4ONFL

Fab fragment of 3d6 in complex with amyloid beta 1-7
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
218
structure length
218
Chain Sequence
b'YVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRIEAEDLGLYYCWQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
pubmed doi rcsb
molecule keywords 3D6 FAB ANTIBODY HEAVY CHAIN
source organism Mus musculus
molecule tags Immune system
total genus 54
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4onfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4onfL01
1PKQB 4HKBA 4LDLB 4JO1H 1F4WL 3DXAD 3CVIH 2QHRH 5E00B 4ETYA 1U8IA 3RIAK 4QWWC 5K9QG 3LZFL 1UT9A 4KI1A 5LVEA 4M7JH 5CHNA 3BP5B 3D0VA 2L7UA 3V6FA 4NGHL 2VIRA 3GGWA 4H0GA 2BSED 1FG2B 1EAPB 5TJWK 3LKRB 3VI3E 3WUZA 1ZT4B 2XACC 5BQ7A 3MRHA 3V6OC 4IRJD 1NUFA 5IW3A 4OF6A 2F53A 5L9DH 1P2CB 3TO4C 3FQRA 3ZDZE 1CGVA 3CSYB 1FZMB 2Q76A 3EYVB 4G6FD 1INQB 5DT1L 1JGLL 1T3FA 5JZ7C 4AQ1B 1T0NB 3K3QA 2EDTA 2P7TA 1B90A 5BS0D 4BYHA 1Y6KR 4H0HB 1V7NH 1PY4A 2MPAL 1OGAA 1XIWD 3CUPB 4GMTH 4J23A 4NNPL 4ZS7L 1S9WB 4X4YB 1RZFH 5TE4L 4L9LA 4YR6A 4NUGH 2PNDA 4N0UA 4OUUB 5EO0B 1D6VH 4OZGE 3ROOA 3MJ7B 3UAJC 2P48B 4LHUA 4KI5F 2FJHB 3U30C 4HUMB 4CVWA 5I16B 1AQDB 1YY8A 2Z31C 3NBNA 5C9KA 4PTUA 2ZJSH 2GITB 3GSNL 2PO6D 3FO1A 1J9CT 2BOCA 5EOTB 1HCFX 3QEUB 4IRSC 3EFDH 2FEEL 4MYWB 4RMUA 4KK5D 1L4IA 1CFSA 2MHAB 4Z95L 2B7DT 1LHZA 5J6HA 4B50A 4NHUA 1T21B 3I02B 3NTCL 5I6XC 5JPNA 3AB0C 1A7RH 2WLZA 5HXMA 2OTWB 4N0YL 1BAFL 4MAUL 2AXFA 4P57A 4I77H 1HIMH 4YDVA 4R6UA 2X10A 2J12B 3ZDYF 3WIIH 3L95A 1E27B 2WBJA 2X9WA 1ZE3C 4E0RB 2BY1A 3M8OL 1N59B 4UOW1 4Y0GA 5D2NE 2CKNA 2VNCA 2VDKL 2AJUL 3G6DH 2VQUA 1W0YT 4LLUB 5FB8A 1KLFA 1R6VA 1F90L 4WW1B 3SKNA 3QIBA 4YE4H 1J5OL 3PHQB 2D7TH 3G6JB 3OB8A 2LVEA 3GSVA 4G6KL 5I17B 1AR1C 4OIIL 1QFWI 4ODXA 5A3IC 4AH2A 3C60D 2QHRL 2XA8H 1K4CA 4QRRD 1XGPB 4U1LA 