4OMYA

Crystal structure of semet nolr from sinorhizobium fredii in complex with oligo at dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
pubmed doi rcsb
source organism Sinorhizobium fredii
molecule tags Transcription/dna
molecule keywords NolR
total genus 31
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4omyA00
2HGCA 1F1ZA 4N0BA 3VFZA 5D5XB 1BC7C 1FNNA 3WGIA 1UB9A 1SMTA 3ISPA 3WTTC 3U1DA 2A69F 3KEOA 2L54A 1W7PD 5E1WA 4EMSA 1B4AA 2VXZA 4BQAA 3CO7C 2Y0MA 1XMKA 1O3QA 2HQNA 2Q0OA 3H3UA 2RC4A 2XAJA 4RB0A 1A04A 5DCMA 2GXBA 3ERED 5IT9K 5KK1A 3DF8A 2FSWA 1T0FA 1J59A 2XIGA 1STZA 1SMYF 3VOEA 1R1UA 1K6OA 1GVJA 2CFXA 3E6MA 4HX4A 2DW4A 2V1DA 2QZ8A 3Q9SA 2PI0A 1ZGAA 1BM9A 3ULQB 1YIOA 3E97A 5L3FA 4CDGA 3ZN0A 1KQ8A 3LA7A 2VOOA 1RUOA 5D4RA 4HLXA 4KMUX 3KP5A 2CW0F 1LNWA 2EV6A 2RNJA 1KQ0A 1RZ4A 4ENMA 4LG0A 1QBJA 1IN4A 2BYVE 4RAZA 3LWFA 1LEBA 1GHCA 1KYZA 3BDDA 1I6XA 1JHFA 4Q4ZF 1RIOH 1O7LA 4Q47A 2RVCA 3JTHA 2GA1A 4LG0B 3BJ6A 2VBWA 2ZMEA 5CLSA 2ISYA 1BJAA 4IRHA 3RKXA 1IXSB 5J8CA 4KIBA 2ZNZA 2OQRA 2EA4A 2P4WA 3MZHA 4F7ZA 2ADUA 2DPDA 1HQCA 1T38A 5E8IA 3TGNA 3ZMVA 4UVAA 2FBIA 2BE5F 4M73A 3HSEA 3KP4A 4ON0A 4UV8A 2P5VA 2HTSA 4WWCA 1WSUA 2MBFA 3FMQA 5K5OA 2R7DA 4Q5SF 4AVPA 4OIOF 3F8BA 5F6FA 3LSTA 1PUEE 4RGRA 5CVVA 2HKOA 1XN7A 2V1XA 3KP2A 2JSCA 4EJTA 4ZZDA 2MC3A 3R60A 3IKTA 4KT5C 2LF8A 1FYMA 1ZGJA 5ICFA 1KGSA 3WG9A 2G9WA 4B09A 2M8EA 1XGMA 1MJ9A 3TQNA 3KEQA 1XGNA 4HOBA 4I09A 4QLCU 3P7NA 1BBYA 3QU3A 4CICA 3BY6A 2IJLA 3KP7A 3ZQ7A 1IN6A 2IW5A 2BGCA 1OYYA 4KN7X 1BI2A 2CSOA 3MAJA 1FYKA 1YW8A 5TJJA 4PGHA 3V7RA 1YFHA 4Y17A 4M72A 2EV5A 4OIRF 2M30A 1T2KA 4NQWA 2EFWA 2W85A 2M1BA 4G7ZF 4XSZF 3IRRA 1Z05A 4ZYEA 1S7AA 3ABTA 2XUBA 1RUNA 2YSRA 1XSVA 1ZHFA 2P5KA 2Y75A 5HLHA 2XKOA 1KU3A 1U5TC 3NRVA 2XAHA 3IRQA 3MZYA 3R6SA 2OAZA 3B73A 3K9TA 3F8NA 1XSXA 2W84A 2P8TA 3K1MA 3TOBA 3V7CA 5BPDA 1SD5A 4GO1A 1CF7A 1ZG3A 1E17A 4M71A 1HKTA 4ASNA 3GUDA 1TBXA 1RNLA 3J81Z 4ENNA 1TQMA 3JSOA 2K7LA 4H0EA 4LJZF 3EUHA 3D0SA 1J75A 1MJAA 1R5HA 5CVJA 1DPUA 3FMSA 1ZRCA 1FSEA 3I59B 2QVOA 4EJUA 3M7GA 1HKQA 2FF4A 2IP2A 2Z3YA 2L01A 3SXYA 4YFNF 4OMYA 3DPLC 3K0LA 4PDKA 2XAQA 3S2WA 2P7VB 3RDIA 3TDZC 2OD5A 4P5OA 3L09A 2F5EA 1YO5C 3LA2A 1U8RA 4HDUA 3F3XA 5L3GA 5HOOA 3G73A 1J0RA 1FWZA 3GXOA 5E17F 3HHHA 2EV0A 3ELKA 1OMIA 1YLFA 4D0PA 2VE8A 3KLNA 3GEZA 4A5MA 3J7AO 5FB2A 3F8MA 3ZP5A 2Z9OA 2FU4A 3WTYC 1W7PA 5D8LB 3FX3A 2ESHA 2FEZA 1MDMB 2P7CB 2V6CA 2KJCA 1ZN2A 1F9NA 2HEOA 4FT8A 1ZLJA 3RYPA 1U5TB 3F72A 2O03A 4BNCA 3FF5A 3I71A 4ZYHA 3DPTA 1ZRFA 2DU9A 4U7BA 3ABUA 5CYVA 3HIFA 5ICGA 1U2WA 3FXRA 1USSA 5KVRA 3WTWC 1BN5A 1Z6RA 2XRNA 1R00A 3M8FA 2P5LC 1J9IA 2WC2A 3M9AA 3SHFA 1AWCA 4KA4A 1KU7A 3EETA 5HS9A 2DTRA 1IN8A 2RGVA 4WCGA 3GVAA 1TNTA 3GFMA 2Z5UA 2FOKA 1FC3A 3KETA 1YTYA 3F6VA 3ECOA 3ECHA 2TDXA 2RDPA 1E2XA 5LGUA 4P9FA 3W6JB 3HRMA 2L02A 4WXDA 3WTXC 1UCRA 1FLIA 3R0AA 2F2EA 3BJAA 3E6DA 3I4PA 2GIVA 4WK8F 4I02A 1T39A 5CVUA 1G3WA 2OZ6A 2V9VA 2RQPA 3L7WA 3W6KB 3DP7A 2GXGA 3F21A 4PCQA 3GZ6A 1EH7A 1LJ9A 1U78A 1IRGA 2X0LA 4KNYA 3WGHA 1U3EM 4RS8A 3KZYA 5HLIA 4S05A 4A5NA 4WXHA 2H6BA 3QRFF 2UXXA 1IF1A 1QGPA 2ZXJA 4P55A 5E1XA 1P6RA 1FSHA 3GF2A 4WXCA 4G7OF 3WTZA 2AS5F 3BPXA 4U0WA 3NEUA 5ICCA 3Q9VA 1ZYRF 4LLGF 5A2QK 1XB4A 3QP5A 1UHMA 2NNNA 5LEJA 2COMA 3FXQA 5AIPA 2P6SA 3O2PE 3SZTA 5H6QA 5HLGA 3K1PA 3IHUA 4M9ZA 5DEQA 4A6DA 4KICA 4IVNA 3WTUC 3JTGA 1S8NA 4EJOA 4ZYGA 1OKRA 3VODA 4L0YB 2JPBA 3GW2A 3SFZA 5J6XA 3KLOA 4L18B 1L0OC 1WWXA 1QZZA 3I54A 5D4SA 3GFJA 2QM3A 2ZMEB 1W4MA 3IWZA 1O3TA 1QZYA 4IRIA 3QAHA 2A68F 2W57A 1WQ2A 5F1RA 2STTA 2PJPA 3V8JA 3WODF 5HDGA 2W25A 3QPHA 4HW0A 4KUMA 1IW7F 2KIUA 1G3YA 2KRFA 5LHIA 2DQRA 4L5JA 2R7FA 1IN5A 2CWEA 4G8XA 2MD5A 2OA4A 1SD4A 4M74A 3BOQA 4LK1F 4UNOA 1TQIA 4LK0F 3HOTA 4G9YA 4XLPF 2A61A 4XBFA 1IUYA 2YR2A 4MQVA 5D5VB 2ZNYA 4EM2A 1RI7A 5AIQA 2RV8A 4L0ZB 5F64A 4L5IA 1VTNC 1BIBA 4PGGA 1B9NA 1U5TA 4R8HA 2G7HA 2EK5A 1G3SA 2Q2EA 4FHTA 4ESFA 3CTAA 1LVAA 2DQLA 3CJNA 1LEAA 1X3UA 4RGXA 5LBQA 1FPQA 4NB5A 1B59A 4MEYF 5K1YA 2HYFA 4L9VA 5EEHA 2LF7A 2VOPA 1MZBA 2LKPA 2M5WA 5LRSA 2CG4A 4U0YA 2OQGA 2WV0A 4I7HA 2PFBA 2QBYA 1FZPB 3L9FA 5FLXK 2XHKA 3FMRA 1S7OA 4HF1A 1R7JA 3QU6A 3I0TA 1W7PB 3E5UA 3DEUA 2ZBKA 3RJPA 2GQQA 5HS8A 1WRJA 2H09A 5EEGA 2QBYB 3FXUA 4E70A 1I1SA 1HW2A 2XVCA 1SFEA 1LB2A 4BH9A 2UZKA 4JK1X 2MH9A 2E7WA 4AD9A 4CXFA 3V4GA 5CVIA 1D5VA 5FO5A 2MLGA 2FE3A 2VE9A 2HR3A 3FHZA 4AIJA 1H9TA 1ODDA 4BXUA 4HF2A 2QWWA 3GFIA 4LFUA 1QNTA 4ENJA 1BI0A 1P4AA 5DCFA 3DFGA 1MJBA 4KIFA 2HOEA 1S6LA 1Z1DA 2IRFG 4P9UA 1XCVA 2BV6A 1XSDA 2LDUA 2EWNA 1JHHA 2XV4S 1H0MA 2YU3A 4A0XA 2XKPA 1JXSA 2ETHA 3CLOA 2JRTA 5HDNA 1R5GA 3N97A 3M1EA 5D5UB 3KP3A 2PEXA 4HBLA 3I64A 1MGTA 1FP2A 2HFHA 1SD7A 1H9GA 2EA2A 5JR3A 1T98A 5D5WB 5D6FA 1DDNA 4BHPA 3ML6A 4LGWA 3FZVA 2CGPA 2OZUA 1SFUA 2HTJA 3E3VA 4M9XA 3RIRA 4RB2C 1FOKA 4HYEA 1DP7P 5K5RA 4MGRA 3C1DA 1Z6TA 1REPC 5LHGA 3EYYA 5D8KB 1YW7A 4WF2A 1FX7A 4MTEA 2NYXA 1P4XA 4KMFA 4EM1A 3I58A 2L4AA 1Z9CA 5H6RA 2FQ3A 2UXNA 3MFKA 1MKMA 5LHHA 2DK5A 1IXRC 5L3BA 1YG2A 2STWA 1GXQA 2X4HA 3N4MA 2JTVA 2HQRA 4BHCA 2NNYA 2GA2A 4EM0B 2PLYA 1W5SA 3JSPA 2HYGD 3HSFA 1W5TA 4IHTA 2CYYA 2OBPA 5LEKA 1G4DA 3PQKA 5DDGA 1YYVA 1XCBA 4ZZLA 3HTSB 3QPTA 1ZG1A 4UVCA 2EFQA 4Z2YA 1L3LA 1U6GA 1HSJA 4YFXF 1NHAA 4BYYA 4CGZA 2VBXA 2O6GE 3P9KA 2D1HA 2H6CA 1I1GA 2L4MA 2ZCWA 4LLLA 4L9TA 1K79A 4NHJA 4HDVA 3T8TA 2E1CA 4IJAA 1D8JA 4EJWA 4PZJA 4KFCA 4JBAA 3O6BB 2ZFWA 4JQFA 1TLHB 3TO6A 5A2QZ 4HZFA 3GFLA 1EH8A 1TQPA 2GWRA 1HBXG 1KU2A 1BI1A 2F5DA 4OINF 2QLZA 2IA2A 4L9NA 4XRFA 2WTEA 3V8LA 2YPRA 5LGTA 3P9IA 3HTUA 1K7AA 5LGNA 3OV8A 4I0AA 1TW2A 1XD7A 1DUXC 3H92A 2IPQX 4FX4A 2XGXA 1O3SA 4IXAA 3V8KA 2E1NA 2XAFA 3LQRA 5FD5A 3TO9A 5DUKA 5BPIA 3TOAA 2RKHA 3L00A 2KIFA 2D45A 3LQQA 4A6EA 3GLXA 3B02A 4DQ2A 1FYLA 3E5QA 2YX7A 3BP8A 2O0YA 1P92A 2F5CA 3E6CC 1PDNC 2XAGA 2D2WA 5ILSA 3OOPA 4B8XA 1WI9A 4AWXB 2MH2A 2VT3A 2O8XA 4AIHA 5FFZA 2FMYA 5L3EA 1Z91A 1IAWA 4Y13A 4P96A 2D1VA 4IHSA 3DQVC 2UWMA 1XDSA 3GO5A 4KDPA 4LB6B 2ZO4A 3LAPA 2J5OA 2Z33A 5IT9Z 4OIQF 2FMLA 2EJRA 3REOA 1QQIA 4KIGA 3FM3A 4A2UA 2O3FA 3F23A 3IL2A 1O3RA 1ZAOA 3BWGA 2VN2A 5ED4A 4RGSA 2VBYA 1GXPA 3C7JA 1ZRDA 3GX4X 3K1NA 4ZH4F 5HDKA 4A0ZA 2V1UA 1S29A 5ILVA 4GGGA 4O3MA 2AXLA 3RKWA 4RB1A 2FRHA 3GZ5A 3T1BA 1XDUA 4QWQA 5L3DA 2O61A 4HX8A 1BC8C 4GYIA 2NAZA 3D5LA 3KFWX 4OIPF 1QPMA 2HDCA 3K69A 4GCVA 4K2EA 4CZZA 2EFNA 6PAXA 3WE2A 3M8EA 2VT2A 4HF0A 3EDPA 3T8RA 1XGSA 4MTDA 5LRRA 4BHBA 2DAOA 3DXJF 4HV6A 2VONA 5BMZA 1AOYA 2K4BA 3JAMK 3C18A 1XMAA 3HHGA 3RYRA 4DNCA 1LDDA 2HS5A 2PN6A 2WWYA 2A07F 3U2RA 5E20A 4UV9A 1BI3A 4MQ9F 2BEOA 1YS7A 3CDHA 2CQKA 2ZJ2A 4R79A 2A6HF 2QQ9A 3KCCA 2JZYA 4EV0A 2VC0A 4LB5A 3ZMUA 5JI6A 2MA3A 1S3JA 4UXNA 1UHWA 1HXDA 3E5XA 2DFIA 1LDJA 1ONVA 2Z99A 3PFIA 1JE8A 1HW1A 1SFXA 4UHTA 3CO6C 1ZREA 1IRFA 1XGOA 1FT9A 1R23A 1BIAA 4TV7A 4Y15A 4HAMA 2H27A 4O6JA 1HKSA 4WX9A 5DCMB 1B1BA 3ZMDA 3O3KA 2M45A 2IA0A 1LQ1A 4YIIA 1J7KA 1Q1HA 1IN7A 4BAYA 2QQBA 3COAC 3IWFA 5FGMA 4CHUA 4YIFA 2JPCA 1JGSA 4A0YA 1F5TA 2FA5A 3F8CA 1ZG5A 2F5FA 2HZTA 4LD5A 5FD6A 2ELHA 3ZMTA 2L3DA 3HSRA 1R1VA 2IA1A 4R1HA 2Q8KA 4EQQA 2HWVA 4U7DA 2R3SA 2GZWA 4O5VA 3I59A 2MLKA 5K5QA 1R58A 1QO0D 2ACJA 5DD8A 1Y0UA 2W24A 1OPCA 3ZPLA 1K78B 1D3YA 1O57A 5ERIA 3WU0A 1ON1A 5LLQA 5FLXZ 2QYOA 3HRTA 5HS7A 3QOPA 2FXAA 3BROA 2K02A 3J81K 4EGYA 4UUVA 3SZPA 1SD6A 4G94A 5JHUA 1J2XA 3TKYA 2A3SA 4MEXF 3RPQA 1EH6A 3DKWA 3T5XA 1FBSA 4RB3C 3I5UA 2FNPA 5HVQC 2BBYA 5DYMA 2ZKZA 1O7FA 1YS6A 1FBUA 2M87A 2KJBA 2H94A 2QENA 3MWMA 5JVTA 4ZYDA 4HA8A 1KYWA 1I5ZA 2EFOA 4AIKA 1TTYA 4RAYA 2GAUA 2EFPA 3G3ZA 1TNSA 5L3CA 3P9CA 1DPRA 1R1TA 4ESJA 2JT1A 5CJ9A 4GXOA 4ESBA 1KU9A 3R0JA 2LSOA 3WU1B 4KYWA 4L9JA 5BOXA 4HQMA 3CUOA 3K2ZA 5BQTA 3IC7A 4KN4X 3LA3A 3J80K 4YG2F 3AAFA 3MCZA 2V79A 1LDKB 2ISZA 3CUQB 5DUIA 1V4RA 2PG4A 1IZ1A 2NS0A 2PMHA 4I98B 2VC1A 4CYDA 3ZN1A 5D6EA 1C0WA 4RGUA 3R61A 3JW4A 1OYWA 3CUQA 2DI3A 2XASA 3L2CA 3KZZA 3LAJA 3QP6A 5CVRA 1ON2A 3DV8A 4M6YA 4OU0A 5J8FA 5JFRA 3WTVC 1HSTA 2K86A 5ILUA 3RTRA 1FY7A 1P4WA 4IPAA 4XLNF 5TRDA 1WKMA 1Z7UA 2G7UA 4I2OA 4EVIA 2C6YA 5AONA 1CF7B 3RKYA 1FBQA 3MQ0A 4LLNA 2A5YB 3HRSA 3LFKA 3ROUA 2DT5A 3R4KA 2FNAA 2LNBA 3JAMZ 5H20A 2QUFA 5ICEA 5E1ZB 4HQEA 2DPUA 1CGPA 4S04A 1ZLKA 1G3TA 1OR7A 3GWZA 1ZARA 2PMUA 2K27A 4N9HA 3J80Z 3HUGA 2NRAC 2KIMA 3HRUA 3MEXA 3H3ZA 2P6TA 2DO7A 2A6EF 3F8FA 3I53A 4G6QA 2DLLA 2DBBA 2IVMA 1B9MA 3T0YA 3ZMZA 3ZMSA 4M6XA 3WE3A 4EGZA 4OOIA 4CO8A 3C3WA 3BZ6A 5BS6A 2FBKA 1IXCA 2RN7A 1J5YA 3GYHX 1UFMA 4EJVA 2DK8A 3FM5A 3HYIA 3EYIA 1MDMA 5E8GA 4HX7A 1D8KA 2CO5A 2OU2A 3V7SA 4A12A 4LMYA 1K78A 4ENKA 2KKOA 3TO7A 4G6DA 4FX0A 3SQNA 5DV5A 1OYIA 4ETSA 1BOAA 1MD0A 3NQOA 2EB7A 1ZH5A 2YX4A 4GYGA 3FWEA 4Q48A 2IT0A 3BPVA 4IRGA 3VEPA 3RI4A 3Q5FA 1FP1D 1USTA 2K4JA 3BJOA 4U88A 1B6AA 3TDUC 3WGGA 3F6OA 3HOSA 1T6SA 2VODA 4HLYA 1G6NA 2PBIA 4I01A 1KA8A 2B0LA 4YFKF 1PP8F 5IT3A 1SAXA 1P2FA 5DD4A 1YQAA 3KP6A 1I27A 4IF4A 2HKXA 1EV7A 3RPUA 3E6BA 2VBZA 2QQAA 1PP7U 3IKVA 4XSXF 2Y48A 5E18F 2ESNA 4MNUA 4N9IA 3F22A 4HV5A 1KQ9A 4G7HF 1R22A 3U9GA 3VB2A 2PQ8A 2XROA 1TW3A 1F4KA 1ULYA 4OMZA 4UVBA 1R36A 3PQJA 3WTSC 1HW5A 2FBHA 4U0VA 3KE2A 2E7XA 4MHGA 1YW9A 3EQLF 5FFXA 1V3FA 4M9SA 3CUQC 2J5PA 4I0BA
chains in the Genus database with same CATH superfamily
1VQNI 2HGCA 1F1ZA 1ZTRA 4YIRX 2KQRA 4E6KG 4N0BA 3VFZA 4XICA 5D5XB 1BC7C 2LMDA 1FNNA 1ACIA 3WGIA 1UB9A 2VJ5A 3H9GA 1SMTA 3ISPA 3WTTC 3U1DA 1Z7LA 2A69F 3KEOA 2L7MP 2L54A 3RQ4A 1W7PD 2XPVA 5E1WA 1I6HJ 2DCEA 1B4AA 2VXZA 2ZSIB 4EMSA 2HVSA 1GV5A 3CO7C 1UAAA 2Y0MA 4BQAA 1XMKA 2Q2EB 3SEQA 1O3QA 4V19K 2HQNA 4C2UA 2Q0OA 2HVRA 4BQNA 3H3UA 3S1RJ 2RC4A 1MBKA 2XAJA 4RB0A 2VKHA 1A04A 2LFBA 5FRMA 3VWBA 2XAUA 1VQMI 5DCMA 2GXBA 3ERED 2AHQA 1ZR2A 3S8PA 5IT9K 5KK1A 3GZNB 2GIZA 3DF8A 1DGWY 2HPMA 4B48A 4E7HA 2FSWA 3CCVI 2B7EA 1T0FA 1J59A 3O8HA 4I0BA 1Y8RB 2XIGA 4HNUA 1STZA 1SMYF 3VOEA 1R1UA 1K6OA 1GVJA 2CFXA 3E6MA 4HX4A 2DW4A 2V1DA 2VQHA 2QZ8A 3Q9SA 4PJ0C 3OYGA 2PI0A 1ZGAA 4BJ6C 1BM9A 3ULQB 4BGDA 1SAUA 3OYDA 1U9OA 3H3VK 1YIOA 1X2NA 5J4VA 3E97A 2K85A 5L3FA 4CDGA 1OCRH 3ZN0A 1KQ8A 3LA7A 3BG9A 2VOOA 4QPOA 1RUOA 5D4RA 4HLXA 4KMUX 3KP5A 2CW0F 1LNWA 2EV6A 2RNJA 4RAGA 1KQ0A 4FASD 1RZ4A 2KT0A 5HNFA 4ENMA 1QHGA 3PIOF 3GTKJ 3BC8A 4LG0A 1QBJA 1IN4A 2BYVE 4RAZA 3LWFA 1S72I 1LEBA 1GHCA 1KYZA 3BDDA 1I6XA 1JHFA 2JA5J 3BZCA 4Q4ZF 3UR3C 1RIOH 1O7LA 4F3QA 4B44A 4Q47A 2OTJI 3P5JA 2RVCA 3JTHA 1Y6IA 4XONA 2GA1A 4LG0B 1MBJA 2MW8A 3BJ6A 1N78A 2VBWA 2ZMEA 4HNVA 5CLSA 4DIQA 4ZTFA 3HOVJ 2ISYA 1BJAA 4IRHA 3RKXA 1IXSB 5J8CA 4KIBA 4LIUA 5GTHC 3H9QA 4XQFA 2WY8Q 2P0WA 2VLAA 2ZNZA 2D5VA 2KZGA 2OQRA 2EA4A 3DEEA 2P4WA 2IXSA 2X48A 3MZHA 3FK6A 4F7ZA 4OWRB 2M0MA 4ZC3A 2E2HJ 4B47A 2ADUA 1RR8C 2DPDA 3OL4A 1IG7A 3QYFA 1HQCA 1T38A 2DYSH 5E8IA 2UV1A 2ZJRF 3TGNA 2EIKH 3ZMVA 4UVAA 2FBIA 2ZC2A 2BE5F 2BVMA 2JJ7A 3ONQA 3BG3A 4M73A 3HSEA 2M7BA 3F9KA 3FBIB 3KP4A 4ON0A 1YI2I 4UV8A 2ICWG 2P5VA 1W0UA 2HTSA 4WWCA 1WSUA 2MBFA 3FMQA 5K5OA 2R7DA 4Q5SF 4AVPA 4OIOF 3F8BA 5F6FA 5FROA 1BL0A 5DS9A 4PFPA 3K6GA 1X3ZB 2A5WA 3KYLA 3LSTA 1PUEE 2XRLA 1M1EB 4Y3OA 4QTRA 2R5YA 2CW8A 4X1EA 4RGRA 5CVVA 4NC7A 2HKOA 4XLEA 1WZ2A 3HOZJ 1XN7A 2V1XA 1Y39A 3KP2A 4C30A 3ZQQA 1FJLA 3MVPA 2DFHA 2JSCA 4EJTA 4NBQA 3EPZA 4ZZDA 1IGNA 5M5YJ 5EGOB 2MC3A 3R60A 3OSFA 3IKTA 2DYRH 1JT0A 2EZKA 4KT5C 2LF8A 1FYMA 3KIOA 1ZGJA 3MKZA 2GM4A 2IS2A 1POGA 4PJJA 5ICFA 1JUSA 1KGSA 3WG9A 2G9WA 4B09A 2ME6A 2M8EA 1XGMA 1MJ9A 3CMMA 3TQNA 2E1MC 3KEQA 1XGNA 4HOBA 4I09A 2CFOA 4QLCU 2ZXHA 3P7NA 3AFHA 1BBYA 2MGQA 3QU3A 4CICA 3BY6A 2IJLA 2M8GX 3OYJA 1YHQI 1D1CA 3KP7A 3ZQ7A 1IN6A 1UZCA 