4ON3A

Crystal structure of human sorting nexin 10 (snx10)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
150
Chain Sequence
EEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMAFTMKTSCVRRRYREFVWLRQRLQSNALLVQLPELPSKNLFFNMNNRQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-10
publication title Structure of human SNX10 reveals insights into its role in human autosomal recessive osteopetrosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 47
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4on3A00
4PQOA 3HPCX 3IQ2A 4AKVA 4ON3A 4BGJA 1KQ6A 2IWLX 3P0CA 2DYBA 4IKBB 2RAIA 1OCUA 2RAJA 3FOGA 4AZ9A 2REAA 2ETTA 2REDA 2CZOA 1H6HA 4OXWA 4PZGA 1KMDA 2AR5A 2YPSA 4IKDA 2CSKA 4IKBA 1OCSA 1GD5A 2I4KA 2WWEA 3HPBA 2RAKA 1O7KA 4P2IA 4P2JA 3LUIA 4PQPA 1XTNA 2V6VA 1XTEA 2V14A 4HASA 3DYTA 2L73A
chains in the Genus database with same CATH superfamily
4PQOA 3HPCX 3IQ2A 4AKVA 4ON3A 4BGJA 1KQ6A 2IWLX 3P0CA 2DYBA 4IKBB 2RAIA 1OCUA 2RAJA 3FOGA 4AZ9A 2REAA 2ETTA 2REDA 2CZOA 1H6HA 4OXWA 4PZGA 1KMDA 2AR5A 2YPSA 4IKDA 2CSKA 4IKBA 1OCSA 1GD5A 2I4KA 2WWEA 3HPBA 2RAKA 1O7KA 4P2IA 4P2JA 3LUIA 4PQPA 1XTNA 2V6VA 1XTEA 2V14A 4HASA 3DYTA 2L73A
chains in the Genus database with same CATH topology
4PQOA 3HPCX 3IQ2A 4AKVA 4ON3A 4BGJA 1KQ6A 2IWLX 3P0CA 2DYBA 4IKBB 2RAIA 1OCUA 2RAJA 3FOGA 4AZ9A 2REAA 2ETTA 2REDA 2CZOA 1H6HA 4OXWA 4PZGA 1KMDA 2AR5A 2YPSA 4IKDA 2CSKA 4IKBA 1OCSA 1GD5A 2I4KA 2WWEA 3HPBA 2RAKA 1O7KA 4P2IA 4P2JA 3LUIA 4PQPA 1XTNA 2V6VA 1XTEA 2V14A 4HASA 3DYTA 2L73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQO A;  3HPC X;  3IQ2 A;  4AKV A;  4ON3 A;  4BGJ A;  1KQ6 A;  2IWL X;  3P0C A;  2DYB A;  4IKB B;  2RAI A;  1OCU A;  2RAJ A;  3FOG A;  4AZ9 A;  2REA A;  2ETT A;  2RED A;  2CZO A;  1H6H A;  4OXW A;  4PZG A;  1KMD A;  2AR5 A;  2YPS A;  4IKD A;  2CSK A;  4IKB A;  1OCS A;  1GD5 A;  2I4K A;  2WWE A;  3HPB A;  2RAK A;  1O7K A;  4P2I A;  4P2J A;  3LUI A;  4PQP A;  1XTN A;  2V6V A;  1XTE A;  2V14 A;  4HAS A;  3DYT A;  2L73 A; 
#chains in the Genus database with same CATH topology
 4PQO A;  3HPC X;  3IQ2 A;  4AKV A;  4ON3 A;  4BGJ A;  1KQ6 A;  2IWL X;  3P0C A;  2DYB A;  4IKB B;  2RAI A;  1OCU A;  2RAJ A;  3FOG A;  4AZ9 A;  2REA A;  2ETT A;  2RED A;  2CZO A;  1H6H A;  4OXW A;  4PZG A;  1KMD A;  2AR5 A;  2YPS A;  4IKD A;  2CSK A;  4IKB A;  1OCS A;  1GD5 A;  2I4K A;  2WWE A;  3HPB A;  2RAK A;  1O7K A;  4P2I A;  4P2J A;  3LUI A;  4PQP A;  1XTN A;  2V6V A;  1XTE A;  2V14 A;  4HAS A;  3DYT A;  2L73 A; 
#chains in the Genus database with same CATH homology
 4PQO A;  3HPC X;  3IQ2 A;  4AKV A;  4ON3 A;  4BGJ A;  1KQ6 A;  2IWL X;  3P0C A;  2DYB A;  4IKB B;  2RAI A;  1OCU A;  2RAJ A;  3FOG A;  4AZ9 A;  2REA A;  2ETT A;  2RED A;  2CZO A;  1H6H A;  4OXW A;  4PZG A;  1KMD A;  2AR5 A;  2YPS A;  4IKD A;  2CSK A;  4IKB A;  1OCS A;  1GD5 A;  2I4K A;  2WWE A;  3HPB A;  2RAK A;  1O7K A;  4P2I A;  4P2J A;  3LUI A;  4PQP A;  1XTN A;  2V6V A;  1XTE A;  2V14 A;  4HAS A;  3DYT A;  2L73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...