1I3RA 4OF0A 2YXMA 3I3EA 5J8OA 5IB1B 2F9BT 1C16A 4FXGA 1JI2A 5F7DB 4KHXL 4N0CD 1IAIM 3HA0A 4Y5YC 4RWHA 3GSQB 3VW3L 5IFJB 3SE4C 4FQIL 1ZANH 3HFML 5KAQG 2HFGH 1PZ5B 1IGIH 1XF3A 4HXBH 2DTSA 4RMWA 3AB0B 3KGRA 4XC3L 2ED7A 4HUVB 1H3VA 2ERJC 4JRXB 3S8WA 2OTUA 4QRPA 1V7NL 5CBAB 3VXMA 3PJSA 5DURB 2BNQA 4OFVA 3TPUA 1C5DA 4LSUH 3WFDH 1XGYH 1JHLH 3BUYB 4GG6E 2R69H 4XVJH 4KJQD 3EFFA 2D4FA 3TVMD 3OG4B 4NUGL 2QQLL 3D3VE 4X6CB 4G42A 3KNBA 1K3IA 1OAYH 5JIKA 3TNMB 5F89A 1A0QH 1EMTH 5HHQA 5C0AA 2H1PH 2R2HB 1T20B 5E8NA 5D1QA 5C0BA 4PRID 4V1DA 2YSSB 2BMKB 1OP5K 4FNLL 4J6RL 1UCBH 2FWOA 4P4KB 2ATPB 1EPFA 5B8CB 2HT3C 2YPLB 5C8JA 5ID0A 3DUSB 1UJ3B 3ESUF 1ORQB 1NCNA 3TO2B 1HXYB 4OAWA 1A1NA 1A1MB 3O6MH 1B0WA 3TJHC 2ESVD 4XGZA 2PXYD 3ZL4L 4OZIA 3CFJA 5I1CL 5DHYA 2MQ3A 4MNGB 4Y5YB 5F44A 1T03L 1HIML 3MLSH 5HY9B 2QQQA 1CD9B 1EJOH 4XP1H 4BFBD 3I3BA 3LS4H 3KXFB 1CXIA 1ND0A 5TH2B 3RNKB 3VXTB 2IALB 5LCVH 1YNTB 1RJYA 2JJTC 4KC3B 1QBAA 1HZHL 3DV6B 5JQHC 3WFEH 1W0WB 5DK0A 5I73B 3BWUC 1REIA 4FXKA 4HCRH 3VWJC 2ERJB 4LCIH 2AS5M 3CMGA 4XBEL 3FQXA 2ADJA 3U4BL 3ARYA 3K4ZA 4LSVL 5F88A 4TUJB 1LQSR 2W38A 5TE6L 2PO6C 2NX5A 1FL3A 3DXAB 2KKQA 3KPOB 3LKRA 2VAJA 3MV9E 4HKZB 2J8UA 1BQLH 2XA3A 4NRZA 4XHJC 3T3ME 1G0XA 3CDCA 3EYVA 1RJLB 4Z78B 3EO0B 2X1OA 1AR2A 2QQKH 2PTUA 2QADD 4X6BB 1U9KA 4NDMB 2P5ED 4G9DA 3UBXB 1C5BH 2BNRB 2HTLD 1AGDB 4JVUA 4OGXL 3VWKC 3HR6A 4H20H 2OSLB 4HXBL 3CUPA 3WXVH 4G6FB 1OARL 4I4WB 4AG4H 3OR6B 5GSVB 1N0XH 1U8KA 5DUPH 3JWNC 3O11B 3LKOA 5ISZE 3SDDA 4S2SB 1AQDA 3KS0J 1XIWB 2DL9A 2ATKA 1OTTC 1G7HA 1MQKL 3EOBB 1QSVA 3LKPA 4JFDE 4LBEB 1H15A 4GRMB 1HNFA 3MX0A 4U0RC 4XCNA 3I6LD 3QEUA 1A6AA 5GIRB 1FZJA 3EYOA 3O41B 1BJ1H 4OBSA 3OJMB 3L7FA 4WI4A 4AIOA 4HX1B 1Y18A 4X6FB 5MERA 4GXVH 3I02A 2PO6B 3TV3L 1HCVA 4N90E 4UOJA 4FMFA 2OTWA 1CDGA 4S1RH 1NGYB 4NQEE 4HGWB 2OZ4A 4DKEH 3RVWD 3UBXG 1CT8A 3TFKD 4Q9CA 