3KPHA 4HRIA 2IW5A 2LLKA 2BGCA 3PNYA 1OYYA 4JX4A 4RLQA 1JKQC 4KN7X 4MLOA 1BI2A 2CSOA 2GOXB 3MAJA 3QQAA 3M1CA 1FYKA 3AG4H 3BG6A 1YW8A 2G0EA 2XF5A 5TJJA 3S3MA 5M5WJ 4PGHA 1WCMJ 1TWAJ 1Z21A 4D7MA 1RC9A 5C44J 3V7RA 1YFHA 2E36A 5EF6A 4Y17A 1FIAA 3BR1A 4II2A 4RA2A 4M72A 4D5CA 2EV5A 2VUMJ 4OIRF 1JTYA 2M30A 1T2KA 1ORKA 4NQWA 2EFWA 2W85A 5E3NA 2M1BA 2R0QC 2CS3A 2FJ1A 3CP2A 4G7ZF 4XSZF 3D5RC 3IRRA 2X6OA 1Z05A 4ZYEA 1S7AA 2QKMB 3ABTA 2XUBA 1QU3A 2VPRA 3NARA 1PUFB 1RUNA 4E4HA 3CDIA 2YSRA 1MSEC 1XSVA 2Y75A 1ZHFA 2P5KA 2KL4A 3OYEA 2Y31A 4NDLA 2R7UA 1HLVA 5HLHA 2XKOA 1KU3A 1U5TC 2KDOA 2GXAA 3NRVA 2XAHA 3IRQA 5FKLA 2QGUA 3VYRB 3MZYA 2WAQN 4IO9F 3R6SA 2EIJH 1X3WB 2OAZA 1VQ8I 3B73A 1X2MA 3K9TA 3F8NA 2HPIA 2PX9A 1XSXA 2W84A 4M3BA 1OISA 2AO9A 2P8TA 3K1MA 2OF7A 3CC4I 3TOBA 3V7CA 1KZHA 4XR6A 5LD2C 4HSTA 1T95A 5BPDA 1SD5A 4GO1A 3ZRGA 1CF7A 1ZG3A 2E35A 1E17A 4M71A 3PM1A 1HKTA 2FUG2 4ASNA 3ZR8X 3GUDA 1LE8A 4A93J 4XOPA 3JRDA 1TBXA 1RNLA 3J81Z 4ENNA 2L2OA 3RPUD 2XGCA 1TQMA 3JSOA 2K7LA 3BT9A 4H0EA 3W6VA 4LJZF 3EUHA 3TW7A 1B8IA 3D0SA 3E1SA 3IUOA 3CESA 4DZJA 5B1AH 1J75A 2LREA 3PNTA 3DU5A 3SYTA 1JJ6C 3A4CA 2DFEA 1MJAA 1R5HA 3JCUC 3CCJI 4CYCB 4NC8A 1EKEA 3Q0VA 5CVJA 1DPUA 3FMSA 1ZRCA 1MH4A 1FSEA 2ID3A 2QVOA 3I59B 4EJUA 2R93J 3M7GA 3BTLA 3VYSB 4HNTA 4UY8I 1HKQA 2FF4A 2IP2A 2Z3YA 2L01A 3SXYA 2IS1A 4Y7NJ 3PFYA 4YFNF 4OMYA 1BJZA 3DPLC 3K0LA 4E7KA 4BY1J 2WB1A 2XAQA 4PDKA 1TT0A 2HQAA 2NVTJ 1IDYA 3S2WA 3WG7H 2P7VB 3RDIA 1S7EA 3TDZC 2O7OA 2OD5A 2EZLA 4P5OA 2ID6A 5B5EC 3L09A 3LNQA 2F5EA 5JVGF 1E0EA 1YO5C 3JRGA 3LA2A 1U8RA 4HDUA 3F3XA 5L3GA 1ERDA 5HOOA 3G73A 1J0RA 1FWZA 3TW6A 3GXOA 5E17F 3HHHA 4BEHB 2EV0A 2M3AA 3ELKA 1OMIA 1YLFA 5CKTA 4D0PA 4DYRA 4CUGA 5HNHA 4A3MJ 2ECBA 2VE8A 3KLNA 3GEZA 2DJIA 3HB9A 5CQEA 4A5MA 2QSHX 3J7AO 5K7HA 3M4OJ 2LOOA 1DQUA 5FB2A 3OWTA 3F8MA 3ZP5A 2GLOA 2Z9OA 1P9QC 2FU4A 2R7SA 1W7PA 3WTYC 3ZXSA 5D8LB 4B1RA 2M4KA 3FX3A 2ESHA 2FEZA 1MDMB 4ZDPA 1W36D 4BEHA 2P7CB 3G2BA 2V6CA 2TCTA 2E19A 2KJCA 2R5ZB 4BE0A 3BCAA 1FMVA 3OYBA 3L1PA 1ZN2A 2ZFUA 1F9NA 2W4SA 2HEOA 4FT8A 1ZLJA 1OCTC 3RYPA 4BJ5C 4RAFA 1U5TB 3F72A 1TWCJ 3J7AY 3IH2A 2O03A 4BNCA 3FF5A 3I71A 4ZYHA 5KHDA 3DPTA 1ZRFA 3G1MA 2DU9A 2HOTA 3OS0A 4U7BA 3ABUA 5CYVA 5KAFC 3IV5A 3HIFA 5ICGA 2L9SA 3L2WA 5JLWA 1U2WA 4Z6YA 3FXRA 5FLMJ 3HGGA 1USSA 5KVRA 1K83J 3ESWB 4FQGA 3WTWC 3FISA 3S16J 1G8XA 1BN5A 1Z6RA 5E3OA 4M3EA 2DTZA 4UUSA 3QYBA 1XPXA 2W7NA 2XRNA 1R00A 2GOMA 3M8FA 3GMEA 2E1OA 3DTKA 3FIWA 2WC2A 2P5LC 1J9IA 3M9AA 1W5CC 4A3CJ 1SC7A 3DU6A 4CCMA 3SHFA 1AWCA 2VPLA 2JA8J 2KLOA 1FTZA 4KA4A 3OR2C 3U21A 1KU7A 4BBRJ 3EETA 3BQZA 3K4LA 3HDDA 3OIQA 5HS9A 2DTRA 1IN8A 2JVGA 2RGVA 1X4PA 4WCGA 3GVAA 4PK4A 1TNTA 3GFMA 3LSJA 2Z5UA 2FOKA 1FC3A 3KETA 2BW3A 1YTYA 3F6VA 2GBYA 3ECOA 4X6AJ 5DM7F 3ECHA 2TDXA 2RDPA 4IZZA 5FRNA 1E2XA 3DKYA 5LGUA 4IKFA 3B6AA 2H1LA 4P9FA 3W6JB 4AU7A 4C2TA 3E0JB 2JQ7A 2MC4A 3HKZA 1U0JA 3HRMA 2L02A 4WXDA 3WTXC 5J1RA 1UCRA 3C2HA 3S1MJ 1FLIA 3R0AA 2VI6A 1DGRM 2VXDA 1SVOA 5M3MJ 1TC3C 1SVLA 4MO7A 2F2EA 2Y69H 3BJAA 3E6DA 4NQWB 1QHHD 1LVKA 2DOFA 1ZGWA 3I4PA 2GIVA 4WK8F 4ZDLA 4I02A 3LSKA 3HM5A 1VQ4I 1T39A 3NWTA 5CVUA 1G3WA 2OZ6A 2V9VA 2RQPA 3L7WA 4XLCA 3IP4B 3W6KB 1FIPA 2XSJC 3ZQHA 3DP7A 2CMPA 2GXGA 3GTGJ 3F21A 1OCPA 2QCOA 1KONA 4ZJZA 3JRBA 1LFUP 4PCQA 4BE1A 5M5XJ 3GZ6A 4BBSJ 1EH7A 2LKXA 2CU7A 5GADJ 1LJ9A 1U78A 1IRGA 1ZK8A 2X0LA 4XKCA 1SVMA 4KNYA 3WGHA 1U3EM 3HGYA 4RS8A 1T56A 3KZYA 5HLIA 4S05A 2X6WA 4A5NA 4WXHA 3BTCA 2H6BA 3QRFF 3HOYJ 2O9LA 2PJRB 2UXXA 1IF1A 1QGPA 2ZXJA 4P55A 5E1XA 2XSDC 1U9NA 5IYBJ 2E2IJ 1P6RA 2CV1A 1VQKI 3K70D 1FSHA 2I8DA 3GF2A 4WXCA 4G7OF 3WTZA 3S1QJ 2AS5F 3BPXA 2EZHA 1RESA 3A2KA 3ERMA 4U0WA 2QEXI 3NEUA 5ICCA 1E3HA 1MBGA 3Q9VA 3SZGA 4I76A 1ZYRF 4LLGF 4A3FJ 3I55I 3HBLA 4XKVA 5A2QK 2LBFB 1XB4A 3QP5A 1UHMA 2NNNA 2HXIA 2O5RA 4NC6A 3SDGA 1ETVA 3QYEA 5TGTA 5LEJA 2COMA 1J09A 3FXQA 5AIPA 2P6SA 2R7RA 1D0ZA 3O2PE 3SZTA 2DODA 5H6QA 4BXXJ 5HLGA 3K1PA 3IHUA 4M9ZA 5DEQA 1ZR4A 4A6DA 4KICA 2BHZA 4IVNA 2KPMA 3WTUC 3JTGA 1S8NA 4KITB 4EJOA 4ZYGA 1MH3A 1OKRA 1HDPA 3VODA 4L0YB 1X1AA 1BR4A 4AYBA 4MIMA 2K3PA 5B3SH 3OYKA 2JPBA 3GW2A 3SFZA 2X1CA 5J6XA 3KLOA 4L18B 5J4YA 1L0OC 1WWXA 1ETYA 1QZZA 3I54A 3OYNA 5D4SA 1I3QJ 3DTEA 2HI3A 3GFJA 4IEJA 2RREA 3SEZA 2WAFA 4CA0A 3OYIA 1APLC 3DEWA 2QM3A 2ZMEB 1W4MA 3IWZA 4B43A 1O3TA 1MSFC 1QZYA 4IRIA 3QAHA 2DA2A 4DBRA 3CC2I 1RR7A 3LSHA 2A68F 2W57A 1WQ2A 5F1RA 2STTA 4P1WA 3LOCA 3V8JA 2PJPA 3ZOBA 3HOXJ 3WODF 4F93B 1R9TJ 2IS4A 5HDGA 4IOAF 2W25A 3VYTB 4XM3A 4DOZA 2NOGA 1W1WE 3QPHA 3JRIA 4HW0A 2M4GA 4KUMA 4F91B 1IW7F 2KIUA 3ABMH 1G3YA 4RMNA 2KRFA 5LHIA 2DQRA 4L5JA 4NUBA 2R7FA 1QZEA 2V9KA 1JKPC 3FKIJ 1IN5A 2CWEA 4G8XA 4M3DA 1N25A 3PSFA 2MD5A 2OA4A 4F52A 2EQRA 2FQ4A 1SD4A 4M74A 3BOQA 4LK1F 5E79C 2VJJA 4UNOA 1TQIA 4LK0F 1X19A 1V5EA 3HOTA 3BCBA 4F92B 4G9YA 2L7FP 1A31A 4LG3A 2OPTA 3WHBA 4XLPF 2A61A 2L7ZA 4XBFA 2NOJB 1IUYA 1F36A 2CQ7A 4ZTJA 3HPHA 2NXNB 1WJFA 2YR2A 4MQVA 5D5VB 2ZNYA 4EM2A 1BOBA 3HZJA 5CPRB 3LSPA 2H8WA 1RI7A 2DA1A 4LITA 5AIQA 3OS2A 3DCFA 2RV8A 5J1YA 3OY9A 3K4CA 4L0ZB 5F64A 1SFKA 1YX5A 4L5IA 4BQQA 2V7FA 1VTNC 2N8GA 4B3XA 2AQEA 2EBIA 4A3IJ 1BIBA 4PGGA 2Y9ZA 2WV1A 2LR8A 1B9NA 1U5TA 4R8HA 2XB0X 3C2GA 2G7HA 1HCRA 4BJTA 2EK5A 1G3SA 4CCKA 2AQFA 2ZXIA 3BR5A 2V26A 1OFCX 3OS1A 5F08A 2B9SA 1TT5B 2V1NA 1VQ6I 1T0FC 2Q2EA 4FHTA 3TL4X 4ESFA 2XPUA 1XX5A 3CTAA 3K70C 1LVAA 2DQLA 2ZSHB 3CJNA 1LEAA 1X3UA 5KNLA 2WAQA 4RGXA 3S17J 5LBQA 3MKYB 3MKLA 1FPQA 4DJAA 1PUFA 3BR6A 4NB5A 1B59A 2UUZA 2L9VA 1TZLA 2L7KA 1XS9A 4MEYF 5K1YA 1UJ8A 2HYFA 4L9VA 5EEHA 4CH7A 2LBFA 2LF7A 4FETA 3L2VA 2VOPA 2OCEA 1MZBA 2LKPA 2M5WA 5LRSA 3SDBA 1FMWA 1D1BA 2CG4A 4U0YA 2OQGA 2WV0A 4HSRA 2PFBA 4I7HA 3OYFA 3PIPF 1A36A 2QBYA 2AXTC 1FZPB 3M8JA 3L9FA 5FLXK 1JGGA 2XHKA 3FMRA 5HODA 2DMPA 5GP9A 1XMXA 5EG0A 2ZMEC 5IP6A 1GT0C 2V4JC 1YIJI 3S32A 1S7OA 4W1UA 1OLTA 4HF1A 1QRYA 2WA0A 1R7JA 2Y9YA 3EUAA 3QU6A 3I0TA 3E5UA 1W7PB 1IRXA 3DEUA 2BHYA 2ZBKA 3RJPA 3CZ6A 3L2RA 2DA5A 1WRJA 2GQQA 1X1BA 2H09A 5EEGA 5HS8A 3KYDB 2QBYB 2FD5A 1Y8QB 1YX3A 3FXUA 3VPRA 4E70A 5LFAA 1HW2A 1I1SA 2XGEA 2XVCA 1SFEA 1LB2A 2MSYA 3CCMI 3K4JA 4BH9A 2LYCA 3RZDJ 2UZKA 1N77A 4JK1X 3HG9A 2MH9A 4II3A 2E7WA 4AD9A 1A6IA 4CXFA 4CCNA 1D1AA 3V4GA 5CVIA 3EUKL 2RAEA 1SANA 2QQ8A 1D5VA 5FO5A 2JVHA 2MLGA 4XL9A 3OL3A 5HLTA 2FE3A 1TWFJ 1YE9A 2VE9A 2HR3A 2K40A 3FHZA 4AC0A 1ETXA 3FXKA 4AIJA 2VKEA 2F6CA 2EINH 1H9TA 1ODDA 4BXUA 4HF2A 4G12A 2QWWA 3CMEI 4H4KC 2LY9A 4LFUA 3GFIA 1QNTA 3RQIA 2Q1ZB 4KISA 5B1BH 1WJEA 3FBNB 3TBIA 4ENJA 1BI0A 3ZGKA 1P4AA 1P7IA 5DCFA 3DFGA 2OUMA 2HXOA 1PYVA 1MJBA 4KIFA 2DDBA 2WBMA 1V5FA 2HOEA 4CYCA 1S6LA 5F1JA 4XLHA 1Z1DA 5E3MA 4XN0A 2IRFG 2XB5A 4P9UA 1XCVA 2BV6A 1XSDA 2LDUA 2EWNA 1JHHA 2XV4S 2K9QA 4BDYA 1H0MA 2YU3A 4A0XA 3LFUA 2XKPA 1JXSA 2ETHA 3CLOA 3IH3A 2JRTA 4B4CA 5HDNA 1R5GA 3N97A 1D5YA 4AIDA 5EDNA 3M1EA 5D5UB 3KP3A 2HDWA 2PEXA 4HBLA 3I64A 1MGTA 1FP2A 2HFHA 1SD7A 1H9GA 2EA2A 4E7ZA 1E3OC 5JR3A 3OYAA 1UG0A 1F43A 1PVEA 1T98A 4S0HB 1FOYA 1V5GA 5D5WB 4CSWA 5D6FA 3G1OA 4DBQA 5EJCA 1IV6A 4A69C 2BXYA 4BHPA 5IOYA 1DDNA 2YS9A 3ML6A 4LGWA 3FZVA 2CGPA 2OZUA 2CV0A 1SFUA 2Y30A 2HTJA 3ZCOA 4IQJA 3E3VA 4M9XA 3RIRA 5IP7J 4RB2C 3QPLA 3MKWB 1FOKA 4QSHA 2HVQA 4HYEA 2HZDA 5K5RA 4D1QA 2M9HA 4MGRA 3C1DA 1DP7P 1Z6TA 1GDTA 2NVXJ 2VASA 1REPC 5LHGA 2BW3B 1VNDA 3EYYA 5D8KB 1YW7A 1VQLI 2B63J 4WF2A 1FX7A 1VQ7I 2NYXA 4MTEA 4A3GJ 1P4XA 3DBHB 4KMFA 1BW5A 1IDZA 4EM1A 2LH9A 3I58A 1B72B 2L4AA 1Z9CA 1EA3A 2R4GA 5H6RA 4RM3A 2R7WA 1T8IA 1N75A 1IRZA 2FQ3A 2UXNA 3VSKA 3MFKA 2IGNA 1MKMA 4A3BJ 2XDVA 3CCUI 5LHHA 2DK5A 3AG2H 3TP3A 2PMZA 1IXRC 1I39A 5L3BA 4IX7A 5B66C 1YG2A 2STWA 1GXQA 2X4HA 4E7IA 5EZHA 4AUXA 3N4MA 5EGOA 2JTVA 2HQRA 4BHCA 3DKXA 2NNYA 1ZKGA 2GA2A 4EM0B 1VFCA 1BA5A 1IV8A 2PLYA 2DT6A 3H35A 4RBOA 1W5SA 1WJDA 4XLAA 3JSPA 2HYGD 3HSFA 4IHWA 1W5TA 4C3JJ 4IHTA 1MNDA 1MMSA 2CYYA 2OBPA 1TL8A 5LEKA 2ZJQF 1G4DA 3PQKA 5DDGA 1YYVA 4IHVA 1R4NB 1XCBA 3VSLA 2E60A 1UG2A 4ZZLA 2QA4I 3HTSB 3QPTA 2V6EA 1ZG1A 3FXJA 1IUFA 4UVCA 4BUPA 2EFQA 2R7ZJ 4HEA2 5JLXA 3BR3A 3W3CA 4BQOA 4Z2YA 3QODA 1L3LA 1WGXA 1U6GA 4A3KJ 1HSJA 4KJZA 4YFXF 1NHAA 4BYYA 4CGZA 1UMQA 2VBXA 2A05A 3TP0A 5F27A 4IOCF 2O6GE 2Z2SB 3D5SC 5C4JJ 4N4OB 2TRTA 3P9KA 2K9NA 2D1HA 2H6CA 3FK7A 2QSFX 2M0CA 1I1GA 1LPQA 2L4MA 2ZCWA 4LLLA 5FKKA 3AG3H 4L9TA 1K79A 4RM2A 3JR9A 4NHJA 4HDVA 3T8TA 2E1CA 4IJAA 1D0XA 1D8JA 4EJWA 2WY7Q 3RKQA 4C3HJ 4E7SA 2Z16A 2BOLA 4PZJA 4KFCA 4G6TB 4C3IJ 1Z0XA 3KZIC 4JBAA 3O6BB 2ZFWA 3X2QH 4JQFA 3ASNH 1TLHB 3TO6A 4DYCA 5A2QZ 4HZFA 2DXIA 3F0CA 3GFLA 3HOWJ 1EH8A 1P7JA 1TQPA 2E71A 2CV2A 2GWRA 1NG6A 1WJ5A 5F04A 1HBXG 1HOMA 3ZQCA 5GAHJ 1KU2A 1BI1A 2F5DA 1LUJB 4OINF 4EATA 2QLZA 1QVUA 1WPKA 2IA2A 4J01A 4L9NA 2XF6A 4XRFA 3RCOA 3HUGB 2WTEA 1NG7A 1X1DA 2KISA 3V8LA 1U8BA 2YPRA 1WH7A 2DFFA 5LGTA 4OAYA 1Z77A 4BU2A 1MW7A 3GLLA 3P9IA 3HTUA 1K7AA 2I5UA 5LGNA 2LRDA 2DA3A 3OV8A 1MNEA 4I0AA 1YRNB 3GCMA 3A0HC 1TW2A 1XD7A 1DUXC 3H92A 1WHUA 2JA2A 2IPQX 2K3FA 4DW6A 1WJCA 2JA7J 4F55A 2JA6J 1R71A 4FX4A 5GTIC 4C9YA 3PO2J 3G4SI 2XGXA 3CLQA 3QWLA 1O3SA 1B8IB 1MMDA 1ETQA 1K4SA 3BG7A 4IXAA 2MYSA 1JT6A 4N4NB 3OMYA 3V8KA 2RQQA 3HJEA 4YRVA 3OYLA 2E1NA 4M6VA 3CCQI 2XAFA 4M3GA 4ANJA 3LQRA 5FD5A 3TO9A 1VQ5I 5H2FC 1LE8B 1JI8A 5DUKA 5BPIA 1AKHB 3TOAA 2RKHA 5DM6F 3L00A 4HG2A 2KIFA 2D45A 3LQQA 1OQYA 2F4IA 4A6EA 1W36C 3GLXA 3O8GA 2EZIA 3B02A 4OAZA 4DQ2A 3OYMA 1FYLA 3CDLA 3E5QA 2YX7A 3LSMA 3BP8A 5GPAA 2O0YA 1P92A 2F5CA 3S2DJ 3E6CC 1PDNC 2XAGA 2D2WA 9ANTA 4PJNA 1NK2P 5ILSA 4PUSA 3OOPA 3G71I 1RRJA 4ITVA 4B8XA 1WI9A 4AWXB 2MH2A 2VT3A 3LL7A 3CMYA 2O8XA 4AIHA 5EZGA 2HOAA 3K2AA 2BY2A 4JP0A 5FFZA 3GTPJ 2FMYA 5L3EA 1Z91A 3FHNA 1IAWA 1K61A 1WJAA 4Y13A 1UHSA 4P96A 2D1VA 4IHSA 3DQVC 2VKDA 4XORA 1G59A 2UWMA 4XIDA 1XDSA 2COBA 3GO5A 2LK2A 4M3FA 1VQOI 3OYCA 3HKZN 4KDPA 4V2GA 5IOZA 3S93A 2ELJA 4LB6B 2ZO4A 2ZB9A 3LAPA 2J5OA 2Z33A 1CQTA 1OR7C 5IT9Z 2VQCA 4OIQF 1YJNI 5KCMA 3CF5F 5F0HA 1MMGA 2L9RA 4XRSA 1YJWI 2FMLA 1RKWA 4JYKA 1H89C 2EJRA 1A6QA 2W00A 3REOA 1QQIA 4KIGA 4IHXA 3FM3A 2E1MB 3PO3J 4A2UA 2O3FA 3F23A 3IL2A 3DBLB 1H88C 1O3RA 3A02A 1ZAOA 3BWGA 4U87A 1OCOH 2VN2A 1TWHJ 5ED4A 1VI0A 2VQGA 3BR2A 4BE2A 4RGSA 2VBYA 1GXPA 3C7JA 2VKVA 1ZRDA 1HA8A 5FJ8J 2Y0SA 3GX4X 1BR2A 2KRCA 3K1NA 4A3LJ 4ZH4F 2DT7B 5HDKA 4A0ZA 1I3AA 4YEJA 2V1UA 2CJJA 1S29A 4DZPA 1V54H 5ILVA 4GGGA 4O3MA 2FX0A 4CCLA 3V42A 2AXLA 3EUHC 3A03A 1RETA 3RKWA 4RB1A 1MMAA 2DMUA 2R5ZA 4EEFG 5FKMA 4A3JJ 2DMTA 2FRHA 3GZ5A 3T1BA 2R7VA 1XDUA 4DYQA 3FXMA 4QWQA 5L3DA 2O61A 1FTTA 3OR1C 2L5QA 3A0BC 4HX8A 1BC8C 4E7LA 4V2FA 4GYIA 2NAZA 3D5LA 1S9HA 3FXOA 3KFWX 2K9SA 1I50J 3SFIA 4OIPF 1GV2A 1QPMA 2HDCA 4BXFA 1EF4A 3KX2A 3K69A 4GCVA 4JX6A 4K2EA 4CZZA 1HC8A 2EFNA 2MD0A 3KYCB 1YRNA 3CJTB 4PJMA 3CMAI 6PAXA 3WE2A 1GLNA 3M8EA 2BY0A 2VT2A 5F0FA 3PSIA 1OJLA 2CUEA 4HF0A 4ZDOA 2K9LA 3EDPA 2VIXA 3DBRB 4PSXA 3T8RA 1XGSA 3IH4A 2WB1N 4LIVA 4LOCA 2HU9A 5LRRA 4MTDA 1DU6A 3OYHA 4BHBA 2DAOA 3DXJF 4HV6A 1TP4A 2VONA 5BMZA 1AOYA 2FOWA 2K4BA 3JAMK 1JKRC 3C18A 1Y1WJ 2H1KA 1XMAA 3HXLA 3HHGA 1YITI 3RYRA 2CRGA 4DNCA 1LDDA 2HS5A 1T08B 2PN6A 2CQNA 2WWYA 4MFEA 1MIJA 3GTQJ 2A07F 2CQXA 1OCCH 3OSGA 2X1EA 4UUTA 3U2RA 2I10A 2X6YA 3CCLI 1AHDP 3HPGA 5E20A 4UV9A 1BI3A 4MQ9F 3M07A 2BEOA 1YS7A 3CDHA 2CQKA 3ASOH 5GAEJ 3I56I 2ZJ2A 4AM3A 4R79A 2A6HF 3B6CA 2QQ9A 2OCCH 3KCCA 4XOTA 4XNFA 4YELA 1ZQ3P 2CH0A 1FOWA 2JZYA 4EV0A 2VC0A 5J3LA 2WADA 4LB5A 3ZMUA 4XRMA 5JI6A 2MA3A 1S3JA 4UXNA 1UHWA 1HXDA 3E5XA 2DFIA 3L2UA 1LDJA 1ONVA 4HPQA 2Z99A 1Z3XA 3PFIA 1JE8A 3K4BA 1HW1A 2IEKA 1SFXA 2DA6A 3PUFA 2HOSA 4RLFA 3K10A 4UHTA 3CO6C 3IAS2 1ZREA 2JUCA 