4ONFL

Fab fragment of 3d6 in complex with amyloid beta 1-7
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
218
structure length
218
Chain Sequence
b'YVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRIEAEDLGLYYCWQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3D6 FAB ANTIBODY HEAVY CHAIN
publication title Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 54
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4onfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4onfL01
4JGJA 4HIHA 4UNVA 1A7NL 1MFCL 2R0WL 5F8QC 1ZHNA 1CBVH 1LNUA 1TVBA 4OLYL 4Y8AA 4AEHH 2AV1B 1DVFB 2HTLD 1FL5B 3GBNH 4UT7H 4PJIB 3WCYA 4NQVB 4PGBA 3JVGC 4JG1H 5TQ0H 3JTSB 3O11B 4GKZA 5J1AB 3QR2A 1GZQB 5JZ7D 5T33L 1HSBB 5CD5D 3QNZA 3SO3B 2V2WA 1GVIA 4FXKB 4IDLA 3ARSA 4DGIH 3WXWL 4S1RH 4MMXC 3OKEB 5E6IC 3DTXB 1T22A 1J1PH 1OGTA 3FCTA 1DDHA 3DGGB 3MLUH 3KYOB 5CJOH 1JFQL 1H3UA 1G7PB 3T0EC 1OSZA 5E94B 1S7SB 2DMCA 1GC1H 1IGCH 3FHQA 4LDEB 2YEZA 4KAQL 4NBYB 4RSVA 3FN3A 3C08L 5D2NC 4OF5A 3BRGC 1A9BA 2X4OA 5KAQG 3DX9A 4MJIE 5BZDB 4NRZA 5ISZE 1OGAA 3MBEC 1QLFA 4JFEE 4XVSH 3MRRB 4MJID 4ELME 1OTUC 4UV4H 4JFED 1T83A 4NWTL 5C2BL 3SDDB 1NFDE 1V5JA 3O4LD 4NIKB 3EOBB 5ALBL 3ZE2F 1UA6L 1NLBH 1Q94A 1XIWD 4JKWA 5GJTL 4F7MB 3ELAT 4UIMA 2WV3A 5F44A 3VJ6B 1MRCH 1FNFA 2C1PB 3CSBA 3ZYIA 1NUDA 3FT2A 3VGEA 1BVLB 4H1LA 2ITDB 4HUUB 3ARBB 4I77H 3QA3B 4XP6H 1KN4H 4NM8L 1ZXQA 1FYHB 2XKSA 2ICWI 2HG5B 4RAUB 4BUGA 4PJ7A 3SQOH 2ADGA 2MCG1 3CGTA 4HAFA 1MIMH 3W2DH 1WEJL 3CFDA 1XCTA 4U0RB 4Y4FB 1G9NH 2DKMA 1S8DA 2K3TA 4QHLB 2AEPL 5IM7B 1L9NA 3BP7B 4Y4HC 1C7SA 1UADC 3U9PH 3HPLA 1FFNB 4HUNB 4OZHE 4QRRB 2BHYA 2BY2A 4YDIL 5ACLA 2OI9B 4DUXA 4UNTA 4V2CB 5B3JE 5CZXC 4QY8B 3FFCB 4PJBA 4XPHH 4CNIA 5BJTA 2R2HA 4R6UA 1YEKH 2KZWA 4GT7A 4M8QB 5L2JA 2NR6D 1OHQA 1QFUH 3FRPA 8FABA 2R2CA 3P0GB 2PTTA 4AEEA 3UPCA 4PJFA 3ARWA 4KVCH 3FN0H 2A2QT 5F8RC 3OR6B 3GRWH 3MCKB 1CE6B 4XWGH 4YXLH 3BIAX 4QWWC 1MVUB 2X1OA 4HJGB 4V2BA 5I66A 2AXGA 1MCLA 3RZCA 3QPQC 4MA7H 3NCYS 4B0MM 2H2SC 5JXEA 3EZ8A 1KPRA 2UY6A 1S9XB 3C60B 3FQTA 4ETYA 4XPFH 2VYRE 1U3YA 2CDGA 4AEHL 3QDMB 4BFBD 1XGQB 2BRRL 2ATPA 3QJHA 1S7UA 3ULSA 2DJSA 4HEME 3Q3GA 5GS2H 3K4AA 5HHVH 3HMWH 3I85A 1TVDA 3TJHC 2DYPA 3CLFH 2AEQH 4B50A 1WK0A 2CO7B 4DEPC 4XVUD 3TCXA 2OJZL 2NX5E 1BX2A 3AS3A 1MWAA 3MRJB 2J6EH 3I6GB 4WW2B 4U6XA 3P4NB 5DRXA 1GC1L 3F58L 3GSUB 2Y4SA 1V7NL 1MFDL 1OP3K 4NCDA 4WI7A 4YFEA 5FB8B 5GS1C 5FA4B 5DJAB 1NBZA 4K3DL 1A7OH 1MJ7H 4XVSL 4M4PA 4EI5A 2DBLH 1DL7L 3FQXA 3BSZH 1IILE 4JO1H 1U8MA 4ODVH 3BEVA 4Q2ZB 1ED3A 2Y1VA 1NLBL 3CDGB 1YJDC 4RNRA 5HHXL 3PV7A 5GS0D 4LLWB 4GQ9L 1MRCL 4Z7UE 5FDWB 3VRIB 1G1CA 3N9GH 2LU4A 4XP6L 1N26A 4R7NB 1F4YH 4RIRA 5C0FA 2WQRA 4I5BB 2P8PA 3BE1H 3C6SA 5J0BA 2BSRA 1X6LA 1MREL 2R23B 3RL2B 3GI8H 4HWUA 3E3QC 1I7ZB 1BBJA 2X41A 4P2RA 2E7LC 2CXKA 2X1XR 5I1LB 1U8QB 5GZOD 4D9RE 4F15B 4BSVA 4NQSB 1YNTB 2OP4L 5DVKA 4ONFH 4CVXB 1VDGA 5J56B 2LV4A 4ORZC 3U9PL 1XGYH 4L29B 2VIRB 3MMEB 3QH3A 4K94C 5T1LD 4P5KB 3NA4A 5HDOA 3V6BR 1CI5A 1NAMA 2X4TB 4UV7H 3VWJB 1EXUB 3BJ91 5H94A 4HJJL 1XF3B 3HC4L 2RFXA 1HOCB 3FN0L 2UVFA 3TO4B 1IM9D 1JGDA 1UKSA 1CK0L 1AHWA 4WO4A 1RJZB 3T65A 3O2DL 5I9QC 4NRXA 2X1WL 5JW4N 2X42A 4NN6B 1I8KB 3KPNA 1KLGA 2HLFC 4RZCA 2XYCA 1DEEB 4L3CA 1BWWA 5F7MC 5HGHB 5E6YA 4BFGA 5DJDB 3BKJH 2VAJA 4NKQB 1NKRA 1GGBL 5DEFB 5CP3A 4K23H 5SWSD 2OL3H 5L6YH 1LEGB 5HHVL 3HMWL 1X5FA 3D39A 2EYRA 2E6JA 2F8OA 2YS4A 1F11B 3T0VA 2D7MA 2YHGA 1ZT1A 1PSKL 2KUTA 1J18A 1ORSA 4LQFH 3GIZH 1KEGH 5ETUA 4OI8A 2GCYA 3QUZD 3O6ML 5DVOA 3S37X 5E70A 4HS3B 2OSLB 4PJGE 2DTSA 3RTQC 35C8H 1JNHA 4KQ4L 5LJYH 1FHGA 4U2YA 3HAEG 3BDYL 4JPWL 4JCMA 4N1CA 2XA8L 4OUUB 3NFSH 1KIPA 3CFCL 1IFHH 1XGTA 2NY4C 1RUAH 3L3KA 1AD0B 2J2ZA 2VXVL 2VAAB 4EUPA 5J8OA 1KB5A 1LDSA 1LQSR 4HMEA 4J8RA 3S3PA 4HIHB 3WBDA 1ZHNB 1TVBB 5GGUB 3WNMA 1A3LH 2FECI 1W0WA 1LK3L 2PR4L 2L7UA 1GXEA 3GDBA 1YEFH 4NNYA 4HCRL 4GKZB 3VH8G 4G9FE 3GI8L 1EEYB 1EUTA 3GK8H 4G9FD 4OZIF 1KEML 1J9CT 3QNZB 2GAZA 3TA3D 2MFNA 2V2WB 1C5BH 2ZSWA 5FDYA 2J88L 3CFKA 4PB9L 3HI6L 2PTUA 1T22B 1IT9H 2H26B 1EO8H 1IL1A 3HPJA 1T89C 2V7HA 4H5SA 3VRLE 3ARED 1XGYL 1CICD 3OAZH 1T7YA 3MYZA 4Y5YA 2YEZB 1ODAA 1J11A 3HA0A 1FFOA 4OZGF 3FOLA 3WD5L 2DQJH 3ZHDA 3MQIA 1A9BB 2X4OB 3DX9B 4F57L 4M7JL 1Z9MA 1QLFB 1TVHA 1ZT7B 3W5MA 5CILL 2EYSA 1JI2A 3BI9X 3CXDH 2V17L 4WUUE 2XTJB 1EDQA 3O45B 4NQDE 3AFLA 4EOWH 4NQDD 4G6MH 3MOBH 1CF8L 2EIDA 1B0RA 4NC0B 1H5BC 4K7FA 5IFHH 5H35A 1LE9A 2VKXA 3HE6A 3JV5A 3T4YA 1PEZA 3PABB 4ZXBB 2HMIC 4FFVC 4H1LB 3QDHA 3LB6C 5DSCA 5E2TL 2W1NA 4HBQA 4L8SC 3UBXG 1KSRA 1CGWA 1RPQA 3VRJA 3W11D 2ADGB 1WZMA 1QHOA 2FECL 4PJDE 2QQKH 2OL3L 3LEVL 4M48H 2HJFA 2BNQE 3QIWC 5T1DL 2BNQD 4ZFOB 5GXBB 4M03A 1K8DA 4PGEA 1UACH 5I1CH 3GSRB 3MJ9L 4FQQB 4O5LL 3O2WH 4LVNB 4L4VA 1T21A 4U1HA 3TBSA 1FBIL 4Z0XA 5BJTB 2R2HB 1OM3H 3T0XA 4IIQB 3G6JA 5IJKC 5MENB 3F8UB 8FABB 1WICA 3ULUD 3OR7A 4KHXH 4PJFB 5EOQH 5KOMC 1B9ZA 2RR3A 2K9UA 4OTXH 5BVPH 3VXPA 4JDVB 4PRBA 1G6RH 1MJ8H 1P84K 5E56A 4F7EA 5FGBA 3RZCB 5I66B 4DW2L 1LP9A 3T1WA 4F3FA 1MAMH 2HT4D 2YPLD 