2CR6A 3SCMA 1A02N 3HI1A 5JA8B 1E27A 1QACA 4L3ED 4JQIH 3R8QA 4RGNE 1QLEH 4RAHA 2P1YA 4XCYA 3SOBH 1DN0A 2YEZA 5DYOB 3HZVB 2J6EA 2ZUQC 4XP1L 1ZHLB 2LV4A 2GY5A 4LMQE 4KJQC 1LK3L 5D7IA 3SJVE 4YNYA 3TWCL 3SEPA 2HN7B 4GOSA 4F2MA 3BKML 4TTGA 1NAML 1PG7L 3QDMA 4LLYA 4ZSOE 3LD8C 4UNTA 3BP4A 1RMFH 5TF1H 3QUZD 1ZS8B 4HLZG 1N6UA 1EEZB 3QJFB 3MZGB 3OF6A 5F7DA 1KCKA 2W9LA 1YEKL 3L3GA 4OKVA 3V4VH 3GSQA 4QRRB 4KV5F 3ILQC 1HK6A 3VA2C 4TNVF 5IWLA 1T1YA 3Q1SH 4ZMAT 5EBMA 1VA9A 5H94B 3LH2H 3BYYA 2QQKL 3MUZ1 1CDYA 3ULSA 1RD6A 3VFWA 2UY6A 2DF3A 4YGVA 2F74B 2Z8RA 5SWZA 3RTQA 3GFUA 4ZFGH 2EEBA 5D9SB 1XZ0B 4JRXA 3NCBB 3MCG1 2KQMA 3ULUC 2VOTA 2XZAH 4WW2A 4NQXA 3UTZA 2JIXD 4R2GC 1AHWA 4KI5D 3BUYA 4MNQE 1X5IA 2UWEB 3RA7H 5DUPL 4M7KL 4LOUD 5D5MB 2BC4A 2EDYA 3DX6A 1S5IL 1LEKB 5GPRA 3VE0A 3QDJE 3MA7A 4WI2A 3IGAB 1EVUA 1ONQA 2FLRT 3EJZD 5E24E 2Y07H 4J4PC 4WWKD 1KNOB 4I9WE 3TVMB 2D4DA 4FFZH 4XPTL 1AGBA 2EC9U 4PJBB 3S3SA 3WXWH 1CTOA 2WWMD 3U4EB 2WUCH 3LD8B 1ORQA 4M4RA 4W70A 4DN3L 5EFIA 3LCYA 4U0QB 4QEGA 2DQJL 5CLTA 2K1MA 5E08H 4PRIB 1T7WA 2GJ6D 4U3CA 5J1AB 5F9WB 2C1PA 4LSQL 2XG4A 4JANA 4UT6L 2XWBA 5HGAA 1JF5A 2BHUA 1ACZA 2B4CC 1RZ7H 2Y06H 4X5XB 3NZHL 5C3TA 2ESVB 4PV9B 1YNTA 3AS3A 4EBQH 1RZ8A 4JR9H 2CJUH 4NWTH 2BVYA 5SWSA 2XRAL 1JWUA 1KYOK 4XBGB 3SOBL 3UPRB 3GI8L 4LSPH 3V2AR 3C2SA 4M9PA 1LO4H 3SDAA 2DLHA 3X13B 1A7OH 2FECI 4I3SH 4HFWA 3PF2A 3ZO0A 2Q3AA 1MFCL 5FV2A 3KVQA 3Q5YA 5DR5H 5D70L 4ZPTB 1XF2B 3T0BA 4KY1L 1PG7W 4NUJB 1J1XL 4BSWA 3PL6C 5GGQL 5KANI 3F12A 1QO3B 4HC1L 3BH8B 2EXYD 3QIWC 4R7NA 1IGFL 4MJ6B 2Z91A 3MLWL 1FDLH 1WFOA 2KZWA 4MD5A 5EULV 1AGDA 4IRJA 1K5NB 4PB9H 1WBXB 4PD4K 2GY7B 2XTJD 3PABB 1XF4B 2NZ9C 1F3DH 2OM5A 4HPOL 3RUGA 1JYWA 3WYRA 4AMKH 3OR6A 4S1QH 1RHHB 4NKOB 2QADB 3BP6A 3DO3A 4RFNC 2AJYH 1UKSA 5BS0A 1YN6B 3SKUD 1C12B 2EE6A 3O4OB 3CLFH 3MV7D 5FFLA 3HC0B 4R7DB 4YWGH 1DBAH 4PJFE 1QFUL 