1IRFA 3GTJJ 1XGOA 1FOXA 3J7YJ 1DU0A 1FT9A 3M3YJ 1R23A 1BIAA 3CQZJ 3LSRA 2KDZA 5EYRA 4TV7A 4Y15A 4CCOA 4HAMA 2H27A 4O6JA 1OCZH 4XKBA 2DMNA 1Z67A 1HKSA 2XF7A 4WX9A 5DCMB 1Q1VA 3AL0C 2DA7A 3H9JA 2H8RA 1B1BA 3ZMDA 3O3KA 3I4NJ 3GTOJ 1MBFA 3W2VA 1R49A 2IS6A 4UB6C 3BTIA 5GAGJ 5E3LA 2M45A 2IA0A 1LQ1A 1J7KA 4YIIA 1Q1HA 1IN7A 5J47A 2L9NA 2LY2A 3LMMA 4BKXA 4BAYA 2QQBA 3AG1H 3COAC 3IWFA 3CP8A 5FGMA 4CHUA 4PJLA 3FDYA 4YIFA 5C3EJ 2JPCA 2NVQJ 2LP0A 1JGSA 1X4OA 4A0YA 1F5TA 2FA5A 2WAEA 3DPUA 2E34A 5FKNA 3F8CA 4BY7J 4C2MJ 1ZG5A 2F5FA 2HZTA 4LD5A 4FE4A 4BS9A 2EIMH 5FD6A 2ELHA 3ZMTA 2L3DA 3HSRA 1HDDC 1R1VA 2IA1A 4R1HA 3MD2A 2Q8KA 1D0YA 2QF7A 4EQQA 1IO2A 2OJED 1UELB 1R6RA 1WVRA 3E7LA 3W2WA 2HWVA 4U7DA 2R3SA 3VYUB 2GZWA 4O5VA 2JUGA 2QKLB 1R4MB 3I59A 2MLKA 1A35A 5K5QA 1R58A 3Q3SA 2JN6A 5IP9J 1QO0D 2VQLA 2ACJA 3DTIA 2LTPA 2R7XA 5DD8A 1Y0UA 4A3EJ 1QA6A 2W24A 3CF2A 3DWLE 1OPCA 3ZPLA 1K78B 5K7ZA 1D3YA 1O57A 2E5ZA 2IGOA 2R7QA 3CCYA 5ERIA 2JSPA 1ON1A 1VZ0A 3WU0A 5LLQA 3UKGA 3OOUA 3DLAA 1DP3A 1YJ9I 4IL6C 2KZVA 5FLXZ 2QYOA 3HRTA 5HS7A 3NAUA 2F48A 3QOPA 3TEDA 2FXAA 3JRHA 2KFDA 3BROA 2K02A 4MFDA 3J81K 4EGYA 4UUVA 2KP6A 1K6YA 1ITYA 3TMOA 2CQQA 2CUFA 3SZPA 2W1OA 1SD6A 5IYCJ 2ZXWH 3AKZA 4DGWB 2KMUA 4G94A 5JHUA 1MBHA 1J2XA 3NWSA 1TWGJ 2NVUB 1X58A 3S14J 1B72A 3CC7I 4BDZA 3TKYA 5C4XJ 3ZQGA 2A3SA 4MEXF 3BG5A 2W48A 3H1CA 4E7JA 2E5NA 4CZCA 2CW7A 3IAM2 4FCYA 5FLVA 3RPQA 1EH6A 3DKWA 2RNGA 3T5XA 1FBSA 3A1YA 2R92J 2ZJPF 2LVSA 4JX5A 2P81A 3QOEA 4RB3C 3CJQB 3I5UA 2FNPA 5HVQC 2R7TA 4ABZA 1G2HA 2BBYA 5DYMA 2ZKZA 5GPCA 2DMQA 4W97A 1JJ8C 1Y56A 1O7FA 1YS6A 1FBUA 2M87A 3RSNA 2V9PA 3FKJA 2KJBA 4BL0B 2H94A 2MFZA 2QENA 3MWMA 4XK4A 4Y4RA 5JVTA 3J7ZI 3OIOA 2Y0SN 1SEUA 2DOEA 4ZYDA 4HA8A 2DA4A 3VDXA 2EH3A 3BLYA 1QVTA 2ELKA 1KYWA 2ME0A 1I5ZA 2EFOA 4XLFA 1TTYA 2EILH 4AIKA 4RAYA 2GAUA 2EFPA 3G3ZA 1TNSA 5L3CA 1ETOA 1ZELA 3P9CA 3AL0B 5EG0B 1DPRA 1R1TA 4ESJA 2JT1A 3BZKA 3PJRA 5CJ9A 4GXOA 4ESBA 3JRAA 4GFBA 1KU9A 1Y0NA 2K9MA 3R0JA 2LSOA 3KEYA 3WU1B 1NH3A 4FISA 4L9JA 5BOXA 4KYWA 4HQMA 1MMNA 2BVLA 3WU2C 3CUOA 4XMYA 1XC5A 3K2ZA 5BQTA 3IC7A 3PL8A 5TISC 3LSIA 1X1PA 1VQ9I 1LFPA 3PNVA 4KN4X 4BACA 1Z3YA 2IAIA 3LA3A 1T33A 4XRSG 2X51A 3J80K 4YG2F 3GTMJ 4I99C 3AAFA 3MCZA 2V79A 3W2AA 1Y1VJ 1LDKB 2ISZA 3CUQB 1WFXA 5DUIA 1V4RA 2PG4A 1IZ1A 2JRMA 1EJ9A 3Q0UA 2F5VA 2NS0A 5F0CA 2HNHA 3JRFA 3H5RA 2PMHA 4I98B 2VC1A 1K4TA 1PJRA 3QPSA 4CYDA 2LKSA 3ZN1A 5D6EA 2LD5A 1C0WA 2NS8A 4RGUA 2YUSA 4JOMA 3R61A 4D7NA 2K5CA 3I3LA 3JW4A 3I4MJ 1OYWA 3CUQA 1ETWA 2DI3A 2F4MB 2L0KA 4A3DJ 3I9V2 2VJ4A 2XASA 3L2CA 3KZZA 1AA7A 3LAJA 3QP6A 3OIPA 2W82A 2JWTA 5CVRA 2XC7A 1ON2A 2VL8A 3DV8A 3U1KA 4M6YA 2E2JJ 4OU0A 5J8FA 1WI3A 5JFRA 3WTVC 1HSTA 2K86A 3ABKH 4RDUA 4J00A 3S3OA 5ILUA 3HOUJ 1NK3P 3RTRA 1FY7A 1P4WA 4I6ZA 3GBGA 3S15J 3RZOJ 2JK3A 3A01A 1ENHA 4IPAA 2EPFA 4X0GA 4XLNF 2KHMA 2CUJA 1FEXA 2HYJA 5TRDA 1WKMA 1Z7UA 2G7UA 4J19A 4I2OA 3A01B 4EVIA 2C6YA 3CD6I 2R5YB 5AONA 1VF9A 1CF7B 2DJNA 3RKYA 1FBQA 3MQ0A 3BQYA 3HL2A 4LLNA 2M2EA 3HC7A 2A5YB 3HRSA 3LFKA 3ROUA 2DT5A 3R4KA 5IY5H 5JHFA 3K4KA 3S3NA 2FNAA 2LNBA 3CCEI 3S2HJ 2HQ5A 3JAMZ 5H20A 2PMZN 2A6TA 2QUFA 5M3FJ 5ICEA 2CUZA 5E1ZB 4B3AA 4HQEA 2DPUA 1CGPA 1BR1A 2VB6A 4S04A 1BW6A 1ZLKA 1G3TA 4UB8C 1OR7A 3GWZA 1ZARA 2VJIA 2PMUA 2K27A 4N9HA 3J80Z 4UUSB 3HUGA 2NRAC 2KIMA 3HRUA 3MEXA 3H3ZA 3ZQIA 3ZQFA 2P6TA 2DO7A 4GDFA 2A6EF 2OV7A 1QPIA 1S5LC 3F8FA 3I53A 3H5NA 1LFBA 1XG1A 4G6QA 2DLLA 2DOAA 2XGDA 2DBBA 1NTCA 2YU9J 3UNGC 1MNMC 2IVMA 1B9MA 3T0YA 3ZMZA 3ZMSA 4M6XA 5IPAA 3WE3A 3CJRB 4EGZA 1MBEA 4OOIA 4CO8A 2OTLI 3HEFA 3C3WA 2IBDA 2IGMA 4KT6A 1GVDA 3BZ6A 5BS6A 2FBKA 2NVYJ 1IXCA 2XPWA 2M7AA 2RN7A 1J5YA 3H5AA 3GYHX 1UFMA 4EJVA 2DK8A 2KRHA 2R7OA 3FM5A 3HYIA 3EYIA 4Y52J 1MDMA 4FE7A 4NNJA 5E8GA 4HX7A 4PSWA 2MABA 1D8KA 2CO5A 2OU2A 3V7SA 4A12A 4XN3A 4LMYA 1JKOC 1K78A 4ENKA 3H36A 2KKOA 2NS7A 4Y33A 5J40A 3TO7A 4G6DA 4FX0A 3SQNA 1SFOJ 5DV5A 1R5ID 5DTDA 3JRCA 1OYIA 4ETSA 4L5EA 1BOAA 1MD0A 3MMYB 2EB7A 3NQOA 1ZH5A 2YX4A 4GYGA 3FWEA 4Q48A 2IT0A 3FXLA 4IHYA 3BPVA 4IRGA 2QSGX 2DN0A 3VEPA 3RI4A 3Q5FA 1RKTA 1AU7A 1IC8A 4ZYAA 1FP1D 1USTA 2K4JA 1V55H 3BJOA 1B6AA 4U88A 3TDUC 3WGGA 3F6OA 3K4NA 1RPWA 3JREA 3HOSA 3D1NI 2LC2A 1T6SA 3K4MA 4HLYA 4FTHA 2VODA 1G6NA 2PBIA 4D5FA 3GTLJ 4I01A 1A5JA 1KA8A 3ZQLA 2B0LA 4YFKF 3BR0A 3G6EI 1PP8F 1ETKA 2O8KA 1X1CA 3H0DA 5CQGA 4QIWN 5IT3A 1SAXA 4D9JA 3CCRI 2MG4A 1WH5A 1LKXA 5KAIC 1IJWC 1P2FA 5DD4A 1YQAA 3KP6A 4GRIA 1I27A 4IF4A 4XKWA 3G1LA 2X9DA 2DDAA 2HKXA 2Y2ZA 2M34A 1EV7A 3RPUA 3E6BA 2BZTA 2VBZA 2QQAA 2X1DA 1O4XA 1AKHA 3C2BA 3DLLF 3WHCA 1PP7U 1YOVB 3IKVA 4XSXF 2Y48A 5J1UA 5E18F 3CCSI 2ESNA 3H0GJ 2BY3A 3N05A 4MNUA 4N9IA 3F22A 2BY1A 3S1NJ 2LY1A 5K7FA 4HV5A 1W0TA 5IYDJ 2PJRA 1JUPA 1KQ9A 4G7HF 2JMWA 3MZ8A 1R22A 3BTJA 3U9GA 3ABLH 5BNGA 3VB2A 4CCJA 2PQ8A 2LG4A 3LSGA 2XROA 1TW3A 2X85A 4AYBN 1ULYA 2OC6A 1F4KA 4QPQA 4IQ4A 4OMZA 4PFOA 3PUBA 4UVBA 2HDDA 1R36A 3PQJA 3WTSC 2Z1DA 1VQPI 2IGKA 1JTXA 3MN2A 1HW5A 2FBHA 4U0VA 1XTAA 1E3PA 3KE2A 2F4OB 1H8AC 5EEAA 1HF0A 2ECCA 2E7XA 1JUMA 4MHGA 3Q0WA 2X6XA 3SJMA 3K7AJ 1YW9A 3EQLF 2BXZA 2KIQA 3L2QA 5FKOA 5FFXA 1V3FA 4M9SA 1WJBA 3CUQC 2J5PA 1GUUA 4AVZA
chains in the Genus database with same CATH topology
2HGCA 1F1ZA 4N0BA 3VFZA 5D5XB 1BC7C 1FNNA 3WGIA 1UB9A 1SMTA 3ISPA 3WTTC 3U1DA 2A69F 3KEOA 2L54A 1W7PD 5E1WA 4EMSA 1B4AA 2VXZA 4BQAA 3CO7C 2Y0MA 1XMKA 1O3QA 2HQNA 2Q0OA 3H3UA 2RC4A 2XAJA 4RB0A 1A04A 5DCMA 2GXBA 3ERED 5IT9K 5KK1A 3DF8A 2FSWA 1T0FA 1J59A 2XIGA 1STZA 1SMYF 3VOEA 1R1UA 1K6OA 1GVJA 2CFXA 3E6MA 4HX4A 2DW4A 2V1DA 2QZ8A 3Q9SA 2PI0A 1ZGAA 1BM9A 3ULQB 1YIOA 3E97A 5L3FA 4CDGA 3ZN0A 1KQ8A 3LA7A 2VOOA 1RUOA 5D4RA 4HLXA 4KMUX 3KP5A 2CW0F 1LNWA 2EV6A 2RNJA 1KQ0A 1RZ4A 4ENMA 4LG0A 1QBJA 1IN4A 2BYVE 4RAZA 3LWFA 1LEBA 1GHCA 1KYZA 3BDDA 1I6XA 1JHFA 4Q4ZF 1RIOH 1O7LA 4Q47A 2RVCA 3JTHA 2GA1A 4LG0B 3BJ6A 2VBWA 2ZMEA 5CLSA 2ISYA 1BJAA 4IRHA 3RKXA 1IXSB 5J8CA 4KIBA 2ZNZA 2OQRA 2EA4A 2P4WA 3MZHA 4F7ZA 2ADUA 2DPDA 1HQCA 1T38A 5E8IA 3TGNA 3ZMVA 4UVAA 2FBIA 2BE5F 4M73A 3HSEA 3KP4A 4ON0A 4UV8A 2P5VA 2HTSA 4WWCA 1WSUA 2MBFA 3FMQA 5K5OA 2R7DA 4Q5SF 4AVPA 4OIOF 3F8BA 5F6FA 3LSTA 1PUEE 4RGRA 5CVVA 2HKOA 1XN7A 2V1XA 3KP2A 2JSCA 4EJTA 4ZZDA 2MC3A 3R60A 3IKTA 4KT5C 2LF8A 1FYMA 1ZGJA 5ICFA 1KGSA 3WG9A 2G9WA 4B09A 2M8EA 1XGMA 1MJ9A 3TQNA 3KEQA 1XGNA 4HOBA 4I09A 4QLCU 3P7NA 1BBYA 3QU3A 4CICA 3BY6A 2IJLA 3KP7A 3ZQ7A 1IN6A 2IW5A 2BGCA 1OYYA 4KN7X 1BI2A 2CSOA 3MAJA 1FYKA 1YW8A 5TJJA 4PGHA 3V7RA 1YFHA 4Y17A 4M72A 2EV5A 4OIRF 2M30A 1T2KA 4NQWA 2EFWA 2W85A 2M1BA 4G7ZF 4XSZF 3IRRA 1Z05A 4ZYEA 1S7AA 3ABTA 2XUBA 1RUNA 2YSRA 1XSVA 1ZHFA 2P5KA 2Y75A 5HLHA 2XKOA 1KU3A 1U5TC 3NRVA 2XAHA 3IRQA 3MZYA 3R6SA 2OAZA 3B73A 3K9TA 3F8NA 1XSXA 2W84A 2P8TA 3K1MA 3TOBA 3V7CA 5BPDA 1SD5A 4GO1A 1CF7A 1ZG3A 1E17A 4M71A 1HKTA 4ASNA 3GUDA 1TBXA 1RNLA 3J81Z 4ENNA 1TQMA 3JSOA 2K7LA 4H0EA 4LJZF 3EUHA 3D0SA 1J75A 1MJAA 1R5HA 5CVJA 1DPUA 3FMSA 1ZRCA 1FSEA 3I59B 2QVOA 4EJUA 3M7GA 1HKQA 2FF4A 2IP2A 2Z3YA 2L01A 3SXYA 4YFNF 4OMYA 3DPLC 3K0LA 4PDKA 2XAQA 3S2WA 2P7VB 3RDIA 3TDZC 2OD5A 4P5OA 3L09A 2F5EA 1YO5C 3LA2A 1U8RA 4HDUA 3F3XA 5L3GA 5HOOA 3G73A 1J0RA 1FWZA 3GXOA 5E17F 3HHHA 2EV0A 3ELKA 1OMIA 1YLFA 4D0PA 2VE8A 3KLNA 3GEZA 4A5MA 3J7AO 5FB2A 3F8MA 3ZP5A 2Z9OA 2FU4A 3WTYC 1W7PA 5D8LB 3FX3A 2ESHA 2FEZA 1MDMB 2P7CB 2V6CA 2KJCA 1ZN2A 1F9NA 2HEOA 4FT8A 1ZLJA 3RYPA 1U5TB 3F72A 2O03A 4BNCA 3FF5A 3I71A 4ZYHA 3DPTA 1ZRFA 2DU9A 4U7BA 3ABUA 5CYVA 3HIFA 5ICGA 1U2WA 3FXRA 1USSA 5KVRA 3WTWC 1BN5A 1Z6RA 2XRNA 1R00A 3M8FA 2P5LC 1J9IA 2WC2A 3M9AA 3SHFA 1AWCA 4KA4A 1KU7A 3EETA 5HS9A 2DTRA 1IN8A 2RGVA 4WCGA 3GVAA 1TNTA 3GFMA 2Z5UA 2FOKA 1FC3A 3KETA 1YTYA 3F6VA 3ECOA 3ECHA 2TDXA 2RDPA 1E2XA 5LGUA 4P9FA 3W6JB 3HRMA 2L02A 4WXDA 3WTXC 1UCRA 1FLIA 3R0AA 2F2EA 3BJAA 3E6DA 3I4PA 2GIVA 4WK8F 4I02A 1T39A 5CVUA 1G3WA 2OZ6A 2V9VA 2RQPA 3L7WA 3W6KB 3DP7A 2GXGA 3F21A 4PCQA 3GZ6A 1EH7A 1LJ9A 1U78A 1IRGA 2X0LA 4KNYA 3WGHA 1U3EM 4RS8A 3KZYA 5HLIA 4S05A 4A5NA 4WXHA 2H6BA 3QRFF 2UXXA 1IF1A 1QGPA 2ZXJA 4P55A 5E1XA 1P6RA 1FSHA 3GF2A 4WXCA 4G7OF 3WTZA 2AS5F 3BPXA 4U0WA 3NEUA 5ICCA 3Q9VA 1ZYRF 4LLGF 5A2QK 1XB4A 3QP5A 1UHMA 2NNNA 5LEJA 2COMA 3FXQA 5AIPA 2P6SA 3O2PE 3SZTA 5H6QA 5HLGA 3K1PA 3IHUA 4M9ZA 5DEQA 4A6DA 4KICA 4IVNA 3WTUC 3JTGA 1S8NA 4EJOA 4ZYGA 1OKRA 3VODA 4L0YB 2JPBA 3GW2A 3SFZA 5J6XA 3KLOA 4L18B 1L0OC 1WWXA 1QZZA 3I54A 5D4SA 3GFJA 2QM3A 2ZMEB 1W4MA 3IWZA 1O3TA 1QZYA 4IRIA 3QAHA 2A68F 2W57A 1WQ2A 5F1RA 2STTA 2PJPA 3V8JA 3WODF 5HDGA 2W25A 3QPHA 4HW0A 4KUMA 1IW7F 2KIUA 1G3YA 2KRFA 5LHIA 2DQRA 4L5JA 2R7FA 1IN5A 2CWEA 4G8XA 2MD5A 2OA4A 1SD4A 4M74A 3BOQA 4LK1F 4UNOA 1TQIA 4LK0F 3HOTA 4G9YA 4XLPF 2A61A 4XBFA 1IUYA 2YR2A 4MQVA 5D5VB 2ZNYA 4EM2A 1RI7A 5AIQA 2RV8A 4L0ZB 5F64A 4L5IA 1VTNC 1BIBA 4PGGA 1B9NA 1U5TA 4R8HA 2G7HA 2EK5A 1G3SA 2Q2EA 4FHTA 4ESFA 3CTAA 1LVAA 2DQLA 3CJNA 1LEAA 1X3UA 4RGXA 5LBQA 1FPQA 4NB5A 1B59A 4MEYF 5K1YA 2HYFA 4L9VA 5EEHA 2LF7A 2VOPA 1MZBA 2LKPA 2M5WA 5LRSA 2CG4A 4U0YA 2OQGA 2WV0A 4I7HA 2PFBA 2QBYA 1FZPB 3L9FA 5FLXK 2XHKA 3FMRA 1S7OA 4HF1A 1R7JA 3QU6A 3I0TA 1W7PB 3E5UA 3DEUA 2ZBKA 3RJPA 2GQQA 5HS8A 1WRJA 2H09A 5EEGA 2QBYB 3FXUA 4E70A 1I1SA 1HW2A 2XVCA 1SFEA 1LB2A 4BH9A 2UZKA 4JK1X 2MH9A 2E7WA 4AD9A 4CXFA 3V4GA 5CVIA 1D5VA 5FO5A 2MLGA 2FE3A 2VE9A 2HR3A 3FHZA 4AIJA 1H9TA 1ODDA 4BXUA 4HF2A 2QWWA 3GFIA 4LFUA 1QNTA 4ENJA 1BI0A 1P4AA 5DCFA 3DFGA 1MJBA 4KIFA 2HOEA 1S6LA 1Z1DA 2IRFG 4P9UA 1XCVA 2BV6A 1XSDA 2LDUA 2EWNA 1JHHA 2XV4S 1H0MA 2YU3A 4A0XA 2XKPA 1JXSA 2ETHA 3CLOA 2JRTA 5HDNA 1R5GA 3N97A 3M1EA 5D5UB 3KP3A 2PEXA 4HBLA 3I64A 1MGTA 1FP2A 2HFHA 1SD7A 1H9GA 2EA2A 5JR3A 1T98A 5D5WB 5D6FA 1DDNA 4BHPA 3ML6A 4LGWA 3FZVA 2CGPA 2OZUA 1SFUA 2HTJA 3E3VA 4M9XA 3RIRA 4RB2C 1FOKA 4HYEA 1DP7P 5K5RA 4MGRA 3C1DA 1Z6TA 1REPC 5LHGA 3EYYA 5D8KB 1YW7A 4WF2A 1FX7A 4MTEA 2NYXA 1P4XA 4KMFA 4EM1A 3I58A 2L4AA 1Z9CA 5H6RA 2FQ3A 2UXNA 3MFKA 1MKMA 5LHHA 2DK5A 1IXRC 5L3BA 1YG2A 2STWA 1GXQA 2X4HA 3N4MA 2JTVA 2HQRA 4BHCA 2NNYA 2GA2A 4EM0B 2PLYA 1W5SA 3JSPA 2HYGD 3HSFA 1W5TA 4IHTA 2CYYA 2OBPA 5LEKA 1G4DA 3PQKA 5DDGA 1YYVA 1XCBA 4ZZLA 3HTSB 3QPTA 1ZG1A 4UVCA 2EFQA 4Z2YA 1L3LA 1U6GA 1HSJA 4YFXF 1NHAA 4BYYA 4CGZA 2VBXA 2O6GE 3P9KA 2D1HA 2H6CA 1I1GA 2L4MA 2ZCWA 4LLLA 4L9TA 1K79A 4NHJA 4HDVA 3T8TA 2E1CA 4IJAA 1D8JA 4EJWA 4PZJA 4KFCA 4JBAA 3O6BB 2ZFWA 4JQFA 1TLHB 3TO6A 5A2QZ 4HZFA 3GFLA 1EH8A 1TQPA 2GWRA 1HBXG 1KU2A 1BI1A 2F5DA 4OINF 2QLZA 2IA2A 4L9NA 4XRFA 2WTEA 3V8LA 2YPRA 5LGTA 3P9IA 3HTUA 1K7AA 5LGNA 3OV8A 4I0AA 1TW2A 1XD7A 1DUXC 3H92A 2IPQX 4FX4A 2XGXA 1O3SA 4IXAA 3V8KA 2E1NA 2XAFA 3LQRA 5FD5A 3TO9A 5DUKA 5BPIA 3TOAA 2RKHA 3L00A 2KIFA 2D45A 3LQQA 4A6EA 3GLXA 3B02A 4DQ2A 1FYLA 3E5QA 2YX7A 3BP8A 2O0YA 1P92A 2F5CA 3E6CC 1PDNC 2XAGA 2D2WA 5ILSA 3OOPA 4B8XA 1WI9A 4AWXB 2MH2A 2VT3A 2O8XA 4AIHA 5FFZA 2FMYA 5L3EA 1Z91A 1IAWA 4Y13A 4P96A 2D1VA 4IHSA 3DQVC 2UWMA 1XDSA 3GO5A 4KDPA 4LB6B 2ZO4A 3LAPA 2J5OA 2Z33A 5IT9Z 4OIQF 2FMLA 2EJRA 3REOA 1QQIA 4KIGA 3FM3A 4A2UA 2O3FA 3F23A 3IL2A 1O3RA 1ZAOA 3BWGA 2VN2A 5ED4A 4RGSA 2VBYA 1GXPA 3C7JA 1ZRDA 3GX4X 3K1NA 4ZH4F 5HDKA 4A0ZA 2V1UA 1S29A 5ILVA 4GGGA 4O3MA 2AXLA 3RKWA 4RB1A 2FRHA 3GZ5A 3T1BA 1XDUA 4QWQA 5L3DA 2O61A 4HX8A 1BC8C 4GYIA 2NAZA 3D5LA 3KFWX 4OIPF 1QPMA 2HDCA 3K69A 4GCVA 4K2EA 4CZZA 2EFNA 6PAXA 3WE2A 3M8EA 2VT2A 4HF0A 3EDPA 3T8RA 1XGSA 4MTDA 5LRRA 4BHBA 2DAOA 3DXJF 4HV6A 2VONA 5BMZA 1AOYA 2K4BA 3JAMK 3C18A 1XMAA 3HHGA 3RYRA 4DNCA 1LDDA 2HS5A 2PN6A 2WWYA 2A07F 3U2RA 5E20A 4UV9A 1BI3A 4MQ9F 2BEOA 1YS7A 3CDHA 2CQKA 2ZJ2A 4R79A 2A6HF 2QQ9A 3KCCA 2JZYA 4EV0A 2VC0A 4LB5A 3ZMUA 5JI6A 