4ONFL

Fab fragment of 3d6 in complex with amyloid beta 1-7
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
218
structure length
218
Chain Sequence
YVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRIEAEDLGLYYCWQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3D6 FAB ANTIBODY HEAVY CHAIN
publication title Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 54
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4onfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4onfL01
4O4YL 4KHTH 2AEPH 1QBMH 4BFIB 2W0FA 4JN1L 5D6CB 3C60B 4X8JA 1P5UA 5ECJE 1QBAA 3STLA 4HC1L 5IB4B 1S7XB 2UWEE 1CLYH 2BRRL 2WP3T 3C6LC 2OR9H 4HIXH 3KXFA 5SX4I 43C9A 2AXGA 4HT1L 1A64A 2VDNL 1E0OB 5JZ7D 5HGDB 1PAMA 1OB1A 4MWFA 5DJZA 1TJIL 5I1LB 1NMCB 4A6YH 5FCUH 3F65A 5DQDH 1Z5LA 4K2UH 5IVXA 5FOBB 1XF2B 3C5SA 3BP4A 4S1QL 2AKRB 1BIIB 2GK2A 5I1CL 3HC0A 3QULB 1KFAH 3CCHB 4RAUA 2VISB 1T4KB 2CPCA 4LHUB 4K3DL 4R97B 4Z77A 3NH7L 3SGKC 2R29H 1K4DB 3CC5B 4XP6L 2XV6B 3QSKB 4GRLD 4GKZB 4X6DB 1NAKL 3DXAD 4HEME 5ANMA 5D96B 3UTSA 4HKZA 4TTGA 4U4BA 4KK5D 1FYHB 3G04A 3NZHL 5E2VL 3WS6C 3P73B 2XZCH 2SEBA 1IM9D 3IDGA 4WFHD 5C08B 4HJ0D 5C9JB 5KANG 5IMLB 2DOCA 2DQCH 3CFEA 2Y06L 2OZ4L 1P4BL 3ZKMC 5KZCD 1LNUB 1RURH 4G7VL 5IVZB 4F9PC 1R5VB 3PWPD 4APQA 4Y5YA 2R1XB 4AMKL 4EI6A 3P11H 4GRLC 4OCLC 2OTUA 1Q94A 4PGCA 3OV6A 4A6YB 4BA8A 4GAJH 1YN7B 4KK5C 5SWQA 3SGJA 4J3VA 2GJ6B 3BDYH 3QDJA 4WUUE 5IV2B 4FZ8H 2Q87A 5LXGH 1T04B 3E1F1 2ARJB 2R39A 4HJ0C 1T5WB 3HI5H 1LEGB 4PUBH 4ZPVA 1I9RH 1IC7L 1EUTA 4NKOA 3TA3B 3BT2H 4UV7H 3D69A 4P9MH 5C0JA 2W91A 4PREA 2J5LC 3GI8L 3GHEH 4JFZL 2V5YA 4EEEA 4XAKD 3LMJH 3EFDL 5D7SH 2BY3A 1A5FL 4HWEL 1P9MC 3IDUA 1WJ3A 5DJ2B 2BSED 4B53A 3BAEL 5JUEH 4I0PD 4ORGA 4NNYB 3RL1B 4IRSA 4MA8H 1ADQA 2F19H 3ULSB 4P23D 4ELMB 5DF0A 1FAIH 3LEXB 4DN4H 2JB6A 5KS9E 3JTTA 1X5KA 3NFNA 5EO9A 4TTDD 1C7SA 3V8CA 3CAFA 3I02A 3KYAA 1J10A 3VXTB 2H6PB 1EO8H 1CDBA 4WWKC 1QSED 2X4NB 5MEPB 3AS0A 3MLZH 1YNKH 3G6AA 5ETUB 3VXNB 1RUMH 2PO6A 4OF8A 1FLRL 1ZT1B 4S2SB 3MRQB 4HFWA 3QH3A 4XMPH 1CR9L 3HR5A 2EE3A 1Q8MA 4NQDE 1MIMH 5J13B 1UB6A 4R2GD 5AYUL 3OHXA 2WQ8A 4GQ9L 4XNUL 12E8L 3AXLA 3F6LA 2NY4C 3IGAA 5J6HA 4KXZH 1ZLSH 2OL3A 1YEGL 4MCZA 2AJ3B 3MV7E 3TWCL 1UXWB 3OPZL 3ARDD 3WFZA 3DX6A 2X4SB 1YYLH 3O11B 3RU8L 1EA9C 3MFGB 5CJXC 1ZT7B 1UKSA 2MPAH 2HKFH 4IBLT 5FO9B 1D3CA 4POZC 3O6MH 3OKKA 4HUWB 1QRNA 2AJUL 2P1YA 3FFCD 3I6LE 3SO3C 4E41A 1FG2A 3PNWA 2NY0B 4W68A 3LIZL 4JO1L 1F58L 4P2RE 5ESVA 1AIFA 3NN8A 3ECBB 3S4SG 4JFEE 1NCBH 3EYSH 2A77L 4UI2A 1XFPA 3ARDC 2FHBA 2JCCF 4FFYH 4X6EB 6FABH 4GXVH 5E8EB 4Z78B 3QXUA 3TV3H 1B0GA 1FIEA 4PY7B 4H20L 5HBBA 3KJ6H 5CUSH 1R5WA 4ZSOB 4Y16C 3F6IA 4P2QB 4Y5XB 5CFHA 3TBSB 4LASL 3IDMB 5JHDD 4JQVA 3RL2B 1WC7A 5FHAH 3HNSH 4JQIL 2XZAH 5DSCB 4Z7VB 4LOUD 3KHQA 4D3CL 2R0ZH 4F7MB 2OCFD 1JPSH 1L4IA 3KYKL 3GK8H 5GRXG 5H2BA 5T3ZL 3I75A 4C83B 5D7KD 2RHEA 5IMOB 2DMKA 5CD5C 1A4KA 1JRHI 1TZIA 4ZOBA 5MP6L 3FT2A 5K33A 4ODVH 3MCKA 5BCAA 1OGAA 1DUYA 3P0YL 1MCWM 4HZLB 4UDUB 4M1GL 1MQKH 3D1MC 2JB5L 4KDTA 5FXCH 1MHPL 2QL1A 4MQXC 4HUVA 4NIKB 4X7SL 3WJJA 4JVPA 4LOUC 4XZUB 2BCKB 4ZTPH 1NANI 1P5VA 1INEL 2BVTA 3R06A 5E03A 1VPOL 1RZJH 5D7LD 1T6WA 1CFBA 5C0BB 5T5NF 1XR8B 2BERA 1LE9A 2VTFA 2XN9E 2BVYA 4NWTH 1MCPL 4NHUB 3BZ4A 2NMSA 1FYTB 3TBTA 3I9GH 1J9CT 4DZBB 4GKOA 1HIML 3MBED 3EZ8A 2PKDA 3VXRE 1F11A 1QFWH 1XR9B 2NR6C 2VDLH 3MO1A 4MCYA 3TO4B 3VMPA 1YJDL 4LLDB 3S4SB 2I5YL 7CGTA 5DEGB 4NUJB 2YEZB 4MNQD 5JPNB 2C4XA 4UT6H 3DYOA 2V5TA 4BQBA 1OARL 3ZYIA 5TQ0L 3FRUB 3UTQB 4CAGA 5JQ6H 3IDIB 3GSVA 4MHHI 1QFWM 2YD3A 3MJ9H 1H0DA 4RA3A 1R3HA 4LSSL 4U2YA 2J4WL 1FZKA 4X7TB 3MBEC 5ENWB 4LVNC 3SE3C 1A6ZB 1U95B 1ERNA 3U4EA 3CFBB 2GUOB 5D7IF 1KCSH 5C0EA 4HKBB 3BE1L 1JZ7A 2GAZB 4N0YH 5DUML 4LSQL 4XBPA 1RULL 4W81A 2ARWA 1HHGB 3CMGA 3P30L 4JFFA 3DNKA 5BS0E 4UINH 5J6GA 3TNMB 2CIKA 5KSUB 2MOVA 3ARVA 1PYWB 4RWYH 1HNGA 2A6DA 2PTTA 2B39A 3JVGC 1FL5A 2NYYC 4FN0A 1Q0YL 3HG1D 1JPFB 3BSZL 1RFDH 3BPNC 4MYWB 2O5YL 4XBGA 1A47A 2CK2A 2H2SC 2OJEA 3MRPA 5E1AB 4Z6AT 4ZUUB 1FQ9C 1JMZA 1XT5A 1P7KB 1NGQL 5GS0H 3P4OA 3L95A 1MHEA 1F4YH 3LQZA 2YZ8A 3GIZH 1FZMA 4N5ED 2GTWA 3B6SA 3IU4H 2F53E 3QWQB 1JZ8A 4ZODA 3ZT5A 2AS5M 4HLJA 1RIVH 2C3VA 2W0KA 4AH2B 3CFKB 1HN1A 2D0GA 3L3OB 4FZEL 4G43A 5I16A 3EYUL 4PB9H 4ZUTA 5MEOA 3SGEI 2EH8H 5EOCJ 2OLDA 2EO1A 2IBZY 3QUMB 3T0ED 4XX1E 2DYPA 3BGFB 5AG8A 4N5EC 5CKGA 4J3OC 3O3BA 4LGSB 1UCBL 4Z7WB 4PJCE 2NY2C 5MERB 1FRGL 5DJCB 3LZFL 4KFZC 3W5NA 3HAEA 5SV4A 4XNYH 4M62H 2ITCB 4NM8H 1F2XK 4TNVF 2E7MA 2ESVA 2I9TA 1EIBA 3T2NH 3PDOB 4X9FA 3QJHB 4KJPC 1DTUA 4RFOH 5IKCA 5D7IB 1BGXH 3VXPB 2NTFB 1QLEH 3V7AG 2R1YA 3GB7B 2VQ1B 3IS1X 4XPTH 1CVSC 2NY7H 3EDKA 1BQSA 2FBJL 4MXQC 2QQNL 5ERWB 3UBXA 2XWJB 5FYKU 5HJ3A 1TNNA 3I85A 4YQXH 4D0DB 5D2LE 1VCAA 3QEUA 4O51A 1MCNA 3BPOB 1EGJH 1LDPL 3LHPH 3X3FL 5L2KE 1MCCA 1P2CA 2WINB 3PABB 4G8IA 4TYUA 3RVWD 5C0IB 3KLSA 4M7KL 3MZGB 5LAXA 4BFBD 4KMLB 3N85H 1MLCB 3RGVD 4AT6B 1KJ2H 4PGEA 2QQQA 4YAQB 1S9WB 4LLYA 1NJ9A 2P5ED 3D2UD 4PRHD 4X5WB 1MFCH 1MFAL 1TETL 3AFLA 4NQEA 3SKUD 1KPUA 4PGJA 