4I0PA 1W72B 4OFYA 3IETB 2DJSA 2PETA 4ZPVB 2ARWA 4LBEA 1UH4A 2SEBA 5EA0H 3NMEA 5GIRA 5EU4B 3JUZA 1MIEL 3AGVA 4DAGH 1YEIL 4HX1A 3ULVF 4I2XA 1EZVX 3BPOC 3DV4A 4N9OB 5D1ZD 3RPKA 4X9FA 4IMKC 3FFCE 1I9IH 3JZ7A 2NTFA 3V0VB 4J2XA 3DMMD 3IDUA 2HKHL 5DWUH 4JHWH 3FCTA 3MUGB 3PL6B 4MJID 2D2OA 4X9HA 1X3DA 1IQDB 2F53E 3BXNA 5INCA 5C71A 5DRWA 3SE3A 1HYSD 3VGGA 1BFVH 3QB7C 3UTQB 4FQJH 1ZV5A 4WUUA 4F57L 5E6ZA 4AY0A 1SMAA 3QPXL 3SE8H 2CK0H 2DWEA 1CDHA 1KCUH 1D6EA 1ZHLA 3NCFB 4X5LA 5KVFH 3MJ8A 1HH6A 4KI5C 4L3EB 4EXPX 4PJHF 3H42L 4RDQF 5I1EH 4PP2B 4JR9L 2CJUL 1V7MH 1OGAE 1C7TA 4MHHG 5EH1A 2ZCLL 3CMOL 3MRPB 1U92B 1UCTA 4TSCH 3CH1A 4QCIA 3S96B 3VRJB 1G9NH 4WV1C 1WFUA 1A7OL 1UM4H 1OLZA 3L3OB 1EEZA 1RZGA 2VUOA 3FT2B 2Y5TB 1AJ7H 5FECA 4TOYH 3C60A 4PG2C 5JW3L 1U8HB 2E6JA 1BJ1J 4WFEE 2HLFD 2CLZB 2JCCA 1S7WB 2F58L 1W0VB 3BZDA 1YYLH 3HE6D 3VXUA 4WTZA 4NWUL 4ODUA 1QPXA 4P2RD 5H94A 5C0JB 2AXHA 2GEEA 3NGBC 1D9KD 5GJTL 2ADFL 3SDYH 3TYGL 3JXAA 4PB9L 5DS8B 4RAUA 2P5WA 5CWSA 4F9PC 4F7TB 1Q9LA 4A2MA 3IDXH 1IAIH 5FOBA 1UH2A 5ID1B 4WFGE 4WFFE 5ILTH 4LGRB 3U0WH 2RB8A 1ITBB 4GS7C 4WO4D 1CFTB 4NKIH 4TYUA 4UNUA 2YPKB 3CLFL 2JIXB 4WU5A 1ADQL 1NMBH 4JG0H 2BDNL 1IAKA 3PQYD 3OKDB 4PJBA 1SJHB 1LP9E 1FBIH 1TNMA 2LU4A 4DVBB 4FHBD 3U4EA 4PJ9C 4XP9L 1OM3H 4Z8FH 3LQZA 1U95B 3KPSD 2B0SH 4NN6C 4GJTB 4WWKB 1BLNB 2EIBA 3DGGA 2XZCH 1G7QB 4U1HA 3SGKC 1HHIB 5ITBL 2IBBA 4PJ7B 2PTTB 3U7YH 1MHHB 4XVTH 3NZ8B 1VPOH 1CD1B 4QYOA 2E7BA 3FMGL 2CDEB 2GJ6B 4Z76B 2ESVA 2PXYA 4JAMA 1UC6A 5ACZB 4UNVA 3IJHA 1X5XA 2DI7A 2AXJA 3UPRA 4XXCC 2E7HA 5TF0A 4ODHH 2HTKC 1N2RA 1YNKH 4QRPE 5I8CA 2VXQH 5C0IA 3BZ4A 1YMME 1FVDB 1EHLL 3WIHL 2O61B 4J3TA 2FH6A 4H88H 4Y4KC 4ZPTA 4F37K 1I7TA 4DZ8B 1FN4B 1OPGL 5IR1A 4NUJA 1G9NL 4B7IA 1M7DB 4RAVB 4RA0C 2B8OT 1QO3A 3QHTC 5IB5A 2H9GB 3QJHA 4M48L 5KSAA 1Z3GH 1AJ7L 5C0BE 3TBYB 4XI5C 3FT3B 2JJVA 1XR9A 3DMMC 