2MA3A 1S3JA 4UXNA 1UHWA 1HXDA 3E5XA 2DFIA 1LDJA 1ONVA 2Z99A 3PFIA 1JE8A 1HW1A 1SFXA 4UHTA 3CO6C 1ZREA 1IRFA 1XGOA 1FT9A 1R23A 1BIAA 4TV7A 4Y15A 4HAMA 2H27A 4O6JA 1HKSA 4WX9A 5DCMB 1B1BA 3ZMDA 3O3KA 2M45A 2IA0A 1LQ1A 4YIIA 1J7KA 1Q1HA 1IN7A 4BAYA 2QQBA 3COAC 3IWFA 5FGMA 4CHUA 4YIFA 2JPCA 1JGSA 4A0YA 1F5TA 2FA5A 3F8CA 1ZG5A 2F5FA 2HZTA 4LD5A 5FD6A 2ELHA 3ZMTA 2L3DA 3HSRA 1R1VA 2IA1A 4R1HA 2Q8KA 4EQQA 2HWVA 4U7DA 2R3SA 2GZWA 4O5VA 3I59A 2MLKA 5K5QA 1R58A 1QO0D 2ACJA 5DD8A 1Y0UA 2W24A 1OPCA 3ZPLA 1K78B 1D3YA 1O57A 5ERIA 3WU0A 1ON1A 5LLQA 5FLXZ 2QYOA 3HRTA 5HS7A 3QOPA 2FXAA 3BROA 2K02A 3J81K 4EGYA 4UUVA 3SZPA 1SD6A 4G94A 5JHUA 1J2XA 3TKYA 2A3SA 4MEXF 3RPQA 1EH6A 3DKWA 3T5XA 1FBSA 4RB3C 3I5UA 2FNPA 5HVQC 2BBYA 5DYMA 2ZKZA 1O7FA 1YS6A 1FBUA 2M87A 2KJBA 2H94A 2QENA 3MWMA 5JVTA 4ZYDA 4HA8A 1KYWA 1I5ZA 2EFOA 4AIKA 1TTYA 4RAYA 2GAUA 2EFPA 3G3ZA 1TNSA 5L3CA 3P9CA 1DPRA 1R1TA 4ESJA 2JT1A 5CJ9A 4GXOA 4ESBA 1KU9A 3R0JA 2LSOA 3WU1B 4KYWA 4L9JA 5BOXA 4HQMA 3CUOA 3K2ZA 5BQTA 3IC7A 4KN4X 3LA3A 3J80K 4YG2F 3AAFA 3MCZA 2V79A 1LDKB 2ISZA 3CUQB 5DUIA 1V4RA 2PG4A 1IZ1A 2NS0A 2PMHA 4I98B 2VC1A 4CYDA 3ZN1A 5D6EA 1C0WA 4RGUA 3R61A 3JW4A 1OYWA 3CUQA 2DI3A 2XASA 3L2CA 3KZZA 3LAJA 3QP6A 5CVRA 1ON2A 3DV8A 4M6YA 4OU0A 5J8FA 5JFRA 3WTVC 1HSTA 2K86A 5ILUA 3RTRA 1FY7A 1P4WA 4IPAA 4XLNF 5TRDA 1WKMA 1Z7UA 2G7UA 4I2OA 4EVIA 2C6YA 5AONA 1CF7B 3RKYA 1FBQA 3MQ0A 4LLNA 2A5YB 3HRSA 3LFKA 3ROUA 2DT5A 3R4KA 2FNAA 2LNBA 3JAMZ 5H20A 2QUFA 5ICEA 5E1ZB 4HQEA 2DPUA 1CGPA 4S04A 1ZLKA 1G3TA 1OR7A 3GWZA 1ZARA 2PMUA 2K27A 4N9HA 3J80Z 3HUGA 2NRAC 2KIMA 3HRUA 3MEXA 3H3ZA 2P6TA 2DO7A 2A6EF 3F8FA 3I53A 4G6QA 2DLLA 2DBBA 2IVMA 1B9MA 3T0YA 3ZMZA 3ZMSA 4M6XA 3WE3A 4EGZA 4OOIA 4CO8A 3C3WA 3BZ6A 5BS6A 2FBKA 1IXCA 2RN7A 1J5YA 3GYHX 1UFMA 4EJVA 2DK8A 3FM5A 3HYIA 3EYIA 1MDMA 5E8GA 4HX7A 1D8KA 2CO5A 2OU2A 3V7SA 4A12A 4LMYA 1K78A 4ENKA 2KKOA 3TO7A 4G6DA 4FX0A 3SQNA 5DV5A 1OYIA 4ETSA 1BOAA 1MD0A 3NQOA 2EB7A 1ZH5A 2YX4A 4GYGA 3FWEA 4Q48A 2IT0A 3BPVA 4IRGA 3VEPA 3RI4A 3Q5FA 1FP1D 1USTA 2K4JA 3BJOA 4U88A 1B6AA 3TDUC 3WGGA 3F6OA 3HOSA 1T6SA 2VODA 4HLYA 1G6NA 2PBIA 4I01A 1KA8A 2B0LA 4YFKF 1PP8F 5IT3A 1SAXA 1P2FA 5DD4A 1YQAA 3KP6A 1I27A 4IF4A 2HKXA 1EV7A 3RPUA 3E6BA 2VBZA 2QQAA 1PP7U 3IKVA 4XSXF 2Y48A 5E18F 2ESNA 4MNUA 4N9IA 3F22A 4HV5A 1KQ9A 4G7HF 1R22A 3U9GA 3VB2A 2PQ8A 2XROA 1TW3A 1F4KA 1ULYA 4OMZA 4UVBA 1R36A 3PQJA 3WTSC 1HW5A 2FBHA 4U0VA 3KE2A 2E7XA 4MHGA 1YW9A 3EQLF 5FFXA 1V3FA 4M9SA 3CUQC 2J5PA 4I0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HGC A;  1F1Z A;  4N0B A;  3VFZ A;  5D5X B;  1BC7 C;  1FNN A;  3WGI A;  1UB9 A;  1SMT A;  3ISP A;  3WTT C;  3U1D A;  2A69 F;  3KEO A;  2L54 A;  1W7P D;  5E1W A;  4EMS A;  1B4A A;  2VXZ A;  4BQA A;  3CO7 C;  2Y0M A;  1XMK A;  1O3Q A;  2HQN A;  2Q0O A;  3H3U A;  2RC4 A;  2XAJ A;  4RB0 A;  1A04 A;  5DCM A;  2GXB A;  3ERE D;  5IT9 K;  5KK1 A;  3DF8 A;  2FSW A;  1T0F A;  1J59 A;  2XIG A;  1STZ A;  1SMY F;  3VOE A;  1R1U A;  1K6O A;  1GVJ A;  2CFX A;  3E6M A;  4HX4 A;  2DW4 A;  2V1D A;  2QZ8 A;  3Q9S A;  2PI0 A;  1ZGA A;  1BM9 A;  3ULQ B;  1YIO A;  3E97 A;  5L3F A;  4CDG A;  3ZN0 A;  1KQ8 A;  3LA7 A;  2VOO A;  1RUO A;  5D4R A;  4HLX A;  4KMU X;  3KP5 A;  2CW0 F;  1LNW A;  2EV6 A;  2RNJ A;  1KQ0 A;  1RZ4 A;  4ENM A;  4LG0 A;  1QBJ A;  1IN4 A;  2BYV E;  4RAZ A;  3LWF A;  1LEB A;  1GHC A;  1KYZ A;  3BDD A;  1I6X A;  1JHF A;  4Q4Z F;  1RIO H;  1O7L A;  4Q47 A;  2RVC A;  3JTH A;  2GA1 A;  4LG0 B;  3BJ6 A;  2VBW A;  2ZME A;  5CLS A;  2ISY A;  1BJA A;  4IRH A;  3RKX A;  1IXS B;  5J8C A;  4KIB A;  2ZNZ A;  2OQR A;  2EA4 A;  2P4W A;  3MZH A;  4F7Z A;  2ADU A;  2DPD A;  1HQC A;  1T38 A;  5E8I A;  3TGN A;  3ZMV A;  4UVA A;  2FBI A;  2BE5 F;  4M73 A;  3HSE A;  3KP4 A;  4ON0 A;  4UV8 A;  2P5V A;  2HTS A;  4WWC A;  1WSU A;  2MBF A;  3FMQ A;  5K5O A;  2R7D A;  4Q5S F;  4AVP A;  4OIO F;  3F8B A;  5F6F A;  3LST A;  1PUE E;  4RGR A;  5CVV A;  2HKO A;  1XN7 A;  2V1X A;  3KP2 A;  2JSC A;  4EJT A;  4ZZD A;  2MC3 A;  3R60 A;  3IKT A;  4KT5 C;  2LF8 A;  1FYM A;  1ZGJ A;  5ICF A;  1KGS A;  3WG9 A;  2G9W A;  4B09 A;  2M8E A;  1XGM A;  1MJ9 A;  3TQN A;  3KEQ A;  1XGN A;  4HOB A;  4I09 A;  4QLC U;  3P7N A;  1BBY A;  3QU3 A;  4CIC A;  3BY6 A;  2IJL A;  3KP7 A;  3ZQ7 A;  1IN6 A;  2IW5 A;  2BGC A;  1OYY A;  4KN7 X;  1BI2 A;  2CSO A;  3MAJ A;  1FYK A;  1YW8 A;  5TJJ A;  4PGH A;  3V7R A;  1YFH A;  4Y17 A;  4M72 A;  2EV5 A;  4OIR F;  2M30 A;  1T2K A;  4NQW A;  2EFW A;  2W85 A;  2M1B A;  4G7Z F;  4XSZ F;  3IRR A;  1Z05 A;  4ZYE A;  1S7A A;  3ABT A;  2XUB A;  1RUN A;  2YSR A;  1XSV A;  1ZHF A;  2P5K A;  2Y75 A;  5HLH A;  2XKO A;  1KU3 A;  1U5T C;  3NRV A;  2XAH A;  3IRQ A;  3MZY A;  3R6S A;  2OAZ A;  3B73 A;  3K9T A;  3F8N A;  1XSX A;  2W84 A;  2P8T A;  3K1M A;  3TOB A;  3V7C A;  5BPD A;  1SD5 A;  4GO1 A;  1CF7 A;  1ZG3 A;  1E17 A;  4M71 A;  1HKT A;  4ASN A;  3GUD A;  1TBX A;  1RNL A;  3J81 Z;  4ENN A;  1TQM A;  3JSO A;  2K7L A;  4H0E A;  4LJZ F;  3EUH A;  3D0S A;  1J75 A;  1MJA A;  1R5H A;  5CVJ A;  1DPU A;  3FMS A;  1ZRC A;  1FSE A;  3I59 B;  2QVO A;  4EJU A;  3M7G A;  1HKQ A;  2FF4 A;  2IP2 A;  2Z3Y A;  2L01 A;  3SXY A;  4YFN F;  4OMY A;  3DPL C;  3K0L A;  4PDK A;  2XAQ A;  3S2W A;  2P7V B;  3RDI A;  3TDZ C;  2OD5 A;  4P5O A;  3L09 A;  2F5E A;  1YO5 C;  3LA2 A;  1U8R A;  4HDU A;  3F3X A;  5L3G A;  5HOO A;  3G73 A;  1J0R A;  1FWZ A;  3GXO A;  5E17 F;  3HHH A;  2EV0 A;  3ELK A;  1OMI A;  1YLF A;  4D0P A;  2VE8 A;  3KLN A;  3GEZ A;  4A5M A;  3J7A O;  5FB2 A;  3F8M A;  3ZP5 A;  2Z9O A;  2FU4 A;  3WTY C;  1W7P A;  5D8L B;  3FX3 A;  2ESH A;  2FEZ A;  1MDM B;  2P7C B;  2V6C A;  2KJC A;  1ZN2 A;  1F9N A;  2HEO A;  4FT8 A;  1ZLJ A;  3RYP A;  1U5T B;  3F72 A;  2O03 A;  4BNC A;  3FF5 A;  3I71 A;  4ZYH A;  3DPT A;  1ZRF A;  2DU9 A;  4U7B A;  3ABU A;  5CYV A;  3HIF A;  5ICG A;  1U2W A;  3FXR A;  1USS A;  5KVR A;  3WTW C;  1BN5 A;  1Z6R A;  2XRN A;  1R00 A;  3M8F A;  2P5L C;  1J9I A;  2WC2 A;  3M9A A;  3SHF A;  1AWC A;  4KA4 A;  1KU7 A;  3EET A;  5HS9 A;  2DTR A;  1IN8 A;  2RGV A;  4WCG A;  3GVA A;  1TNT A;  3GFM A;  2Z5U A;  2FOK A;  1FC3 A;  3KET A;  1YTY A;  3F6V A;  3ECO A;  3ECH A;  2TDX A;  2RDP A;  1E2X A;  5LGU A;  4P9F A;  3W6J B;  3HRM A;  2L02 A;  4WXD A;  3WTX C;  1UCR A;  1FLI A;  3R0A A;  2F2E A;  3BJA A;  3E6D A;  3I4P A;  2GIV A;  4WK8 F;  4I02 A;  1T39 A;  5CVU A;  1G3W A;  2OZ6 A;  2V9V A;  2RQP A;  3L7W A;  3W6K B;  3DP7 A;  2GXG A;  3F21 A;  4PCQ A;  3GZ6 A;  1EH7 A;  1LJ9 A;  1U78 A;  1IRG A;  2X0L A;  4KNY A;  3WGH A;  1U3E M;  4RS8 A;  3KZY A;  5HLI A;  4S05 A;  4A5N A;  4WXH A;  2H6B A;  3QRF F;  2UXX A;  1IF1 A;  1QGP A;  2ZXJ A;  4P55 A;  5E1X A;  1P6R A;  1FSH A;  3GF2 A;  4WXC A;  4G7O F;  3WTZ A;  2AS5 F;  3BPX A;  4U0W A;  3NEU A;  5ICC A;  3Q9V A;  1ZYR F;  4LLG F;  5A2Q K;  1XB4 A;  3QP5 A;  1UHM A;  2NNN A;  5LEJ A;  2COM A;  3FXQ A;  5AIP A;  2P6S A;  3O2P E;  3SZT A;  5H6Q A;  5HLG A;  3K1P A;  3IHU A;  4M9Z A;  5DEQ A;  4A6D A;  4KIC A;  4IVN A;  3WTU C;  3JTG A;  1S8N A;  4EJO A;  4ZYG A;  1OKR A;  3VOD A;  4L0Y B;  2JPB A;  3GW2 A;  3SFZ A;  5J6X A;  3KLO A;  4L18 B;  1L0O C;  1WWX A;  1QZZ A;  3I54 A;  5D4S A;  3GFJ A;  2QM3 A;  2ZME B;  1W4M A;  3IWZ A;  1O3T A;  1QZY A;  4IRI A;  3QAH A;  2A68 F;  2W57 A;  1WQ2 A;  5F1R A;  2STT A;  2PJP A;  3V8J A;  3WOD F;  5HDG A;  2W25 A;  3QPH A;  4HW0 A;  4KUM A;  1IW7 F;  2KIU A;  1G3Y A;  2KRF A;  5LHI A;  2DQR A;  4L5J A;  2R7F A;  1IN5 A;  2CWE A;  4G8X A;  2MD5 A;  2OA4 A;  1SD4 A;  4M74 A;  3BOQ A;  4LK1 F;  4UNO A;  1TQI A;  4LK0 F;  3HOT A;  4G9Y A;  4XLP F;  2A61 A;  4XBF A;  1IUY A;  2YR2 A;  4MQV A;  5D5V B;  2ZNY A;  4EM2 A;  1RI7 A;  5AIQ A;  2RV8 A;  4L0Z B;  5F64 A;  4L5I A;  1VTN C;  1BIB A;  4PGG A;  1B9N A;  1U5T A;  4R8H A;  2G7H A;  2EK5 A;  1G3S A;  2Q2E A;  4FHT A;  4ESF A;  3CTA A;  1LVA A;  2DQL A;  3CJN A;  1LEA A;  1X3U A;  4RGX A;  5LBQ A;  1FPQ A;  4NB5 A;  1B59 A;  4MEY F;  5K1Y A;  2HYF A;  4L9V A;  5EEH A;  2LF7 A;  2VOP A;  1MZB A;  2LKP A;  2M5W A;  5LRS A;  2CG4 A;  4U0Y A;  2OQG A;  2WV0 A;  4I7H A;  2PFB A;  2QBY A;  1FZP B;  3L9F A;  5FLX K;  2XHK A;  3FMR A;  1S7O A;  4HF1 A;  1R7J A;  3QU6 A;  3I0T A;  1W7P B;  3E5U A;  3DEU A;  2ZBK A;  3RJP A;  2GQQ A;  5HS8 A;  1WRJ A;  2H09 A;  5EEG A;  2QBY B;  3FXU A;  4E70 A;  1I1S A;  1HW2 A;  2XVC A;  1SFE A;  1LB2 A;  4BH9 A;  2UZK A;  4JK1 X;  2MH9 A;  2E7W A;  4AD9 A;  4CXF A;  3V4G A;  5CVI A;  1D5V A;  5FO5 A;  2MLG A;  2FE3 A;  2VE9 A;  2HR3 A;  3FHZ A;  4AIJ A;  1H9T A;  1ODD A;  4BXU A;  4HF2 A;  2QWW A;  3GFI A;  4LFU A;  1QNT A;  4ENJ A;  1BI0 A;  1P4A A;  5DCF A;  3DFG A;  1MJB A;  4KIF A;  2HOE A;  1S6L A;  1Z1D A;  2IRF G;  4P9U A;  1XCV A;  2BV6 A;  1XSD A;  2LDU A;  2EWN A;  1JHH A;  2XV4 S;  1H0M A;  2YU3 A;  4A0X A;  2XKP A;  1JXS A;  2ETH A;  3CLO A;  2JRT A;  5HDN A;  1R5G A;  3N97 A;  3M1E A;  5D5U B;  3KP3 A;  2PEX A;  4HBL A;  3I64 A;  1MGT A;  1FP2 A;  2HFH A;  1SD7 A;  1H9G A;  2EA2 A;  5JR3 A;  1T98 A;  5D5W B;  5D6F A;  1DDN A;  4BHP A;  3ML6 A;  4LGW A;  3FZV A;  2CGP A;  2OZU A;  1SFU A;  2HTJ A;  3E3V A;  4M9X A;  3RIR A;  4RB2 C;  1FOK A;  4HYE A;  1DP7 P;  5K5R A;  4MGR A;  3C1D A;  1Z6T A;  1REP C;  5LHG A;  3EYY A;  5D8K B;  1YW7 A;  4WF2 A;  1FX7 A;  4MTE A;  2NYX A;  1P4X A;  4KMF A;  4EM1 A;  3I58 A;  2L4A A;  1Z9C A;  5H6R A;  2FQ3 A;  2UXN A;  3MFK A;  1MKM A;  5LHH A;  2DK5 A;  1IXR C;  5L3B A;  1YG2 A;  2STW A;  1GXQ A;  2X4H A;  3N4M A;  2JTV A;  2HQR A;  4BHC A;  2NNY A;  2GA2 A;  4EM0 B;  2PLY A;  1W5S A;  3JSP A;  2HYG D;  3HSF A;  1W5T A;  4IHT A;  2CYY A;  2OBP A;  5LEK A;  1G4D A;  3PQK A;  5DDG A;  1YYV A;  1XCB A;  4ZZL A;  3HTS B;  3QPT A;  1ZG1 A;  4UVC A;  2EFQ A;  4Z2Y A;  1L3L A;  1U6G A;  1HSJ A;  4YFX F;  1NHA A;  4BYY A;  4CGZ A;  2VBX A;  2O6G E;  3P9K A;  2D1H A;  2H6C A;  1I1G A;  2L4M A;  2ZCW A;  4LLL A;  4L9T A;  1K79 A;  4NHJ A;  4HDV A;  3T8T A;  2E1C A;  4IJA A;  1D8J A;  4EJW A;  4PZJ A;  4KFC A;  4JBA A;  3O6B B;  2ZFW A;  4JQF A;  1TLH B;  3TO6 A;  5A2Q Z;  4HZF A;  3GFL A;  1EH8 A;  1TQP A;  2GWR A;  1HBX G;  1KU2 A;  1BI1 A;  2F5D A;  4OIN F;  2QLZ A;  2IA2 A;  4L9N A;  4XRF A;  2WTE A;  3V8L A;  2YPR A;  5LGT A;  3P9I A;  3HTU A;  1K7A A;  5LGN A;  3OV8 A;  4I0A A;  1TW2 A;  1XD7 A;  1DUX C;  3H92 A;  2IPQ X;  4FX4 A;  2XGX A;  1O3S A;  4IXA A;  3V8K A;  2E1N A;  2XAF A;  3LQR A;  5FD5 A;  3TO9 A;  5DUK A;  5BPI A;  3TOA A;  2RKH A;  3L00 A;  2KIF A;  2D45 A;  3LQQ A;  4A6E A;  3GLX A;  3B02 A;  4DQ2 A;  1FYL A;  3E5Q A;  2YX7 A;  3BP8 A;  2O0Y A;  1P92 A;  2F5C A;  3E6C C;  1PDN C;  2XAG A;  2D2W A;  5ILS A;  3OOP A;  4B8X A;  1WI9 A;  4AWX B;  2MH2 A;  2VT3 A;  2O8X A;  4AIH A;  5FFZ A;  2FMY A;  5L3E A;  1Z91 A;  1IAW A;  4Y13 A;  4P96 A;  2D1V A;  4IHS A;  3DQV C;  2UWM A;  1XDS A;  3GO5 A;  4KDP A;  4LB6 B;  2ZO4 A;  3LAP A;  2J5O A;  2Z33 A;  5IT9 Z;  4OIQ F;  2FML A;  2EJR A;  3REO A;  1QQI A;  4KIG A;  3FM3 A;  4A2U A;  2O3F A;  3F23 A;  3IL2 A;  1O3R A;  1ZAO A;  3BWG A;  2VN2 A;  5ED4 A;  4RGS A;  2VBY A;  1GXP A;  3C7J A;  1ZRD A;  3GX4 X;  3K1N A;  4ZH4 F;  5HDK A;  4A0Z A;  2V1U A;  1S29 A;  5ILV A;  4GGG A;  4O3M A;  2AXL A;  3RKW A;  4RB1 A;  2FRH A;  3GZ5 A;  3T1B A;  1XDU A;  4QWQ A;  5L3D A;  2O61 A;  4HX8 A;  1BC8 C;  4GYI A;  2NAZ A;  3D5L A;  3KFW X;  4OIP F;  1QPM A;  2HDC A;  3K69 