3S34H 2X70A 5TJWK 1JI1A 2Z0BA 1YPZE 4AYFA 1CK0L 1FDLH 1A3LL 5EIIA 1J11A 3TIEB 2A74A 2IALA 3RVWC 4KZDH 5IG7A 1B4JL 2BVPA 2P5WD 3G5XA 3QQ9C 1LK3L 2GFBB 3RGVC 4OIIL 5EZJB 1RSFA 2NNAA 3SJVA 2A0LD 4WY7L 4NQUA 4YBQD 3QXWA 4YXLH 3K2UL 3G5VB 4YHIA 1R5IA 3FB6A 3ROOA 3MREB 3AGVA 5GIRB 3VWKB 2BSTB 1A22B 2ZWLT 3VWJC 2V7NA 4Z5RA 1FORH 2J6EH 4JKPH 4L9LB 1CLOL 4ERSL 4NGHL 4Z7NE 2APVA 4HW6A 1KJ2B 4ZUWA 1DCLA 3JXAA 4IIQB 1TQCB 1W72L 4P5TD 5DZNA 1XGQA 2XOTA 3KYMB 4JDVB 4MDIB 1XF3A 4HH9B 3KXFD 3L7FB 3MODH 4XPFH 5T1LB 4JREB 2X4QB 4YBQC 3MACL 4HDIB 1K6QH 1A6WH 2Z91B 5KVMC 4JRYB 2R8SL 2VLRB 4JKWA 1CFQB 2DICA 1UWGH 1FH5H 2W9EH 4X4YA 5ALBL 2W59A 1MEXH 2OS7A 2EDXA 3EJYD 4JCLA 5ICYB 1QFUL 1S8DB 4P5TC 2GYSA 4FQJL 3BD5A 4Y1AE 3O81A 2YD7A 3WIHL 2VJXA 3RA7L 2DQDH 3IB4A 1XH3A 2FGWL 3MRJB 3KNBA 5TE4L 4KPHL 4WI2A 2BC4B 3K46A 1FG9C 5DMIL 2BOBA 1FC1A 1MUJB 4M1DH 1UB5A 3RBSA 2AJSL 3CFCH 1OQXA 2WUCH 3SDXB 3GDBA 1D6EA 2HJKA 3DVNB 4K7PL 4JZOA 4YHMH 1EZVX 1TIUA 3GSXB 2A6JB 1U58A 1LK2A 2VLKA 3WBDA 3UDWA 5HHOA 5T3ZD 5FO8B 4TQEH 4PGBA 3UP1A 2Y9RT 4OLYL 3L3JA 3WN5A 1I8MA 2F5AH 1EERB 2CXGA 1FIGH 1DEEB 3PGDB 4TSCH 4LLWB 1MFNA 1N5YH 4JHBA 5DQJA 3RGHA 3UJIH 5CJ8A 2YPKB 1ACYL 4DGIL 4ZNEE 1F3RB 4GG6E 4WEUD 3ZZ1A 1BVKB 3W2DL 4Q9RH 1DE4B 1U3ZA 2VDOH 1YUHA 4WRLA 3ILPA 3MLUL 3LB6D 1H3PH 1P7QD 1S5HA 5ISZB 2YBRB 4GBXB 2FJHA 4IDJL 4LDOB 3SGJC 3Q48A 2ADGA 3UTTA 2MQ0A 2YN5A 3BWAB 1A6VL 4KROB 3OSKA 3WFHB 4L3EE 3AB0C 1UFUA 3ULVH 5I8OL 3QI9A 3U1SL 3CX2A 2MMXA 5T1KB 1VDGA 2HRLA 5AAWA 3LSOB 1QHOA 2F8XC 4LLVB 5CSBA 3V0WL 1WLHA 2VLJE 3GBMH 2A6IB 5CGTA 2Q7YA 5JDSA 5DD6A 5HDQL 5EBLA 4U1IA 3KVQA 4M6AA 5FEBA 3PWVA 3P0VH 4BQ8A 5KTEH 5CILL 1RUPH 3FAXA 3H9YA 4IRSC 3QCTH 4PB0H 2VN7A 2ZSVB 4PJIE 3D48R 3G6DL 2QADD 4LIQH 4Y4FA 4BQ9A 1ITBB 2D0HA 1NCTA 4FMFA 4F57L 4GQPH 3RUGE 2HH0H 1DBAH 3LQMA 5C8JB 2KQMA 4ONOA 5KSBB 1A2YB 3KPPA 5DJXA 1XMWA 1IEHA 3J7HA 4JKMA 3RNKB 1G7HB 2DIAA 2D31A 4I2XB 5CP3H 5E9DB 1INQB 1OCWH 1GRWA 2NZIA 2NXYD 2W60B 4LSTH 4M93C 2H32A 3I6LD 4QY8B 4ODSH 3RWJA 35C8H 4OV6F 4E41D 4HXAL 2DKUA 4JLRB 5AUMA 3BI9X 4NNXB 1OAYH 2CK0L 3QIWA 5KSAD 1H3WM 2GCYB 2FJFB 3MRDA 4NKIH 3BRFA 1YNLL 3IJYA 1IAMA 1X5IA 1EMTL 3BP5B 1ZHKA 3QRFM 1MFDH 3ARGB 2HT2D 2WP3O 5IEKB 4XC3L 4XMKL 4P48A 1N3NB 2ZPKL 4OFVA 5C0FA 1JHLL 1PZ5B 2HVKB 3GGWB 5A2IH 1ZGLA 5DA4A 4MNGB 2NXYC 2WIIA 3QQ4B 4XCEA 2Y36L 5E2WL 1CXHA 3NIDF 4OGYL 3U0TA 3V6BR 2UVFA 5CBEB 1YEEL 1WBZA 1HI6A 3HMWL 4PJAF 3MLPA 1QSFB 1NFDA 2OR8A 5HHQB 3O2WL 3VXMA 4R96A 5IESH 5GGTA 2VWEE 3ZSTA 3ELAT 3V8OA 1MWAL 2HT2C 2IG2L 4FFZL 4NC2B 3SKJL 2X4TA 3O6KH 1QQDA 3ULUE 5JIIA 4Q6YA 1AGEB 4JZJA 2DQEL 4L8SA 3S98A 4O2EB 1P4LA 5C09B 1OLZA 1BQUA 4JQVC 4JO3L 3Q6FA 5C0CE 3OKOA 4WI5A 1HE7A 4UQ2B 4LGPB 3D39B 3CZJA 3QUYB 2RR3A 1JGUH 1TVBB 4H25B 3VE0A 2Z93A 3DROB 5EUOA 4AENB 5DJYA 3ARYA 2AJXL 4G8GA 3TIDA 2IPTL 1A1OB 3NACL 5DR5H 1A6UL 4U1KA 4G9FB 4C56E 5IVOA 5CINL 1I3VA 1DBBL 1SEBA 1X5YA 5E08L 1H3UA 1UYWH 4JB9H 3EBAA 3UYRH 5J3HD 2XN9D 5C9KA 2LU7A 4XB8A 1M05A 3RP1A 2AVGA 4CU8A 1I9IL 5DA0B 3MRNA 2OSLB 4KDTC 2G75A 2ICWB 2OX5A 3O8XB 4DKEH 2H3NA 3WJJC 1T03L 1QLRA 4NO2B 4PJHE 1A6TA 4Y4KA 5D4QA 3O2VH 1S7WB 5JLZB 4ZFOA 3CVIL 3MUJA 2EC9T 5J3HC 1RJLB 4K8RH 5I19H 2YPLE 3H9SE 3HN3A 3OKLB 1KULA 4AEHL 2CMRH 3QEQA 4O9HH 5I76B 1I3GH 4IRJA 5DK0B 5HHNA 1EBAA 1A6PA 1CICD 2CR3A 4HV8A 1EHLL 1MI5E 2UY7A 5D8JH 4X6CE 4ZD3H 2OR7A 3DLQR 1FFQA 2J8UF 4JRXB 5L7XL 5DJAA 5LG1A 3EOTL 5I75B 1ND0A 5DURB 1VB9A 4Z7OF 1VGKA 3DMMD 4QRSA 5BS0D 1JZ4A 1N8ZB 3BP6B 3MCG1 3MC0A 1IE5A 3LN5A 4MAYA 1CICC 4J8RB 2K1MA 3JZ7A 1U3HB 4XHJD 1O7SA 3BD4A 1RY7B 3VG0L 2OI9B 3ZKSD 4XPAL 1JGLL 4NC0B 5HYQA 1DUZB 3MX0A 4U6TA 2P7TB 3OR7A 3OKDB 1IFHL 1NLDH 3BQUA 1AO7B 3O2DL 3IFLL 4PJDE 4TVPD 2OTWA 3O6FB 4OGXL 4K7FB 4QXTB 4Y8AA 3NPZB 2HFEB 3QQ3B 1IT9L 5EPMA 1S5IH 4Z76A 2DTSA 5BXFA 1U8LB 4XHJC 3C6SB 1C5BL 1OAQL 1PKQE 3PIQB 3QNYA 1FFOB 4DJMA 1MCDA 5SX4H 3V4VL 2W07A 1AY1H 3FONB 1JZ5A 2AI0L 5EU6A 4F33A 2BNRB 4KKCC 2E27L 4M9PA 2AK4B 1JNNH 5CP7B 3M1BB 3OKEA 3ZT7A 4YGVA 3FO2A 3RY6A 2X1WL 3QDHA 4G6AC 3TT1H 3WKNA 3ULUL 3C08H 4KQ4L 3M17A 3O3EB 1LILA 1JCKA 3PE9A 5E2TH 1ZXQA 5L8LB 3DIFB 2L7JA 5CZXD 4U7SA 1IQDB 2ZUXA 1T1YA 4PGDA 4GMTH 1NEZA 3GMNA 2V9RA 3O6LL 1F8TH 2HT4D 3CJJA 3SPVB 5LGJA 5B8CA 4QRRD 2P8LA 5HGHA 4WU7B 3X14A 3EOBB 4ODHL 1QO3A 3MLTB 3TNNA 1IC1A 1A6AB 1MRDH 5JW5A 2BNUA 3DSFL 1AQDB 4XI5D 4P5KA 3UJTL 3BKMH 1KXQE 3VFTA 1B0RA 2NY3D 4PY8I 5CZXC 5T3XE 2EEBA 1NBZB 1KJ3L 1KYOK 3GSNA 3F7VB 1YMME 4U6HA 3O9WD 1Z3GL 1K85A 3HUJB 4Z95H 1KPVB 1RZKC 2EKSB 5E6ZA 4L1DA 4OCMC 2WMPA 1DANU 4FQCL 1GGIH 1UVQB 3GMMA 4NCC1 2A9ML 3LN4B 4YDIH 1MRCH 1G7MB 1WIOA 4CMMB 4HK0B 1DN0B 1AC6A 1YQVH 4HIEB 2YSSB 2NY3C 2X7LA 5EORH 3VD4A 1ORSB 1FO0A 4GRLB 4LVOC 3O4LD 5LGHH 4FQXA 3DXAB 3FRPG 3SQOL 1XGUA 1HHIA 1LEKA 3SKNA 4LEXH 3QRGL 1PX4A 4XNQA 3KPSE 1IM9B 3ZL4H 4HIJB 1RUAL 4OIBA 4WO4D 4HIHA 1J0KA 1I7TA 3NMEA 4NRXB 5KZCB 4WW2B 3PWPB 2OZ4A 5F3BA 3GM8A 4H0GA 1UQSA 5FKPA 4HEPG 2GK0A 4I0CC 2ZUQB 1MRFH 4NDMA 4KJQD 4QNPF 3GUTB 3ZTJG 2RIKA 4JFQA 1CD0A 3DBXA 4JG1L 4DW2L 5BQ7A 3QCUL 3VDBA 