5GRZA 1KPRB 2IBZX 5I73B 4Q9QL 4OM1H 3U7YL 1NC4D 2A9NL 5EZLA 3TYGL 4D2NA 3WJLA 5F1NA 3VG9B 2CDGB 2BNRA 3HG1D 3TN0C 4BQBA 3FQNA 4AM0A 4FZEH 4BZ2H 3MV8A 1S7UB 1J1OL 3PDGA 3ULSB 3X12A 3FAWA 5I75B 4GRWH 1EERB 1YZZA 3PV6B 1NCBL 4JPKH 1WQVT 5EO9A 1KLFA 1HWHB 3BWUC 3VXNB 4HUVA 1F45A 4XCNA 4M1GL 3RIFK 3T0AA 2YSSA 1UH4A 3QZWA 5SWZE 3O9WC 1S3KH 4OD1L 5T1LB 3PL6D 1PX3A 4OT1L 4PJ8D 1V3KA 2HN7B 3GO1L 3SDXA 4NPYA 3PQYE 4ODWA 1PAMA 1OSPL 3PQYD 1KN2H 3AB0B 1J7VR 4MA3A 1QEWA 2GEEA 4PV8A 3VFNA 1WAAA 2E3VA 1PEWA 3IAGC 3FB7A 3HNVH 1XZ0B 4X9BA 4PY7B 3NAAH 4EI5B 4ZUTB 5JA8B 3FQXB 1NC2D 4LLAA 5DUPH 1U8MB 1T3FA 3UPRB 3S35X 5D1QA 1ED3B 2ZCKL 1I8LC 4HIEB 4JZJC 1HYSD 4OD3L 2EDTA 4GMTL 4RNRB 1KJ3H 4JGUA 3S88L 2XI9A 5DJCA 2JJSA 3LHPH 3BIKA 5C0FB 1P1ZB 3QXTA 7CGTA 3WFDH 1Z9SA 1J10A 3T1FB 2X40A 3QP3A 5J12B 1IGIH 2YXMA 3QG6B 2B0SL 4MA1B 2Q87A 1A6PA 4P2RB 4KZEL 1EA9C 1VFBA 4LDOB 1RFDH 1YPZF 3QUZB 4GG6E 4JQIH 1KJMA 4IHOA 4JN2B 2EYTA 3C6LD 4PJHB 3MV9A 4BSVB 1RAMA 1FG9C 1CD1B 1NCWH 3REWA 1F3JA 4HT1H 4PV9B 4N5EC 4RFOH 5FO7A 3ZT5A 3QH3B 4NHUA 2A77H 1X5XA 2VLRE 3SY0A 1WLHA 2X10A 3SDAA 3LY6A 3D0VA 3FRUA 5D8JH 4YZFF 3QXAA 5H94B 5MI0B 1CQKA 5EB9A 4KI1A 1XAUA 2RFXB 2VLJD 4X0KA 4FP8L 2F54D 1JGDB 4HGWA 1AHWB 3BGFC 1M71A 5IEHB 3VG0L 1B6UA 4QRPA 3KPNB 1KLGB 4MQXD 4RZCB 1EFQA 2CUMA 3PWPA 4L3CB 4XZUA 5JW3H 2KBGA 4KROB 4J23A 4NQTA 3IJHA 2UWEB 4GRLA 2AJUH 3IT8D 1U8IB 5GGQH 3S34H 4Q0XH 5LBSL 3OHXA 5FO8B 3H9ZA 4LCWE 1KT2A 4F2MA 1RZJH 2YA2A 3DMMD 4U1NA 4LHUA 4XCFL 3D39B 1AIFA 5DD5H 1D3CA 2EYRB 4ZOEA 1J12A 5HGBA 1ZT1B 1ERNA 4S2SA 3UJTH 1YC7A 1C8PA 2HFGL 2VDRL 1GHFH 1ORSB 3KS0H 4ZAKB 1MCJA 2P5EA 1JZ5A 3I75B 1RUMH 4A6YA 4UIKH 1OAKH 2DM4A 5I16A 3BKYH 5IV2B 4R90H 4M5ZL 4YUEH 2IADA 3MRFA 5HHOB 1U58B 2DBJA 5DMGC 1FVDA 4C4KO 1KIPB 5CJXA 1NCCH 3LKRB 5BXFA 4O2EA 3R0NA 1XGTB 3L3KB 1GCFA 3KPSE 3SJVA 4EUPB 1FNSH 1KB5B 3QHFH 4PREA 1IAIH 1UENA 1A7RL 4YDLB 1I3RA 1LO3L 4PJIF 3VD9A 2A0LC 5DQDL 4PJAA 4Q6YA 1W0WB 3U2SA 3UTTE 1AGFA 2WLYA 1I4FB 2Q1EA 3G5ZA 3MLTA 4X9HA 5I0ZA 2FZ3A 5C3LD 1FZKB 1I1AC 5FYKL 2GIYA 5K93A 2OTPA 1TCRA 1CFNA 4XMKH 2ZSWB 1AO7B 2Y36L 4QRUB 5GZNC 4MXQC 1JTPA 4P9HC 4Z18A 1TTUA 4JFXA 4ESKA 3HPJB 4UT6L 4LKCB 1SJHB 4XP9L 4YX2L 3VMOA 3ALWA 3T0DA 2DIAA 3LKPA 5EU4A 4Y5YB 4MDIB 2A77L 1FNAA 1FFOB 2R1XB 1K8IA 3FOLB 3RQ3A 2C5DC 1WFTA 5EIIA 4ZFZB 3QHZL 5FECA 5E9DA 3WKMH 5C0AD 5MP6L 4NUGL 1MCRA 2YKLH 4AJ0A 1F5WA 1TVHB 2YPLB 2IFGA 4JZNA 5C0RL 3RWEB 1RK0A 4I13B 4ZO8A 2AV7A 1KBGH 1I9RL 4K7FB 1U3ZA 3QUXD 1LE9B 1KYOK 2EDYA 2AK1L 3LRHA 1ROWA 2PXYC 4L3EA 3TZVB 5ANME 32C2A 5GRYA 2JK5A 1TTGA 3QNXA 4TRPL 1I85A 4PRPA 2Y72A 3T0WA 3AVEA 4U0QB 3V4PH 2W9EH 5MHSE 2H3NB 3W0WA 1U92A 5MHSD 1R0AH 1AFVL 1YEEL 3QFDA 4TUKL 3VRJB 1G9NC 5K33A 5EZOL 4G3YH 4K94L 3F7VA 3VI3F 1AP2B 1Z3GH 2HJFB 3OKOA 4PJCE 4ORGA 1MFNA 3KPPA 3STZA 4P59L 2EXWD 3N50A 5ENWA 1K8DB 1MFBL 4EDWH 3DWTA 5FHBL 2V6HA 1YMHA 1JGVL 5A3ID 2V9TA 3AC0A 4XCCL 5AG8A 1NUNB 1OAKL 4L4VB 3DYOA 5AEAA 1T21B 4U1HB 1H8OA 5DJ8A 4Z0XB 5BW7C 3JWOC 1MHPL 2VDKH 1G7MA 1XEDA 2GJ6E 3U83A 2GJ6D 3G6JB 1MQKL 5SX4I 2BCKA 5T1KD 2VZOA 4P23A 2QEJA 1BQHG 3DUUA 4P2OD 3VXPB 3SCMA 4PRBB 5HSFA 1NJ9B 1LP9B 1FJ1B 1G9EA 4AY0A 3IDYC 4U6HA 1FNSL 1QR1B 4TSAH 2VWEE 1FN4B 5EZLB 4HHAA 3DYPA 2BNRB 4FQPA 5CEYA 4WW1B 2JIXD 1LO4L 3FQNB 4Z7WA 1C5CL 2QKIA 3MV8B 1GYAA 2OTUA 4J3SA 2EDOA 5DRZB 4ODSH 4ETQB 4N8VA 4TTGA 4OSUH 3WHXA 3IS0X 4N0FB 4YE4L 1AXTL 1OTTC 1TCMA 4HUVB 2HH0L 1NFIB 4KU1A 2CIKB 1ZHLA 4U7SA 4UOW0 5JUEH 3EBAA 4AT6A 5TGBA 3SDXB 3EFDH 4OIAA 4QXGL 4NQCE 5DFTA 4U2ZA 4NQCD 4ODWB 1S5IL 4NO0A 4CU7A 3SDCA 2WBWB 5J11B 4NKDA 5FAAA 3QFJA 4LVHC 4HUKB 2FX7L 4PV8B 3VFNB 3PWUB 3FB7B 5ITBH 4QT5B 1PX4A 2FDBP 1BFOA 2M8XA 3T3PE 3B3IA 1PLGH 4P46C 4CVZA 3K80A 1K4DB 1T3FB 5D1QB 5BV7C 3A0OA 5LQBL 1F42A 1R3HA 4I0PA 4I3RH 4LL9A 3WV0A 2DQIL 1DBML 2BJMH 1YMME 3OPZL 5HI4C 3H42H 4ZUSA 3RVXD 3ROOA 3IXTB 1FGVH 5EUOA 5DJCB 2FSEA 3DMMB 4KRPB 2DTMH 3V4PL 3E2HB 3VH8A 3P3YA 1XFPA 1IQWL 5C92A 4L9LA 5E5UB 5ICXA 2VSCA 2W07A 4F58H 1VFBB 2O5YL 4RGOL 4NO5A 1JP5A 5CP7A 4IHOB 1F02I 5EOCH 3MV9B 4UI2A 1I8MA 4RX4A 3NCMA 4MQ7A 4JHWL 4EDWL 3QEUA 4G6KH 1CTOA 5TE4L 5FO7B 4LVEA 5AZ2H 2VXQL 1EEQA 2VR9A 4NHUB 1U93B 5EO1B 1N7ML 4FQXD 2VB5A 3SDAB 1W0YT 3VFOA 1ACZA 3LS5H 2VDKL 3BESR 4NOFA 3D0VB 4UTBL 3SO5A 1TQCB 5CCKL 4G5ZL 1LMKA 3EDEA 4IJ3C 3ARTA 2C4FU 1RZGA 3VWKD 5DEGA 5IWLC 1MI5E 1G7HA 1MI5D 3A6OA 1G0DA 3SE8L 5JQ6H 5F71A 4HGWB 4BZ1L 2L4OA 3GBMH 3VFWA 5CZVL 2CDFA 2WBJC 4LSVH 1SY6L 4J4PC 4CBPA 4GAYA 3UBXA 2D9QB 3HLAA 3IJHB 3C2AH 1T1WA 2Y6SD 4ONHA 4EXKA 5KSAA 2A1WL 3QQ9D 5EG6C 3AXLA 4JJ5A 3HZYB 3OHXB 4ZO9A 1FRGH 5F3HA 4F2MB 3MLPA 3BP6A 1EJOH 4U1NB 1CG9A 4YDJA 1ZT4A 4H88L 2APWA 4QOKB 3ZYJA 5B39G 1OP3H 1Q1JH 2VMFA 1KTDA 2VR5A 2YD2A 3EO1A 5HGBB 4AZ8A 3BW9A 4KDWA 1KELH 3HI1B 4HUXA 5FGRA 5JUEL 4NNPH 3B2UD 1WVZA 3ES6B 3WJJA 3TBVA 4Z7QE 3TIDA 2QQLH 5C0AB 5I16B 4JRYB 4BYHA 4BFEA 1CXFA 4CUCA 3K2UL 4P5TC 1FYTA 4IDJL 4LEXH 3MRFB 1K2DA 4JM2D 4L5FH 4LMQI 3B2VH 5DWUL 2AQ1A 1FE8H 1FVDB 1IE5A 1CZ8L 1KGCE 3KDMB 5D6DA 5BXFB 5IB4A 2EIEA 1QSEE 4KI5E 3RGVD 1QSED 