A;  4GCV A;  4K2E A;  4CZZ A;  2EFN A;  6PAX A;  3WE2 A;  3M8E A;  2VT2 A;  4HF0 A;  3EDP A;  3T8R A;  1XGS A;  4MTD A;  5LRR A;  4BHB A;  2DAO A;  3DXJ F;  4HV6 A;  2VON A;  5BMZ A;  1AOY A;  2K4B A;  3JAM K;  3C18 A;  1XMA A;  3HHG A;  3RYR A;  4DNC A;  1LDD A;  2HS5 A;  2PN6 A;  2WWY A;  2A07 F;  3U2R A;  5E20 A;  4UV9 A;  1BI3 A;  4MQ9 F;  2BEO A;  1YS7 A;  3CDH A;  2CQK A;  2ZJ2 A;  4R79 A;  2A6H F;  2QQ9 A;  3KCC A;  2JZY A;  4EV0 A;  2VC0 A;  4LB5 A;  3ZMU A;  5JI6 A;  2MA3 A;  1S3J A;  4UXN A;  1UHW A;  1HXD A;  3E5X A;  2DFI A;  1LDJ A;  1ONV A;  2Z99 A;  3PFI A;  1JE8 A;  1HW1 A;  1SFX A;  4UHT A;  3CO6 C;  1ZRE A;  1IRF A;  1XGO A;  1FT9 A;  1R23 A;  1BIA A;  4TV7 A;  4Y15 A;  4HAM A;  2H27 A;  4O6J A;  1HKS A;  4WX9 A;  5DCM B;  1B1B A;  3ZMD A;  3O3K A;  2M45 A;  2IA0 A;  1LQ1 A;  4YII A;  1J7K A;  1Q1H A;  1IN7 A;  4BAY A;  2QQB A;  3COA C;  3IWF A;  5FGM A;  4CHU A;  4YIF A;  2JPC A;  1JGS A;  4A0Y A;  1F5T A;  2FA5 A;  3F8C A;  1ZG5 A;  2F5F A;  2HZT A;  4LD5 A;  5FD6 A;  2ELH A;  3ZMT A;  2L3D A;  3HSR A;  1R1V A;  2IA1 A;  4R1H A;  2Q8K A;  4EQQ A;  2HWV A;  4U7D A;  2R3S A;  2GZW A;  4O5V A;  3I59 A;  2MLK A;  5K5Q A;  1R58 A;  1QO0 D;  2ACJ A;  5DD8 A;  1Y0U A;  2W24 A;  1OPC A;  3ZPL A;  1K78 B;  1D3Y A;  1O57 A;  5ERI A;  3WU0 A;  1ON1 A;  5LLQ A;  5FLX Z;  2QYO A;  3HRT A;  5HS7 A;  3QOP A;  2FXA A;  3BRO A;  2K02 A;  3J81 K;  4EGY A;  4UUV A;  3SZP A;  1SD6 A;  4G94 A;  5JHU A;  1J2X A;  3TKY A;  2A3S A;  4MEX F;  3RPQ A;  1EH6 A;  3DKW A;  3T5X A;  1FBS A;  4RB3 C;  3I5U A;  2FNP A;  5HVQ C;  2BBY A;  5DYM A;  2ZKZ A;  1O7F A;  1YS6 A;  1FBU A;  2M87 A;  2KJB A;  2H94 A;  2QEN A;  3MWM A;  5JVT A;  4ZYD A;  4HA8 A;  1KYW A;  1I5Z A;  2EFO A;  4AIK A;  1TTY A;  4RAY A;  2GAU A;  2EFP A;  3G3Z A;  1TNS A;  5L3C A;  3P9C A;  1DPR A;  1R1T A;  4ESJ A;  2JT1 A;  5CJ9 A;  4GXO A;  4ESB A;  1KU9 A;  3R0J A;  2LSO A;  3WU1 B;  4KYW A;  4L9J A;  5BOX A;  4HQM A;  3CUO A;  3K2Z A;  5BQT A;  3IC7 A;  4KN4 X;  3LA3 A;  3J80 K;  4YG2 F;  3AAF A;  3MCZ A;  2V79 A;  1LDK B;  2ISZ A;  3CUQ B;  5DUI A;  1V4R A;  2PG4 A;  1IZ1 A;  2NS0 A;  2PMH A;  4I98 B;  2VC1 A;  4CYD A;  3ZN1 A;  5D6E A;  1C0W A;  4RGU A;  3R61 A;  3JW4 A;  1OYW A;  3CUQ A;  2DI3 A;  2XAS A;  3L2C A;  3KZZ A;  3LAJ A;  3QP6 A;  5CVR A;  1ON2 A;  3DV8 A;  4M6Y A;  4OU0 A;  5J8F A;  5JFR A;  3WTV C;  1HST A;  2K86 A;  5ILU A;  3RTR A;  1FY7 A;  1P4W A;  4IPA A;  4XLN F;  5TRD A;  1WKM A;  1Z7U A;  2G7U A;  4I2O A;  4EVI A;  2C6Y A;  5AON A;  1CF7 B;  3RKY A;  1FBQ A;  3MQ0 A;  4LLN A;  2A5Y B;  3HRS A;  3LFK A;  3ROU A;  2DT5 A;  3R4K A;  2FNA A;  2LNB A;  3JAM Z;  5H20 A;  2QUF A;  5ICE A;  5E1Z B;  4HQE A;  2DPU A;  1CGP A;  4S04 A;  1ZLK A;  1G3T A;  1OR7 A;  3GWZ A;  1ZAR A;  2PMU A;  2K27 A;  4N9H A;  3J80 Z;  3HUG A;  2NRA C;  2KIM A;  3HRU A;  3MEX A;  3H3Z A;  2P6T A;  2DO7 A;  2A6E F;  3F8F A;  3I53 A;  4G6Q A;  2DLL A;  2DBB A;  2IVM A;  1B9M A;  3T0Y A;  3ZMZ A;  3ZMS A;  4M6X A;  3WE3 A;  4EGZ A;  4OOI A;  4CO8 A;  3C3W A;  3BZ6 A;  5BS6 A;  2FBK A;  1IXC A;  2RN7 A;  1J5Y A;  3GYH X;  1UFM A;  4EJV A;  2DK8 A;  3FM5 A;  3HYI A;  3EYI A;  1MDM A;  5E8G A;  4HX7 A;  1D8K A;  2CO5 A;  2OU2 A;  3V7S A;  4A12 A;  4LMY A;  1K78 A;  4ENK A;  2KKO A;  3TO7 A;  4G6D A;  4FX0 A;  3SQN A;  5DV5 A;  1OYI A;  4ETS A;  1BOA A;  1MD0 A;  3NQO A;  2EB7 A;  1ZH5 A;  2YX4 A;  4GYG A;  3FWE A;  4Q48 A;  2IT0 A;  3BPV A;  4IRG A;  3VEP A;  3RI4 A;  3Q5F A;  1FP1 D;  1UST A;  2K4J A;  3BJO A;  4U88 A;  1B6A A;  3TDU C;  3WGG A;  3F6O A;  3HOS A;  1T6S A;  2VOD A;  4HLY A;  1G6N A;  2PBI A;  4I01 A;  1KA8 A;  2B0L A;  4YFK F;  1PP8 F;  5IT3 A;  1SAX A;  1P2F A;  5DD4 A;  1YQA A;  3KP6 A;  1I27 A;  4IF4 A;  2HKX A;  1EV7 A;  3RPU A;  3E6B A;  2VBZ A;  2QQA A;  1PP7 U;  3IKV A;  4XSX F;  2Y48 A;  5E18 F;  2ESN A;  4MNU A;  4N9I A;  3F22 A;  4HV5 A;  1KQ9 A;  4G7H F;  1R22 A;  3U9G A;  3VB2 A;  2PQ8 A;  2XRO A;  1TW3 A;  1F4K A;  1ULY A;  4OMZ A;  4UVB A;  1R36 A;  3PQJ A;  3WTS C;  1HW5 A;  2FBH A;  4U0V A;  3KE2 A;  2E7X A;  4MHG A;  1YW9 A;  3EQL F;  5FFX A;  1V3F A;  4M9S A;  3CUQ C;  2J5P A;  4I0B A; 
#chains in the Genus database with same CATH topology
 1VQN I;  2HGC A;  1F1Z A;  1ZTR A;  4YIR X;  2KQR A;  4E6K G;  4N0B A;  3VFZ A;  4XIC A;  5D5X B;  1BC7 C;  2LMD A;  1FNN A;  1ACI A;  3WGI A;  1UB9 A;  2VJ5 A;  3H9G A;  1SMT A;  3ISP A;  3WTT C;  3U1D A;  1Z7L A;  2A69 F;  3KEO A;  2L7M P;  2L54 A;  3RQ4 A;  1W7P D;  2XPV A;  5E1W A;  1I6H J;  2DCE A;  1B4A A;  2VXZ A;  2ZSI B;  4EMS A;  2HVS A;  1GV5 A;  3CO7 C;  1UAA A;  2Y0M A;  4BQA A;  1XMK A;  2Q2E B;  3SEQ A;  1O3Q A;  4V19 K;  2HQN A;  4C2U A;  2Q0O A;  2HVR A;  4BQN A;  3H3U A;  3S1R J;  2RC4 A;  1MBK A;  2XAJ A;  4RB0 A;  2VKH A;  1A04 A;  2LFB A;  5FRM A;  3VWB A;  2XAU A;  1VQM I;  5DCM A;  2GXB A;  3ERE D;  2AHQ A;  1ZR2 A;  3S8P A;  5IT9 K;  5KK1 A;  3GZN B;  2GIZ A;  3DF8 A;  1DGW Y;  2HPM A;  4B48 A;  4E7H A;  2FSW A;  3CCV I;  2B7E A;  1T0F A;  1J59 A;  3O8H A;  4I0B A;  1Y8R B;  2XIG A;  4HNU A;  1STZ A;  1SMY F;  3VOE A;  1R1U A;  1K6O A;  1GVJ A;  2CFX A;  3E6M A;  4HX4 A;  2DW4 A;  2V1D A;  2VQH A;  2QZ8 A;  3Q9S A;  4PJ0 C;  3OYG A;  2PI0 A;  1ZGA A;  4BJ6 C;  1BM9 A;  3ULQ B;  4BGD A;  1SAU A;  3OYD A;  1U9O A;  3H3V K;  1YIO A;  1X2N A;  5J4V A;  3E97 A;  2K85 A;  5L3F A;  4CDG A;  1OCR H;  3ZN0 A;  1KQ8 A;  3LA7 A;  3BG9 A;  2VOO A;  4QPO A;  1RUO A;  5D4R A;  4HLX A;  4KMU X;  3KP5 A;  2CW0 F;  1LNW A;  2EV6 A;  2RNJ A;  4RAG A;  1KQ0 A;  4FAS D;  1RZ4 A;  2KT0 A;  5HNF A;  4ENM A;  1QHG A;  3PIO F;  3GTK J;  3BC8 A;  4LG0 A;  1QBJ A;  1IN4 A;  2BYV E;  4RAZ A;  3LWF A;  1S72 I;  1LEB A;  1GHC A;  1KYZ A;  3BDD A;  1I6X A;  1JHF A;  2JA5 J;  3BZC A;  4Q4Z F;  3UR3 C;  1RIO H;  1O7L A;  4F3Q A;  4B44 A;  4Q47 A;  2OTJ I;  3P5J A;  2RVC A;  3JTH A;  1Y6I A;  4XON A;  2GA1 A;  4LG0 B;  1MBJ A;  2MW8 A;  3BJ6 A;  1N78 A;  2VBW A;  2ZME A;  4HNV A;  5CLS A;  4DIQ A;  4ZTF A;  3HOV J;  2ISY A;  1BJA A;  4IRH A;  3RKX A;  1IXS B;  5J8C A;  4KIB A;  4LIU A;  5GTH C;  3H9Q A;  4XQF A;  2WY8 Q;  2P0W A;  2VLA A;  2ZNZ A;  2D5V A;  2KZG A;  2OQR A;  2EA4 A;  3DEE A;  2P4W A;  2IXS A;  2X48 A;  3MZH A;  3FK6 A;  4F7Z A;  4OWR B;  2M0M A;  4ZC3 A;  2E2H J;  4B47 A;  2ADU A;  1RR8 C;  2DPD A;  3OL4 A;  1IG7 A;  3QYF A;  1HQC A;  1T38 A;  2DYS H;  5E8I A;  2UV1 A;  2ZJR F;  3TGN A;  2EIK H;  3ZMV A;  4UVA A;  2FBI A;  2ZC2 A;  2BE5 F;  2BVM A;  2JJ7 A;  3ONQ A;  3BG3 A;  4M73 A;  3HSE A;  2M7B A;  3F9K A;  3FBI B;  3KP4 A;  4ON0 A;  1YI2 I;  4UV8 A;  2ICW G;  2P5V A;  1W0U A;  2HTS A;  4WWC A;  1WSU A;  2MBF A;  3FMQ A;  5K5O A;  2R7D A;  4Q5S F;  4AVP A;  4OIO F;  3F8B A;  5F6F A;  5FRO A;  1BL0 A;  5DS9 A;  4PFP A;  3K6G A;  1X3Z B;  2A5W A;  3KYL A;  3LST A;  1PUE E;  2XRL A;  1M1E B;  4Y3O A;  4QTR A;  2R5Y A;  2CW8 A;  4X1E A;  4RGR A;  5CVV A;  4NC7 A;  2HKO A;  4XLE A;  1WZ2 A;  3HOZ J;  1XN7 A;  2V1X A;  1Y39 A;  3KP2 A;  4C30 A;  3ZQQ A;  1FJL A;  3MVP A;  2DFH A;  2JSC A;  4EJT A;  4NBQ A;  3EPZ A;  4ZZD A;  1IGN A;  5M5Y J;  5EGO B;  2MC3 A;  3R60 A;  3OSF A;  3IKT A;  2DYR H;  1JT0 A;  2EZK A;  4KT5 C;  2LF8 A;  1FYM A;  3KIO A;  1ZGJ A;  3MKZ A;  2GM4 A;  2IS2 A;  1POG A;  4PJJ A;  5ICF A;  1JUS A;  1KGS A;  3WG9 A;  2G9W A;  4B09 A;  2ME6 A;  2M8E A;  1XGM A;  1MJ9 A;  3CMM A;  3TQN A;  2E1M C;  3KEQ A;  1XGN A;  4HOB A;  4I09 A;  2CFO A;  4QLC U;  2ZXH A;  3P7N A;  3AFH A;  1BBY A;  2MGQ A;  3QU3 A;  4CIC A;  3BY6 A;  2IJL A;  2M8G X;  3OYJ A;  1YHQ I;  1D1C A;  3KP7 A;  3ZQ7 A;  1IN6 A;  1UZC A;  3KPH A;  4HRI A;  2IW5 A;  2LLK A;  2BGC A;  3PNY A;  1OYY A;  4JX4 A;  4RLQ A;  1JKQ C;  4KN7 X;  4MLO A;  1BI2 A;  2CSO A;  2GOX B;  3MAJ A;  3QQA A;  3M1C A;  1FYK A;  3AG4 H;  3BG6 A;  1YW8 A;  2G0E A;  2XF5 A;  5TJJ A;  3S3M A;  5M5W J;  4PGH A;  1WCM J;  1TWA J;  1Z21 A;  4D7M A;  1RC9 A;  5C44 J;  3V7R A;  1YFH A;  2E36 A;  5EF6 A;  4Y17 A;  1FIA A;  3BR1 A;  4II2 A;  4RA2 A;  4M72 A;  4D5C A;  2EV5 A;  2VUM J;  4OIR F;  1JTY A;  2M30 A;  1T2K A;  1ORK A;  4NQW A;  2EFW A;  2W85 A;  5E3N A;  2M1B A;  2R0Q C;  2CS3 A;  2FJ1 A;  3CP2 A;  4G7Z F;  4XSZ F;  3D5R C;  3IRR A;  2X6O A;  1Z05 A;  4ZYE A;  1S7A A;  2QKM B;  3ABT A;  2XUB A;  1QU3 A;  2VPR A;  3NAR A;  1PUF B;  1RUN A;  4E4H A;  3CDI A;  2YSR A;  1MSE C;  1XSV A;  2Y75 A;  1ZHF A;  2P5K A;  2KL4 A;  3OYE A;  2Y31 A;  4NDL A;  2R7U A;  1HLV A;  5HLH A;  2XKO A;  1KU3 A;  1U5T C;  2KDO A;  2GXA A;  3NRV A;  2XAH A;  3IRQ A;  5FKL A;  2QGU A;  3VYR B;  3MZY A;  2WAQ N;  4IO9 F;  3R6S A;  2EIJ H;  1X3W B;  2OAZ A;  1VQ8 I;  3B73 A;  1X2M A;  3K9T A;  3F8N A;  2HPI A;  2PX9 A;  1XSX A;  2W84 A;  4M3B A;  1OIS A;  2AO9 A;  2P8T A;  3K1M A;  2OF7 A;  3CC4 I;  3TOB A;  3V7C A;  1KZH A;  4XR6 A;  5LD2 C;  4HST A;  1T95 A;  5BPD A;  1SD5 A;  4GO1 A;  3ZRG A;  1CF7 A;  1ZG3 A;  2E35 A;  1E17 A;  4M71 A;  3PM1 A;  1HKT A;  2FUG 2;  4ASN A;  3ZR8 X;  3GUD A;  1LE8 A;  4A93 J;  4XOP A;  3JRD A;  1TBX A;  1RNL A;  3J81 Z;  4ENN A;  2L2O A;  3RPU D;  2XGC A;  1TQM A;  3JSO A;  2K7L A;  3BT9 A;  4H0E A;  3W6V A;  4LJZ F;  3EUH A;  3TW7 A;  1B8I A;  3D0S A;  3E1S A;  3IUO A;  3CES A;  4DZJ A;  5B1A H;  1J75 A;  2LRE A;  3PNT A;  3DU5 A;  3SYT A;  1JJ6 C;  3A4C A;  2DFE A;  1MJA A;  1R5H A;  3JCU C;  3CCJ I;  4CYC B;  4NC8 A;  1EKE A;  3Q0V A;  5CVJ A;  1DPU A;  3FMS A;  1ZRC A;  1MH4 A;  1FSE A;  2ID3 A;  2QVO A;  3I59 B;  4EJU A;  2R93 J;  3M7G A;  3BTL A;  3VYS B;  4HNT A;  4UY8 I;  1HKQ A;  2FF4 A;  2IP2 A;  2Z3Y A;  2L01 A;  3SXY A;  2IS1 A;  4Y7N J;  3PFY A;  4YFN F;  4OMY A;  1BJZ A;  3DPL C;  3K0L A;  4E7K A;  4BY1 J;  2WB1 A;  2XAQ A;  4PDK A;  1TT0 A;  2HQA A;  2NVT J;  1IDY A;  3S2W A;  3WG7 H;  2P7V B;  3RDI A;  1S7E A;  3TDZ C;  2O7O A;  2OD5 A;  2EZL A;  4P5O A;  2ID6 A;  5B5E C;  3L09 A;  3LNQ A;  2F5E A;  5JVG F;  1E0E A;  1YO5 C;  3JRG A;  3LA2 A;  1U8R A;  4HDU A;  3F3X A;  5L3G A;  1ERD A;  5HOO A;  3G73 A;  1J0R A;  1FWZ A;  3TW6 A;  3GXO A;  5E17 F;  3HHH A;  4BEH B;  2EV0 A;  2M3A A;  3ELK A;  1OMI A;  1YLF A;  5CKT A;  4D0P A;  4DYR A;  4CUG A;  5HNH A;  4A3M J;  2ECB A;  2VE8 A;  3KLN A;  3GEZ A;  2DJI A;  3HB9 A;  5CQE A;  4A5M A;  2QSH X;  3J7A O;  5K7H A;  3M4O J;  2LOO A;  1DQU A;  5FB2 A;  3OWT A;  3F8M A;  3ZP5 A;  2GLO A;  2Z9O A;  1P9Q C;  2FU4 A;  2R7S A;  1W7P A;  3WTY C;  3ZXS A;  5D8L B;  4B1R A;  2M4K A;  3FX3 A;  2ESH A;  2FEZ A;  1MDM B;  4ZDP A;  1W36 D;  4BEH A;  2P7C B;  3G2B A;  2V6C A;  2TCT A;  2E19 A;  2KJC A;  2R5Z B;  4BE0 A;  3BCA A;  1FMV A;  3OYB A;  3L1P A;  1ZN2 A;  2ZFU A;  1F9N A;  2W4S A;  2HEO A;  4FT8 A;  1ZLJ A;  1OCT C;  3RYP A;  4BJ5 C;  4RAF A;  1U5T B;  3F72 A;  1TWC J;  3J7A Y;  3IH2 A;  2O03 A;  4BNC A;  3FF5 A;  3I71 A;  4ZYH A;  5KHD A;  3DPT A;  1ZRF A;  3G1M A;  2DU9 A;  2HOT A;  3OS0 A;  4U7B A;  3ABU A;  5CYV A;  5KAF C;  3IV5 A;  3HIF A;  5ICG A;  2L9S A;  3L2W A;  5JLW A;  1U2W A;  4Z6Y A;  3FXR A;  5FLM J;  3HGG A;  1USS A;  5KVR A;  1K83 J;  3ESW B;  4FQG A;  3WTW C;  3FIS A;  3S16 J;  1G8X A;  1BN5 A;  1Z6R A;  5E3O A;  4M3E A;  2DTZ A;  4UUS A;  3QYB A;  1XPX A;  2W7N A;  2XRN A;  1R00 A;  2GOM A;  3M8F A;  3GME A;  2E1O A;  3DTK A;  3FIW A;  2WC2 A;  2P5L C;  1J9I A;  3M9A A;  1W5C C;  4A3C J;  1SC7 