2N7AA 1GGBH 1F13A 3D0VA 3N1MC 2HTKD 2D7TH 3EHBD 4XH2A 4XWOC 3E0GA 2VAAB 1ZLUH 4JG0L 3U9PL 3BZEB 4WO4C 4L4VA 1AE6H 5F7HA 3WYRA 1QBLH 2J8OA 2YRLA 4DEPB 1T1WB 4ZNCD 3OQ3B 3V6FA 1JZ6A 5DD0L 5CHNB 4KQ3H 4KJQC 3WNMA 1MFEH 3HRZA 5BVJA 1MY7A 4NN7C 1BLNB 4RIRB 1IEAB 2IANE 2HFGH 1U9KA 2UZXB 1J8KA 4GW5A 2BDNL 2WUBH 2E9IA 4KRMB 3B3IA 3W11C 4M03A 4JPVH 1XCQA 1AHWB 4I0PB 5LQBL 3V6OE 1FFPB 4JHWL 3CXHK 3ZTJH 4Q9QL 4P23B 4NC1C 4DFIA 3SDAD 3LD8C 4P5MB 3GBLA 4JFOA 4YR6A 3NA4A 2I27N 1OSZB 3ARXA 3M8OH 3VMOA 2MJWA 2X41A 3V4UL 3RWDB 4G8EB 2DQHL 1U8OA 3B9KD 1JFQL 5D5ME 3WNLA 3X3GH 4MA3A 3NABH 1J8HA 4HBQA 1M7IA 1VADB 4XCFL 2HP4A 1T0NB 2UUDK 3TESA 5KW9L 1Q9OB 1S7QB 4OLUH 3D18A 1F4AA 3BHBB 3K80A 1YEIH 3FT4A 1Y18A 1LE5B 4KC3B 4R7DB 3SDAC 4XCYB 4R2GB 4NSKB 1RMFH 1GSMA 1L0YA 2A2QT 2BOCA 5E2JA 1QG3A 4CUCA 1I9EA 2Y4SA 2CJUH 5J1AB 5T3XL 3ARDB 4YDJA 5IBLD 2KZWA 1FNFA 4DGYL 4X6FB 5DFTA 4LQFL 4B7LA 4LF3A 4BH7B 2QTEA 4L4TE 4PJEB 3MUZ1 4JVWA 4GKNA 1JWSA 3FFCB 4G6KL 4UIMA 4MDJB 5JW3H 1V7ML 4JFDA 3MGTA 2OP4H 3JWDL 2AXFA 1IGFH 1I1YA 4UIKH 3RFZC 1RJYA 2D7MA 3EFFA 4GG8A 5I1EL 5I9QB 3TPKA 5I71C 3CDGA 2HTLD 3G6JF 1M7DA 6CGTA 1IGJB 3MRMA 1HOCA 4JO2L 1Q72L 1MY5A 1MJ7H 5CZVH 1G7IB 2R2HB 3KPRD 4PYGA 3UDWC 3MRCB 1GGCH 5FAAA 4OSUH 1NANH 3C2AL 5EBWB 5FUZL 5JHDB 1G9NL 4KV5E 1YMHB 1CDHA 2Q8AH 1GHFL 1W0YT 3QJFA 3QHTC 4MHHG 1BF2A 2Q86A 4PRNA 3VRLF 4QHMB 4N8CH 5FGCE 3HI1B 4ALAH 4PRDA 5FK9A 3IS0X 4R7NA 1HCFX 1D7FA 4UU9B 3IRZA 5DO2D 4GAGH 4HJJL 3CUPA 4BSJA 5DMYA 3OAYK 1P7HL 2MCG1 1KNOB 1CZ8L 2VLJD 3MRFB 4P46A 5FUOH 4XP9L 3RIFF 2ED7A 4HKXA 4P3WA 4WUUA 4EDWL 3LEYH 3RZCA 5GRJH 3MJ8B 3D3VD 4HKJB 1I1AA 5I1HH 3SDYL 4KRPC 5DD5H 2CRMA 4FQ2H 5CEZE 2EYSB 1IEBA 2Q3AA 2YA1A 2BZDA 3GMPB 1WF5A 3FTGA 3QI9C 1TZHA 1HQRB 3X12B 2OTPA 2OBGA 4HS3A 1JPGB 4OJFL 5AG9A 3F12B 3QO1B 2FIRT 2C7UB 1S7RA 3F5WA 5IIEB 3DRQB 4JJ5B 3A6CH 2VL5A 3G08B 3ROLA 2VDRH 2Z8VC 2ZJSH 3WFBL 3MBEB 3V6ZB 4LVNB 1NGXB 2C1OB 3KPOA 2FYYA 4XPHH 5CGYD 5IM7B 4YE4H 3QXTA 3LRSA 1U8JA 4Q0XH 3FQXA 3FB5B 3TBWB 3S35H 4CJ0A 4MNQB 3MNVB 2BX5A 4KAQH 3EO9H 1NDGA 4GFTB 4YK4C 4O4YH 4JN1H 5IQ7L 3KYNB 4HC1H 2R2BB 2BRRH 1KGCE 2DQTL 4NQDA 4WI8A 2E6PA 5D1ZA 5I1GL 3ARBD 4HT1H 2NY5L 4L8BA 2VDNH 3NGBC 4P2CG 4CDGC 5JMRA 4NQTA 1TJIH 3QWRA 1P53A 4WFFE 4PJGE 1MCJA 3QIWC 2GTZA 3MV7A 1ZA3B 4NKMA 4S1QH 1BQHG 5GRVK 2IAMA 4WI4A 1BOGB 3MGOB 5I1CH 2XICA 4LVHB 1FZJA 4NKDB 1AXSA 3IYLW 4N0RA 4FQHB 1A1NB 3R0NA 3WSQH 3ARBC 4JR9L 4K3DH 3SGEH 3NH7H 4DKFL 2IMMA 4OB5L 4XP6H 1XGRB 1X4XA 4F7PB 4GW1A 4G8FA 4MB3A 4P2RA 5C0CD 1NAKH 1DBKL 3HG1B 3EGSA 3L3GA 4LPCA 3NZHH 1NGWB 4GUPB 5DMGC 1KN2H 3H0TB 5DD3L 2L4OA 4AIOA 2Y06H 4G8GD 2XNAA 43CAB 1P4BH 3NIGF 1ZHBB 3TJHD 4K71C 4G7VH 4C56D 5FF6A 4QOKE 3DX9B 1WBXA 5K59E 1NGZA 2CRIA 4AMKH 1FE8L 4JZJC 5IQ9A 4L8SC 4KI5D 4NO5B 1T80A 4GRWE 2MHAA 3C87A 3EJZD 3MJGX 4OUUA 4MJ5B 3VXQA 3LV3A 5JW4Q 3PHQA 3I84A 3GSWB 5L0QC 4PP2A 1IC7H 5ICZA 1CG9B 3TJHC 2VABB 1FL6B 1CFTB 2X9XA 4I5BB 3T0EB 1U8IA 4HIIA 4MXVF 3WV0A 4I48B 3THMH 4JPIB 4F37K 2KPNA 1A0QL 4L3CB 3X13B 2XFXA 5JPMA 1N7ML 2YPLD 2CUHA 3H9SD 4C57C 4KI5C 3GI8H 4TNWF 2APWA 5E8PA 5CEZL 4WCYL 3EJZC 1A5FH 3BO8A 2DLIA 1JWUA 2WANA 4HWEH 5BV7L 1MI5D 4NM4L 3BAEH 2HKHL 4OZFG 3CK0L 4RAHA 3HPJB 2X1QA 4NO0D 2KBGA 1MCLA 3V5KB 5L9DH 4CN4A 1C5DA 2CIIB 1QVOB 1U42A 5C0AD 4XNMB 1BQHB 1SYSA 1Q9LA 5ADOL 2VKWA 3ARZA 1N5AA 4O2CB 5IVXF 4OD2B 5CMAA 1DANT 1G7PA 5I8KL 4UDTA 3RTQA 1DZBA 4Y8DC 4IRJC 5E6YA 4H5SA 3HNTL 4XCNB 5DQ9A 5C07E 5TDOA 4MB4A 4P4KD 3VFVB 4X6DE 3DRTB 5IP4A 5F3HA 1CI5A 1RZGA 2DN7A 1FLRH 1CR9H 4U6XB 4H26A 1BZ9A 4QTIL 4KKNA 1S9VA 4CGTA 5AYUH 5D1QA 5ESQB 5GGUB 4HUNB 4XNUH 5MENB 12E8H 1CFVH 1RZ7L 4PRHB 2P5EB 3D2UB 4OZFH 1JNJA 1YEGH 3MBXL 3TWCH 3DUUA 3OPZH 1XIWA 4OFYD 1KJVB 2VO5A 3IXTB 3RU8H 1KB5L 3TBYA 3MROB 2N56A 1VACA 3GFUA 4ZXBA 4F7TA 5EU6D 3VFUB 4BK5A 4HMCA 1DQDL 2XY2A 2P5WB 3SDDD 3TFKC 2AJUH 1HEZA 4G3YL 4Q2ZA 3P2TA 2EC8A 1PQZA 4LNVA 3QNXA 3FMGL 4JO1H 1F58H 3RI5F 5BW7A 1MELA 2AEQL 3EO1A 2J12B 4OZHB 2A77H 2AV7B 2NY6D 3L5WB 4ONFL 4XT1C 2BMKA 2GQHA 1HKLL 5KJRL 2GSIB 3I3DA 4H20H 4RMQA 2EDTA 4G6ML 1DL7H 2YMXL 4QGTA 3Q1SL 3SDDC 2WW8A 5EDXA 4KHXL 3TGXA 4LASH 1UZ6E 2UWEB 1OTUD 4P5TB 5GS2D 4JQIH 4ELME 1UEMA 2V2WA 4OZFB 2F74B 3BKCL 3KXFB 5T3XD 4NYLA 1G7LB 3BEWA 3TYFA 5F88B 2NY6C 3IDNB 4PTUA 1FVDB 1HYSD 4OLXL 1FJ1B 5JDJA 4D3CH 1C5CL 1JNHB 3KYKH 2I07B 5T3ZH 5DK2B 2EE9A 4HUXA 2Y72A 4P99A 4QYOA 1H15A 1H5BC 1FNEA 3CVHL 3WFEL 3CX5J 3OR6B 5MP6H 2Q6WA 3QUKA 1NC2B 4PBXA 4UUJA 5GXBB 5E8NB 2BY0A 1D5XB 1K9TA 3P0YH 3V5HB 3C5ZD 4M1GH 1DQLL 1K5NB 2DI8A 1EHAA 1YZZA 4JFYB 3VCLA 2JB5H 1MHPH 4CRPA 4X7SH 1N59A 2YUZA 4GAYB 3S8WA 3VGAB 1INEH 1H3VA 3MUGA 4PJCA 4TSAL 5BVPH 4ELKA 1X5FA 4HS8L 3FQNA 3PDDA 4OF7A 1VESA 3KPSD 3B5HA 3VH8A 5FOJA 1VPOH 3ZTNL 3GRWL 5E5MB 5ABDE 5DDHA 3O3DB 2ITDB 5B38A 1MCPH 5IHZB 4ZS7L 3WUWA 4BUHA 1BREA 3P4MA 4WI9A 1ZEAL 5FHBL 4FS0A 1HIMH 5A16A 2OTUB 4PJ7A 3DX7A 1FV1A 1P84J 1T3FB 5DTFA 4ODUB 3OAZK 1YJDH 2XKSA 2I5YH 3ZE1F 1BVZA 3HZVB 2OM5A 5E0QA 4FFVD 2ICES 5D2LA 5FA3A 1FLTX 1OARH 5TQ0H 1BMGA 4WHCA 3U9UB 2NW3A 2AEPL 4P2QE 