1W72L 1NGPH 3V9FA 3FZUC 1J5OH 3UCRA 4OZ4A 4R2GB 3TV3L 1L6ZA 4POZD 2BFVH 5GS2D 3P30L 4K55A 1FZJA 1LEIB 5DDHA 3H42L 1I3RB 4G9DA 5C8JA 5ISZA 4JFEA 4ELMA 1FAKT 4MB5A 1AGFB 2VDOL 5DJ2A 3DLQR 3ILQC 4XBEL 1J0ZA 3HB3C 4WHYG 4GXUM 2FZ3B 2C3VB 3NGBC 4QEGA 2X89A 1JGEA 4KJQC 4LSTH 3UTOA 4HBCL 4F58L 4W4OC 1TCRB 3IJSA 1SEBA 1YN7B 3MLXL 4R96A 4OD2A 1CFVH 4M7ZC 3BDXA 4JY6A 3S5LG 2I5YH 1NMCC 1QRND 3UYRH 2W60A 4JFXB 3MPCA 2V5MA 3OZ9H 4G6KL 4CVUA 1A14L 5FV1L 1MJUH 4NFCA 5JMOC 3BN9C 1JTTA 1K8IB 1W8NA 3LCYA 5EBWA 1T2QH 4O51A 3LS5L 5E9DB 4P2OB 3VE0B 5HD8C 4MX7A 2IPUK 1CGSL 3A6CH 3X3GH 1FNGA 5I0DA 1EGJA 3GMOA 1RK0B 3RNKA 3IAPA 3DV4A 4XHJD 5DFWH 4OZHA 1UEMA 4OM0H 5IW1A 5J13C 3ZE0F 4GAFB 3SGEH 3ZDXF 32C2B 5C0CE 3QNXB 1OARL 4HEPG 5C0CD 5IF0A 4PRPB 5IFAL 3W0WB 3NIDF 5F7DB 1A2YB 4P3DB 5ICZA 2R0LH 5I1DA 4KKBC 2C1OA 3FB8A 4XNZB 1FDLH 4QO1A 4TSBH 1ITBB 1JF1A 2X4UA 3F7VB 3R8QA 1UT9A 5IVXB 1C12B 3AS0A 5E5MA 3SKMB 3OKOB 4ORGB 3T2NH 3KPPB 5CIPH 3LPWA 2NXZC 4GKOA 4P0DA 3TVMC 5C0EB 5ENWB 4ZNEE 3U36A 4EQ2A 4YHKH 1FP5A 2B1HL 2WAHA 4DVBB 1DR9A 3OX8A 4M43L 4KPHL 3FB5A 4PJBF 1RZFH 5DJ8B 1NEZB 3T2QA 2LAGB 5J89A 1ONQB 4PJFF 4QYOA 5CJQH 1U8KB 3BZFB 4Z8FL 1JMZA 3HKFA 1FE8L 1MCKA 2NX5A 4HKJA 5FYJU 5HPMA 4OZFH 4PP1C 3GBLA 2ICWB 2EDQA 3DUUB 3I9GH 3LSOA 4U6YB 1MFEL 2MHAA 2P48B 2F58H 3HZVB 5BZWB 5L88H 3VFVA 1RJLA 4Z6AT 3BYTA 5LKNA 5B8CA 3V8CA 3MRNA 3SN6N 4HSQA 4F9PA 5CEYB 3OG6B 4O58H 4ODTH 2QKIB 4LLVA 2DJUA 1VGEL 2OTUB 3BKMH 4JHAL 2XV6B 5D7JC 1I1FA 1YEJH 3WHXB 1DVFC 1MCDA 4HPOH 3V4VL 4MA8H 3WFEH 2J12B 3F6IA 3IKKA 2E27L 4HIXL 4X98A 4KZDL 1ZHLB 5E2VH 3RVWC 4BSWA 4Z7UA 1JI1A 2OX5A 4EBQL 5F1IA 1CS6A 1WZKA 3UYRL 2O5ZH 3ARDA 4HWBL 3WS3B 1NBVL 2AI0L 2JCCB 4HZLA 3GSNH 2H6PA 4JRXE 4NO0B 1MCOH 3D85D 3HAEB 3DXAD 3HE7A 1QTYT 4XP1H 3O2VH 4LLDA 4NKDB 4Z78B 2CLVA 3ABZA 3QFJB 3TNMA 1KCVL 3EYUH 2IWGA 1OPGH 2YPVL 4HMCA 1EPFA 3L3HA 3BZEA 4ZPVB 1MHEA 1AGEA 1Z9OA 3QCVH 4IRSA 4PLJC 1BFOB 1YNLH 3QUYC 3M1BA 1I3GH 5JOFB 3C5ZD 5JXAH 4FA8A 3A6CL 4CVZB 4WU5B 1U8NA 3DHMA 3UDWA 3DOSA 2D7TH 4FQHA 1F90H 4OM0L 1A6UL 1DZBA 4EIGB 3FB6A 3FQRA 3TC9A 4ZUSB 3ROOB 1IEAA 5C0NC 1ZSDB 3O4OC 4JEGB 4P9HL 3I2CL 5GGTH 2Y06L 3VH8B 1TPXC 1F97A 5IVZA 3ZKMC 4IOSD 1ACYH 5F96L 4X99A 5ICXB 2DJ4A 1P7KA 2WP3O 1ZLWK 1UQSB 4YHOH 1JHKL 2I9TB 3DROA 5I2IA 1RK1A 4MQ7B 4QLRA 4NBXB 4Y4FC 5CSBA 2P44B 3QEUB 5D72L 2WUCL 1JZ4A 3HFMH 1S7VB 4JFDD 1EHLH 4TULL 4BFIA 4TVPL 3B5GA 2D7NA 3OAUL 3VFOB 3FMGH 5T3ZL 4EN3C 4OCRL 1GOHA 1J8HA 1KFAL 3L1OH 2QQQA 4K7PY 4WDIB 4LASH 1RZGB 3AU1A 4N1HB 5DD3L 5E6ID 1G7HB 1YN6A 3S4SG 3REVB 4TSCH 4JY5H 5FYLH 1A1NA 3IDXL 1R3IH 3I9GL 3SGKC 2XG5A 4PJGA 3T0ED 3RDTD 2ZUTA 1A1MA 3MRCA 3TH3T 3WIHL 2UZIH 1PW3A 3VD4A 2XXCB 4IMLA 3UBXB 3V7MA 3HLAB 2HRPL 1T1WB 2UY7A 2GJZA 1RHHA 3FN9A 4ONHB 1HINH 5KSAB 3C60C 4NQED 1DQMH 3MBED 1OTUD 4NKIH 4PJEE 5F88A 1YQVL 1RZKH 3BP6B 5J6HA 4H8WC 1CG9B 1QRNB 1ZT4B 4YDJB 1X5HA 3WFEL 3QAZB 1H0DA 1L7IH 1KTDB 1KENH 2PYEE 5HHQA 5EC1A 4GS7B 2XRAH 1E4JA 1G7IA 4C58B 5HHNB 5HHMD 1Q9LA 2N7BA 3TIDB 1FO0L 3MOQA 2WK2A 4ONGH 3O6FD 1NGQH 3CJJA 1P4IH 4G9FA 2HKHL 1IM3B 4BJLA 1FYTB 1K2DB 2Y23A 4X7TA 2Q86A 4XC1L 2DLTA 1BQHA 1KC5H 3BYYA 5DURB 4G6FD 5JXAL 1I9EA 5IB4B 4YHIA 4Y4HD 1OAYH 4JQXC 5CEZL 1XF2A 2ESVE 4PLNC 4UILH 4GRWE 1OWRM 3LIZL 5C07E 2P7TA 3VXTB 5KSVB 1T1ZA 4YC2B 2OK0L 4NT6A 4OGYL 5CZXD 5I1KH 5HYEA 5FUCE 1MNUL 1MY7A 2GQHA 3MXWL 1VPOH 2VZ3A 5DJ2B 1H3PL 4OB5L 4IOFD 4WUUA 4NQDA 3ZSSA 4Y4KC 5LCVL 1JGEB 4XAKE 1ZHBA 1XGPA 1BMGA 3CX5K 3MUY1 4QWWD 4XAKD 2FGZA 4D0DB 4U6VH 4M7KH 3QPQD 1SEBB 4YHOL 4R96B 4OD2B 2H2SD 4NBZB 2GY7B 5KSBE 4D9LH 3JWDC 3IDNA 4ZYKB 3PGDA 5BV7L 4PRIE 5EH1A 2H1PH 1ZLVK 4PRID 4OQTH 1L4IA 4WUKL 1Z5LB 3EAKA 3KLDA 1LO0L 4PJDA 3D87B 4K9EC 5EBWB 4O51B 3RPIA 4XPGL 3FMGL 2R0ZH 1XCQA 5DZOA 2BNQA 2X9WA 4RISH 5D6CA 3TJHD 2FEEI 4HFUL 1Z9LA 4MX7B 2EE6A 5EU6B 1T20A 3RNQA 2W0PA 2A6JB 3QI9C 2IQAA 3GMOB 2NTFA 3RNKB 2OQJB 2YOCA 3DV4B 4OZHB 3V0VA 5ESAA 3KXFD 5BMFL 5IW1B 3S36H 1R5IB 3EOAA 4F8TA 3TO4C 2PW2A 4HK0A 5FYKE 3CVIH 3DETC 4LBEB 2DMKA 4CN1A 3OB0K 5FYKD 4HWEL 5IF0B 1I1CA 2YD9A 4NN6C 3CFBA 4FQ2L 5GIRA 1DQML 1KACB 3RBSA 2NW2A 2JTDA 4K8RC 3ZMRA 1JPTH 4X8XA 3V79C 1RZKL 1WZ1H 4KXZH 3IYLW 3MODH 1JF1B 4K3HA 1PG7L 5GRUL 1AKJB 4HC1L 5E5MB 4WEUD 3RKPA 1G0XA 5D93B 3BPLC 3D85B 5D2LE 1PQZA 3DXAB 3KYKL 4DZ8A 5I1HH 3U36B 3ARGD 5EU7C 2Q8BL 1VADA 5DVMA 1IKFL 1F4WH 1KJ2H 1RHFA 1QVOA 1JNLH 2IH3B 1IAKA 4RGNB 1TZGL 2BP3A 3FB5B 3VFGH 3RUGB 1GGCH 2WINB 4F33A 5C0GA 3C5ZB 1BLNB 3G6JF 3EYSH 5KW9L 4I3GA 5E7BA 4YPJA 3ARZA 3T3ME 4QYOB 3PXJA 2FJFB 5SWZA 3PL6A 4QXUL 4LF3A 2BY0A 4DN3H 2NX5B 1XH3A 5HPMB 4FMFA 2C3GA 4UTAH 5DQJA 3MA7B 2XFXB 1LP9F 1JGLL 3RIAF 2FEEL 2GY5A 2YK1L 3GMQA 3LSOB 3RWCA 2MHAB 3PQYA 3QPXL 2B2XL 1ZS8B 1NUGA 4WI6A 1RJLB 1CCZA 1U6AL 3QXDA 5HVHB 4G7VL 3IFNH 1VA9A 3TT1H 5E8DL 3MRNB 5B8CB 1AD9A 2NY6C 1OB1A 3P4LA 1BF8A 2NY2C 3X13A 1ZA3A 4X6CA 1R3JB 4NJ9H 4X9FA 1NCDH 2N4IA 2FX9H 3DX7A 3P73B 1P7QD 1I1FB 4YO0A 3FO9A 4LSSL 4KKAC 3F7PC 1F6AA 3EO0B 4GXUN 4PJXB 3HMXA 3OKNA 4N0UE 3A67H 4KK8C 3SDXF 3U9UA 5EIQA 2NXYD 1B2WH 2HLFD 3TT3H 