A;  3DU6 A;  4CCM A;  3SHF A;  1AWC A;  2VPL A;  2JA8 J;  2KLO A;  1FTZ A;  4KA4 A;  3OR2 C;  3U21 A;  1KU7 A;  4BBR J;  3EET A;  3BQZ A;  3K4L A;  3HDD A;  3OIQ A;  5HS9 A;  2DTR A;  1IN8 A;  2JVG A;  2RGV A;  1X4P A;  4WCG A;  3GVA A;  4PK4 A;  1TNT A;  3GFM A;  3LSJ A;  2Z5U A;  2FOK A;  1FC3 A;  3KET A;  2BW3 A;  1YTY A;  3F6V A;  2GBY A;  3ECO A;  4X6A J;  5DM7 F;  3ECH A;  2TDX A;  2RDP A;  4IZZ A;  5FRN A;  1E2X A;  3DKY A;  5LGU A;  4IKF A;  3B6A A;  2H1L A;  4P9F A;  3W6J B;  4AU7 A;  4C2T A;  3E0J B;  2JQ7 A;  2MC4 A;  3HKZ A;  1U0J A;  3HRM A;  2L02 A;  4WXD A;  3WTX C;  5J1R A;  1UCR A;  3C2H A;  3S1M J;  1FLI A;  3R0A A;  2VI6 A;  1DGR M;  2VXD A;  1SVO A;  5M3M J;  1TC3 C;  1SVL A;  4MO7 A;  2F2E A;  2Y69 H;  3BJA A;  3E6D A;  4NQW B;  1QHH D;  1LVK A;  2DOF A;  1ZGW A;  3I4P A;  2GIV A;  4WK8 F;  4ZDL A;  4I02 A;  3LSK A;  3HM5 A;  1VQ4 I;  1T39 A;  3NWT A;  5CVU A;  1G3W A;  2OZ6 A;  2V9V A;  2RQP A;  3L7W A;  4XLC A;  3IP4 B;  3W6K B;  1FIP A;  2XSJ C;  3ZQH A;  3DP7 A;  2CMP A;  2GXG A;  3GTG J;  3F21 A;  1OCP A;  2QCO A;  1KON A;  4ZJZ A;  3JRB A;  1LFU P;  4PCQ A;  4BE1 A;  5M5X J;  3GZ6 A;  4BBS J;  1EH7 A;  2LKX A;  2CU7 A;  5GAD J;  1LJ9 A;  1U78 A;  1IRG A;  1ZK8 A;  2X0L A;  4XKC A;  1SVM A;  4KNY A;  3WGH A;  1U3E M;  3HGY A;  4RS8 A;  1T56 A;  3KZY A;  5HLI A;  4S05 A;  2X6W A;  4A5N A;  4WXH A;  3BTC A;  2H6B A;  3QRF F;  3HOY J;  2O9L A;  2PJR B;  2UXX A;  1IF1 A;  1QGP A;  2ZXJ A;  4P55 A;  5E1X A;  2XSD C;  1U9N A;  5IYB J;  2E2I J;  1P6R A;  2CV1 A;  1VQK I;  3K70 D;  1FSH A;  2I8D A;  3GF2 A;  4WXC A;  4G7O F;  3WTZ A;  3S1Q J;  2AS5 F;  3BPX A;  2EZH A;  1RES A;  3A2K A;  3ERM A;  4U0W A;  2QEX I;  3NEU A;  5ICC A;  1E3H A;  1MBG A;  3Q9V A;  3SZG A;  4I76 A;  1ZYR F;  4LLG F;  4A3F J;  3I55 I;  3HBL A;  4XKV A;  5A2Q K;  2LBF B;  1XB4 A;  3QP5 A;  1UHM A;  2NNN A;  2HXI A;  2O5R A;  4NC6 A;  3SDG A;  1ETV A;  3QYE A;  5TGT A;  5LEJ A;  2COM A;  1J09 A;  3FXQ A;  5AIP A;  2P6S A;  2R7R A;  1D0Z A;  3O2P E;  3SZT A;  2DOD A;  5H6Q A;  4BXX J;  5HLG A;  3K1P A;  3IHU A;  4M9Z A;  5DEQ A;  1ZR4 A;  4A6D A;  4KIC A;  2BHZ A;  4IVN A;  2KPM A;  3WTU C;  3JTG A;  1S8N A;  4KIT B;  4EJO A;  4ZYG A;  1MH3 A;  1OKR A;  1HDP A;  3VOD A;  4L0Y B;  1X1A A;  1BR4 A;  4AYB A;  4MIM A;  2K3P A;  5B3S H;  3OYK A;  2JPB A;  3GW2 A;  3SFZ A;  2X1C A;  5J6X A;  3KLO A;  4L18 B;  5J4Y A;  1L0O C;  1WWX A;  1ETY A;  1QZZ A;  3I54 A;  3OYN A;  5D4S A;  1I3Q J;  3DTE A;  2HI3 A;  3GFJ A;  4IEJ A;  2RRE A;  3SEZ A;  2WAF A;  4CA0 A;  3OYI A;  1APL C;  3DEW A;  2QM3 A;  2ZME B;  1W4M A;  3IWZ A;  4B43 A;  1O3T A;  1MSF C;  1QZY A;  4IRI A;  3QAH A;  2DA2 A;  4DBR A;  3CC2 I;  1RR7 A;  3LSH A;  2A68 F;  2W57 A;  1WQ2 A;  5F1R A;  2STT A;  4P1W A;  3LOC A;  3V8J A;  2PJP A;  3ZOB A;  3HOX J;  3WOD F;  4F93 B;  1R9T J;  2IS4 A;  5HDG A;  4IOA F;  2W25 A;  3VYT B;  4XM3 A;  4DOZ A;  2NOG A;  1W1W E;  3QPH A;  3JRI A;  4HW0 A;  2M4G A;  4KUM A;  4F91 B;  1IW7 F;  2KIU A;  3ABM H;  1G3Y A;  4RMN A;  2KRF A;  5LHI A;  2DQR A;  4L5J A;  4NUB A;  2R7F A;  1QZE A;  2V9K A;  1JKP C;  3FKI J;  1IN5 A;  2CWE A;  4G8X A;  4M3D A;  1N25 A;  3PSF A;  2MD5 A;  2OA4 A;  4F52 A;  2EQR A;  2FQ4 A;  1SD4 A;  4M74 A;  3BOQ A;  4LK1 F;  5E79 C;  2VJJ A;  4UNO A;  1TQI A;  4LK0 F;  1X19 A;  1V5E A;  3HOT A;  3BCB A;  4F92 B;  4G9Y A;  2L7F P;  1A31 A;  4LG3 A;  2OPT A;  3WHB A;  4XLP F;  2A61 A;  2L7Z A;  4XBF A;  2NOJ B;  1IUY A;  1F36 A;  2CQ7 A;  4ZTJ A;  3HPH A;  2NXN B;  1WJF A;  2YR2 A;  4MQV A;  5D5V B;  2ZNY A;  4EM2 A;  1BOB A;  3HZJ A;  5CPR B;  3LSP A;  2H8W A;  1RI7 A;  2DA1 A;  4LIT A;  5AIQ A;  3OS2 A;  3DCF A;  2RV8 A;  5J1Y A;  3OY9 A;  3K4C A;  4L0Z B;  5F64 A;  1SFK A;  1YX5 A;  4L5I A;  4BQQ A;  2V7F A;  1VTN C;  2N8G A;  4B3X A;  2AQE A;  2EBI A;  4A3I J;  1BIB A;  4PGG A;  2Y9Z A;  2WV1 A;  2LR8 A;  1B9N A;  1U5T A;  4R8H A;  2XB0 X;  3C2G A;  2G7H A;  1HCR A;  4BJT A;  2EK5 A;  1G3S A;  4CCK A;  2AQF A;  2ZXI A;  3BR5 A;  2V26 A;  1OFC X;  3OS1 A;  5F08 A;  2B9S A;  1TT5 B;  2V1N A;  1VQ6 I;  1T0F C;  2Q2E A;  4FHT A;  3TL4 X;  4ESF A;  2XPU A;  1XX5 A;  3CTA A;  3K70 C;  1LVA A;  2DQL A;  2ZSH B;  3CJN A;  1LEA A;  1X3U A;  5KNL A;  2WAQ A;  4RGX A;  3S17 J;  5LBQ A;  3MKY B;  3MKL A;  1FPQ A;  4DJA A;  1PUF A;  3BR6 A;  4NB5 A;  1B59 A;  2UUZ A;  2L9V A;  1TZL A;  2L7K A;  1XS9 A;  4MEY F;  5K1Y A;  1UJ8 A;  2HYF A;  4L9V A;  5EEH A;  4CH7 A;  2LBF A;  2LF7 A;  4FET A;  3L2V A;  2VOP A;  2OCE A;  1MZB A;  2LKP A;  2M5W A;  5LRS A;  3SDB A;  1FMW A;  1D1B A;  2CG4 A;  4U0Y A;  2OQG A;  2WV0 A;  4HSR A;  2PFB A;  4I7H A;  3OYF A;  3PIP F;  1A36 A;  2QBY A;  2AXT C;  1FZP B;  3M8J A;  3L9F A;  5FLX K;  1JGG A;  2XHK A;  3FMR A;  5HOD A;  2DMP A;  5GP9 A;  1XMX A;  5EG0 A;  2ZME C;  5IP6 A;  1GT0 C;  2V4J C;  1YIJ I;  3S32 A;  1S7O A;  4W1U A;  1OLT A;  4HF1 A;  1QRY A;  2WA0 A;  1R7J A;  2Y9Y A;  3EUA A;  3QU6 A;  3I0T A;  3E5U A;  1W7P B;  1IRX A;  3DEU A;  2BHY A;  2ZBK A;  3RJP A;  3CZ6 A;  3L2R A;  2DA5 A;  1WRJ A;  2GQQ A;  1X1B A;  2H09 A;  5EEG A;  5HS8 A;  3KYD B;  2QBY B;  2FD5 A;  1Y8Q B;  1YX3 A;  3FXU A;  3VPR A;  4E70 A;  5LFA A;  1HW2 A;  1I1S A;  2XGE A;  2XVC A;  1SFE A;  1LB2 A;  2MSY A;  3CCM I;  3K4J A;  4BH9 A;  2LYC A;  3RZD J;  2UZK A;  1N77 A;  4JK1 X;  3HG9 A;  2MH9 A;  4II3 A;  2E7W A;  4AD9 A;  1A6I A;  4CXF A;  4CCN A;  1D1A A;  3V4G A;  5CVI A;  3EUK L;  2RAE A;  1SAN A;  2QQ8 A;  1D5V A;  5FO5 A;  2JVH A;  2MLG A;  4XL9 A;  3OL3 A;  5HLT A;  2FE3 A;  1TWF J;  1YE9 A;  2VE9 A;  2HR3 A;  2K40 A;  3FHZ A;  4AC0 A;  1ETX A;  3FXK A;  4AIJ A;  2VKE A;  2F6C A;  2EIN H;  1H9T A;  1ODD A;  4BXU A;  4HF2 A;  4G12 A;  2QWW A;  3CME I;  4H4K C;  2LY9 A;  4LFU A;  3GFI A;  1QNT A;  3RQI A;  2Q1Z B;  4KIS A;  5B1B H;  1WJE A;  3FBN B;  3TBI A;  4ENJ A;  1BI0 A;  3ZGK A;  1P4A A;  1P7I A;  5DCF A;  3DFG A;  2OUM A;  2HXO A;  1PYV A;  1MJB A;  4KIF A;  2DDB A;  2WBM A;  1V5F A;  2HOE A;  4CYC A;  1S6L A;  5F1J A;  4XLH A;  1Z1D A;  5E3M A;  4XN0 A;  2IRF G;  2XB5 A;  4P9U A;  1XCV A;  2BV6 A;  1XSD A;  2LDU A;  2EWN A;  1JHH A;  2XV4 S;  2K9Q A;  4BDY A;  1H0M A;  2YU3 A;  4A0X A;  3LFU A;  2XKP A;  1JXS A;  2ETH A;  3CLO A;  3IH3 A;  2JRT A;  4B4C A;  5HDN A;  1R5G A;  3N97 A;  1D5Y A;  4AID A;  5EDN A;  3M1E A;  5D5U B;  3KP3 A;  2HDW A;  2PEX A;  4HBL A;  3I64 A;  1MGT A;  1FP2 A;  2HFH A;  1SD7 A;  1H9G A;  2EA2 A;  4E7Z A;  1E3O C;  5JR3 A;  3OYA A;  1UG0 A;  1F43 A;  1PVE A;  1T98 A;  4S0H B;  1FOY A;  1V5G A;  5D5W B;  4CSW A;  5D6F A;  3G1O A;  4DBQ A;  5EJC A;  1IV6 A;  4A69 C;  2BXY A;  4BHP A;  5IOY A;  1DDN A;  2YS9 A;  3ML6 A;  4LGW A;  3FZV A;  2CGP A;  2OZU A;  2CV0 A;  1SFU A;  2Y30 A;  2HTJ A;  3ZCO A;  4IQJ A;  3E3V A;  4M9X A;  3RIR A;  5IP7 J;  4RB2 C;  3QPL A;  3MKW B;  1FOK A;  4QSH A;  2HVQ A;  4HYE A;  2HZD A;  5K5R A;  4D1Q A;  2M9H A;  4MGR A;  3C1D A;  1DP7 P;  1Z6T A;  1GDT A;  2NVX J;  2VAS A;  1REP C;  5LHG A;  2BW3 B;  1VND A;  3EYY A;  5D8K B;  1YW7 A;  1VQL I;  2B63 J;  4WF2 A;  1FX7 A;  1VQ7 I;  2NYX A;  4MTE A;  4A3G J;  1P4X A;  3DBH B;  4KMF A;  1BW5 A;  1IDZ A;  4EM1 A;  2LH9 A;  3I58 A;  1B72 B;  2L4A A;  1Z9C A;  1EA3 A;  2R4G A;  5H6R A;  4RM3 A;  2R7W A;  1T8I A;  1N75 A;  1IRZ A;  2FQ3 A;  2UXN A;  3VSK A;  3MFK A;  2IGN A;  1MKM A;  4A3B J;  2XDV A;  3CCU I;  5LHH A;  2DK5 A;  3AG2 H;  3TP3 A;  2PMZ A;  1IXR C;  1I39 A;  5L3B A;  4IX7 A;  5B66 C;  1YG2 A;  2STW A;  1GXQ A;  2X4H A;  4E7I A;  5EZH A;  4AUX A;  3N4M A;  5EGO A;  2JTV A;  2HQR A;  4BHC A;  3DKX A;  2NNY A;  1ZKG A;  2GA2 A;  4EM0 B;  1VFC A;  1BA5 A;  1IV8 A;  2PLY A;  2DT6 A;  3H35 A;  4RBO A;  1W5S A;  1WJD A;  4XLA A;  3JSP A;  2HYG D;  3HSF A;  4IHW A;  1W5T A;  4C3J J;  4IHT A;  1MND A;  1MMS A;  2CYY A;  2OBP A;  1TL8 A;  5LEK A;  2ZJQ F;  1G4D A;  3PQK A;  5DDG A;  1YYV A;  4IHV A;  1R4N B;  1XCB A;  3VSL A;  2E60 A;  1UG2 A;  4ZZL A;  2QA4 I;  3HTS B;  3QPT A;  2V6E A;  1ZG1 A;  3FXJ A;  1IUF A;  4UVC A;  4BUP A;  2EFQ A;  2R7Z J;  4HEA 2;  5JLX A;  3BR3 A;  3W3C A;  4BQO A;  4Z2Y A;  3QOD A;  1L3L A;  1WGX A;  1U6G A;  4A3K J;  1HSJ A;  4KJZ A;  4YFX F;  1NHA A;  4BYY A;  4CGZ A;  1UMQ A;  2VBX A;  2A05 A;  3TP0 A;  5F27 A;  4IOC F;  2O6G E;  2Z2S B;  3D5S C;  5C4J J;  4N4O B;  2TRT A;  3P9K A;  2K9N A;  2D1H A;  2H6C A;  3FK7 A;  2QSF X;  2M0C A;  1I1G A;  1LPQ A;  2L4M A;  2ZCW A;  4LLL A;  5FKK A;  3AG3 H;  4L9T A;  1K79 A;  4RM2 A;  3JR9 A;  4NHJ A;  4HDV A;  3T8T A;  2E1C A;  4IJA A;  1D0X A;  1D8J A;  4EJW A;  2WY7 Q;  3RKQ A;  4C3H J;  4E7S A;  2Z16 A;  2BOL A;  4PZJ A;  4KFC A;  4G6T B;  4C3I J;  1Z0X A;  3KZI C;  4JBA A;  3O6B B;  2ZFW A;  3X2Q H;  4JQF A;  3ASN H;  1TLH B;  3TO6 A;  4DYC A;  5A2Q Z;  4HZF A;  2DXI A;  3F0C A;  3GFL A;  3HOW J;  1EH8 A;  1P7J A;  1TQP A;  2E71 A;  2CV2 A;  2GWR A;  1NG6 A;  1WJ5 A;  5F04 A;  1HBX G;  1HOM A;  3ZQC A;  5GAH J;  1KU2 A;  1BI1 A;  2F5D A;  1LUJ B;  4OIN F;  4EAT A;  2QLZ A;  1QVU A;  1WPK A;  2IA2 A;  4J01 A;  4L9N A;  2XF6 A;  4XRF A;  3RCO A;  3HUG B;  2WTE A;  1NG7 A;  1X1D A;  2KIS A;  3V8L A;  1U8B A;  2YPR A;  1WH7 A;  2DFF A;  5LGT A;  4OAY A;  1Z77 A;  4BU2 A;  1MW7 A;  3GLL A;  3P9I A;  3HTU A;  1K7A A;  2I5U A;  5LGN A;  2LRD A;  2DA3 A;  3OV8 A;  1MNE A;  4I0A A;  1YRN B;  3GCM A;  3A0H C;  1TW2 A;  1XD7 A;  1DUX C;  3H92 A;  1WHU A;  2JA2 A;  2IPQ X;  2K3F A;  4DW6 A;  1WJC A;  2JA7 J;  4F55 A;  2JA6 J;  1R71 A;  4FX4 A;  5GTI C;  4C9Y A;  3PO2 J;  3G4S I;  2XGX A;  3CLQ A;  3QWL A;  1O3S A;  1B8I B;  1MMD A;  1ETQ A;  1K4S A;  3BG7 A;  4IXA A;  2MYS A;  1JT6 A;  4N4N B;  3OMY A;  3V8K A;  2RQQ A;  3HJE A;  4YRV A;  3OYL A;  2E1N A;  4M6V A;  3CCQ I;  2XAF A;  4M3G A;  4ANJ A;  3LQR A;  5FD5 A;  3TO9 A;  1VQ5 I;  5H2F C;  1LE8 B;  1JI8 A;  5DUK A;  5BPI A;  1AKH B;  3TOA A;  2RKH A;  5DM6 F;  3L00 A;  4HG2 A;  2KIF A;  2D45 A;  3LQQ A;  1OQY A;  2F4I A;  4A6E A;  1W36 C;  3GLX A;  3O8G A;  2EZI A;  3B02 A;  4OAZ A;  4DQ2 A;  3OYM A;  1FYL A;  3CDL A;  3E5Q A;  2YX7 A;  3LSM A;  3BP8 A;  5GPA A;  2O0Y A;  1P92 A;  2F5C A;  3S2D J;  3E6C C;  1PDN C;  2XAG A;  2D2W A;  9ANT A;  4PJN A;  1NK2 P;  5ILS A;  4PUS A;  3OOP A;  3G71 I;  1RRJ A;  4ITV A;  4B8X A;  1WI9 A;  4AWX B;  2MH2 A;  2VT3 A;  3LL7 A;  3CMY A;  2O8X A;  4AIH A;  5EZG A;  2HOA A;  3K2A A;  2BY2 A;  4JP0 A;  5FFZ A;  3GTP J;  2FMY A;  5L3E A;  1Z91 A;  3FHN A;  1IAW A;  1K61 A;  1WJA A;  4Y13 A;  1UHS A;  4P96 A;  2D1V A;  4IHS A;  3DQV C;  2VKD A;  4XOR A;  1G59 A;  2UWM A;  4XID A;  1XDS A;  2COB A;  3GO5 A;  2LK2 A;  4M3F A;  1VQO I;  3OYC A;  3HKZ N;  4KDP A;  4V2G A;  5IOZ A;  3S93 A;  2ELJ A;  4LB6 B;  2ZO4 A;  2ZB9 A;  3LAP A;  2J5O A;  2Z33 A;  1CQT A;  1OR7 C;  5IT9 Z;  2VQC A;  4OIQ F;  1YJN I;  5KCM A;  3CF5 F;  5F0H A;  1MMG A;  2L9R A;  4XRS A;  1YJW I;  2FML A;  1RKW A;  4JYK A;  1H89 C;  2EJR A;  1A6Q A;  2W00 A;  3REO A;  1QQI A;  4KIG A;  4IHX A;  3FM3 A;  2E1M B;  3PO3 J;  4A2U A;  2O3F A;  3F23 A;  3IL2 A;  3DBL B;  1H88 C;  1O3R A;  3A02 A;  1ZAO A;  3BWG A;  4U87 A;  1OCO H;  2VN2 A;  1TWH J;  5ED4 A;  1VI0 A;  2VQG A;  3BR2 A;  4BE2 A;  4RGS A;  2VBY A;  1GXP A;  3C7J A;  2VKV A;  1ZRD A;  1HA8 A;  5FJ8 J;  2Y0S A;  3GX4 X;  1BR2 A;  2KRC A;  3K1N A;  4A3L J;  4ZH4 F;  