4PYHA 3T04D 1CLYL 4HIXL 4HJGB 4L9DA 5HHXH 1P7QB 1MHCB 3DECA 4Q6IB 5D72H 4FXKA 3BE1H 5DUMH 5FCUL 3SE4A 4LSQH 4M7LL 1JWMA 1RULH 3OB8A 5CSZB 2FO4A 2FZ3A 2LTQC 5KS9B 1YPZA 1HXMA 3P30H 3RNQB 3DO7B 5SWSD 3GSUA 5IHUL 3CU7A 2H9GB 2UYLB 3QFDA 3R1GL 3TZVD 1NPUA 1KN4L 5E7FA 5J11C 4P2OD 1XF5B 1Q0YH 3LKNA 3QWOA 3LPGA 4KUCD 3BSZH 4EUPA 2O5YH 1ZS8B 4X9IA 2NZ9D 5DEFA 2Q20A 5IK3B 5F21B 3QH3B 5JORA 3MNWB 4M93B 5C0BE 4XP5L 3OX8B 2QADB 4JM2A 1WV7T 4X5LA 3TZVC 3IETA 4KKAC 4X4XA 4OD1L 4XHQA 3GJEA 2VXUL 5E8OA 2WBJA 2DWDA 1VENA 2DLEA 1IZKA 5EC1B 1SM3H 4NZUH 5FM5M 3ARFA 3QDME 3SOBL 3EYUH 2GY7B 2NXYB 4KY1L 4JFHE 4WU5A 1QTYT 4PG2A 4XXDA 4X99A 4PUBL 3FB7B 3MRGA 5MEQA 2R4RL 4K7PX 5IHBA 2JCCE 4JFDD 1UCBH 4F2MB 3MMEA 5KSAB 4OFDA 3W0WA 4JFEB 4P9ML 1FRGH 3QG6B 4WTZA 4HS6B 2YC1B 3LZFH 4Y1AA 1W0VA 3GHEL 4YLQT 1ZMYA 3ESVF 5J0BA 1RZ8B 5I73B 4RISL 1LO5B 4M6OL 4NN6B 4PD4K 5EFIA 1OAKL 1IRAY 1S7UA 3L3HB 3HI6H 1CD8A 3MOBL 1F3DH 1I7ZA 3KPLB 1DQTA 2BVUA 4C58B 1T1XA 4UBDD 3OBAA 4GRMA 2A6KB 1FAIL 3DVFA 4DN4L 1G1YA 3WL9B 3GBNL 5JQHC 3MRLA 5FUCE 2X05A 1IGYB 4O2FB 2YUXA 5DS8A 3OWEA 1NFKA 4KDVA 2FBJH 2QQNH 4IMLA 4UT9L 1FCGA 3T0DA 1NDMB 3BIKA 4HMDA 5IEHB 5DHVH 4K94L 1F97A 1WFOA 3MLZL 3QFJD 3X3FH 4P3DA 1ES0A 3WO4C 1WGOA 2CDEB 4OT1H 1AGCB 4KJYB 4AM0A 1MH5A 3FO9A 4PRBA 2QV2A 4UBDC 3RZCD 3A6BL 3U36A 3UPRB 4PJ9A 3DURB 4OZGA 2GSGA 5HVHC 4GS7B 2NPLX 4TULL 3HHRB 3PGCB 3JWNC 5HXMA 4Y19E 3MXVL 3WLBA 1MFAH 1TETH 1V3MA 5CD3A 2QKIB 4MJID 1ZLSL 3VD5A 1D9KD 4U1NA 1D5ZB 1ONQA 5TDNB 1YYLL 1CK0H 1A3LH 2UZYB 3NFPA 4P46C 2IMNA 1BZ7A 2XN9B 4PJ5D 3RZCC 4EOWL 4U0RB 1B4JH 3B2UC 3CDFA 3X11B 4FNLL 1LK3H 1I1AC 4K3JL 1KLUA 4OIIH 4Y4HB 4U1JA 3JWOC 4I3SL 1HILB 3TVMA 4FXGA 3LAFA 2DQJL 2Y6SD 5DHVB 1NCBL 3K2UH 1LO3L 1D6VL 1HSBA 3C5JB 5KVFL 1M71B 3REWB 5IOPB 1JE6A 4U7MA 1CLOH 4ERSH 4TVPH 4LLMB 4NGHH 25C8L 4MVBC 4DK6A 4IOSD 1X7QA 5HYJE 1W72H 3SKOA 1KGCD 4HWBH 5D7IE 1CICB 1LD9A 4PJIA 4JGUA 4RMUA 3GJFA 3MACH 5F72S 4KU1A 3RVTD 3SKMA 5CJBA 1ZAGA 4ETQA 4U1SA 5GSRB 4PLKC 5C0EB 2R8SH 2R0ZL 3ARWA 4JPKL 5ALBH 3IFPB 4HUMB 1EBPA 3DMMB 3K7UA 4RNRA 3FN9A 5BS0B 4GKSA 1FGVL 2FHFA 3A6OA 3WIHH 3RA7H 4Z0BL 3C8DA 5D1ZC 2FGWH 5TE4H 3RVTC 4KPHH 1TVHB 5INCA 2R23A 5DMIH 5EU3B 4MJ4A 3BUTA 1L9NA 3S96A 1RZKH 3LS4L 4HGWA 2JJSC 4ISVB 1G6RH 2AJSH 5HYEA 4FHBD 5EU4B 4XVUC 4YIQB 4LBEA 4OZIA 1U8MA 3GMLA 1W72B 4R3SA 4WVRA 1Y0LB 1OY3B 3UTOA 2EKJA 3L3DA 2NXZC 1AR1D 4YHNA 2O5ZL 4KK6D 3QEHA 1XGPA 4K7PH 2F53B 2LE9A 4AEFA 3O4OB 1OD9A 4OLYH 3HZMB 4XWGL 1QFPA 4RDQF 1RHHA 1MREL 3E6FB 1C08B 3T4AA 4NO3A 2ZUVA 1DR9A 4OV5A 3OXRA 2YRZA 5D93C 1KTLB 3Q6GL 1ACYH 1EHNA 1NUGA 3GKWL 15C8H 5DRXB 4DGIH 5A2LH 1AR1C 4HBCL 3QEGL 5DYOA 5F97E 4WDIB 2P4AB 4QXGL 4YFLF 4R4NC 1WQVT 4QRRB 1RQ5A 2ZOKB 2DDQH 3MLUH 5EU7E 4HHAB 1G6RB 5TF0A 4IDJH 5TH2A 2P43B 3V7AE 1R3LB 1Q9WA 1Z9SA 5KOVC 4JRYE 5GGSB 2NY3B 3LH2H 5I8OH 2AW2A 3U1SH 3ARPA 2X09A 4NT6B 2J2ZA 3O9WB 4JRWA 3FZUC 4TUJB 2ICWJ 5T1DL 1ITCA 5K9QI 3QUML 5E6IA 3V0WH 5JNYA 2PYEE 3T77A 3D25A 3PXHA 3RTQD 1TZGL 5HDQH 4ZDHA 4PJHA 1F6AB 4PJ8A 2R9HD 2W65A 4O51B 3V5DB 4TUOB 3HPLB 5CILH 1FN4B 5K9KA 5J1SC 1VFAB 2EECA 3O4LB 1Y6NR 4I18A 3HE7A 5KVGL 3U7WL 5E8DL 2PYFB 4M48H 1S9XB 1RUKL 1U2HA 3G6DH 1CLZL 3SDXE 4PJFA 5E7BA 5IROA 5F9DC 1HQ4A 4M5YH 1F4YL 1YEFH 3O45A 5GS1B 1BVLB 1UJ3B 3RTQC 4C59B 4WO4B 4YHOL 3RX7A 3DGGA 3OXSB 1MIEH 1EO5A 2R9HC 1F4HA 3HFML 1RIVL 3PWUB 4H0IA 3CFJA 2BSRA 5DHXB 1OP5H 3VFSA 1H3TA 3EYFA 3L3KA 2LV4A 3OKNA 2P8MA 4DUXA 4CU6A 5CEXA 4HXAH 5D1QC 5FGBA 2ADJA 4J2XA 3S5LG 2CK0H 5JOFA 4U3CA 1SJHA 1CU4L 2FJGA 1YNLH 4NPYA 3V2AR 1HHHA 1QKZL 1XIWC 4CADA 4QHKI 3HE6A 5H94B 4XC3H 4XMKH 3ZE0F 2ZPKH 1LP9B 5ID0A 1JHLH 2VXVL 3BKYL 3BUYB 2G9HA 3AMLA 5ACZB 3WLWC 4ZXBC 2DMCA 2Z31A 2Y36H 4MS8C 5E2WH 2HLFC 2C1PA 1WEJL 3QZWG 1YEEH 3ARRA 2VLLA 3HMWH 3MYZA 1AGDA 2EDYA 5HVFB 1FNGA 1FHGA 3VXUD 5EZIH 5HDBF 1IGCL 3O2WH 4JFXB 1DJSA 2EEAA 3G5YB 4KGJA 2P8PA 1MWAH 2IG2H 2D2OA 4FFZH 5H35B 1PKQA 3SKJH 1HKFA 1X5ZA 3SDAB 2LAGB 4J4PA 5AWNL 4N0FB 2X40A 5EOTA 4A2LA 2W0LA 4W4OA 5I1DB 1JV5B 1EXUA 3B9KB 4JO3H 5DFWH 2PETA 4OF6A 3QAZC 5E00B 2IPUK 4KWUA 4AEIL 5L8JB 5FB8A 1KJ2L 3U7AA 4EN3A 1DLFL 1G9MC 1AGBA 2AJXH 3AAZB 3HA0A 3D9AL 2IPTH 3H7BA 3NACH 1A6UH 1E28A 3IU3A 4QRUB 4NQCA 5CINH 1DBBH 3FOMA 5E08H 4FQLL 1JF1A 4OZ4B 4U1GC 5E9DE 4Y5VA 5JXAH 1NKRA 4PLJD 2WM0A 2MKWA 1I9IH 3UAJD 1JHTB 4Y2DD 4MD5A 1MWAB 3RWCB 5MI0C 4J3TA 3ES6A 1T03H 1S9YA 3CIQA 1JBJA 2IQ9L 2AGJL 4PFEA 4PJBA 5GHWH 3S5LB 2HA1A 4J7RA 3W9DB 3BX7C 3P4NB 1OF2A 5FKAA 1WZMA 5LCVL 1QUNA 1W2KT 4IS6B 4TN9A 4ONHA 3CVIH 5B22A 1U93A 4FQQA 1FFRA 4JHAL 1LEIB 2C4FU 4F8QA 4AEHH 4GG6B 1I1CA 2ATPA 2FSEA 5F71A 4FP8L 2D7PA 5K9OB 3I6KA 1B0WA 4J6RL 3TH3T 5F8QC 2NW2A 1OT2A 3KPRB 1T83A 2GITB 1D5MB 2O26U 3QZWB 2CDFB 1CN4A 3VFMA 5L7XH 3WHXB 3EOTH 1IM3A 4MAUL 4L3EB 1UWGL 1SMAA 1NFDF 3QA3B 5FM5O 4ZTOL 1WSST 1NCCL 4PLOB 3P77A 2B4CC 4ZFZA 5KAQF 5DRWA 1NBQA 3EYOB 3FCTB 1WIUA 1N0LA 5IR1A 5IJVA 2VLJB 5EZOL 3IDJA 3VG0H 3DJ9A 1YYML 1DDHB 2XT1B 4UV4L 4XPAH 5JXED 5HY9B 1JGLH 2VE6A 3D3VB 2KUTA 4BSWB 3SQBA 1A4JA 3RWEA 2YRPA 1AXTL 1IFHH 