4JFDB 1RMFL 1OAXL 4Z7OE 5T5NF 5BS0E 2CDEB 1YEIL 3DO3A 5BS0D 3DRTA 1RIHH 3HE7B 1WAAF 1DQTA 3TNMB 4OQTL 5E6IB 5LGHH 4QRSA 2CK0H 4OFPA 4JDTL 3L3HB 4FN0A 4GG6A 3BZEB 2BX5A 3C6LA 4HD9A 4IRSB 5A2JH 4JN1H 4XMLL 3GHBL 3T0EB 3M1BB 5AD0B 1MPAL 3L3JB 2CKBL 4FFZH 2R2EB 2WLZA 3ULVF 3TM6A 4XVTH 2HP4A 2J4WH 2VDNH 1U8NB 1L7TL 4HXAH 5D2NB 1T83C 5DD0L 4FQHB 1YC8A 2VLRA 5HDBF 3RTQD 4NQEB 2XTJC 5AYUH 1XF4A 3FQRB 4YK4B 5INDA 1REIA 2VXUL 4MJ6A 2J8UE 4GW1B 5F6IB 1G9MH 3VFPA 4R3SA 3DGCR 3KLSA 2ARWA 1N5AB 4PD4K 4BUHA 1FH5H 5KG9B 1P7KB 4PTUA 4U1SB 2NY4D 5IOPB 1U41A 1HILA 1PG7W 3PGFL 5ALCL 2XQYG 2DL2A 3S5LA 5E1HB 3SBWC 2R4RL 1UWGH 3MLWH 4UB0H 5F9WB 4I8DA 2IJ0C 3QRGL 2C3WA 2X4QA 5I15H 5KAQF 4U3HA 1JNLL 1XR8A 4WV1A 3VFGL 1I7UA 4OF7A 4LCWA 4KFZC 1FL6A 5LXGL 4BFIB 3JXAA 4B7LA 2AGJH 3NACL 2R2BA 3EYSL 4JKMA 3ZLQC 4KUCF 3VA2C 5FKPA 5I1AA 1J8HB 5CINH 4PRHE 4JR9H 5I76A 4GLRH 3AU1B 3VDAA 3SE3A 1AJ7L 3GMLA 4HGKC 3LV3A 4KY1L 4XBGA 5ILTH 1JNNL 2VLLA 3H9SD 5A1AA 3MLRH 3UXFA 3RWFA 4LEOA 1LO2H 4PJGB 4X6BA 1A1MB 3MRCB 5GGRA 5I74B 4BKLB 3O41B 3B4NA 1CGXA 3B9KA 3TT1L 2JB5L 5IK3A 3EDKA 3RZCC 4BH7A 2GJZB 5HYJA 5I73C 4JDZB 5F88B 1NCDL 1U8JA 1X5ZA 3QCUL 3V6OE 1P2CA 5J6HB 3KPSA 5IQ7L 3OWEA 1H0DB 5I75C 5HHQB 1UXSA 5EC1B 4FXGA 4YEEA 3MGAA 3N85L 2R8SH 1G7IB 1OP5K 3I6KB 3DX8B 5AUMA 1FAIL 4Z7NF 2SEBB 2HMID 4FFVD 2OZ4L 3LB6D 3UTTA 1KXVC 3X14A 1VFAA 2F9BT 3GSWA 3ZKQD 4AL8L 1Z2KA 3MRMA 4QTHA 2D0HA 2A6KB 5EA0H 5I1GL 2Q86B 5KANG 3QEQD 1SJEA 5L9DH 1BQHB 2X4RB 3QIWD 3L3DA 3D0LB 1W8OA 5L2KD 4XVTL 3IDIB 4TYUA 4UBDC 5C7XL 1JF5A 2W0KA 1XF2B 3V2AR 3SKJL 4EI5C 5B4MC 2QSCL 4MJ2A 1JZ3A 1IC1A 3CFEA 1EMTH 5GRJH 4M02A 2K7QA 4PJAF 4FQJH 4NT6B 1E4XH 1PKQA 1R5WA 4YBQC 5KVFL 2HJLB 3WIIH 3HR5B 4JZJA 1QNZL 4YBLB 1F8TH 1TJHH 3OKKB 1JPSL 1CYGA 1DUYA 4OGAC 1CD9B 12E8H 1XGPB 1KCSL 5DVLA 2ADFL 1A1OB 1N4XL 1A4JB 3EJYD 3V4UH 3BO8B 3UJIL 1KNOA 5ANMA 3ARFC 3GNMH 1BD2D 3HUJE 4S1SL 4L8DA 4DZBB 4Y2DA 4LARH 4WRLA 2NY3C 3PGDB 1ADQA 2EDXA 3LDBC 3DIFA 1MRFH 3CFIC 3NFNA 5D7SL 5SWQA 5EFIB 4PJDB 1GGUA 2AGJL 3ESVF 3RPIB 3NCYP 3GHEL 2ZG2A 3L5XL 4PJCA 4APQD 4NKMA 4DCQA 5CINL 4M61B 3BP4B 1T20B 3V6ZB 1MCSA 3O9WD 3RNQB 2IQAB 3BIBX 5DYOA 3RBGA 1P84J 5MI0C 4ZUWB 5CZKA 4YEFA 3V0VB 2ZSVA 5JO5A 1E4XI 3UTQB 5I17A 3MV7D 3EOAB 3LRSA 1JUFA 1GPOL 2VLKA 2I07A 3BH9A 1AHWC 4WO4C 3IF1A 5DMIL 1CXEA 5HJ3A 1L0YA 2H2PD 3LKSA 5I71B 1N0XH 2J8HA 2IPKA 4RMSA 4MMZC 4P9ML 5GIRB 2BOCA 5T1MA 5MEQA 5K9QG 1NQBA 2D7PA 4NJAH 4DUWA 5IB5A 4N1EA 2NW3A 1BP3B 1MEXL 4E41E 2WWKT 1S7WB 4E41D 2ZUQC 3KJ6H 3VXRA 1TZHB 4DZ8B 4HUWA 1YYLH 4JFYA 2B39A 2R1WA 1KIRA 1VADB 3CK0L 1QVOB 2DIJA 3WUWG 3PE9A 4QHKJ 5JDSA 2QJDA 4F33B 5C0GB 4OIIL 1R3KA 4WHTA 1SHMA 1K5NA 4OFKA 3Q6FB 4JFFE 1GOGA 3UTPE 4J3XA 4JFFD 1G7JA 3UTPD 1JE6A 3S4SA 3FO0H 4LF3B 1JPFA 1Q0YH 3MUGA 3ZTNL 2MQ3A 4DKFL 1I9IL 1M1SA 4ZS6C 3HNSL 4NQCA 3GMQB 4DQOH 3RWCB 1KB9J 5TPWL 4N5ED 4H8WL 3LQAH 1X4ZA 2G60L 5DK2B 5DQ9A 3QXDB 3VFSA 5EOTB 3IS1X 1AD9B 2D0FA 3SGDH 4FQJL 4Z7WF 1E4XL 3X13B 3X3FH 3Q1SH 4X6CB 3MGOB 3VGDA 2VOTA 4YDLC 1BIIA 1NAKL 3PNWB 1Q9WB 5B39B 4D0CB 3FQWA 3OG4B 2R0KL 2Q8AH 3FO9B 12E8L 3DVFA 1F6AB 2ZUYA 3D3VD 3D69A 2WSKA 3SPVA 3U0TA 4FABH 1YMMA 3U9UB 1INEL 2RAMA 2MCPL 4HKBA 3DRTB 1IBGH 3HN3A 5HI5C 2PTVA 4HIJA 4Y2OA 3ZE1F 4QHMB 1I7RA 4UINH 1P53A 1DQQA 4HAGA 4UQ3A 5EU3A 2IAMA 2Q6WA 5L8JB 3TNNA 25C8L 4ACPA 4Y5YC 2ARJB 3BRDA 5KVDL 1FC1A 5C09E 3DNKA 4I4WA 1ITCA 2IEPA 2XXMB 2Q7YA 4R0LA 2IANB 4P57A 1HHKA 1F2XK 3BAEL 2CRMA 3DURA 1UG9A 5E2WH 4AYFA 2VLRB 4FQXA 3TO2A 4D0BB 1KLUB 5EUOF 3QDGD 1XF4B 5INDB 1Y0LA 1ND0A 1Q8MA 2BDNH 3PHSA 4X6DB 1E28B 5C0DB 4OFYD 1NCAL 5FUZH 4FTVE 5M95B 5BO1L 3HE6C 1N0XL 1UJ3A 1FQ9C 4LRNL 5J3HD 4YDKH 4G8IA 5DMGD 1ES0A 3JWDL 1C16A 1H5BB 1FFRA 2Z9TA 4PTUB 1TQBC 3PWJA 1UWXK 1ZOXA 4K9EL 3PIQA 3SE9H 2XQBL 4LLMA 1JYNA 4LSQL 4Y88A 3TWCL 1UM5L 3JTTA 2D3VA 3NZHH 3MUHL 4KKCD 1LDPH 1S7RA 5TDNA 1CGYA 1ZMYA 2OR9L 4GBXD 1HK6A 2A0LD 1XR8B 4O4YH 4WV1B 1I7UB 2Z93A 4Y1AD 4LCWB 1FL6B 3DARA 1ZE3C 5CHNA 5L2KB 3BFOA 1I1AD 2VUOA 3PDOA 2GT9A 4O9HH 1IZKA 5I76B 3GKWL 1V7MH 4XBGB 5GZND 4MXQD 4DKDC 2VLLB 4K8RL 5TH2A 1JZ2A 2DKSA 4LEOB 4Q9CA 2VISA 1MOEA 4XNUH 5GGRB 3GRWA 3IB4A 1JHTA 4HDIA 3B9KB 4U1JB 4ZMAT 5BQ7B 5IVNA 5FGBC 3CXHJ 4BH7B 1QO3B 1IC4L 2VL5A 3U0WH 4IOIB 3MFFA 3Q1SL 4WFGE 5GGVY 5HYJB 5M7QA 2IBZY 4WFGD 4XCYA 1EV2E 2PYFA 5ADOL 3WJLC 3MLVL 1NBYB 3W81A 3RKDD 1BD2B 5F21B 4ODBD 4NCC1 3KPSB 4LPUA 4L8CA 1HKFA 1X5YA 4TVPE 1RV6X 3TN0B 4TVPD 1UXSB 4FXGB 2QQNL 4KMTH 2PXYD 5T3ZD 5T5FH 1W72B 4W68A 3QULB 1OTSD 2UZYB 3QO1B 3U7WL 2J8OA 1AXSA 1SM3L 2P45B 1IBGL 1T04A 2VDML 1VFAB 4NP4H 3GSWB 1X5LA 4GW4B 2J6EA 1OY3B 1N2RA 5GGRY 5KN5B 4PB0L 2HTKC 5J11C 3MRMB 4QTHB 2ZPKH 2DD8L 3Q5YA 2F15A 3LH2L 1SJEB 6FABL 3MV7B 1BHGA 3QIUD 5DI8A 5MERB 1HH9A 1SVCP 1PG7X 4GW5A 4PJ9A 3B6SB 2FB4H 4PUBH 3PWVA 4OF8A 2D2OA 4F7TA 1N64H 2MPAH 4XP5L 3P9LA 5D1QC 1ZLWH 1V3MA 3ULVC 5CSZB 4ELMF 2BDNL 4FQ1H 1PKQB 1R5WB 3PDDA 3QWOA 3FOMA 4K71B 3JUZA 1DBKL 4JZJB 4KKNA 2E7MA 3OTTA 4M3KB 3WHE1 2JJSC 4JFQA 2M2DA 2R9HC 2XNAB 2CK2A 3E2HC 1N6QH 2EC9T 3SE9L 3HC3H 3G6AA 