2DT7 B;  5HDK A;  4A0Z A;  1I3A A;  4YEJ A;  2V1U A;  2CJJ A;  1S29 A;  4DZP A;  1V54 H;  5ILV A;  4GGG A;  4O3M A;  2FX0 A;  4CCL A;  3V42 A;  2AXL A;  3EUH C;  3A03 A;  1RET A;  3RKW A;  4RB1 A;  1MMA A;  2DMU A;  2R5Z A;  4EEF G;  5FKM A;  4A3J J;  2DMT A;  2FRH A;  3GZ5 A;  3T1B A;  2R7V A;  1XDU A;  4DYQ A;  3FXM A;  4QWQ A;  5L3D A;  2O61 A;  1FTT A;  3OR1 C;  2L5Q A;  3A0B C;  4HX8 A;  1BC8 C;  4E7L A;  4V2F A;  4GYI A;  2NAZ A;  3D5L A;  1S9H A;  3FXO A;  3KFW X;  2K9S A;  1I50 J;  3SFI A;  4OIP F;  1GV2 A;  1QPM A;  2HDC A;  4BXF A;  1EF4 A;  3KX2 A;  3K69 A;  4GCV A;  4JX6 A;  4K2E A;  4CZZ A;  1HC8 A;  2EFN A;  2MD0 A;  3KYC B;  1YRN A;  3CJT B;  4PJM A;  3CMA I;  6PAX A;  3WE2 A;  1GLN A;  3M8E A;  2BY0 A;  2VT2 A;  5F0F A;  3PSI A;  1OJL A;  2CUE A;  4HF0 A;  4ZDO A;  2K9L A;  3EDP A;  2VIX A;  3DBR B;  4PSX A;  3T8R A;  1XGS A;  3IH4 A;  2WB1 N;  4LIV A;  4LOC A;  2HU9 A;  5LRR A;  4MTD A;  1DU6 A;  3OYH A;  4BHB A;  2DAO A;  3DXJ F;  4HV6 A;  1TP4 A;  2VON A;  5BMZ A;  1AOY A;  2FOW A;  2K4B A;  3JAM K;  1JKR C;  3C18 A;  1Y1W J;  2H1K A;  1XMA A;  3HXL A;  3HHG A;  1YIT I;  3RYR A;  2CRG A;  4DNC A;  1LDD A;  2HS5 A;  1T08 B;  2PN6 A;  2CQN A;  2WWY A;  4MFE A;  1MIJ A;  3GTQ J;  2A07 F;  2CQX A;  1OCC H;  3OSG A;  2X1E A;  4UUT A;  3U2R A;  2I10 A;  2X6Y A;  3CCL I;  1AHD P;  3HPG A;  5E20 A;  4UV9 A;  1BI3 A;  4MQ9 F;  3M07 A;  2BEO A;  1YS7 A;  3CDH A;  2CQK A;  3ASO H;  5GAE J;  3I56 I;  2ZJ2 A;  4AM3 A;  4R79 A;  2A6H F;  3B6C A;  2QQ9 A;  2OCC H;  3KCC A;  4XOT A;  4XNF A;  4YEL A;  1ZQ3 P;  2CH0 A;  1FOW A;  2JZY A;  4EV0 A;  2VC0 A;  5J3L A;  2WAD A;  4LB5 A;  3ZMU A;  4XRM A;  5JI6 A;  2MA3 A;  1S3J A;  4UXN A;  1UHW A;  1HXD A;  3E5X A;  2DFI A;  3L2U A;  1LDJ A;  1ONV A;  4HPQ A;  2Z99 A;  1Z3X A;  3PFI A;  1JE8 A;  3K4B A;  1HW1 A;  2IEK A;  1SFX A;  2DA6 A;  3PUF A;  2HOS A;  4RLF A;  3K10 A;  4UHT A;  3CO6 C;  3IAS 2;  1ZRE A;  2JUC A;  1IRF A;  3GTJ J;  1XGO A;  1FOX A;  3J7Y J;  1DU0 A;  1FT9 A;  3M3Y J;  1R23 A;  1BIA A;  3CQZ J;  3LSR A;  2KDZ A;  5EYR A;  4TV7 A;  4Y15 A;  4CCO A;  4HAM A;  2H27 A;  4O6J A;  1OCZ H;  4XKB A;  2DMN A;  1Z67 A;  1HKS A;  2XF7 A;  4WX9 A;  5DCM B;  1Q1V A;  3AL0 C;  2DA7 A;  3H9J A;  2H8R A;  1B1B A;  3ZMD A;  3O3K A;  3I4N J;  3GTO J;  1MBF A;  3W2V A;  1R49 A;  2IS6 A;  4UB6 C;  3BTI A;  5GAG J;  5E3L A;  2M45 A;  2IA0 A;  1LQ1 A;  1J7K A;  4YII A;  1Q1H A;  1IN7 A;  5J47 A;  2L9N A;  2LY2 A;  3LMM A;  4BKX A;  4BAY A;  2QQB A;  3AG1 H;  3COA C;  3IWF A;  3CP8 A;  5FGM A;  4CHU A;  4PJL A;  3FDY A;  4YIF A;  5C3E J;  2JPC A;  2NVQ J;  2LP0 A;  1JGS A;  1X4O A;  4A0Y A;  1F5T A;  2FA5 A;  2WAE A;  3DPU A;  2E34 A;  5FKN A;  3F8C A;  4BY7 J;  4C2M J;  1ZG5 A;  2F5F A;  2HZT A;  4LD5 A;  4FE4 A;  4BS9 A;  2EIM H;  5FD6 A;  2ELH A;  3ZMT A;  2L3D A;  3HSR A;  1HDD C;  1R1V A;  2IA1 A;  4R1H A;  3MD2 A;  2Q8K A;  1D0Y A;  2QF7 A;  4EQQ A;  1IO2 A;  2OJE D;  1UEL B;  1R6R A;  1WVR A;  3E7L A;  3W2W A;  2HWV A;  4U7D A;  2R3S A;  3VYU B;  2GZW A;  4O5V A;  2JUG A;  2QKL B;  1R4M B;  3I59 A;  2MLK A;  1A35 A;  5K5Q A;  1R58 A;  3Q3S A;  2JN6 A;  5IP9 J;  1QO0 D;  2VQL A;  2ACJ A;  3DTI A;  2LTP A;  2R7X A;  5DD8 A;  1Y0U A;  4A3E J;  1QA6 A;  2W24 A;  3CF2 A;  3DWL E;  1OPC A;  3ZPL A;  1K78 B;  5K7Z A;  1D3Y A;  1O57 A;  2E5Z A;  2IGO A;  2R7Q A;  3CCY A;  5ERI A;  2JSP A;  1ON1 A;  1VZ0 A;  3WU0 A;  5LLQ A;  3UKG A;  3OOU A;  3DLA A;  1DP3 A;  1YJ9 I;  4IL6 C;  2KZV A;  5FLX Z;  2QYO A;  3HRT A;  5HS7 A;  3NAU A;  2F48 A;  3QOP A;  3TED A;  2FXA A;  3JRH A;  2KFD A;  3BRO A;  2K02 A;  4MFD A;  3J81 K;  4EGY A;  4UUV A;  2KP6 A;  1K6Y A;  1ITY A;  3TMO A;  2CQQ A;  2CUF A;  3SZP A;  2W1O A;  1SD6 A;  5IYC J;  2ZXW H;  3AKZ A;  4DGW B;  2KMU A;  4G94 A;  5JHU A;  1MBH A;  1J2X A;  3NWS A;  1TWG J;  2NVU B;  1X58 A;  3S14 J;  1B72 A;  3CC7 I;  4BDZ A;  3TKY A;  5C4X J;  3ZQG A;  2A3S A;  4MEX F;  3BG5 A;  2W48 A;  3H1C A;  4E7J A;  2E5N A;  4CZC A;  2CW7 A;  3IAM 2;  4FCY A;  5FLV A;  3RPQ A;  1EH6 A;  3DKW A;  2RNG A;  3T5X A;  1FBS A;  3A1Y A;  2R92 J;  2ZJP F;  2LVS A;  4JX5 A;  2P81 A;  3QOE A;  4RB3 C;  3CJQ B;  3I5U A;  2FNP A;  5HVQ C;  2R7T A;  4ABZ A;  1G2H A;  2BBY A;  5DYM A;  2ZKZ A;  5GPC A;  2DMQ A;  4W97 A;  1JJ8 C;  1Y56 A;  1O7F A;  1YS6 A;  1FBU A;  2M87 A;  3RSN A;  2V9P A;  3FKJ A;  2KJB A;  4BL0 B;  2H94 A;  2MFZ A;  2QEN A;  3MWM A;  4XK4 A;  4Y4R A;  5JVT A;  3J7Z I;  3OIO A;  2Y0S N;  1SEU A;  2DOE A;  4ZYD A;  4HA8 A;  2DA4 A;  3VDX A;  2EH3 A;  3BLY A;  1QVT A;  2ELK A;  1KYW A;  2ME0 A;  1I5Z A;  2EFO A;  4XLF A;  1TTY A;  2EIL H;  4AIK A;  4RAY A;  2GAU A;  2EFP A;  3G3Z A;  1TNS A;  5L3C A;  1ETO A;  1ZEL A;  3P9C A;  3AL0 B;  5EG0 B;  1DPR A;  1R1T A;  4ESJ A;  2JT1 A;  3BZK A;  3PJR A;  5CJ9 A;  4GXO A;  4ESB A;  3JRA A;  4GFB A;  1KU9 A;  1Y0N A;  2K9M A;  3R0J A;  2LSO A;  3KEY A;  3WU1 B;  1NH3 A;  4FIS A;  4L9J A;  5BOX A;  4KYW A;  4HQM A;  1MMN A;  2BVL A;  3WU2 C;  3CUO A;  4XMY A;  1XC5 A;  3K2Z A;  5BQT A;  3IC7 A;  3PL8 A;  5TIS C;  3LSI A;  1X1P A;  1VQ9 I;  1LFP A;  3PNV A;  4KN4 X;  4BAC A;  1Z3Y A;  2IAI A;  3LA3 A;  1T33 A;  4XRS G;  2X51 A;  3J80 K;  4YG2 F;  3GTM J;  4I99 C;  3AAF A;  3MCZ A;  2V79 A;  3W2A A;  1Y1V J;  1LDK B;  2ISZ A;  3CUQ B;  1WFX A;  5DUI A;  1V4R A;  2PG4 A;  1IZ1 A;  2JRM A;  1EJ9 A;  3Q0U A;  2F5V A;  2NS0 A;  5F0C A;  2HNH A;  3JRF A;  3H5R A;  2PMH A;  4I98 B;  2VC1 A;  1K4T A;  1PJR A;  3QPS A;  4CYD A;  2LKS A;  3ZN1 A;  5D6E A;  2LD5 A;  1C0W A;  2NS8 A;  4RGU A;  2YUS A;  4JOM A;  3R61 A;  4D7N A;  2K5C A;  3I3L A;  3JW4 A;  3I4M J;  1OYW A;  3CUQ A;  1ETW A;  2DI3 A;  2F4M B;  2L0K A;  4A3D J;  3I9V 2;  2VJ4 A;  2XAS A;  3L2C A;  3KZZ A;  1AA7 A;  3LAJ A;  3QP6 A;  3OIP A;  2W82 A;  2JWT A;  5CVR A;  2XC7 A;  1ON2 A;  2VL8 A;  3DV8 A;  3U1K A;  4M6Y A;  2E2J J;  4OU0 A;  5J8F A;  1WI3 A;  5JFR A;  3WTV C;  1HST A;  2K86 A;  3ABK H;  4RDU A;  4J00 A;  3S3O A;  5ILU A;  3HOU J;  1NK3 P;  3RTR A;  1FY7 A;  1P4W A;  4I6Z A;  3GBG A;  3S15 J;  3RZO J;  2JK3 A;  3A01 A;  1ENH A;  4IPA A;  2EPF A;  4X0G A;  4XLN F;  2KHM A;  2CUJ A;  1FEX A;  2HYJ A;  5TRD A;  1WKM A;  1Z7U A;  2G7U A;  4J19 A;  4I2O A;  3A01 B;  4EVI A;  2C6Y A;  3CD6 I;  2R5Y B;  5AON A;  1VF9 A;  1CF7 B;  2DJN A;  3RKY A;  1FBQ A;  3MQ0 A;  3BQY A;  3HL2 A;  4LLN A;  2M2E A;  3HC7 A;  2A5Y B;  3HRS A;  3LFK A;  3ROU A;  2DT5 A;  3R4K A;  5IY5 H;  5JHF A;  3K4K A;  3S3N A;  2FNA A;  2LNB A;  3CCE I;  3S2H J;  2HQ5 A;  3JAM Z;  5H20 A;  2PMZ N;  2A6T A;  2QUF A;  5M3F J;  5ICE A;  2CUZ A;  5E1Z B;  4B3A A;  4HQE A;  2DPU A;  1CGP A;  1BR1 A;  2VB6 A;  4S04 A;  1BW6 A;  1ZLK A;  1G3T A;  4UB8 C;  1OR7 A;  3GWZ A;  1ZAR A;  2VJI A;  2PMU A;  2K27 A;  4N9H A;  3J80 Z;  4UUS B;  3HUG A;  2NRA C;  2KIM A;  3HRU A;  3MEX A;  3H3Z A;  3ZQI A;  3ZQF A;  2P6T A;  2DO7 A;  4GDF A;  2A6E F;  2OV7 A;  1QPI A;  1S5L C;  3F8F A;  3I53 A;  3H5N A;  1LFB A;  1XG1 A;  4G6Q A;  2DLL A;  2DOA A;  2XGD A;  2DBB A;  1NTC A;  2YU9 J;  3UNG C;  1MNM C;  2IVM A;  1B9M A;  3T0Y A;  3ZMZ A;  3ZMS A;  4M6X A;  5IPA A;  3WE3 A;  3CJR B;  4EGZ A;  1MBE A;  4OOI A;  4CO8 A;  2OTL I;  3HEF A;  3C3W A;  2IBD A;  2IGM A;  4KT6 A;  1GVD A;  3BZ6 A;  5BS6 A;  2FBK A;  2NVY J;  1IXC A;  2XPW A;  2M7A A;  2RN7 A;  1J5Y A;  3H5A A;  3GYH X;  1UFM A;  4EJV A;  2DK8 A;  2KRH A;  2R7O A;  3FM5 A;  3HYI A;  3EYI A;  4Y52 J;  1MDM A;  4FE7 A;  4NNJ A;  5E8G A;  4HX7 A;  4PSW A;  2MAB A;  1D8K A;  2CO5 A;  2OU2 A;  3V7S A;  4A12 A;  4XN3 A;  4LMY A;  1JKO C;  1K78 A;  4ENK A;  3H36 A;  2KKO A;  2NS7 A;  4Y33 A;  5J40 A;  3TO7 A;  4G6D A;  4FX0 A;  3SQN A;  1SFO J;  5DV5 A;  1R5I D;  5DTD A;  3JRC A;  1OYI A;  4ETS A;  4L5E A;  1BOA A;  1MD0 A;  3MMY B;  2EB7 A;  3NQO A;  1ZH5 A;  2YX4 A;  4GYG A;  3FWE A;  4Q48 A;  2IT0 A;  3FXL A;  4IHY A;  3BPV A;  4IRG A;  2QSG X;  2DN0 A;  3VEP A;  3RI4 A;  3Q5F A;  1RKT A;  1AU7 A;  1IC8 A;  4ZYA A;  1FP1 D;  1UST A;  2K4J A;  1V55 H;  3BJO A;  1B6A A;  4U88 A;  3TDU C;  3WGG A;  3F6O A;  3K4N A;  1RPW A;  3JRE A;  3HOS A;  3D1N I;  2LC2 A;  1T6S A;  3K4M A;  4HLY A;  4FTH A;  2VOD A;  1G6N A;  2PBI A;  4D5F A;  3GTL J;  4I01 A;  1A5J A;  1KA8 A;  3ZQL A;  2B0L A;  4YFK F;  3BR0 A;  3G6E I;  1PP8 F;  1ETK A;  2O8K A;  1X1C A;  3H0D A;  5CQG A;  4QIW N;  5IT3 A;  1SAX A;  4D9J A;  3CCR I;  2MG4 A;  1WH5 A;  1LKX A;  5KAI C;  1IJW C;  1P2F A;  5DD4 A;  1YQA A;  3KP6 A;  4GRI A;  1I27 A;  4IF4 A;  4XKW A;  3G1L A;  2X9D A;  2DDA A;  2HKX A;  2Y2Z A;  2M34 A;  1EV7 A;  3RPU A;  3E6B A;  2BZT A;  2VBZ A;  2QQA A;  2X1D A;  1O4X A;  1AKH A;  3C2B A;  3DLL F;  3WHC A;  1PP7 U;  1YOV B;  3IKV A;  4XSX F;  2Y48 A;  5J1U A;  5E18 F;  3CCS I;  2ESN A;  3H0G J;  2BY3 A;  3N05 A;  4MNU A;  4N9I A;  3F22 A;  2BY1 A;  3S1N J;  2LY1 A;  5K7F A;  4HV5 A;  1W0T A;  5IYD J;  2PJR A;  1JUP A;  1KQ9 A;  4G7H F;  2JMW A;  3MZ8 A;  1R22 A;  3BTJ A;  3U9G A;  3ABL H;  5BNG A;  3VB2 A;  4CCJ A;  2PQ8 A;  2LG4 A;  3LSG A;  2XRO A;  1TW3 A;  2X85 A;  4AYB N;  1ULY A;  2OC6 A;  1F4K A;  4QPQ A;  4IQ4 A;  4OMZ A;  4PFO A;  3PUB A;  4UVB A;  2HDD A;  1R36 A;  3PQJ A;  3WTS C;  2Z1D A;  1VQP I;  2IGK A;  1JTX A;  3MN2 A;  1HW5 A;  2FBH A;  4U0V A;  1XTA A;  1E3P A;  3KE2 A;  2F4O B;  1H8A C;  5EEA A;  1HF0 A;  2ECC A;  2E7X A;  1JUM A;  4MHG A;  3Q0W A;  2X6X A;  3SJM A;  3K7A J;  1YW9 A;  3EQL F;  2BXZ A;  2KIQ A;  3L2Q A;  5FKO A;  5FFX A;  1V3F A;  4M9S A;  1WJB A;  3CUQ C;  2J5P A;  1GUU A;  4AVZ A; 
#chains in the Genus database with same CATH homology
 2HGC A;  1F1Z A;  4N0B A;  3VFZ A;  5D5X B;  1BC7 C;  1FNN A;  3WGI A;  1UB9 A;  1SMT A;  3ISP A;  3WTT C;  3U1D A;  2A69 F;  3KEO A;  2L54 A;  1W7P D;  5E1W A;  4EMS A;  1B4A A;  2VXZ A;  4BQA A;  3CO7 C;  2Y0M A;  1XMK A;  1O3Q A;  2HQN A;  2Q0O A;  3H3U A;  2RC4 A;  2XAJ A;  4RB0 A;  1A04 A;  5DCM A;  2GXB A;  3ERE D;  5IT9 K;  5KK1 A;  3DF8 A;  2FSW A;  1T0F A;  1J59 A;  2XIG A;  1STZ A;  1SMY F;  3VOE A;  1R1U A;  1K6O A;  1GVJ A;  2CFX A;  3E6M A;  4HX4 A;  2DW4 A;  2V1D A;  2QZ8 A;  3Q9S A;  2PI0 A;  1ZGA A;  1BM9 A;  3ULQ B;  1YIO A;  3E97 A;  5L3F A;  4CDG A;  3ZN0 A;  1KQ8 A;  3LA7 A;  2VOO A;  1RUO A;  5D4R A;  4HLX A;  4KMU X;  3KP5 A;  2CW0 F;  1LNW A;  2EV6 A;  2RNJ A;  1KQ0 A;  1RZ4 A;  4ENM A;  4LG0 A;  1QBJ A;  1IN4 A;  2BYV E;  4RAZ A;  3LWF A;  1LEB A;  1GHC A;  1KYZ A;  3BDD A;  1I6X A;  1JHF A;  4Q4Z F;  1RIO H;  1O7L A;  4Q47 A;  2RVC A;  3JTH A;  2GA1 A;  4LG0 B;  3BJ6 A;  2VBW A;  2ZME A;  5CLS A;  2ISY A;  1BJA A;  4IRH A;  3RKX A;  1IXS B;  5J8C A;  4KIB A;  2ZNZ A;  2OQR A;  2EA4 A;  2P4W A;  3MZH A;  4F7Z A;  2ADU A;  2DPD A;  1HQC A;  1T38 A;  5E8I A;  3TGN A;  3ZMV A;  4UVA A;  2FBI A;  2BE5 F;  4M73 A;  3HSE A;  3KP4 A;  4ON0 A;  4UV8 A;  2P5V A;  2HTS A;  4WWC A;  1WSU A;  2MBF A;  3FMQ A;  5K5O A;  2R7D A;  4Q5S F;  4AVP A;  4OIO F;  3F8B A;  5F6F A;  3LST A;  1PUE E;  4RGR A;  5CVV A;  2HKO A;  1XN7 A;  2V1X A;  3KP2 A;  2JSC A;  4EJT A;  4ZZD A;  2MC3 A;  3R60 A;  3IKT A;  4KT5 C;  2LF8 A;  1FYM A;  1ZGJ A;  5ICF A;  1KGS A;  3WG9 A;  2G9W A;  4B09 A;  2M8E A;  1XGM A;  1MJ9 A;  3TQN A;  3KEQ A;  1XGN A;  4HOB A;  4I09 A;  4QLC U;  3P7N A;  1BBY A;  3QU3 A;  4CIC A;  3BY6 A;  2IJL A;  3KP7 A;  3ZQ7 A;  1IN6 