1UXSB 3O2DH 4RMVA 3SE4C 3IFLH 2V5MA 3RZWA 4OGXH 2VR5A 1YEDA 3CFCL 4G6JL 4G9FE 4WUKL 5EUOF 4QXUL 1RJZA 1IT9H 1PLGL 1RUQL 2HJFB 2P47B 4LAQL 4DVBA 5C1MB 1S78D 3TO2B 1C5BH 2IANA 1T89C 2NLJA 3RUGB 4YHML 3V4VH 2FLBT 3UTZA 1RD6A 5CBAA 1S7TA 2AI0H 3QNZA 1OAZL 4V1DE 2E27H 4YK4B 3T65B 1JPTH 1I3RA 3QDMD 1X4YA 5F1IB 4ZYKA 3ULUH 4E5XB 4KQ4H 4WHTB 5IF0A 5C6PB 4JFHD 1KLGB 4OUOA 1V8HA 2N4IA 1N5YL 3MRRA 4RZCB 3NGBB 2BVOA 3PUCA 3OGCA 3LKRB 3O6LH 1S78C 1AD9B 4ZO6A 2XPGA 4X4ME 5D5MA 5ICXB 2JJTA 2VIRA 4OLZL 2WBJC 2H2PD 3HZKA 2VDOL 4ODHH 3PQYE 1A02N 1H3PL 3BOVA 5BRZA 4U3XA 3T8XA 1LO4H 3DSFH 3TBVA 1U8KA 3ARFC 3BH8B 4LCCC 3NIDE 5DRNA 3R0MA 3UJTH 4RFNC 4JRXE 4KK8C 4PJXA 2DD8L 4BZ2L 1XZ0B 4N1HB 3ARBB 2EDNA 3FB8A 5C0DA 4PG2C 4HGKC 1U8NA 1F3JB 1KG0B 5SWZA 3U4BH 3LEVL 4NUGH 4OLEA 1Z3GH 2R69L 5HVGB 1UH3A 3IF1A 3LKSB 3QUZA 2H2PC 2XACC 1VHPA 1DVFA 3ZHKA 4FQCH 3VA2C 2UUDH 2GW5A 2A9MH 3S88H 8FABA 4G80B 5CEYB 5DJ8B 4FTVA 3O3AA 1QR1B 3GEWB 4QF1B 3P0VL 1HDMA 4K55A 3B2VL 2XWTA 4X5XB 4CW1B 5C0CB 5EO0A 3SQOH 3F7PC 3FQTA 2XIDA 4EVNA 5TQ2L 1NKOA 5CJ5A 3TC9A 2VR9A 5DK3A 3LQAC 1A1MB 2Z93B 4H1LG 1RUAH 3BXNB 5A3IC 3JBG7 1ACZA 1NCWL 3IDYB 4NZTL 3ZHDA 3GSOA 1VGEL 1JGDA 4C56B 2BNRE 4EI5D 1O5DT 4X6BB 5D1XD 1FP5A 5L2JB 1W0WB 4I1NB 1SJEB 4PRPA 4JG1H 4DW2H 2VOTA 3QCUH 4PJ9C 1HH9A 3T1FB 3VXOB 3DV4A 1Q1JL 5F1KC 4YHPB 1IBGL 2KKQA 4JG0H 3MYJA 3QIBA 3U9PH 4QWWD 4MMXC 2AERT 1I8KA 4Z0XA 3RDTA 4JY6B 1VFBA 5JW4R 5D1XC 4UT7L 4OAWA 5FFLA 5GSVA 2JLLA 5DD0H 4ZFOB 1G7JB 2HVJB 2YPLB 3H9SB 1UZ8A 5I17B 3GMRB 1XF4B 4H1LH 2YD1A 2I60L 2ZG1A 5IB2A 1ZA6B 4XTRD 3GMOA 5HYJD 2G2RB 4S10A 4OFPA 1RK0B 1TTUA 4O5LL 4G9DA 2BDNH 3TN0B 1PKOA 1Q9KA 3KPQB 2P24A 1MI5B 4HV8B 4X6CB 3TVMC 5LQBH 5E24E 4QWWC 3QCVL 3EYQD 2Z92B 1CDCA 2Q76B 3PJSA 4Z7OE 4Q9QH 1A9BA 1VKXA 3BPCB 4NO0B 2ZCHL 2AV1A 1QEWA 5T1MA 5C0AB 3VI4F 3U82B 3DTXA 5GRUH 4EZMA 1T21B 1KIRA 1LO2L 1R24B 4U31A 4RGMB 1JFQH 4YNYA 2FWOA 4HCRL 4P4KB 1PW3A 3DXAE 3LKQB 1B9ZA 3D0LA 3SCMD 4NN5C 4K9EC 3SY0B 3EYQC 2HN7B 1JGUL 4M6NL 5CKAA 4QXWA 5HYSG 2NX5E 4LP5A 3OAUH 2I9LA 1L6XA 4UAOC 1WZ1L 4E0RA 1SYVB 1EFXA 4H1LB 4NRZB 4PJDB 5I2IA 3AS3A 3D85D 2A9NL 5AD0B 4FQIL 1RI8A 2OTWB 4YPGA 5JTWA 3PWPE 5GS2H 1M4KA 1SY6A 2B2XL 3UYRL 2DB8A 5IFJB 4ZO7A 1RIHL 5T3XH 4JY4A 4DGYH 3SCMC 4LQFH 5IFAL 4M3JA 4DKEL 3NVQA 1GOHA 4PJGA 3PXJA 5EC2B 1IC4L 3SDDB 3BH9B 2MWCA 4G6KH 5EN2B 4N9GA 1HCVA 1V7MH 4U1LA 3JWDH 3KG5A 3K8KA 5FYJU 3H42H 4KUZL 3OB0K 4OM1L 1HXYA 2XKNA 5I1EH 3F7YB 3GIVB 3QUXD 2PW2B 4I4WB 1BZQK 4JO2H 1ZHNA 1DQJB 3FQUA 1H5BB 4OGZA 5F89B 2X4PB 1R3JA 4QHUA 2YK1L 4IEFB 3VJ6A 3C2AH 4TSBL 5FUZH 2FO1A 1G9NH 5EUKA 1RJCA 3Q3GA 1GHFH 4DCQB 3RX5A 3DYPA 2XTJC 1N2RB 3IFOA 3W82A 5B39A 5GRZA 4Z7UA 3W81A 2EDJA 4L29A 4QOKA 1YMMB 1A7NL 2RFXB 3VFOB 2HJLB 4JAMB 4B0MM 4D0BA 3ARQA 2DIBA 4HJJH 1AD0B 2BNQA 1C1EL 4XCCH 1QSEE 2PYED 4X98A 1CZ8H 4AZ8A 4XP9H 3SDCD 3HMXH 3CVHA 5ITFB 4EDWH 1U8HB 4C4KT 3C5ZB 2MTPA 3SDYH 1TFHA 3O0RL 5HYSB 5E4EC 5L6YL 1FO0B 3INUH 4BFIA 5D6CA 3C60A 4PRIA 3U0PB 5IB4A 1S7XA 3KPSB 4OJFH 1T2QL 2E6QA 1IQWL 5E6IC 2Q3ZA 3FL7A 4N0UE 1DFBL 4X80L 5HGDA 2DQGL 1AY1L 2CO7B 1ZSDB 2L7UA 4PJEE 2MQ3A 4QNPE 5I1LA 2X1OA 3KLAB 5FOBA 5DJ0B 1XF2A 1UQSB 2QSCL 2QQLL 4MA7L 2AKRA 2J88L 3WFBH 4I18C 1BIIA 2DWEB 5J89A 1KBGL 4LLAA 4JFQB 4OGAD 3QULA 4G42B 3CCHA 3NAAL 5IROC 4LLUB 1I7UB 1T4KA 2VISA 4GMTL 4LHUA 3FOLB 4J1UB 1WT5A 1K4DA 3CC5A 1TJHL 2D03L 3O41B 2C4FT 4GKZA 4X6DA 5I15H 4H88L 4MX7B 2F54E 1FNSL 5IW6B 2W9DL 5F9WC 1N6VA 4LEOB 2R0LL 4M3KB 5JHDE 2UZIL 3P73A 2DQTH 5C08A 5C9JA 5I1GH 5IMLA 4KKLD 1MJ8L 5F6IC 2ADIB 1LNUA 3B9VA 5IVZA 1R5VA 3F62A 5FGBC 1XF1A 2R1XA 1KIQB 5HDOA 2DQFB 2F5BL 5D7KE 3MV8D 4Z95L 4OBRA 4A6YA 3FQWB 1NAMB 3BRGC 5SWSB 1YN7A 1GGIL 4WGWB 2GJ6A 4X7DC 4M61B 5IV2A 2XWBB 1RU9L 1WZLA 2DM4A 4UZGA 5EOQH 1T04A 2EIZB 4M4RA 2ARJA 3TZVB 1T5WA 4JR9H 4OB5H 1LEGA 4PV9B 5I18L 3BFOA 4YWGL 4QRPE 3EKCA 4P2OB 1X5AA 4JGJA 3TA3A 3OJDB 3QDGE 4X9HA 2JIXD 5I6XC 5DD3H 4CVXB 1VERA 3K0WA 5D7LE 4Z7QF 5LGKA 2J3SA 5DJ2A 1CTNA 4JN2B 1QYGH 5D2NC 3J8F7 1FPTL 2XY1A 4YHYB 1E4JA 3VA6A 2EDDA 4NNYA 1FE8H 3RL1A 4W4OC 3ULSA 4ELMA 1OM3L 3LEXA 4P4RB 5HGAB 4QRQB 4CU7A 2EDKA 4OKVB 3PWLB 1UC6A 1MLBB 2D7TL 5LWYL 3VXTA 2H6PA 4MNQE 2NCMA 1JWSB 3MZTA 2X4NA 5MEPA 3MLSL 4ZO8A 4YBLC 3WS3B 2NY1B 5C0GB 1K4CB 4J23A 3MGTB 1R0AL 1BWMA 1A0QH 5ETUA 2FD6L 1N7MH 2XZQL 3VXNA 4XNZC 3BZFB 1ZT1A 4S2SA 3MRQA 3GSQB 4Y5VC 2JJUA 4RWHA 4YPJA 5MHSD 1D5IL 3NCCB 5KSVB 2X89D 3GMQB 3EOYG 5BV7H 1IKNA 4NM4H 2HKHH 4JGMA 1NC4D 3MV9E 3WO4B 3UZVB 2AJ3A 3VRLE 3CK0H 1UXWA 2X4SA 3O11A 4AIZA 2VDPL 4OCRH 5KN5B 5ADOH 3W9EB 5FGCB 5HVHB 1ZT7A 2XXMB 2Q8BL 5FO9A 4MA1C 1L6ZA 3M8OL 5I8KH 2DJ4A 4QTHB 5DGQA 1A9EB 2PXYD 2WWKT 3HNTH 4R0LB 3C2SA 5ADPH 3UXFA 3QFJB 2Y5TB 4NQXB 5IFHL 2IH3B 1OW0C 3UPAA 4M1CD 3T4YA 4XPBL 3VD7A 4X6EA 3VXSD 3FO1B 5D7JD 4QTIH 5DFVD 4Z78A 2MNUA 1LQSR 4PY7A 4KK9C 1OHQA 4MZ2A 3ZLQC 1FCCA 4YFEA 4ZSOA 1RZ7H 4P2QA 4Y5XA 3TBSA 3H7LA 3MBXH 2PXYC 4GW4B 3IDMA 5BV7B 4MJIB 3HCVB 1FSKB 5F7FA 3RL2A 1D9KB 1Z2KA 4ODTL 2YUVA 1IAOB 1KB5H 2LQRA 2QJDA 1YEJL 5DSCA 4M1CC 2F15A 3OAZH 3ZKNC 