1IVLA 1KNOB 2X5PA 3GI9L 3K7UA 1XF1A 2QSQA 5C0CA 1E27A 1R24A 4Y2DB 5DHVB 5HGAB 4F80A 4RWYL 1UVQB 3O0RH 3ZL4L 5I1IH 4NC2B 4CADB 1P6FA 1AQKL 3DIFB 2NNAA 4DTGH 2EH8L 3VXUA 1ZA6A 4LPWA 2DQTH 5CEZD 5TQ2L 4MAUH 4IMKA 5C2UB 1OTTD 2FX8L 1Q72H 3CVHB 4R8WH 3SEPA 4PJ5E 4DCQB 4I3SL 1FG2A 1UYWH 3SDAC 5EBMB 4ZNEA 4NYLA 1HSAA 3PP3K 3IFOB 4YHZL 1J1XL 1SYSB 3M8OH 4OZHF 5JIKA 5DYOB 1E6OH 5C86A 4OCYL 3JUYA 1DQJA 3K81A 3P0YL 4KK5C 3WL9B 4WWKA 2ZSVB 4S1DC 1LILA 2Z4QA 3OF6D 5JO5B 4RMTA 4XNUL 1YY8A 3V0AC 1Q0XH 2VLKB 2I07B 3BH9B 5C6PB 3CFJB 5IWLA 3IF1B 5HJ3B 2VUYA 2BOBA 3LKSB 4G6AD 4ELKA 3UZQA 3UJJH 3BGFB 4XBPA 4Y19E 2X7LA 5ICYA 2QADC 2WBJA 4Y19D 2O5XH 3NH7H 4GRLC 3RX7A 5FK9A 4BH8B 4QHUA 5IB5B 4RQQB 4DKAA 2H32H 5F7EH 3MFGB 4YXHL 3I02A 3WIFA 2OL3A 4OCXL 3VXRB 5J1TC 3LMJH 1A6TA 4JFYB 4OJFL 2P47B 1P4BH 1EUUA 2R1WB 1KIRB 5HI4D 1XT5A 4KK6D 5JIPA 2X9XA 1U8LA 3N1PC 4U7MA 5JDSB 1QBLH 4N8CH 4MNGE 5FYLE 1I9JL 3O3DA 1BM3H 4P2QE 3P2TA 4FMKA 4P2QD 4LHQB 2J5LC 4P4KA 2ZJSL 4O2CA 5ITFA 5E2UL 1DN0A 5EC2A 2CR3A 4O2FA 2HWZH 3S4SB 2AABH 1FVEB 4QXTA 1Q38A 1ZEAH 4M6MH 4LOUC 4F9LC 1UCTA 4HS8L 3IXAB 3EOTH 4R26H 4JRXA 5D71L 4C57C 4PUBL 3C8KB 2F19L 5CGTA 5DQ9B 5GISH 3VFSB 3BQUA 3TESA 4I2XB 2P49B 4HH9A 1BWMA 1VFMA 3QJFA 3NTCL 4YNYA 3MCLH 3SQBA 4TQEH 5C3TA 1O5DT 1E0OB 2X1PA 3H3PH 1N0LA 3ARRA 4YQXH 4POUB 1MWAL 1U2CA 3EJZC 4HJ0C 1ZLVH 1U2HA 4JG0H 4M6OH 1N5YL 4Z7UF 2R69H 3SPVB 1YMMB 1KG0B 4J4PD 5DJ6B 2AK4D 2ATKB 4FG6C 1MF2H 4KTEL 1JIBA 3D2UA 4XXCA 5JPNB 1MELA 3DVGA 3T04D 1LHZA 4IRJD 4UQ3B 2IAMB 4HLZG 1K4CA 4ZS7L 3AAZA 4Q74A 4JAMA 3OB0H 4BSJA 4I4WB 1RUQH 1K85A 3B9EA 4JY4A 2Q7YB 1NGZB 1AQDA 1EHXA 4P57B 1HHKB 5CWSA 2HKFH 3UAJC 1CN4A 2XPGA 1OF2A 3JZ7A 4MNQD 3DURB 1QUNA 2YPKA 5HYSG 3TO2B 3RWJA 4QNPE 2W59A 1S9WA 5E0QA 1UKTA 1Y0LB 3JV6A 3K4DA 3VXSA 1ND0B 3EHBD 4GXVH 2LVCA 4P5TD 5EZJA 3V5HB 2D31B 3RVTC 2VC2L 1UJ3B 5DJ0A 2B1AL 3QDJB 1ES0B 1C16B 3EYVA 5LG1A 1UXWA 3O6LL 5IP4A 2CGRH 3ALPA 4NM4H 4OLZL 4XPAL 3RDTA 3S37H 4U49A 3PIQB 3FZUD 4LLMB 5GGSA 1P9MA 3ULUH 3JTTB 3MLZL 2AQ3A 4XMPH 2NY5H 4PYHA 1DCLA 5E00A 5IT2L 5KS9E 1NAML 5DHXB 5TF1L 1TJGH 4JLRB 4PJEA 4TOYL 4ODXB 3QUMA 2KL6A 2G5BA 3ILQD 3HB3D 1EVTC 3UZVB 4X7FC 2P46B 3ARUA 4I18A 4DAGL 6CGTA 4KJQD 2PYEA 5DK0B 4D3CL 2OXHA 2BSED 2NY0C 4TPRL 2HVKA 4PJGF 2I60H 4O02L 3T8XB 3ILPA 3RAJH 1MHCA 3O6FA 5EZIH 1KCKA 4OLWH 1DJSA 5CJ8A 4YHYC 2GUOB 1JHTB 4P23C 4HDIB 1G6RA 3SCMC 3BN9D 5TDPA 1G7LA 3KYNB 5DUML 1MCCA 5DD6B 4B5EA 2DQUL 2GTZA 1UZ8A 3CSYB 1L0QA 1T0PB 4JFOA 4E0RA 2HFEB 2PYFB 3BVNA 1I8IA 2ZKHL 4YQXL 2Y5TA 2EDWA 2ESVA 4JG0L 5C07A 2L7JA 1CLOH 1NGWB 1G0YR 2DL9A 3P9WB 4JRWA 3WUWA 1DBBH 1KTLA 3OJ2C 4LK4A 4NC1E 5MEPA 2UYLA 1AXSB 1C1EH 1T04B 4JKPH 2D03H 4P2YA 3G5VA 4ISVA 4WNQA 1JWSA 2D7OA 3MC0A 4W4NA 2WW8A 2G9HB 4KHTH 3SDCC 1FPTH 5IKCA 3SDYH 1ZK9A 1KB5L 4JB9H 5I8CA 4OZIB 4LLQB 2A74B 4PBXA 3TVMD 1U8OA 5KSBA 3VRLF 5DI8B 3BKCH 3QDAA 1OQXA 4GW5B 4PJ9B 4WGWB 1KPVB 1DE4A 3PWVB 3CSPA 3I50L 3O3AB 4M93B 4LCIH 3RVUC 2Y7QA 5ERWB 4I0CC 4ZOCA 3MROB 1M05B 4NHCL 1FLRH 4AEIH 4I0PC 1YNKL 5CUSL 4P46B 3QWOB 3FOMB 4LGSB 1SYVB 2PO6C 3LKQA 4K2UH 4M6NH 2IFFH 4MB4A 4PLKD 1ZVSA 2VLME 3NABL 4O00A 4U1GC 1CXLA 2VLMD 3GIVA 3RJDA 2QTEA 1BFSA 4JFQB 2XKNA 2B7DT 2XWBB 3VXME 2VABB 3CDYA 2Y07H 3BT2H 4PP2A 2EH7L 4L9LC 4NDMA 3G6AB 2C9AA 2Q76A 2HA1A 1DBAL 4NKOB 1E27B 3R8BB 3WFBH 1R24B 4KUZH 3WNNA 5ID1A 2N1KA 1CDUA 4PJDF 2EDNA 4MS8C 5FGSA 2DICA 3VXUB 1ZA6B 4OLXH 4HH8A 3O8XC 2F8XC 3KR3H 1DVFD 4QGYA 3EYFA 4PJIE 3UO1H 2P5WB 5HPOA 4NSKA 3IDMB 1FG2B 5D2LA 3TPUA 3ARGA 1HSAB 3MRGB 2FEDC 5E99L 4Z95H 2I60L 1KV3A 3RAJL 4XAWH 4WI4A 4EN3A 3MBXH 3WN5A 1YY8B 3QG7H 4RAVB 4J3TA 4OZFG 3CLEL 4R9HA 5HBBA 4ERSH 2BOBB 5F7YC 4ELKB 5DLML 1OP5H 1IGYA 4PS4L 1GZPA 1F58L 43CAB 4K3EH 4PLJD 5CGYC 1BQLH 1ZGLB 4XBPB 3D48R 1QFWH 5ICYB 2WBJB 3DBXA 2VQ1B 5FK9B 1QYGH 5KSAC 4QHUB 4HZAA 4XPBL 2VDLL 4FQIL 1DLFH 3VDBA 2OJEA 4ODHL 3KPQA 3SDDD 1UWEL 1HXMA 1A6TB 3B83A 2PNDA 4R4NC 4WTWA 2DQEL 2W9LA 3QAZC 3CC5A 1CVRA 5C0ND 4RAHA 4FZ8L 1LO5A 5E8EA 2IMNA 4GS7C 2Z0BA 3DX6B 1VGKB 3WJJC 1M7DB 5F9AC 3ARBD 3S35H 1UFUA 4P4KB 5ITFB 4O2CB 5IHUH 3ZKNC 1BEYH 2WMPA 4Q9RH 4QXTB 4JB9L 5CD5C 4TNWK 5BS0A 4X9IA 4Y4FD 3QT2A 4TUOA 4DFHA 1GSMA 4ZTOL 4JM4L 4JRXB 1BGXL 5BRZB 5D6DC 5C08A 3ARQA 4LCIL 1A6ZA 2B8OT 3BQUB 2NZ9C 3ZDYE 4X6CF 1T1XA 3QJFB 2E9JA 5JLZA 4QRRD 1FORH 4K2UL 1MSPA 4YC2C 3ZDZE 1DBJH 3FFCD 5H2BA 5J7CC 4QHNA 2IBBA 4Z7VE 1MCQA 1MHHB 4S0SD 4DGYL 4KGJA 4QF1A 1KXQE 3G6DH 1MCIA 2ZOKB 1SBSL 2HVJB 1C5DA 1A7NH 1MFCH 2J8UA 2R0WH 3PHQB 2C4XA 5D7KE 3UZEA 2A6IB 3OBAA 4XWOD 4OLYH 4LFHD 5HHPA 4NUJA 3NGBB 4OAWA 3D2UB 4AIZA 3C60D 2FL5B 3DVGB 3RGHA 5IJVA 4Z77A 1A3RL 2FATL 2JLLA 3QDME 5IIEB 4M7ZB 4K07A 4WCYH 4HPYL 3KR3L 3ULVL 1K4CB 1NMCB 3IRPX 3MNWB 3ZO0A 2XZQL 3WXWH 4PRAA 4JAMB 5FHAL 1YPZB 5IBTL 2JELL 4JO2L 1JFQH 4WEBH 5HYIA 2Y5EA 1HH6B 2XPGB 4HWNA 3LQZA 1JHLH 2YPKB 4TVSa 2LAAA 4JPIA 3UX9B 5J06A 1WBYB 4KAQH 4X6DF 3WNLA 3RWJB 3QWRA 1A0QL 2RCSL 1S9WB 3JV6B 3VXSB 2LABA 3C08H 1ZVHA 4BELD 4OUOA 4YAQB 5EZJB 3P11L 4PRHA 1JN6B 4NWTH 4NO2A 5EUKA 4TUJA 3EYVB 1BQLL 1UXWB 