A;  2IW5 A;  2BGC A;  1OYY A;  4KN7 X;  1BI2 A;  2CSO A;  3MAJ A;  1FYK A;  1YW8 A;  5TJJ A;  4PGH A;  3V7R A;  1YFH A;  4Y17 A;  4M72 A;  2EV5 A;  4OIR F;  2M30 A;  1T2K A;  4NQW A;  2EFW A;  2W85 A;  2M1B A;  4G7Z F;  4XSZ F;  3IRR A;  1Z05 A;  4ZYE A;  1S7A A;  3ABT A;  2XUB A;  1RUN A;  2YSR A;  1XSV A;  1ZHF A;  2P5K A;  2Y75 A;  5HLH A;  2XKO A;  1KU3 A;  1U5T C;  3NRV A;  2XAH A;  3IRQ A;  3MZY A;  3R6S A;  2OAZ A;  3B73 A;  3K9T A;  3F8N A;  1XSX A;  2W84 A;  2P8T A;  3K1M A;  3TOB A;  3V7C A;  5BPD A;  1SD5 A;  4GO1 A;  1CF7 A;  1ZG3 A;  1E17 A;  4M71 A;  1HKT A;  4ASN A;  3GUD A;  1TBX A;  1RNL A;  3J81 Z;  4ENN A;  1TQM A;  3JSO A;  2K7L A;  4H0E A;  4LJZ F;  3EUH A;  3D0S A;  1J75 A;  1MJA A;  1R5H A;  5CVJ A;  1DPU A;  3FMS A;  1ZRC A;  1FSE A;  3I59 B;  2QVO A;  4EJU A;  3M7G A;  1HKQ A;  2FF4 A;  2IP2 A;  2Z3Y A;  2L01 A;  3SXY A;  4YFN F;  4OMY A;  3DPL C;  3K0L A;  4PDK A;  2XAQ A;  3S2W A;  2P7V B;  3RDI A;  3TDZ C;  2OD5 A;  4P5O A;  3L09 A;  2F5E A;  1YO5 C;  3LA2 A;  1U8R A;  4HDU A;  3F3X A;  5L3G A;  5HOO A;  3G73 A;  1J0R A;  1FWZ A;  3GXO A;  5E17 F;  3HHH A;  2EV0 A;  3ELK A;  1OMI A;  1YLF A;  4D0P A;  2VE8 A;  3KLN A;  3GEZ A;  4A5M A;  3J7A O;  5FB2 A;  3F8M A;  3ZP5 A;  2Z9O A;  2FU4 A;  3WTY C;  1W7P A;  5D8L B;  3FX3 A;  2ESH A;  2FEZ A;  1MDM B;  2P7C B;  2V6C A;  2KJC A;  1ZN2 A;  1F9N A;  2HEO A;  4FT8 A;  1ZLJ A;  3RYP A;  1U5T B;  3F72 A;  2O03 A;  4BNC A;  3FF5 A;  3I71 A;  4ZYH A;  3DPT A;  1ZRF A;  2DU9 A;  4U7B A;  3ABU A;  5CYV A;  3HIF A;  5ICG A;  1U2W A;  3FXR A;  1USS A;  5KVR A;  3WTW C;  1BN5 A;  1Z6R A;  2XRN A;  1R00 A;  3M8F A;  2P5L C;  1J9I A;  2WC2 A;  3M9A A;  3SHF A;  1AWC A;  4KA4 A;  1KU7 A;  3EET A;  5HS9 A;  2DTR A;  1IN8 A;  2RGV A;  4WCG A;  3GVA A;  1TNT A;  3GFM A;  2Z5U A;  2FOK A;  1FC3 A;  3KET A;  1YTY A;  3F6V A;  3ECO A;  3ECH A;  2TDX A;  2RDP A;  1E2X A;  5LGU A;  4P9F A;  3W6J B;  3HRM A;  2L02 A;  4WXD A;  3WTX C;  1UCR A;  1FLI A;  3R0A A;  2F2E A;  3BJA A;  3E6D A;  3I4P A;  2GIV A;  4WK8 F;  4I02 A;  1T39 A;  5CVU A;  1G3W A;  2OZ6 A;  2V9V A;  2RQP A;  3L7W A;  3W6K B;  3DP7 A;  2GXG A;  3F21 A;  4PCQ A;  3GZ6 A;  1EH7 A;  1LJ9 A;  1U78 A;  1IRG A;  2X0L A;  4KNY A;  3WGH A;  1U3E M;  4RS8 A;  3KZY A;  5HLI A;  4S05 A;  4A5N A;  4WXH A;  2H6B A;  3QRF F;  2UXX A;  1IF1 A;  1QGP A;  2ZXJ A;  4P55 A;  5E1X A;  1P6R A;  1FSH A;  3GF2 A;  4WXC A;  4G7O F;  3WTZ A;  2AS5 F;  3BPX A;  4U0W A;  3NEU A;  5ICC A;  3Q9V A;  1ZYR F;  4LLG F;  5A2Q K;  1XB4 A;  3QP5 A;  1UHM A;  2NNN A;  5LEJ A;  2COM A;  3FXQ A;  5AIP A;  2P6S A;  3O2P E;  3SZT A;  5H6Q A;  5HLG A;  3K1P A;  3IHU A;  4M9Z A;  5DEQ A;  4A6D A;  4KIC A;  4IVN A;  3WTU C;  3JTG A;  1S8N A;  4EJO A;  4ZYG A;  1OKR A;  3VOD A;  4L0Y B;  2JPB A;  3GW2 A;  3SFZ A;  5J6X A;  3KLO A;  4L18 B;  1L0O C;  1WWX A;  1QZZ A;  3I54 A;  5D4S A;  3GFJ A;  2QM3 A;  2ZME B;  1W4M A;  3IWZ A;  1O3T A;  1QZY A;  4IRI A;  3QAH A;  2A68 F;  2W57 A;  1WQ2 A;  5F1R A;  2STT A;  2PJP A;  3V8J A;  3WOD F;  5HDG A;  2W25 A;  3QPH A;  4HW0 A;  4KUM A;  1IW7 F;  2KIU A;  1G3Y A;  2KRF A;  5LHI A;  2DQR A;  4L5J A;  2R7F A;  1IN5 A;  2CWE A;  4G8X A;  2MD5 A;  2OA4 A;  1SD4 A;  4M74 A;  3BOQ A;  4LK1 F;  4UNO A;  1TQI A;  4LK0 F;  3HOT A;  4G9Y A;  4XLP F;  2A61 A;  4XBF A;  1IUY A;  2YR2 A;  4MQV A;  5D5V B;  2ZNY A;  4EM2 A;  1RI7 A;  5AIQ A;  2RV8 A;  4L0Z B;  5F64 A;  4L5I A;  1VTN C;  1BIB A;  4PGG A;  1B9N A;  1U5T A;  4R8H A;  2G7H A;  2EK5 A;  1G3S A;  2Q2E A;  4FHT A;  4ESF A;  3CTA A;  1LVA A;  2DQL A;  3CJN A;  1LEA A;  1X3U A;  4RGX A;  5LBQ A;  1FPQ A;  4NB5 A;  1B59 A;  4MEY F;  5K1Y A;  2HYF A;  4L9V A;  5EEH A;  2LF7 A;  2VOP A;  1MZB A;  2LKP A;  2M5W A;  5LRS A;  2CG4 A;  4U0Y A;  2OQG A;  2WV0 A;  4I7H A;  2PFB A;  2QBY A;  1FZP B;  3L9F A;  5FLX K;  2XHK A;  3FMR A;  1S7O A;  4HF1 A;  1R7J A;  3QU6 A;  3I0T A;  1W7P B;  3E5U A;  3DEU A;  2ZBK A;  3RJP A;  2GQQ A;  5HS8 A;  1WRJ A;  2H09 A;  5EEG A;  2QBY B;  3FXU A;  4E70 A;  1I1S A;  1HW2 A;  2XVC A;  1SFE A;  1LB2 A;  4BH9 A;  2UZK A;  4JK1 X;  2MH9 A;  2E7W A;  4AD9 A;  4CXF A;  3V4G A;  5CVI A;  1D5V A;  5FO5 A;  2MLG A;  2FE3 A;  2VE9 A;  2HR3 A;  3FHZ A;  4AIJ A;  1H9T A;  1ODD A;  4BXU A;  4HF2 A;  2QWW A;  3GFI A;  4LFU A;  1QNT A;  4ENJ A;  1BI0 A;  1P4A A;  5DCF A;  3DFG A;  1MJB A;  4KIF A;  2HOE A;  1S6L A;  1Z1D A;  2IRF G;  4P9U A;  1XCV A;  2BV6 A;  1XSD A;  2LDU A;  2EWN A;  1JHH A;  2XV4 S;  1H0M A;  2YU3 A;  4A0X A;  2XKP A;  1JXS A;  2ETH A;  3CLO A;  2JRT A;  5HDN A;  1R5G A;  3N97 A;  3M1E A;  5D5U B;  3KP3 A;  2PEX A;  4HBL A;  3I64 A;  1MGT A;  1FP2 A;  2HFH A;  1SD7 A;  1H9G A;  2EA2 A;  5JR3 A;  1T98 A;  5D5W B;  5D6F A;  1DDN A;  4BHP A;  3ML6 A;  4LGW A;  3FZV A;  2CGP A;  2OZU A;  1SFU A;  2HTJ A;  3E3V A;  4M9X A;  3RIR A;  4RB2 C;  1FOK A;  4HYE A;  1DP7 P;  5K5R A;  4MGR A;  3C1D A;  1Z6T A;  1REP C;  5LHG A;  3EYY A;  5D8K B;  1YW7 A;  4WF2 A;  1FX7 A;  4MTE A;  2NYX A;  1P4X A;  4KMF A;  4EM1 A;  3I58 A;  2L4A A;  1Z9C A;  5H6R A;  2FQ3 A;  2UXN A;  3MFK A;  1MKM A;  5LHH A;  2DK5 A;  1IXR C;  5L3B A;  1YG2 A;  2STW A;  1GXQ A;  2X4H A;  3N4M A;  2JTV A;  2HQR A;  4BHC A;  2NNY A;  2GA2 A;  4EM0 B;  2PLY A;  1W5S A;  3JSP A;  2HYG D;  3HSF A;  1W5T A;  4IHT A;  2CYY A;  2OBP A;  5LEK A;  1G4D A;  3PQK A;  5DDG A;  1YYV A;  1XCB A;  4ZZL A;  3HTS B;  3QPT A;  1ZG1 A;  4UVC A;  2EFQ A;  4Z2Y A;  1L3L A;  1U6G A;  1HSJ A;  4YFX F;  1NHA A;  4BYY A;  4CGZ A;  2VBX A;  2O6G E;  3P9K A;  2D1H A;  2H6C A;  1I1G A;  2L4M A;  2ZCW A;  4LLL A;  4L9T A;  1K79 A;  4NHJ A;  4HDV A;  3T8T A;  2E1C A;  4IJA A;  1D8J A;  4EJW A;  4PZJ A;  4KFC A;  4JBA A;  3O6B B;  2ZFW A;  4JQF A;  1TLH B;  3TO6 A;  5A2Q Z;  4HZF A;  3GFL A;  1EH8 A;  1TQP A;  2GWR A;  1HBX G;  1KU2 A;  1BI1 A;  2F5D A;  4OIN F;  2QLZ A;  2IA2 A;  4L9N A;  4XRF A;  2WTE A;  3V8L A;  2YPR A;  5LGT A;  3P9I A;  3HTU A;  1K7A A;  5LGN A;  3OV8 A;  4I0A A;  1TW2 A;  1XD7 A;  1DUX C;  3H92 A;  2IPQ X;  4FX4 A;  2XGX A;  1O3S A;  4IXA A;  3V8K A;  2E1N A;  2XAF A;  3LQR A;  5FD5 A;  3TO9 A;  5DUK A;  5BPI A;  3TOA A;  2RKH A;  3L00 A;  2KIF A;  2D45 A;  3LQQ A;  4A6E A;  3GLX A;  3B02 A;  4DQ2 A;  1FYL A;  3E5Q A;  2YX7 A;  3BP8 A;  2O0Y A;  1P92 A;  2F5C A;  3E6C C;  1PDN C;  2XAG A;  2D2W A;  5ILS A;  3OOP A;  4B8X A;  1WI9 A;  4AWX B;  2MH2 A;  2VT3 A;  2O8X A;  4AIH A;  5FFZ A;  2FMY A;  5L3E A;  1Z91 A;  1IAW A;  4Y13 A;  4P96 A;  2D1V A;  4IHS A;  3DQV C;  2UWM A;  1XDS A;  3GO5 A;  4KDP A;  4LB6 B;  2ZO4 A;  3LAP A;  2J5O A;  2Z33 A;  5IT9 Z;  4OIQ F;  2FML A;  2EJR A;  3REO A;  1QQI A;  4KIG A;  3FM3 A;  4A2U A;  2O3F A;  3F23 A;  3IL2 A;  1O3R A;  1ZAO A;  3BWG A;  2VN2 A;  5ED4 A;  4RGS A;  2VBY A;  1GXP A;  3C7J A;  1ZRD A;  3GX4 X;  3K1N A;  4ZH4 F;  5HDK A;  4A0Z A;  2V1U A;  1S29 A;  5ILV A;  4GGG A;  4O3M A;  2AXL A;  3RKW A;  4RB1 A;  2FRH A;  3GZ5 A;  3T1B A;  1XDU A;  4QWQ A;  5L3D A;  2O61 A;  4HX8 A;  1BC8 C;  4GYI A;  2NAZ A;  3D5L A;  3KFW X;  4OIP F;  1QPM A;  2HDC A;  3K69 A;  4GCV A;  4K2E A;  4CZZ A;  2EFN A;  6PAX A;  3WE2 A;  3M8E A;  2VT2 A;  4HF0 A;  3EDP A;  3T8R A;  1XGS A;  4MTD A;  5LRR A;  4BHB A;  2DAO A;  3DXJ F;  4HV6 A;  2VON A;  5BMZ A;  1AOY A;  2K4B A;  3JAM K;  3C18 A;  1XMA A;  3HHG A;  3RYR A;  4DNC A;  1LDD A;  2HS5 A;  2PN6 A;  2WWY A;  2A07 F;  3U2R A;  5E20 A;  4UV9 A;  1BI3 A;  4MQ9 F;  2BEO A;  1YS7 A;  3CDH A;  2CQK A;  2ZJ2 A;  4R79 A;  2A6H F;  2QQ9 A;  3KCC A;  2JZY A;  4EV0 A;  2VC0 A;  4LB5 A;  3ZMU A;  5JI6 A;  2MA3 A;  1S3J A;  4UXN A;  1UHW A;  1HXD A;  3E5X A;  2DFI A;  1LDJ A;  1ONV A;  2Z99 A;  3PFI A;  1JE8 A;  1HW1 A;  1SFX A;  4UHT A;  3CO6 C;  1ZRE A;  1IRF A;  1XGO A;  1FT9 A;  1R23 A;  1BIA A;  4TV7 A;  4Y15 A;  4HAM A;  2H27 A;  4O6J A;  1HKS A;  4WX9 A;  5DCM B;  1B1B A;  3ZMD A;  3O3K A;  2M45 A;  2IA0 A;  1LQ1 A;  4YII A;  1J7K A;  1Q1H A;  1IN7 A;  4BAY A;  2QQB A;  3COA C;  3IWF A;  5FGM A;  4CHU A;  4YIF A;  2JPC A;  1JGS A;  4A0Y A;  1F5T A;  2FA5 A;  3F8C A;  1ZG5 A;  2F5F A;  2HZT A;  4LD5 A;  5FD6 A;  2ELH A;  3ZMT A;  2L3D A;  3HSR A;  1R1V A;  2IA1 A;  4R1H A;  2Q8K A;  4EQQ A;  2HWV A;  4U7D A;  2R3S A;  2GZW A;  4O5V A;  3I59 A;  2MLK A;  5K5Q A;  1R58 A;  1QO0 D;  2ACJ A;  5DD8 A;  1Y0U A;  2W24 A;  1OPC A;  3ZPL A;  1K78 B;  1D3Y A;  1O57 A;  5ERI A;  3WU0 A;  1ON1 A;  5LLQ A;  5FLX Z;  2QYO A;  3HRT A;  5HS7 A;  3QOP A;  2FXA A;  3BRO A;  2K02 A;  3J81 K;  4EGY A;  4UUV A;  3SZP A;  1SD6 A;  4G94 A;  5JHU A;  1J2X A;  3TKY A;  2A3S A;  4MEX F;  3RPQ A;  1EH6 A;  3DKW A;  3T5X A;  1FBS A;  4RB3 C;  3I5U A;  2FNP A;  5HVQ C;  2BBY A;  5DYM A;  2ZKZ A;  1O7F A;  1YS6 A;  1FBU A;  2M87 A;  2KJB A;  2H94 A;  2QEN A;  3MWM A;  5JVT A;  4ZYD A;  4HA8 A;  1KYW A;  1I5Z A;  2EFO A;  4AIK A;  1TTY A;  4RAY A;  2GAU A;  2EFP A;  3G3Z A;  1TNS A;  5L3C A;  3P9C A;  1DPR A;  1R1T A;  4ESJ A;  2JT1 A;  5CJ9 A;  4GXO A;  4ESB A;  1KU9 A;  3R0J A;  2LSO A;  3WU1 B;  4KYW A;  4L9J A;  5BOX A;  4HQM A;  3CUO A;  3K2Z A;  5BQT A;  3IC7 A;  4KN4 X;  3LA3 A;  3J80 K;  4YG2 F;  3AAF A;  3MCZ A;  2V79 A;  1LDK B;  2ISZ A;  3CUQ B;  5DUI A;  1V4R A;  2PG4 A;  1IZ1 A;  2NS0 A;  2PMH A;  4I98 B;  2VC1 A;  4CYD A;  3ZN1 A;  5D6E A;  1C0W A;  4RGU A;  3R61 A;  3JW4 A;  1OYW A;  3CUQ A;  2DI3 A;  2XAS A;  3L2C A;  3KZZ A;  3LAJ A;  3QP6 A;  5CVR A;  1ON2 A;  3DV8 A;  4M6Y A;  4OU0 A;  5J8F A;  5JFR A;  3WTV C;  1HST A;  2K86 A;  5ILU A;  3RTR A;  1FY7 A;  1P4W A;  4IPA A;  4XLN F;  5TRD A;  1WKM A;  1Z7U A;  2G7U A;  4I2O A;  4EVI A;  2C6Y A;  5AON A;  1CF7 B;  3RKY A;  1FBQ A;  3MQ0 A;  4LLN A;  2A5Y B;  3HRS A;  3LFK A;  3ROU A;  2DT5 A;  3R4K A;  2FNA A;  2LNB A;  3JAM Z;  5H20 A;  2QUF A;  5ICE A;  5E1Z B;  4HQE A;  2DPU A;  1CGP A;  4S04 A;  1ZLK A;  1G3T A;  1OR7 A;  3GWZ A;  1ZAR A;  2PMU A;  2K27 A;  4N9H A;  3J80 Z;  3HUG A;  2NRA C;  2KIM A;  3HRU A;  3MEX A;  3H3Z A;  2P6T A;  2DO7 A;  2A6E F;  3F8F A;  3I53 A;  4G6Q A;  2DLL A;  2DBB A;  2IVM A;  1B9M A;  3T0Y A;  3ZMZ A;  3ZMS A;  4M6X A;  3WE3 A;  4EGZ A;  4OOI A;  4CO8 A;  3C3W A;  3BZ6 A;  5BS6 A;  2FBK A;  1IXC A;  2RN7 A;  1J5Y A;  3GYH X;  1UFM A;  4EJV A;  2DK8 A;  3FM5 A;  3HYI A;  3EYI A;  1MDM A;  5E8G A;  4HX7 A;  1D8K A;  2CO5 A;  2OU2 A;  3V7S A;  4A12 A;  4LMY A;  1K78 A;  4ENK A;  2KKO A;  3TO7 A;  4G6D A;  4FX0 A;  3SQN A;  5DV5 A;  1OYI A;  4ETS A;  1BOA A;  1MD0 A;  3NQO A;  2EB7 A;  1ZH5 A;  2YX4 A;  4GYG A;  3FWE A;  4Q48 A;  2IT0 A;  3BPV A;  4IRG A;  3VEP A;  3RI4 A;  3Q5F A;  1FP1 D;  1UST A;  2K4J A;  3BJO A;  4U88 A;  1B6A A;  3TDU C;  3WGG A;  3F6O A;  3HOS A;  1T6S A;  2VOD A;  4HLY A;  1G6N A;  2PBI A;  4I01 A;  1KA8 A;  2B0L A;  4YFK F;  1PP8 F;  5IT3 A;  1SAX A;  1P2F A;  5DD4 A;  1YQA A;  3KP6 A;  1I27 A;  4IF4 A;  2HKX A;  1EV7 A;  3RPU A;  3E6B A;  2VBZ A;  2QQA A;  1PP7 U;  3IKV A;  4XSX F;  2Y48 A;  5E18 F;  2ESN A;  4MNU A;  4N9I A;  3F22 A;  4HV5 A;  1KQ9 A;  4G7H F;  1R22 A;  3U9G A;  3VB2 A;  2PQ8 A;  2XRO A;  1TW3 A;  1F4K A;  1ULY A;  4OMZ A;  4UVB A;  1R36 A;  3PQJ A;  3WTS C;  1HW5 A;  2FBH A;  4U0V A;  3KE2 A;  2E7X A;  4MHG A;  1YW9 A;  3EQL F;  5FFX A;  1V3F A;  4M9S A;  3CUQ C;  2J5P A;  4I0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...