4Z7VA 5B3JF 4ZOEA 4V1DD 2EDBA 4PJ5B 1UWXK 3BW9B 5BJTB 1DQDH 2B1AL 5DFVC 4JFPB 3ET9F 4C83A 4G3YH 1BJ1H 5IMOA 3FMGH 5JW3L 3ROLB 1MNUL 2ZUWA 3GNML 2AEQH 2CKBH 3MR9B 2V2XB 4GO6B 4ONFH 4HZLA 4UDUA 3OF6D 1HKLH 4ZPTB 2V5RA 5KJRH 3BWUC 1AKJD 3CPLB 5T5FL 5CJOH 3EIFA 4XZUA 4G6MH 4ZUSB 2BCKA 2YMXH 3PQYD 1HK6A 4GT7A 5DWUL 3CU1A 4FQ1L 5E94B 5F9AC 2Q8AL 3NZ8B 1B4RA 3BKCH 4N1CA 5C0BA 1XR8A 4N8CL 4OLXH 1KB5B 5DRZB 2EDRA 3PGFL 4NHUA 1C5CH 1FYTA 4GRWH 3L9RB 4PP1C 1N4XL 2E5EA 2CLZB 2JJTC 5F70A 4DZBA 3L7EB 3WFEH 3MA9L 3ARED 1XR9A 1PEZA 3TO4A 5DI8B 4LLDA 3S4SA 5GRJL 1DQLH 1PFCA 5ELIA 1VFOA 3RWIB 2CKBB 5DEGA 4NUJA 2YEZA 1NMBL 4FTVD 5JPNA 1SHMA 5HHVL 3CH1A 3OKYA 5K9QG 3R8BB 3FRUA 4YXKL 2FEDD 3UTQA 5IMKB 3IDIA 5ILTL 3IJSB 4PRHE 4TSAH 3KWWB 4HS8H 3EUUA 1T5XB 1TTGA 4QT5B 4X7TA 3QUZC 1KT2B 5ENWA 1HHJB 3ZTNH 3GRWH 4YGAB 1A6ZA 1DVFC 1U95A 5I66B 4LARL 3W39B 3CFBA 2GUOA 3VGEA 2COQA 1NCDL 3RPIB 1FFNB 4ZS7H 2E7LA 4HKBA 2GAZA 2ILLA 4DZ8B 2P5WE 1KTRL 1ZEAH 2OXHA 1TPXC 2BXZA 2FEDC 1HHGA 1OPGL 2DLTA 2I26N 4GRWB 2ZNXA 2VKXA 1U3YA 5KSUA 3TNMA 2VSDA 1PYWA 4NFDA 1ZLVK 1IGTB 2BXYA 1VEMA 4UOW1 3RDTD 3EO9L 5CZKA 1X5XA 1QPXA 1JPFA 4HIIB 4UNVA 2RBLA 5ACLA 2FX8L 2VR4A 1KTDB 4FOMA 3P9LB 5E1AA 4ZUUA 3MJ9A 1P7KA 2FGZA 2APFA 3KXFE 3RX8A 4LKXB 4PV8B 4P49A 3SE8H 1LDSA 3QIBC 1Q38A 2IADB 4M7LH 4OLVL 3RDTC 5IVXE 2JKXA 4AH2A 3CFKA 2LU4A 5IHUH 4E9LA 4LPUA 1KJMB 3L3OA 4NOBA 3PHSA 3ZKMD 3M07A 3R1GH 3WSQL 1G7PB 1MHHB 4HX1B 1KN4H 4LPYA 2EYTB 5C07B 1MQ8A 4YHLL 4RGND 3HR6A 4F58L 5IJKA 4Z7WA 3AS2A 5ANME 4S1RL 5MERA 5C0RL 3UTSE 3LKOB 5DJCA 1ZGLP 2NX5D 5IVNA 1B90A 1KN2L 1OP9A 2Y7QB 2ITCA 4XP5H 4PJCF 2AK1L 4KKBC 2W92A 2ZCKL 3PP4L 3PDOA 4IOIB 5CWSB 2ICEB 4OD1H 2VXUH 3MOAH 3QJHA 2GJZB 3WDJA 1JK8B 4YO0B 4BSVB 4U05A 3VXPA 4RGNC 2NTFA 5T3ZE 4HWZB 5DJ6B 4BH8B 3GB7A 2VQ1A 3SOBH 2FBOJ 3QDJE 4KY1H 3WUWG 1ED3B 5ERWA 1WFTA 2XWJA 4PJ7F 4HULB 3I3EA 4D0DA 2Y5EA 1MSPA 3TPUB 2R4RH 4DUWA 5BO1L 4RX4A 2X4OB 3THML 2WINA 3PABA 3RIFK 5D2LF 5C0IA 1NGPL 3CDYA 1TCRB 4XGZB 4RISH 3QO0B 4ZFFB 1JZ2A 1MLCA 5K93A 4AT6A 4M6OH 1CF8L 4WWKD 5F7UA 4MQSB 4YAQA 1OAKH 1S9WA 3S37H 3UC0H 3MOBH 4X5WA 5TDPB 3MRIB 4KMQA 1BD2D 3EDEA 4F15C 1DQQB 5L9DL 3QAZB 3GBNH 3VXUB 3TIEA 5I1AB 3ARUA 5F6HI 3L5XL 4UT9H 4YDLC 2NY4D 1YPZF 2GFBA 3RIAF 1TITA 5IB3B 1T66D 5EZJA 1GOFA 4IJ3B 4K94H 4N8VG 2BNQD 1OTSD 1C12B 1EGJA 5EO1B 4B5EA 2ATKB 2R1WB 2GHWB 3A6BH 3C09C 1XCTB 3G5VA 3MREA 5HGGS 5GIRA 3VWKA 2BSTA 4POZD 1KTKE 4R9HA 5C3TA 5GGRY 3VCLB 3CFDB 1CFNB 3UX9B 1SJXA 4TULH 3T0VA 4L9LA 4OCNC 4ODBD 3MXVH 1CFVL 3C9NB 2ZUUA 3PG2A 5KG9B 1KJ2A 3GM0A 4PRID 1T66C 3S3JA 5C86A 3KYMA 4XPGL 4JDVA 3E8UL 4MDIA 5DVLA 1OTSC 1WWAX 4HH9A 4JM2F 3L7FA 5T1LA 1TVDA 2X4QA 3QXAB 4LCWD 1INDL 4HDIA 1J0HA 4EOWH 2Z91A 2BY1A 1GC1C 4Y16D 3REVB 2VLRA 4FNLH 1CFQA 1NQBA 4K3JH 1ZK9A 3HC4L 4Y2DB 1QRNE 4PY8J 4E41E 4I3SH 2YD8A 3STZB 1AJ7L 2DQJH 2R15A 3C60C 3WDIA 5ICYA 1S8DA 3V52L 1LO3H 1D6VH 3L5HA 1SVZA 5KVFH 3PP3K 1GL4B 3MRJA 1WCBB 2BC4A 5FYKD 5F93C 5CD5D 2F54D 1DL7L 25C8H 4I13B 1MUJA 1XGYL 1VFMA 4CVZB 2J6EA 2NW3B 4D8PB 3RHWF 5TFSL 4NWUL 1QRKA 1K8IB 4Y89A 2E8ZA 3WE6B 3SDXA 4GSDL 3WIFB 4MQXD 1FVEB 2O5XL 4JPKH 3DVNA 1YY8B 4R97C 3GSXA 2A6JA 1WT5C 4OI8A 3KJ4C 3GSRB 1NUFA 4U1MB 3TJEL 4LGRB 5FO8A 4DOHE 4N8VB 1HXMB 3U2SB 5D96C 1C16B 1FGVH 3IAGC 2V2TB 1M6OB 4DGVL 1OGAE 1DEEA 3PGDA 4Z0BH 4LLWA 2JELL 1CQYA 4QRPD 2YPKA 4LSUL 5E70A 3T3MF 3LS4H 3QDGD 3CSYB 2FH8A 3LOWA 5I8EB 4OZGF 2NR6D 1BVKA 5BVPL 1AH1A 1DE4A 3D6GA 4L3AA 3PWNB 4TNWK 1R3IL 1OOAA 1SBSL 5ISZA 3A0OA 2YBRA 1NUNB 4GBXA 1QBBA 1J05B 1MCSA 4WV1B 5HI5D 3BWAA 3I2CL 2ZKHL 3EOAB 5JIHA 2O5ZH 5T5NG 2YD6A 4BK4A 1ADQL 2H1PL 2APXA 3WFHA 4HUUB 1UJTA 1S7VB 5F1NB 3TA3C 4XWGH 3H9HB 4XVSH 5T1KA 1MREH 3QDMB 4YDVB 3ILQC 3CXDL 4LCCB 4LLVA 5F7YC 3TEUA 2HWZL 2VAJA 1DLHB 2A6IA 3Q6GH 2A38A 3GKWH 2IPUG 2P42B 5HI5C 2JCCB 4HBCH 3QEGH 1FGNH 2O61B 1ETZB 4QXGH 4KRLB 1A7BA 3WHE0 2ZSVA 5HVWA 5HHXL 4FABL 1ZT4B 2HFFB 3E6HB 1FNAA 1ZVYA 1W8NA 2NYYD 4FFWD 4PRAB 1WICA 5D72L 4KMTL 2IGFL 2OL3L 3MV9D 4HG4J 4PJIF 5C8JA 2B0SL 4WFEE 4POUB 5LBSL 2H2SD 5KSBA 3AS1A 1A2YA 4DKAA 1MAJA 1G7HA 5E9DA 4I2XA 1INQA 5T1DH 4C4KO 2W60A 2ZUSA 3QUMH 5J13C 4QY8A 2LFGA 5EOCH 3G9AB 1TZGH 4IHOB 1IJ9A 4FFWC 4JLRA 1PEWA 4NNXA 3IT8D 4TOYL 2GCYA 3RI5K 2ZOLB 3UZQA 3KYOB 1MVUB 2R56L 3FFDB 1QLFB 3BP5A 4TVPE 5GGRB 1CTOA 2IBZX 5KVGH 3U7WH 3ARGA 5E8DH 4ZG1A 5IEKA 1RUKH 1CLZH 2QR0B 4OCWL 1N3NA 4WFGD 3RWFB 5SV3A 3UJJL 2HVKA 1PZ5A 3GGWA 3B8SA 4MNGA 3QQ4A 4MNHB 3VGFA 1CD1B 1YNTB 4Y19B 1NBVL 4OZIF 2NY2D 4YHOH 1PVHA 5IB5B 5CBEA 2NY0C 3HFMH 4EI5B 4ODXB 5D1XB 3C8HA 3WXWL 5J12B 4OF3A 1QSFA 1RVFL 5HHQA 4RMRA 1SM3L 4NZUL 2QHRL 4PR5B 2P45B 3LKPB 1IKFL 1BZ7B 2D4FA 5CP3A 4OQTH 3P4LA 3MRBB 4ZAKD 4KJPD 3CMOL 1NGYB 3DSNA 1AGEA 1MCRA 4ESKA 2WLYA 1D5BA 1CU4H 2ZP0T 4Y5XC 4O2EA 5C09A 4QRRE 4YEEA 3ZDZF 1QKZH 4MXQD 1I8IB 4UQ2A 4X7CC 4KZEL 3D39A 3QUYA 2VXVH 3BKYH 1TVBA 2PF6A 3GHBL 3DROA 1KOAA 4AENA 4PG9B 4YUEL 1YEHL 2IC2A 3HI6L 5HYJB 4ZAKC 1A1OA 3WFDL 1WEJH 3QISA 1YY9C 5CIPH 2HLAB 3OG6B 2FHCA 4G9FA 1IGCH 5F7DB 5F7NC 1GOGA 4MD4B 2OSLA 3V9FA 