5DR5L 4GAJL 4C56D 1D5IL 4XTRC 5DEZA 5ADPL 2MTPA 5ALBH 5IHLB 1UA6H 3INUL 2BVUA 1N6VA 5GJTH 1NCTA 1ZV5A 5GGSB 1BQSA 1IAIM 4Y7MA 3L5IA 3UTSA 4RMVA 3GFUA 9CGTA 1PGRB 1X3DA 4NM8H 5FUOH 5D93C 1VKXB 3TIEA 2JJUA 1I1YA 3QUMB 5B21A 2X09A 3V6OA 1QSFD 2NXZB 1WEJH 1IKNA 5D96C 4RGNC 3VFRA 3IFLL 1X4XA 2DQDL 4GAGH 4Y4KD 1JV5A 4MCYA 3QQNA 1WITA 2PYEB 2XN9A 4F7CB 2AEPH 2V9RA 1T1YA 1E4WL 2HVKB 3QZWG 5ID0B 2V2TB 3ILPB 1EFXA 5L8KB 2V5RA 4RMRA 3L9RB 3E6HA 4YDIH 3GJEA 4ZFFA 4N0CC 3BUYA 1G6RB 5T5NG 3VI4F 5TDPB 1HQ4B 2NLJB 3TPKA 1XGUA 5E08H 1JWUA 4LSRL 2GTZB 5HVHC 1UZ8B 1Q9OA 2UUDK 5ABDE 5B8CC 4ZD3L 1EAPA 1U3HA 4J6RL 2IF7A 4JFOB 5C0IA 4E0RB 1I8IB 1DBJL 2HLAB 2JJWA 4F9PC 3L3GA 1CLYL 2K1MA 1CXIA 3QI9D 5J57B 2O61A 2AKRB 3VWJD 5LGJB 4GRWB 4A6YL 5C07B 3DSFL 4L4TD 4KV5F 1DANU 1CDCA 1QA9A 3WUWB 3TO4D 3DETD 5D7JB 2E8ZA 4YDVB 3S9DB 5MEPB 5GS0C 2YD8A 2DQCL 2UYLB 2BRRH 2V5YA 3PF2A 3UYOD 5GHWL 3WNOA 3G5VB 4YHML 1PZ5B 5I8KL 4LSPL 4WNQB 4J2XA 1JWSB 3ARDC 4K8RD 4UMGA 3VXQA 1XMWA 3P9MA 4WCYL 3HE7C 3KYMA 1G1YA 3RWIA 4LNRB 4LKXA 4UZGA 2YWYA 2OJZH 3WUZA 3HUJA 3VW3L 2P43B 1U8OB 3ROLA 1VSCA 3GMNB 2IC2A 4E9LA 2R29H 3MGTA 4IRSC 4WEBL 1WWCA 3CZJA 1QBML 1JHLL 2PN5A 3F58H 1V7NH 1MFDH 3CDFA 4RA0C 5F7HA 3RRQA 1UWXH 3QUYB 3UDWC 3IJYA 4K3DH 3LKNA 3LKQB 5DJXB 1TITA 1TFHA 4YK4C 1DL7H 5F6IC 3O4LE 1A47A 1LD9A 2XKNB 2FRGP 3MJ7A 1U8HA 4PP2B 3O4OB 4NDMB 2DAVA 3HAEH 5LWYL 5HHXH 3NIGE 5C0BD 4GQ9H 4J1UA 3FT4B 3G04B 1TPXB 3NN8A 4M7LL 3SKNB 2NY6D 1INQA 1U9KA 3NZ8B 5ID1B 5FUOL 2FWOA 2WBKA 3ALXA 5I8OL 4NZDA 1IAMA 3IDGB 5F9WC 3CSGA 3EDJA 4JO3L 1P69B 1MREH 3MUJA 3SBWA 3THML 4OCNC 1NCNA 4PJCF 2JJVA 5DJYA 1RU9L 3EYFB 1SVZA 3DUHA 4GAGL 4KKAD 4LHUG 1V3JA 2OP4H 1PY9A 4MSWA 4E42B 5HYSA 1JGUL 2YRPA 3QYCA 1NL0H 1DP0A 4EN3B 3MXVL 3PUCA 1IGTA 4XRCA 5TFSL 3WYRA 2AXFA 4U31A 4MDJA 2BC4B 3GMRA 2Z92A 5E08L 5JHDA 4HJJH 3HC4H 1GZPB 5I74C 4DGVL 5E8PB 3V52L 1U95A 2P24A 4FNLL 1CK0H 5LAXA 1OGAD 3O2DH 1RVFL 4EJ1C 5DTFA 4JFZL 3LEXA 2XTJE 2EEAA 2DF3A 1HXMB 2XTJD 4YPGA 1S9KC 5C0JA 4N9GA 3CC5B 2FLBT 3CD4A 4I48A 5E4IA 3MCG1 4MD5A 4EIZC 1LO5B 3RI5F 5E8EB 3CU1A 1GGBH 2JB6B 3O81A 4EI6A 1SEQL 5BOPA 5D1XA 1T5WA 5C6TL 1JYWA 4ZXBD 3ZDXE 3L7FB 2VZSA 4M00A 4ODUA 4OCSL 2DM7A 1GAFL 4PPTA 2GSIB 1PSKH 1KTRL 4JO4L 2ZUVA 1B88A 1JRHH 3PJSB 3L5WA 4LCUA 5F7LB 3O6MH 4TUOB 2R29L 1KXTB 1RIVL 4PGCB 5C08B 4KQ4H 3BPNB 1A6ZB 3OKDA 3AREC 4BK5A 4C56B 1TNMA 5JLZB 3BDYH 1INDL 4DKEL 1KCUL 4JPWH 4MCZB 2R4SH 2XA8H 4H0GA 5C09A 4K3JL 5CBAA 3CFCH 4PD4J 1F4AA 3SOBL 3IU4L 2UV3A 1SBBA 2M26A 3S3JA 4QF1B 5MENE 2VXVH 1B4JL 5MEND 4PJFE 4YBLC 5TF0A 5JORA 1C5DB 2I26N 3Q6GL 1A6VL 4OFYA 5CLWA 1AR1C 1QSFB 3MUZ1 4FTVA 4KKLC 4MHHG 1RURL 5D70L 4XH2A 3RZCD 1LK3H 3BHBA 3PP3H 2PR4H 4Y4KB 4HS6A 4POYA 5JXED 4X4YA 4AIZB 1RUKL 4CU8A 3TYFA 4AENA 4GSDL 3KPRA 4HCRH 5F9OL 2DQHL 3FQUB 3R1GL 4M5YL 3D25A 4N9OB 3ARFA 4Y16A 1URLA 5JW4Q 2Z8SA 1KEMH 1OP9A 3P0VL 3MNVA 1TLKA 1F3DH 3UBXI 4PRAB 1JRHI 2J88H 4PB9H 2QHLA 3HI6H 3QHTC 3LQMA 2G75A 4G8EA 1WCQA 4MXVE 1GIGL 4GBXA 3CH1B 1UH3A 1NL0L 2GK0B 4PIRF 2FR4A 4OKVB 4YR6B 3EKCA 1OOAA 3DV6B 3HI5L 3WD5H 1N8ZB 5J6GB 1BFVL 2V2XB 4M7JH 4URTB 3QI9B 5GRXG 4F57H 1H3WM 3KPTA 4M9OA 4MJ5A 4CMMA 2FLRT 3O3UN 4HIIA 1NMBL 5FM4A 3RWDB 5CILH 2APXA 4NO2B 2W65A 4NOBA 5EUKB 3LZFL 4TUJB 4L4TB 2V17H 1QLEL 3GUTB 4PRNB 5I71C 2VITA 3QXVA 1E4KA 3FTGA 3H0TB 1CF8H 1T80A 4UBDD 4ZTPL 2BVEA 4EI5D 1OAQH 1S9VA 3UTSB 2HT4C 5GRVL 3BMWA 5CIPA 5E2TH 1NMAL 4YBQD 4KJWC 3W39A 1ETZA 3TIEB 1G84A 1I1YB 3IETA 5SWSE 1EGJH 1IGFL 3KHQA 1FVCA 3BPLB 3LEVH 3VFRB 1EEUA 5FKAA 5JIHA 1JV5B 4N8VG 5H8DA 5K9OA 5FF6A 5D5MA 5T1DH 3WFCL 2XN9B 3N0PB 4Z7QF 5EWIL 3PWLB 1T1YB 2B4CC 3K8LA 4HWZA 4P2RD 3LN9A 1JRHL 3MJ9H 4Y5VA 4O5LH 1EFXB 1RZ7L 3PL6C 2YMXL 3PXHA 1MCBA 3KNBA 4PJHE 4OZFA 4GKSB 2NY3D 3GJEB 4ZFFB 2XY2A 4CJ1A 4QTIL 1C08A 1FBIH 2EDBA 3BUYB 3P4MA 2ENYA 1N6UA 3F7YA 3EGSA 1BZ9A 2R4SL 3TH2T 4KI5F 1EAPB 2X1QA 2ADJA 1ZTXL 2HAZA 3QIUA 2DLFL 2BSSA 5C0BB 3ISWA 2AJSL 2X2YA 4X6FA 3GMMA 1F4XL 2NY6B 4X5XB 4DW2H 1CIUA 3V6FA 3QQ3A 2NY2B 2FJGA 4Q9QH 2CUIA 2XICA 3U7YH 2A9NH 3TYGH 4ZO6A 2DQGL 4PGDA 1LNUB 3IFPA 2FIRT 4MAYA 5B38G 2YRZA 1J1OH 4PGBB 1NCBH 3VGBA 5AG9A 5IFJA 1CDGA 4KROD 2UWEE 3GSNA 3VXQB 1CL7I 1IC7L 3P9MB 1HYRC 4M1GH 3KYMB 4KQ3L 2FH6A 4OD1H 4LKXB 1WTLA 3HZKA 3OQ3B 3HUJB 3V7AE 3ROLB 4OT1H 3RHWF 4JPVL 1OGTB 3GO1H 3D39E 3FCTB 1DDHB 3BDBA 2BY1A 3RU8L 3C5SA 3C6LC 3D39D 4XNXL 1OSZB 1OSPH 3OGCA 5FM5O 5KTEL 4ZAKD 4ZG1A 4AG4L 4HW6A 3MREA 4AQOA 3LKNB 3MRQA 4NRZB 3GEWB 4PJ5A 4X80L 1OGAB 2YA1A 4LPXA 4FFWD 3EDFA 2D9CA 3U30C 4H26A 5GGTA 3T4AA 4YFDB 4WTXA 5HHOE 2ZCKH 1A6AA 3MJ7B 1X9QA 5HHOD 1ZKAA 1MFAL 4OD3H 1Q94B 3M17A 4UU9A 4GMTH 4UIMB 1OAQL 4UOW1 3S88H 3FT2B 2VN7A 1OD7A 4MQXC 4D8PA 1INQB 3U0PA 3WEXA 4HUMB 5KVMC 1S78C 1YEHL 2HFFA 4PJ7B 5KVEL 2MKLC 1D5BA 2B0SH 1EGJL 2RB8A 3CFDB 5DJYB 1XCTB 3B9AA 4KZEH 4UUJA 1CR9L 2D4DA 4WV1C 2VTFA 1S8DB 3S3SA 1F3RB 1CL7L 4R4FL 1UB6A 3MTRA 5HYSB 1B3JA 3HPLB 5L7XL 1T66D 3C2SA 1AO7E 3SE3C 3EDDA 1AO7D 1IGTB 3RHWK 4P2QA 2AXFB 4MDJB 4PJBB 4RDQG 4CNIB 5IBLC 2Z92B 5L2JB 1WF5A 5JHDB 3ULUE 2ZNXA 