4JRYE 3IDIA 1K5NA 2VJXA 4PGBB 1WBXA 3VFOB 4P23C 3LRGA 1WZLA 3S3PA 4Q9RH 1NCCH 5HHMD 1T1WB 2P5EA 1G6VK 4Z7QE 5GRUH 1QFHA 5MEOB 3WEXA 1OSZB 4PRNA 3MLXH 4JM2A 2MSPA 4OJFL 3JBG7 1GGTA 2XTJB 1V8HA 1J7VR 1UKTA 5AYUH 3L9RB 4U05A 2A6DB 2OMNA 1W72A 2X4UA 2VKWA 4D8PB 1PKOA 5CJBA 4YPGA 5KJRH 4X4MA 5DD5H 5HYSA 2R23B 2EO1A 5CKAA 1TQCC 3RDTD 1PKQE 3NH7H 3MV7B 1JFQL 4WRLA 5DRXB 4MCYB 5J6GA 1J8KA 4YDJA 3BESR 4ZO8A 1A2YB 5TQ0L 5L2KA 1LO2H 4B7LA 5C09D 3WNOA 4KXZI 4NO3A 2P47B 1PSKH 4CW1A 1D5ZA 3UTTB 1UQSB 3MRFB 1OD9A 2WBKA 3H9SA 4KKCD 4W6XB 5I15H 43CAA 2VAAB 3Q3GA 2B0SL 1JP5A 4L3CA 2J8UE 4LLDB 1EHAA 3HI5H 1E4WL 3U0TA 1UGNA 3N85H 5D1ZB 2XZCL 1OTSD 3X14B 3MQIA 4BQ8A 3N1MC 4LLMB 1P84K 1SQ2N 4HWEL 4A2LA 5C6WH 3DMMB 1B3JA 1NEZA 2JCCF 1KB9K 3PWPB 3GBMH 1KCVL 4P23B 4DOHB 1F3DJ 4MJIB 1VDGA 3BDYL 4TRPL 1K8IA 3IDNA 2D9CA 2X2YA 2WBJC 1AXTL 4G6MH 4KK9C 4I5BB 5BVJA 5ANMB 3SO3C 1WFNA 4KH2A 1U92A 3MOBH 1E4KC 4OGAC 2EZ0C 4ODHL 3S96A 2XQYK 2CDFA 4ZD3H 2CIIB 3IDYB 4ZOEA 4DTGH 4PR5B 4HQQH 1I4FB 4NZDA 5LQBH 5EZJA 5F72S 2VXVH 4OD3H 3SY0B 2DICA 4M43H 1ZTXH 1OQXA 4FFYH 3QUZA 4FQLH 5FO8B 5JR1H 1W0VA 5EORL 1MPAL 5C0FB 3O6KH 1FRGL 3GHEH 1E6OH 2Z8SA 4EI5D 5C0JA 4WNQA 3DUUA 5HYQB 4AENA 3MC0A 5DS8A 5JHLH 3IFOB 5BMFL 2AW2A 2VH5L 4P2RB 1U8JB 1IM3B 4YXLL 3QQ3B 4K7PX 3QULA 8CGTA 4DEPC 1AQKH 2C4XA 1AD0B 1WITA 5GRUL 1FYTB 3KR3H 3WS3B 4JQXC 1QBLH 1TJIL 1FC1A 4WTWA 1X5AA 1DQJB 4PJIA 5CKGA 3KHQA 4WY7L 4KZDH 3G5VA 5CGYD 3ULVD 4WO4B 3L3HB 3UJJH 3UP1A 15C8L 5D7IE 1U8NB 4DVBA 2DQIH 3OKEB 4X8XA 3KPRA 1U95A 5I8EB 4OF7A 1CQYA 4J1UB 4P46D 1A6PA 2AJ3B 5GS1B 1WC7A 4XCEB 3PQYB 3ZHLA 5D1QC 4JFEA 4KJWD 4XP6H 5DMIH 4IM8A 4G8GD 1IEAB 3X3GL 3O9WC 3VXRD 4PJ7A 2Q87A 4ETQA 5I15L 4H1LB 4LGPB 3ZYOA 2QEJA 5E1HB 4LKCB 1TQBC 1KJMB 1N8ZB 2XFXA 4Q6YA 3U0PB 3MZTA 5C92A 1P4IH 2V7HA 3KJ4C 4U1IB 2X05A 2YD6A 3H0TB 1LWRA 4FP8H 4YAQA 5D7LD 1NCUA 