1LGVA 2ICWA 5AWNH 3O8XA 2FIKA 4DFHA 4NO2A 4WEBL 2QEJA 3OJ2C 1FZOB 2R0WL 2B1HL 5HYIA 4OT1L 3TO4D 1S7WA 1BJMA 4JZNB 4YC2B 1VSCA 3O4LE 1KB9K 5AZ2H 5JLZA 4M7ZC 4PJHF 4AEIH 3QQ9D 3SCMB 1R3KA 1RJLA 5IBUG 4QRTB 3OKLA 1DLFH 3TCLB 3EYVB 2AJZB 2CDGB 5EBGA 4X4MA 5I76A 3D9AH 5DK0A 1NFIB 4PJFF 1U8PB 1TMCB 1CGXA 3D85B 4FQLH 4A2MA 1A7OL 4U6YB 5CIPB 3GMLB 3VWJD 2IFFH 3TO4C 2QLVB 4JRXA 1JNLH 5DVNA 3MPCA 5J57B 1ULVA 5CJQL 3ARTA 3VRIB 4XAWL 2EYRB 4NQVB 3PHOB 2IQ9H 2AGJH 3QYCA 1BX2B 1J5OL 3RJQB 2KZ1B 1N8ZA 3SJVE 3FQRB 3BP6A 3AM8A 4R8WH 5LCVH 2VDQL 2IQAB 4J8RA 4LCUB 4NC1E 1U3HA 5TPWL 2BHUA 1LP9E 1OGTB 4JHAH 2XXCB 1DUZA 1RZJC 5I0ZA 3QUXB 4TVPL 2E7LC 2P7TA 4FP8H 5JMOC 3OKDA 1AO7A 3O6FA 2CLRB 4J6RH 4K7FA 3BJLA 4QXTA 4HWBL 3BZDA 2M8XA 1GYAA 4R26L 2HFEA 1U3JA 3QQ3A 3CXHJ 2DS4A 1U8LA 1QR4A 3C6SA 4MAUH 3PIQA 4WTXA 1FFOA 5GGQL 3FONA 2WWKO 4OCYL 4ZTOH 1II4E 2BNRA 3VDAA 1NCCH 2AK4A 5CP7A 3M1BA 5DZOA 2CD0A 1UACL 4OM0L 3O3EA 4M8QB 2PYEB 5EZOH 2R4SL 3SDCB 4PGZA 3DIFA 1YYMH 1IQDA 4UV4H 5IBUB 2VXSL 3NFSL 1RZKL 3SPVA 1AXTH 3PDGA 3UTSD 5J06A 4N90D 1G6RL 4G6JH 3HLAB 4TUKL 4WU7A 4WUKH 3EOBA 1WUNT 3MLTA 1A6AA 4QXUH 5H37G 3TP4A 1AQDA 1PLGH 1RUQH 4LAQH 3GO1L 3AUVA 1YN6B 2C3GA 5GS0D 5C70A 4APQD 1OAZH 1NBZA 1K8DB 3F7VA 2VLKE 4NFBA 5HHOE 5IJKC 3HUJA 1G7QB 1XAUA 1KPVA 2EKSA 2WK2A 3QDJD 2UV3A 4NQSB 1GCFA 3AU1B 1UVQA 1NCAL 4PJBF 3LN4A 1I7RB 5LJYH 3IKCB 1G7MA 1B6UA 15C8L 1EO7A 2C26A 4CMMA 4HK0A 1DN0A 4F9PA 2Z35B 3LDBB 1I4FB 2AQ3A 4HIEA 2YSSA 4RX4D 5GS0C 1ORSA 4OLZH 4GRLA 4X9BA 4Y5YC 4APQC 1X6LA 1WTLA 2VH5L 2E9WA 3DXAA 3KPRE 3ZKXB 2DDQL 4L8CB 4WHDA 5H37H 1J1PL 1YQ2A 1E4XH 4BKLB 1X5JA 3E3QC 2DD8H 4BZ2H 3IVKB 1IM9A 3UTTE 4F9LA 3Q5OA 4HIJA 3W5MA 5HDBE 4DAGL 5FCSH 3LH2L 4NRXA 4IRSD 4P57B 4WW2A 1ROWA 4ZQKB 3LEVH 1U36A 3PWPA 3BN9D 2D4DA 2R69H 1HZHL 2H26B 3MV8B 3GUTA 3FO0L 4PTTB 1EAPB 3H3KA 3OG4B 5D2NB 3T09A 4FG6D 2VAAA 3D3VE 3OJVC 2X44D 2DLGA 3BZEA 1UEYA 2I24N 3B2VH 2PO6D 5FGSA 2DAVA 3BN9C 1T1WA 3BYTA 5FO7B 4M48L 5JOEA 5TQ2H 2QSQA 2B7DT 2JIXB 5CHNA 5EWIL 4KGLA 1H9VA 1KUMA 5D9SB 5C7XH 4M5YL 1YEFL 1BLNA 1RAMA 4RIRA 1IEAA 3L3IB 3CD4A 3T0AA 1NCWH 4NZTH 1VGEH 5E2UH 2DM7A 3GKZA 3N9GL 1IAKB 4K3GA 1MIEL 1U6AL 4FG6C 4URTB 1PZUB 3A67L 3GI9L 5M95B 1AHWA 4I0PA 4OIAA 5T1LD 5JW4M 2CLVB 4LVEA 1FFPA 3FT3B 1U0QA 4P23A 2PO6C 5DUBB 1UWEL 3I6GB 3VWKC 4P5MA 4YX2L 1QRND 1SBBA 1QA9B 1Q1JH 1OSZA 2MCPL 1IBGH 4IOFD 3RWDA 4L9LC 4G8EA 1N0XH 3EO0B 1JTPA 1TQCC 3ABZA 4LCIL 1VADA 5DHYB 5EU7C 4UT7H 1T0NA 2JK5B 3IAPA 3FRPA 3K4DA 1T22B 4JREC 1H3XA 5CJXA 3SGDI 2PW1A 5D5MF 1E6JL 1Q9OA 1S7QA 3BHBA 2I60H 1LE5A 5HHME 2PCPB 5EZLB 4QHNB 4R7DA 2JF1A 3RKPA 4XCYA 4NSKA 5DUPL 1X3DA 4O5LH 3UO1L 5J7CC 3DOSA 4LLQA 4EDXB 4IOFC 2AAVA 2BFVL 4PJXF 1NC4B 3QCVH 5EZIL 4N1EA 4JKLA 1I1FB 5J1AA 3VFNB 1EJOL 3VXME 1BEYL 2ZCHH 4X6FA 4UQ3B 2WQRA 5INDB 3U30B 3DO3A 4BH7A 4W70A 4PJEA 3KGRA 1JHKL 1LO2H 4GAFB 4MQ7B 3FFCA 2DBLL 2PXYB 1HNFA 1RK1B 4MDJA 4HCRH 3WKMH 1OGAD 5E56A 4CMHB 1VEOA 3WFCL 4DQOL 5HPMB 4N5UA 5TGBB 2IEPA 3TYGL 1I9JL 3BD3A 1L9MA 4M6NH 1BQLL 2OQJB 3OKMB 3MFFB 3VXSB 2H8PB 5D7JB 3VFWB 1JYWA 1N64L 4JANB 4RMWA 1IGJA 1WZ1H 4G8GE 1G7IA 1CT8B 2R2HA 3E2HB 2A9NH 4FQIH 4NOFA 5A40E 1NH6A 3MRCA 1ORQB 1JF5A 3BGAA 2B2XH 1AP2B 1CE6B 5EA0L 5EBWA 5JHDA 2VXQL 1RIHH 4GBXD 2NTSP 1YMHA 5JXAL 5A43C 4KI5E 2KH2B 4QHMA 5IFAH 1ZOXA 3HI1A 4K3EL 4KV5F 4V1DB 3T3PF 1ZLWK 1IC4H 2FRGP 4UU9A 5GHWL 3DHMA 4D0CB 2YXFA 4UB0L 3NPSB 1CGUA 1KNOA 2BVQB 2FX9L 3MRFA 4JDZB 4KUZH 4MJ2A 3V0VB 4GH7B 4OM1H 3HNVH 3MRRB 4GBXC 3MJ8A 2E3VA 4HKJA 1AKJB 1NBYB 3QEQE 1AGFB 1UH4A 5FDWB 1E27B 5D70L 2EYSA 4JDTH 3LS5L 3GMPA 3PQYB 2YK1H 2XA3A 1HQRA 3X12A 4TSBH 5IWLA 3BGMB 1JPGA 1J7VR 3VD9A 3F12A 3QO1A 1T6VN 2ZZUT 1B3JA 2FL5B 4PJXB 2C7UA 4PJAB 5C0AE 1J0IA 5IW3A 2EE6A 4WFED 5IIEA 3DRQA 4JJ5A 1A7NH 1EEZB 4JFFD 2H41A 3BVNB 1C1EH 1XEDA 3MBEA 3V6ZA 3SE3A 1NGXA 2D9QB 2C1OA 3AREB 3HB3D 5IM7A 1MFBL 3EW3B 3NCFB 3H8NA 3O3UN 4KKCD 3FB5A 3TBWA 2OYPA 1FNLA 5I74B 3O0RH 4FTVB 4MNQA 3MNVA 5L6YH 2XI9A 2C9AA 3K2MC 1G0YR 4G6AD 1CFSB 1OTTD 1GZPB 2XWTB 3KYNA 3ARGD 3ULVC 1WAAA 3MCLL 2R2BA 1T2QH 1UKTA 4EXPX 1IQWH 2ZSWB 3HB3C 2AJYL 1DFBH 1MCKA 4X80H 2DQGH 3OZ9L 4OTXL 1JPTL 1DP0A 5EU6E 5GGTL 3P9MB 1BFVL 1ZA3A 1CDGA 2QSCH 2QQLH 4U1HB 4MA7H 1OTTC 2J88H 1G0DA 3C6LB 1KIPB 1BOGA 1KBGH 3ARGC 3MGOA 4ZUVB 4DUVA 4PJGF 4ZMAT 2XA8L 4NKDA 1BFSA 3NAAH 1HHKB 4MD0B 4QKXB 4FQHA 1A1NA 2DYPD 5EIQA 4NRYB 1TJHH 3H9ZA 1XGRA 2H45A 5DC9B 4F7EB 2D03H 4F7PA 3KHOA 4H88H 3HG1A 1FNSH 2W9DH 2R0LH 1LO4L 1NGWA 2UZIH 4GUPA 4X0KB 4AG4L 1Y6MR 1TCMA 3H0TA 2ESVD 4HC1A 1MJ8H 4HPYL 3P40A 1M7XA 43CAA 2LABA 1ZHBA 4E42B 4GMSH 4NJ9L 2Z4QB 2J8UB 3DX9A 5ESAB 3U4BL 1FVCB 4NUGL 3VI4E 3NTCL 4AEEA 2F5BH 4Z7UF 4MSWB 4NO5A 4UNUA 3G5ZB 5K59F 4UTAL 3BJ91 3S88L 4MJ5A 3QUYC 1RU9H 3HS0B 3NA9L 5ID1B 1AI1H 1FL3B 3GSWA 3VGBA 4WJ5B 5I18H 4YWGH 1CG9A 1F4XL 2VABA 1FL6A 1CFTA 4I5BA 2IFGA 3T0EA 2FWOB 5FYLL 4ZFOL 4I48A 4JEGB 1GZQB 1T20B 4JPIA 4L3CA 3X13A 1BFOB 3CLEL 2BP3A 2DBJA 4XWOD 2NX5B 2X9WA 2CXKA 1GAFL 1A14L 3O8XC 4IDLA 2VZTA 4NQED 1BBJB 2FCBA 4V2BA 1FPTH 1UWXH 5IBTL 