W A;  2ZJ2 A;  5HS8 A;  2HDC A;  1TQM A;  4M9S A;  1R23 A;  5D4R A;  1YYV A;  4HX8 A;  4I98 B;  2DFI A;  1XDS A;  1EH7 A;  4HZF A;  4EJT A;  1STZ A;  4A6E A;  2VBX A;  1TBX A;  3V8L A;  5CVV A;  3S2W A;  4LK1 F;  3NQO A;  1W7P D;  4HX7 A;  5L3G A;  4L9T A;  3CO6 C;  3E6C C;  5KVR A;  2TDX A;  2G7U A;  3KZY A;  1P92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...