1SBSL 2ICES 3CSPA 4YHYC 3OZ9L 3GSXA 1P5VA 4JRXE 1QLRB 1SEQL 4LLQB 4G6ML 3L3JB 5FHBL 4NZUH 4O2FA 3O3BB 4DEPB 3LSOB 1MVUA 4ZOAA 1XGQB 5DRNB 4FFVD 4X6CE 2L7JA 1CYGA 3DVNB 4GKSA 5CZVH 1QD0A 4ZD3L 3ZE2F 5JW4M 1OAKL 3T4YB 5GRJH 1F8TL 1HEZB 1JZ7A 3DRTA 4YHZH 3GRWA 4NHCH 3K2UL 5F7KC 2KH2B 4KKCC 1MLCA 2D7MA 5EBGA 1FP5A 4H1LG 4HPYH 5HHPA 5IVXA 1ZTXL 4WUKH 1C8PA 4OM1H 2YPLE 2KL6A 1JV5A 1YYML 4UIKH 1YPZB 4MXVE 4J12A 2FSEB 3ISWA 4ERSL 3GBNH 3S36H 3LS5L 3A6CH 1S9KC 3O9WB 2BOBA 4OI9A 5JHLL 4ELMA 5K9KA 1DUYA 1KXVC 3IRPX 3EOTL 3MJ9H 1LE5B 5HGHA 4QXWA 3G9VA 5T1LA 1A3LH 1MCFA 5IROA 3T2NL 2EDRA 5DD1H 2NY0C 3VDBA 5FGBC 5HHMB 1RK0B 2BSSB 1TTUA 1WTGT 4TUOB 1IJ9A 3KJ4B 3BD3A 3DUHA 3THMH 1QBLL 1G6RA 5SWSE 4XC1L 3SDDC 5ERWA 4PGDA 2X4SB 4XWOD 2Z93B 4YHYB 3O8XC 5C0GB 5GGTL 5EUKA 4K55A 3QXDA 4KZDL 5IIEA 1NH6A 4D3CH 3FOMB 5FGCE 3WKNA 3JSSA 4ORZC 1UQSA 5E99L 1EJ6A 2W9DH 1SY6A 1DLFH 2IH3A 3S9DB 3RDTB 2P8LB 2A6KA 3IT8D 3DXAE 1KLUB 4NO0A 1RIVH 3MNWA 1IC5H 3UCRA 4K3EH 5ICZB 3LN4A 2P44B 5D1ZA 4OCLC 3M45A 4XVUD 5C09B 4XP6L 1YC7A 3QNZA 5EZOH 1HHJB 5L8JB 1P7QB 1J0KA 3AXLB 5B21A 5CSZB 2ENYA 1RK1B 1W72H 3HZYB 1KIPA 3SCMC 4P5TD 4NJAL 1QBML 4EUPB 1TZGH 2O5YH 4MJIA 1FFPA 1C08A 3S37H 2CQVA 2ITDB 3U82B 4OZFA 4GW1B 3RUGE 3ZT7A 5F7NC 1HILB 2A74A 1CGYA 1X5YA 3K1KC 2V2WA 1EIBA 3LRHA 3RU8L 3CDGA 3R1GH 4GAJH 5BS0E 1A6WL 1I85C 5CP7A 1ZLVH 4M9OA 4OB5H 2CIIA 3NIFE 4HV8A 1CICA 1N3NB 1JRHH 3NA9H 4X0KB 3IFPB 2YWYA 4UT9H 3F58H 4WI9A 1AI1H 4D9QE 3ARBD 1K6QH 2P8PB 3MV01 3SY0A 1QFWM 4OCSH 5CZVL 3QH3A 5EZIL 2Y36H 1QFPA 2HKFL 3PXHA 3TBTA 2VR9A 4W4OA 2D0HA 5I8OL 3K1DA 4N8VA 4P2QD 5EU5B 3V0WH 4QNPE 3SQBA 4HPYL 4N5EC 4P5KB 5JIHA 5KVMC 2MTPA 4WUKL 1G7PB 5DQDH 5SV3A 1RV6X 3HE6A 5E9DD 4EUPG 2QL1A 1A7PH 2JB5L 3IAQA 4P2RA 2AEQL 5EU3B 3RWHA 4R97C 3GBNL 4X4XA 4Y4FD 1D9KA 3MLVH 5KSVB 3T3PE 3MYJB 3WS3A 2HJKA 1KENH 4WUUE 3RTQC 3P9LA 