3CMOL 1S5HA 2PTTB 3B9KC 4ZUUA 5EULV 5GSVA 1U95B 2P24B 4FP8H 1AC6A 4NFDA 5DD1L 3C9NA 3E8UL 2XTLA 2AXGB 1D7FA 1KOAA 2YPLE 5DTFB 3VG0H 3DUSA 5F6HI 1DSFL 3FQTB 4OLVL 5C0JB 4N9GB 3HG1E 1FGNL 3L6FA 4I48B 1X44A 5D1XB 2ATPB 1T5WB 3QJHB 5LBSH 3TZVD 4QXWA 3W9EA 5KJRL 3Q3GB 4N8PA 4XI5D 4YHPA 4G8GA 1IC5L 2AAVA 4NZRL 4XCFH 4X7DC 2IPUG 1II4E 2DYPB 3GJFK 3AMKA 4OI9A 2ED7A 5H37G 2HFGH 2VDRH 1C7TA 3E6FA 1BX2B 1A5FL 1MWAB 3S6CA 4LCUB 1HQRA 3S7GA 4U6XB 1P7HL 2ICWJ 5DRXB 4W6YB 1D6VH 4LU5L 5GJSL 3OKDB 4MB3A 4M5ZH 1VHPA 4XVJL 2K7PA 1NBZB 4L4VD 4L8BA 1I7TA 5GS0L 4RGMC 5CBAB 1T2JA 3L7EA 2VNCA 2W0LA 2R15A 4XB7A 4K71C 1AE6L 3G6JE 3BEVB 1GGYA 1HHIA 2IALA 1KB9K 3JV0A 4IM8A 4HF5L 1RUPL 1A7RH 5DJZA 1DTUA 2FYYA 1LO3H 1LP9E 4FTVB 4ZUVA 5DQDH 4LAQL 5I1JL 4RIRB 4HS6B 1QACA 3QIBA 3TYFB 2P8PB 4YXKL 4WI8A 3C6SB 2VH5L 4Y2DC 2BSRB 3KPRB 2NY7L 3D25B 3ARFB 1IEHA 2BNRD 3PG2A 5EORL 1BBJB 3IU3A 4NWUL 5FYKH 1D5MA 3MNVB 3MV8D 4YJZL 2WWKO 4OQTA 5FYKU 1QSVA 2NY3B 2Y36H 1KPUA 3LDBB 2G75B 4G8EB 3JSSA 2EXWC 4UT6H 5KS9A 4XP9H 4YX2H 1IGML 1IEBA 4H25A 4TNVF 3NCFB 2VN4A 2AJYL 4JVWA 5A3IC 3ARXA 4XC3L 5DT1L 3SDXE 1RZIA 4Z0BL 5A2KH 3FONA 5K9JL 1YJDH 1BBDH 1A64A 1KTKE 3H9HA 3QHZH 4ENED 1NAMB 5IMOA 5KSUA 2ZG3A 5MP6H 4CMMB 4NUGH 2HTKD 5IMMA 2IPTL 2VLJE 5C0RH 4U1IA 2F54E 4PG2A 3FTGB 4NO3A 1MQ8A 5I18L 4WO4B 1I9RH 2ZCLH 3T65B 4NRXB 2AK1H 4WJ5A 3PGCA 1S9VB 1N3NA 4ZOBA 4TRPH 3H8NA 5D1QD 3ULVD 2VWEC 3L5HA 2VDPL 2VZUA 1T03L 1AFVH 1YEEH 1T5XA 1ETZB 2Z35A 4TUKH 5HDBE 5HGGS 3IETB 5EZOH 1KJ2A 3KWWA 4K94H 2ZUQB 3K8MA 4KRPD 5FKAB 2F5BL 2G5RA 1S7TA 4HX1A 5E24E 1A4KA 5D5MB 3BEWA 5FF6B 4P59H 5E1AA 3W9DA 4JVPA 4XXDA 3F12A 1MFBH 4GUPA 5FHBH 1JGVH 2VE6A 5ETUB 4M4RA 5TDOA 4XCCH 1YEGL 4Y5VB 2QBWA 2GCYB 1DFBH 2JJTA 5IG7A 3KNBB 2D7QA 2VXSL 1OW0A 4OZFB 1QPPA 4V1DA 4GMSL 3MV9D 1D6VL 1C08B 1A21A 1JNHB 3TFKC 1MHPH 2PCPA 3P4MB 3FJTA 5A2FA 2GK2A 2PW1A 3F7YB 3EGSB 4F9LA 4YHLH 3HCVA 1MQKH 2OTWA 2P8LA 1BZ9B 4YIQA 2BZDA 3U4BL 3STBA 2ADJB 3SDAD 1H15A 1HKLL 2BSSB 4GRWF 5TE7L 1NSNL 3HRPA 2BVPA 2KQMA 3GMMB 2IGFL 1BZ7A 3QQ3B 4KUCD 3QB7C 5IR1A 1NLDL 3I84A 4J8RB 2VXTH 2FJGB 4FQLL 4PGDB 3IFPB 4EKXA 3GSQA 4MAYB 1F6FB 1LO4H 3CXHK 3G5XA 3RVXC 2AJ3A 1C5CH 2A6DA 1AXIB 3RFZC 3MRPA 3UC0H 4NNYB 3G9VA 4YE4H 4EXPX 1AXTH 4KC3B 3VXMA 2HH0H 2GAZB 3RL1A 3NMEA 3TJEL 3QNYA 4BK4A 1S9YA 5KSBF 5D1ZA 2IH1A 2IAMC 1BVKA 4A2MA 3CFKB 1GC1C 1OQOA 4QOKE 3QUKA 1WV7T 1X7QA 4QOKD 3C5SB 1IL1B 4QXGH 2V7HB 3CNKA 4H5SB 3QQ4A 1S5IH 3OGCB 2YUWA 1CFQA 4NN7B 4R0LC 1F3DJ 5IQ9A 2FX7H 1T6WA 4KJPD 1PVHA 1YJDL 1BBDL 5C0AE 3MREB 4Z7NE 2VDQH 4NQVA 4FQXC 3ORJA 3MRQB 5INCA 4PJ5B 4JRYE 3O11A 4JRYD 1RULL 2EYSB 1HSBA 3FO1A 4NZUL 4LOUD 4H26B 2DMBA 4LDLB 5LQBH 1A6AB 4OFIA 1UJ3C 5SX4H 3BGMA 2BRQA 1B0RB 2ZCLL 3M17B 5H35B 7FABL 3RA7L 3DGGA 4RMWA 3HE6B 3OAYK 2DQIH 1DBMH 3T4YB 3OPZH 3MRLA 1RSFA 5E94A 4AMKL 5DSCB 5D7LA 4R2GD 3WEXB 5JQHC 1TQBB 2AQ2A 1IQWH 2HFFB 1D5BB 3WXVL 1BIHA 5BZDA 3QQ9C 5C70A 3VGFA 4UUJB 5D2LF 2MKWA 2O5YH 4IRZH 4RGOH 3SDDA 3EJZD 3HHRB 1CLZL 3NIFF 2VKWA 4PGEB 3EOBA 4W6WB 4JHWH 4C83A 2UUDH 3OB8A 1JVKA 5TE4H 1DFBL 1V3LA 1NUFA 4FG6D 2C1PA 2BVYA 3B2UC 3F7RA 3PWNA 2VXQH 1BVLA 3S96A 3ARBA 3TBSB 1N7MH 3T3MF 4FQCL 5AAWA 2ZZUT 2V5SA 1D9KA 4WVRA 5DRNA 4E5XA 4UTBH 5CCKH 2HG5A 4G5ZH 5FIEA 4YHLL 1MAJA 4S1QL 1A7QL 4TTDD 2O26U 4KMQA 2ICEA 3OR7B 4DVRL 4LIQH 2OS7A 3LS4L 4P3CL 4JJHA 3SE8H 5E9DD 3V7AG 1ZANL 4QHLA 4BZ1H 4F7EB 2NMSA 5CZVH 4F3FB 3DUSB 4UAOB 5IM7A 3BP7A 1SY6H 4KI5C 5I6XC 4PGZA 2VXTL 3MSPA 1FFNA 2Z31A 2HRLA 4POZC 2F5AL 3L6FB 2B4CL 2E7HA 5F1NB 2C7UA 4K7PX 2A1WH 2YC1A 4OF3A 2WIIA 4AM0B 4QY8A 3RVTD 4L3ED 3X12B 4FFYL 4Z7VA 4M8QA 3UC0L 1FSKB 4YHPB 3P40A 5EO9B 4G8GB 4PRPD 4H88H 1VCAA 1FL3A 3W0WD 4XCNB 4WY7H 5SX5K 1I3VA 4JVUA 2YSSB 4HULB 3QZWB 4Z7OF 3OR6A 1P6AB 5IVXE 1VENA 2WQ8A 1DANT 1HQRB 1TJIL 2COQA 1S9XA 4NPYB 1NGYA 2ZCHH 4HQQL 4MA3B 1HZHH 1QEWB 2ZOLA 5CJBA 3QDMA 1RIUL 3K2UH 4PJ9C 5JW5A 3K4ZA 2DLIA 1XGQA 4IDJH 4ZPTA 4M93C 4ZFGL 3OKYA 15C8L 2VDQL 3T0BA 5KVGL 5DWUH 3NCJL 4L8BB 1I7TB 4H0IA 2HT3C 3HC0A 3HMXL 1CZ8H 2MQ0A 3L7EB 2IG2L 4HKZA 2NY0D 1W72H 4OV6F 3N1GC 5KBNC 3TV3H 3MZGB 2J8UF 3VGGA 3KJ4B 5AWNL 4XHJC 3MRJA 2PO6A 3P30H 3I6GA 4WW2A 1ZGLP 5A40E 4P23D 4I0KA 1UC6A 3SCMD 2VDOH 5CMAA 3BIKB 3QIBB 5J9PA 1R6VA 5FB8A 1KJVA 4XBEH 1YECL 5FA4A 4OF6A 3WLBA 2YN3A 1EK3A 2G2RA 4F37F 2ORBL 4HBCH 3IU3B 2GITA 1CXHA 4IRZL 1X5JA 5F6HJ 1MCPL 1KJMB 3MLXH 1XR9A 2EYTB 4Q2ZA 1KPUB 4B41A 1MJJA 3MRHA 4IMKC 3KVQA 3P4OA 3REWB 1F3JB 4BA8A 3O8XA 1IEBB 1A14H 3NCBB 5FDWA 3SY0B 3TBWA 2F53A 1QKZL 1RZIB 3FONB 1HCFX 2FD6L 4DOHB 5ESVA 3H9HB 4W6XB 2JCCE 4WWKC 8CGTA 3WSQL 5IMOB 5KSUB 3FRUB 3NA9L 4NO0D 4WI2A 2IQ9L 2E9BA 4UT9L 3SDCD 3QXAB 2R23A 1CGSH 2Z91A 3QFJD 1DQDL 4U1IB 4LIQL 4X0KB 5DHVH 5GGVL 4YHNA 1S7XA 3A6BL 4IBLT 2XY1A 4NO3B 1M71B 4CVXA 2KKQA 4QRPB 1CE1L 4I9WE 3PGCB 1B0WA 3PWPB 1N3NB 4XZUB 1QP1A 4I9WD 1OARH 4L29A 3MMEA 5IFAH 2QADB 4I0PD 4GRLB 1YDPA 5DUBA 3CVHH 2OMNA 3OKMA 5IROA 4MZ2A 1IJ9A 2Z35B 5K9KA 1KJ2B 2A9ML 1KT2B 4DUVA 3VWJA 4CVWA 1JZ8A 4NRYA 1XF3A 4LHUB 4Y5XA 1S7TB 4HX1B 1AIFB 1A4KB 4OBRA 