2X4UB 3JV4B 1B2WL 5HI3C 5M94B 1T0MB 3HPJA 1OM3H 2J5LB 5HGBB 3V5KA 3L6FA 2CIIA 1QVOA 1QNZL 5HHPB 4XNMA 1BQHA 4LHQB 5J9PB 1Z6JT 3DVGB 2YD4A 1EEUA 1WWBX 2VZ3A 3C8KB 4I9WD 4O2CA 1GJIA 3RAJH 4DWHA 3W11D 3SJVD 1Z0NA 2APTA 5LWYH 5IB1B 4YFLI 1BJ1J 3K4AA 2A83B 1F02I 3VFVA 4XCNA 3MLSH 3DRTA 4L4VE 1R0AH 5F9JB 1E4KA 2MSPA 5I1IH 4EXKA 5C2BL 2FD6H 2XZQH 1T1ZB 2GT9B 3MRHB 3JV6B 4U6XA 1D5IH 4X6DF 4RAVB 4TVSa 4YDLB 3PWJB 4K8RD 5I75C 5ESQA 5GGUA 5F7WC 4WWKB 5MENA 3S35X 4KI1A 1HSAB 2KQNA 2DLFL 3CFIC 3S3SA 2IH1B 1JZ3A 4PRHA 2P5EA 3D2UA 1ZVSB 2FR4B 2DJSA 1KJVA 3AM8C 3IXTA 1BD2B 5C6WH 2HG5B 1DBML 1WBYB 2VDPH 5SWSE 1JGEB 3MROA 2Q8BH 5FA4B 5GRUL 3FN3A 1AC0A 1HWHB 3VFUA 2P5WA 3H3PL 2NY4B 4K8RC 5GISL 5FECB 2A73B 1QSEB 3O6FC 2DQUL 4U3HA 4AL8H 5I30L 5IFHH 4AQOA 4WW1B 4OZHA 4XPBH 2AV7A 3L5WA 4D9LL 1K2DB 1IC5L 5SX5K 4RQQB 4F7CB 2EE2A 2GSIA 5FYKH 3OAUL 5L8KB 4LKCB 4NZRL 3SO3B 5JO5B 4BELD 4S11A 1RIUL 5DMKB 4PRIB 4G6FD 2V17L 1JPST 2UWEA 4P5TA 4ODTH 4OZFA 3WJLA 3HZYB 2F74A 1YEJH 4GOSA 3MLYL 1G7LA 4N0UB 2DM3A 5F88A 3IDNA 1UZ6F 1FVDA 3GSNL 4LCWB 1FJ1A 3QXDA 1ZLVH 2B1AH 4ELMF 2VLKD 4Y16B 5HHOD 1JNHA 2L0DA 2I07A 1PG7L 4M7JL 2G5BB 5DK2A 1U91B 3KPNB 3UZEA 5ACMA 5I1JL 1MNUH 3GNMH 3OR6A 4P59L 4JFDE 3H42L 1NC2A 5E8NA 1D5XA 4MXWL 1DQML 5A2FA 1CXIA 3V5HA 1K5NA 4I3GA 4JFYA 2W1NA 1ZWIB 5T5FH 1JN6B 1FO0L 2PR4L 1V5JA 3DV6B 5JZ7C 1IMHC 3KJ4B 2PTUA 4PD4J 4GAYA 2F54B 3JTSB 5DWUH 4FQ1H 3KAAA 4L8DB 1CBVL 3WN5C 4WNQB 3UTTD 4CNIB 5GRVL 4WEMB 5E5MA 4KRPD 1JF6A 1YDPB 2M2DA 3O3DA 2ITDA 4LFHD 3MRKB 3PGFH 5IHZA 3QI9D 32C2B 3H2WA 1N4XH 1QPPA 4HPOH 4Z8FL 3VRJB 4XCCL 3MA9H 3QFJE 3KPMB 1T3FA 1P1ZB 3CZFB 3U0WL 4ODUA 4UTBL 1TQBC 4BFGA 4PPTA 3HMXL 1J88A 2IPKB 3U4AA 2VQUA 5JR1H 5I0DA 3HZVA 1NMBH 1GVIA 4F9LC 1QFOA 3TT3H 5HHVH 5IMMB 4QRPB 5I8CB 4HK3N 2VITB 4YXKH 3INUL 4WW2C 3U9UA 5ILTH 3QDGB 2B8OT 4Z7QE 4MJIE 1EEYB 2ZUQC 4HJGA 4Y4FD 3CSBA 1BECA 1P7QA 1MHCA 4LARH 5D7LB 4QHKJ 2XZZA 4P2YA 4Q6IA 5ALCL 4BZ1L 1NCDH 3N1QC 5TE7L 4PJ5E 1NAML 4N8PA 5HPOA 1J0ZA 5CSZA 3NCYP 4Z7VF 1N6QH 5IW1B 1OPGH 5KS9A 3B4NA 4XRCB 3RNQA 3DO7A 4CVWA 3DVIA 1S7SB 1EJ6A 1A7RL 4DEPC 4M9OA 2H9GA 1ZHLB 2UYLA 2DIJA 5L88L 3STBA 3T0BA 1ZV5A 4LSRH 4QHLB 1U8QA 4Y4FC 5DEZA 2YN3A 3QIWD 4LCYB 1GGUA 1XF5A 1MCQA 4U33A 1JUFB 5I15L 3NBNA 3G6JB 1KEGL 1ZS8A 1AHWC 2FX8H 4I0PC 4JKKA 4MJ6B 5IK3A 4P23C 5HHMD 1F90L 2F58L 1NUDA 3MNWA 3OX8A 4ZFGL 1HH6B 4TTDC 3MV9B 4LNRB 4OLVH 2Y07L 3BPNB 2V7HB 3VXMD 5DMGD 5EC1A 3WEXB 3VW3L 4AIZB 2EEDA 1RZIB 1IGIL 2YKLL 5EOQL 5DVKA 1R6VA 1X6NA 2X9YA 3JV5A 1J86A 3FB7A 2Y23A 4R2GC 5KVEL 4YHLH 3S36L 4F58H 3VFPB 4F2MA 5KSAA 3MNZB 3CSPA 4JFEA 4S1RH 5FM8A 3SBWA 3QG6A 4CN6A 5C0RH 4UOW0 4HS6A 2YC1A 2ERJC 4RRPG 3T4YB 1KCRH 3UEZA 4WWID 3CLFL 4P9HC 1RZ8A 4O58L 2YD5A 1AXIB 1LO5A 2AK1H 4M5ZL 3VFRB 2CR6A 3BKJL 1QYGL 4PLNC 1HYRC 1U92B 2ZCKH 3PP4H 5JW4N 3L3HA 4OCXL 3DUHA 3KPLA 1JTTA 2JE8A 2X6MA 1GGTA 5B3JE 2NY2B 2A6KA 4F3FA 3LVEA 3WL9A 3DUSB 3NCJL 1L0XA 4I3RL 1IGYA 4O2FA 5GQBA 4LRIA 4XC1H 5I9QC 2FB4L 3PP3H 3KR3L 4ZAKB 4Y4KD 3BP7B 1JL8A 1NDMA 3RWHB 5IEHA 5BO1H 4YJZL 4POYA 1H3GA 2CDEA 1AGCA 3MXWL 4KJYA 5FYLD 3VDCA 3NCEB 4H8WC 1NGPH 4XMLL 3UPRA 3DURA 5KVDH 3JWOL 3QEQD 1CF8H 4IRJD 5BZWA 5DC0A 4ODWB 3PV6B 3PGCA 2V9QA 4LSPL 4LSVL 3MLVL 4QCIA 3RWGB 2QKIA 1ZTXL 1K3IA 4Y4KC 3BEVB 5F7EH 1UM5L 1KPRB 3AMKA 1D5ZA 3IXAB 5TDNA 2JJVA 4M7ZB 3T2OA 3KDMB 4OCRL 2XN9A 2DMBA 3L5XH 2VC2L 3X11A 3DX8B 1CVRA 4Y4HA 2AXJA 3DGCR 3BDBA 5ADPL 1HILA 4MAYD 3VXRA 5DJDB 2FX7L 3U6RB 5DHVA 1OAUL 5TE6L 5IWLC 1WZKA 1XGTB 4KTDL 3C5JA 2X4RB 3TFKD 3L5IA 2R2EB 2FLRT 1M71A 3REWA 5A2KH 4Z7WF 5IOPA 1ODAA 3RRQA 1X9QA 3RGVB 3BQUD 3V7MA 3CH1B 4LLMA 2XRAL 4NJAH 1UM4H 1F4WL 1YEKL 1W8OA 4XPGH 3E8UH 3MSPA 1CICA 3X17A 2ZCLL 4MAYC 5D6DA 1O0VA 3EDDA 2WZPD 3VWJB 1INDH 2ZNWA 3U46B 5GSRA 4R4BB 3B43A 2X2YA 1P4IL 3HC4H 1OWRM 1IL1B 3BQUC 1KEML 3IFPA 1BJ8A 1AJ7H 3MJ7B 3DMMA 2YPVL 4RFEB 5BS0A 5DZLA 2E6JA 2CKBL 3K81A 2EDQA 3V52H 3D5OF 5CJOL 1TVHA 5EU3A 2UVEA 3F7RA 3TF7C 1XGYH 2HYMA 1EV2E 5BOZG 5FV1L 2W0FB 4X8JB 4UILH 5TFSH 4NWUH 4ISVA 3RY6C 5EU4A 3STLB 4YIQA 2UY6A 3DI2B 1W72A 4GSDH 3VXUE 4HWBA 1Y0LA 43C9B 4LVHC 2AXGB 2O5XH 1OB1B 4MWFB 1T7ZA 5DJZB 1BP3B 2F53A 1Z5LB 5B8CC 5IVXB 3TJEH 3C5SB 3BP4B 3HZMA 2VNCA 4R4FL 1LO0L 4DGVH 3E6FA 1C08A 3HC0B 1QSZA 1BM3L 2WNGA 4S0TD 1CDYA 1JTOA 4RAUB 2JELH 1J0JA 4M6ML 1KTLA 4Z77B 3WIHA 4LSUH 5DRXA 3WDHA 2OMBA 5D71L 4FQXD 4WDIA 5ANMB 3UTSB 2EC9U 4HKZB 4QRRA 1FAKT 2Q7NA 3G04B 3OL2A 2ZOKA 1R3IH 1SBSH 3MV01 2SEBB 3IDGB 1G6RA 4HHAA 4MZ3A 2LVCA 3L1OL 4TPRL 3CFEB 1R3LA 3S6CA 3I2CH 2ZKHH 3QQNA 1ADQH 2H1PH 4LAJH 5GGSA 5C3LD 4RBPK 4APQB 4Y5YB 3T0EC 4EI6B 1Q94B 4NT6A 4PGCB 4FQXC 2GY5A 4PJ7E 3O9WA 4NBZB 4TUJA 5EBMA 3CXDH 5SWQB 3QPXH 3QDJB 2HWZH 3V4PL 4ZPVB 3AB0B 4L4VD 5M7QA 1F6AA 2D3VA 5L2KA 3V5DA 4TUOA 4NKOB 3HPLA 5AEAA 3IAQA 3WXVL 1FN4A 3D69B 1VFAA 1KELL 5C0JB 3O4LA 1IILE 2OXGA 4PREB 2PYFA 4TRPL 1S9XA 4FABH 4X8XA 5HSFA 4EQ3A 4KMTH 3OMZA 5MEND 2IGFH 2OL3H 3SE8L 3VD3A 4B7IA 2BSSA 5GS1A 1BVLA 4NNPL 1UJ3A 3SDXF 4WO4A 3VGHA 2B0SH 5LBSH 4ORGB 1UA6L 3OXSA 4IRSB 4KTEL 3PWUA 1EX0A