3BEWB 1HOCA 4WY7L 3W9DB 4XXDB 4ZOAA 3F12B 4S2SB 2DKUA 4P4KC 2P5EB 2B1HH 3K74B 2Y25A 4GFTB 4NGHL 1AY1H 5IG7B 4M43H 4A6YB 4KPHH 4YFLF 2J5LB 5C71A 4V1DB 4MVBC 5HGHA 3D9AL 3ZT6A 2ZCHL 4RX4D 2PCPB 5I1EL 4MS8D 5DJDA 5E4EB 1HZHL 2IADB 5DEFA 3HCVB 2ADIA 4Z8FH 2P8LB 4YIQB 1HIML 2DDQL 3BQUC 2GW5A 1LEGA 4G7YL 1H15B 4O2EB 3NBNA 2DWEA 5IB1A 1MFEH 1FLTX 4FOMA 3SJVB 3PP4L 4PBWD 4PREB 5IR1B 4F8QA 1V05A 1DLHA 4LSDA 4ALAL 5FGCB 3AGVA 2Q3ZA 4HS3A 3GSQB 4MJIA 5HDLA 4PJAB 3U46A 2AJ3B 3U2SB 2A6DB 2FBJL 1VGEH 4JHAH 2VRAA 3G5ZB 3MLTB 3KHOA 3MRPB 5CGYD 3O4LA 4MQSB 3V4VH 1NFDA 1QG3A 4XXCC 1OCWL 1XIWA 2UZXB 2E27H 5KSAD 3N1QC 3HUJF 4HIXH 3QNYB 1ZAGA 1CFNB 4KZDH 1S9YB 2ICCA 4JHBA 5D1ZB 1JK8A 2MWCA 1BJ1J 4RBPK 1QRNE 4EBQH 3QUKB 3MACL 4OCLC 4HWBH 1NBVH 2AI0H 1OAUL 3QQ4B 2H41A 4P4RA 3VMNA 3LKPB 5E2JA 1CFQB 5EU4B 5GGUA 5IESL 1KCVH 5IQ9B 1UM4L 5EBLA 2YPVH 5EIIB 5FECB 4GKNA 5INCB 2XT1B 3ZKND 4N0YH 4C59B 1UH2A 1EEYA 2W9DL 3RX5A 3FO1B 1FYTE 4JZNB 3ETBF 1FYTD 2JE8A 5KZCB 1MCFA 2OLDA 2CO6B 2AV7B 1XGRA 3C5JA 3CH8A 3BGMB 1HHJA 1ADQL 1A6UH 2H26A 5DURD 2YD1A 4L3EB 4OGXH 5TE6L 3MRLB 3RDTC 4KWUA 2JK5B 3BOVA 5SV4A 2NZ9D 4P9HH 3VCLA 3I2CH 5D7LB 1P9MC 4PJ7F 3Q5OA 2Y06H 1U92B 3C09B 3CVHL 3QFDB 4MLIA 5F96H 2MMXA 3DYMA 3ZZ1A 5ISZD 1ZT7A 1OL0A 3NOIA 4U1KA 5A2LH 1JHKH 3LEYL 3STZB 5F89A 3O45A 1MLCA 2PUQT 4I18C 1IARB 4C83B 2J1KA 2X89D 3VD7A 1YMHB 5D72H 5HGDA 1KF9B 2WUCH 1AY1L 1S7QA 2FGWH 1Z0NA 3PABA 3PWNB 4ZXBA 1CFBA 3S96B 2XZZA 3H7LA 4JANA 4L9DA 4TULH 3U1SL 4TVPH 2P4AB 1T0NA 3OAUH 1KCRL 1D9KB 5T3ZH 1FFQA 2RJMA 4OCRH 5DRNB 4E5XB 2NY0B 1G7MB 2Z8WC 3O6FC 2AEIT 4G43A 1KFAH 5I30L 1D5ZA 3RPKA 2ICEB 2LTQB 5DD3H 2BCKB 2CRZA 4NZTL 5ELIA 5HVWA 4YHYB 2XWJA 3IDXH 4P23B 2UVEA 4ZFOA 3SCMB 1BVZA 5EU6E 4RFNB 4U6HB 3WIHH 2AJVL 5IB3A 5EU6D 5CJ5A 3GSRA 4JFPA 4FQQA 2Z31B 3B5TA 4HHAB 1MIEL 3KLAA 3OJVC 4M1CC 2HRPH 2C7UB 2EXYC 3QCTL 1DQLL 2YC1B 2WIIB 4DN4L 4Z7WB 1MY5A 1YQVH 5FUCC 3U79A 4IIQA 3GMPA 4Z7VB 4N8VB 3SGJA 5MENA 4M62L 4XTRD 3JWOH 3WMSA 1FL3B 4MGXA 4IOFC 3ECBA 2QHRL 5JTWA 3NCEB 1WC7A 2DWDA 3WS6C 4OCWL 4JDVA 4AT6B 1BPVA 5TGBB 1AKJD 1J0IA 3F62A 4X7SL 3Q5TA 1FO0H 2I25N 2EDJA 3DXAE 3SDCB 5DO2C 1CDJA 1NGYB 3EYOA 1CBVL 2HKHH 2ZOLB 1KUMA 5JW5B 4Y0GA 4RGNE 4ZPTB 3GBNL 4RGND 4UT7L 3RUGE 3PV6A 3NFPA 4XC1H 1MLBA 4JG1L 5FM8A 5TQ0L 3HC0B 3I3EA 1U42A 4N5UA 4N0YL 3B3IB 1OLLA 3VXNA 4HKZB 1OLZA 2VZ1A 2EC9U 4RCAA 5BVJA 4KGLA 5GS3A 1LEKA 4DGIL 5CEZH 4EZMA 2BVTA 4S1RL 5T1LA 1R3HB 3LIZH 4I0PB 2NX5D 5I8EA 2HN7A 3BXNA 1J1PL 2PO6B 3MLUL 2OK0H 5CJOL 5B38B 4OGYH 4OGXL 4N0CD 1MNUH 2E6QA 4U1GB 5EUOB 4B7IA 2FSEB 1IGCL 3MXWH 5CMAB 5J9PB 1H3PH 1BJMA 4OB5H 3KPOA 1KJVB 5DK3A 4L9LB 3WLBB 1IM9A 1RJYA 4KK9C 1XZ0A 2G2RB 4PY7A 5LCVH 1QFOA 4UV4L 4ZUTA 2GITB 4NO5B 5CP7B 1XR9B 2XZCH 3UPRA 1MJJB 4HIEA 3UROR 1I8MB 2C3HA 3MRHB 3P4OB 4PJXE 4OQ1A 4G80A 3O8XB 3ARGC 5BV7H 4LPCA 2FGWL 5SWSA 4JFDE 4WUKH 3TBWB 2F53B 4I77L 1BAFH 1LO0H 1VFUA 5JHLH 1KN4L 4XPGH 5ESVB 1NDGA 1P1ZA 3ARDD 2HT2C 3WN5C 4I1NB 3T1FA 4KMLB 3BJLA 4HFUH 1ZWIA 3SQOL 3HE7D 3QG6A 4QCIA 2Z91B 1MIML 3W2DL 1IRAY 5DEGB 4OBSA 3R06A 3QUZA 5GSRA 1G9NL 4JN2A 1PKOA 3MV11 4YHNB 1S7XB 3T0EE 4PJHA 1QRKA 4IRSD 4D9RD 3VFWB 1CD1A 5BMFH 3QO0A 3S8WA 2OCFD 2CDFB 2AJXH 4PV9A 2H32A 3GJFH 4GAYB 3NPSB 5D2NE 4HWEH 2XWTA 3L5JA 1YDPB 1RZJC 3V5KA 4FQ2H 3OGOE 4NQEE 5DUBB 3OKMB 1UJTA 1WZLA 5K9KB 3AXLB 3E0GA 4JJ5B 4XPHL 1YEKL 1NEZG 5F3HB 4NRYB 1QFUL 5D5MF 3VD5A 1PG7H 4NN5C 5GRUH 4HC1H 4Y5XB 3JWOL 1H3GA 4KVCL 3EYQC 4KTDH 3EO1B 4CDHA 5GQBA 3KYKH 3BW9B 3GRWL 5CD3A 4XWGL 4YXLL 2AP2A 4HUXB 5HHME 5D7IE 2Q8BH 1HDMA 2X4SA 1IKFH 4MA7L 5IEHA 3TBVB 2NXYC 1JYXA 1TZGH 5DHYA 4XPFL 2FHBA 2UWEA 5CEXA 1U8IA 5KW9H 3TA3A 5J4MA 2ADIB 3KPMA 5FO8A 3BPNC 4JKKA 4QXUH 1WGOA 1JNJA 1JGLH 2DWEB 3CLFL 1J8HE 2AEQL 2YK1H 5IB1B 3AREA 3W82A 1CICA 1J8HD 3QPXH 2B2XH 2ZWLT 4OZ4B 4X4XA 4ZAKA 1U6AH 2WZPD 4G7VH 5E8DH 3S97C 1DLHB 3I75A 2DS4A 1CIDA 2J6EL 1FZJB 5DDHB 4G9DB 5K59E 3MJ6A 4MJIB 5C8JB 5IV2A 5ISZB 4JFEB 4LRIC 3U46B 4ELMB 4LP5A 3HTLX 2FHFA 4JKLA 3O4LB 1NFDB 5HHOA 2AVGA 5DMYA 1RZ8A 1U58A 1A7OL 3GM0A 1MJ7L 4LSSH 1XIWB 2DBLL 3LKRA 3IJSB 3BSZL 1JK8B 4JO1L 4ODVL 3TLRA 2XZCL 4JY6B 1RMFH 1OAXH 4P49A 1VEPA 5FV2A 2QR0A 5I19H 2W60B 1YEIH 4P4RB 2ZNWA 3X11A 2OXGA 1PZUB 2EKSA 1BAFL 3N9GL 5B22A 5EBLB 5JHLL 1F4YL 1I4FA 4JDTH 4PTTA 2GTWA 4GKNB 2CXGA 3BE1L 5HY9A 4XMLH 3GHBH 1FZKA 1MPAH 2CKBH 4PBVC 1FNGB 5T3XH 4JZOA 2X44D 3OKLA 1A7BA 1L7TH 5DD0H 1HN1A 3KXFE 4G6JH 1XGRB 3C5JB 1AO7A 5C6WH 4QRUA 1HHJB 2Z8VC 2LE9A 4ONFL 2VXUH 4LKCA 1SJHA 5F9JA 2AJXL 2AXHA 4XPTH 3VCLB 3VU2A 4MDIA 2R1XA 1P5UA 5ICZB 4CN6A 5I1DB 4ZFZA 2C1OB 3FB8B 2OMBA 1BOYA 4UV7L 2X4UB 3PGFH 2NYYC 5ALCH 2YPLA 3BPOB 4U1KB 1O7VA 3RWEA 3V6OC 2DM3A 4RA3A 5F89B 2F8VA 2R4RH 4KTDL 1IKNC 1NC4A 4WUUD 1MLCB 2EDDA 3HG1A 3U7AA 3QRGH 1EAJA 5EO0A 1AR1D 5HGDB 5D96B 1WIUA 4KKLD 1S7QB 3OX8B 3TZVA 1QLRA 1A3QA 2JF1A 2BXZA 3UYPA 5F7UA 5LXGH 4JANB 3OJDA 1T0NB 2H3NA 3NACH 3BKJL 1GJIA 3E3QE 3RIFF 4G43B 5JMRA 2GSGA 1D5ZB 3CPLA 4K23L 4CMHC 1K6QH 4PJ8A 1AJ7H 5L6YL 1AP2A 4HKJB 4KY1H 1JNNH 2QV2A 2C3XA 2XWJB 1U3HC 2FCBA