2FGZA 3MJ9L 5D8JL 5C7XH 4JPVL 4WW2C 4MCZA 2VO5A 3D18B 5K9OA 2EE2A 5L88H 5CGMA 1UZ8B 2BSRA 1BQHA 4LPXA 3AAZB 4WO4A 2J4WL 3L3HA 5J7CC 1P7HL 2J88L 3QEHB 3BH9B 2VN4A 4YHLH 3T8XB 1QP1A 1SBBA 2R1WA 3GMLA 1RIHL 1JE6A 4TVPD 5F7UA 3V8OA 2AJ3A 4NQDD 4XCEA 1UM6H 4RA3A 4K3HA 3OL2A 4L8CB 1BM3H 4G7VH 3RKPA 1QA9B 5EBWB 4LPCA 5I76A 4H1LA 1EGJL 1K8DB 3KPSA 1A6UL 4W6YB 5D71H 1RIVL 4PY8J 4QRRE 4WDIA 1FFOA 1RUML 1PYWA 3REWA 4ONHB 4YX2L 3BAEH 3ALXA 4M7ZC 4G8GB 4U1IA 3VXRB 4ZTOL 2B4CL 4BH7B 4D2NA 5J9PA 1KTDB 4OQ1A 3V52L 1MELA 3QHFH 3ES6B 2JK5A 5A2FA 3VG9C 5IG7B 1TZGL 1RUPL 1N5AB 5ESVA 4QHKI 4B5EA 4GRLA 4PJHB 5GRWA 3O3BA 4KHTH 3B9DA 3UJIH 3LSOA 5F7EL 4MB3A 4BH8B 5D7LB 1UXSB 3WS6C 2UWEE 5C0RH 4OLWH 1RVFH 5D5ME 1TPXB 3F8UB 4E42B 3DVNA 1JNLH 1WBZB 3R1GL 1LEIA 3MRGA 1NCWH 2OQJB 4YBQC 3SDAC 4PJXF 1ZWIB 5F96H 3ZZ1A 1HEZA 4YDKL 1JRHL 3NA9L 2H3NB 4W4NA 2Q20A 5F9AC 3F58L 1B2WL 1MFEH 3OKNB 5F1KC 3VCLB 1M7IB 1DLHB 3AU1B 4PJBE 3MRCB 1ZLUH 1KT2A 3OKOA 2HLAB 5F70A 4NP4L 1VADB 5JMOC 1JCKA 1QVOB 1GGUA 3LHPH 1YPZA 4MXQD 3UYRL 4RGOL 3BJ91 2ZCKL 5HVHB 4HULB 1B6DA 3MLZH 1PBYA 2ZOKB 2E8ZA 5HD8D 2AK4A 3RY4A 4R8WH 1LE5A 5J06A 3QUMA 1NBYB 5IB4B 1M1SA 1T5XB 5DLML 2ZUWA 4E5XA 3UZVB 1BOGA 4EN3D 1RK0A 2ESVE 4ZQKB 1M6OA 4DK6A 4L8BA 5C7XL 3GRWH 3B9EA 4N1CA 1OQOA 5F1NA 2DYPB 5KVGH 3RWIB 5L88L 2Z93A 3CPLA 5IQ7L 1CLZH 2F19H 2Y7QA 3SE9H 2E3VA 2MCPH 4I0PC 1RU9L 1HQRB 5EUOF 3SKMA 5E6IA 4IRZH 3WJJA 1MVFA 5TFSH 3OKMA 1YEHL 3MREB 3RDTA 1JWMB 5IUSA 2OJZH 2X4PB 4X8JA 1Q0YH 5IEHB 1T7VA 3BSZH 4JCLA 3VRIB 3FN0L 4GBXC 5HGGS 4P3DA 3RWGB 1RZIA 4F58H 3MYZA 5BXFB 1F3RB 1GIGH 4LDOB 4RQQB 5KVDH 1BGXH 3AXLA 4WU7B 4R0LC 2JJUA 3FAWA 5CSZA 3OMZA 3WCYA 1RK1A 3C5JB 5MEPB 3HZYA 4JREB 2COQA 2FYYA 5T1KD 1X5KA 3EO9H 1G6RH 2CLRB 3SE3C 1KPRB 5JQ6H 1Z5LA 3G5XA 5GS0D 5ESAB 5FOJA 1NGXA 2P5EE 4MX7B 3FZUD 2EIEA 5HHVH 4P99A 2APWA 5KSUA 5IJVB 3VMNA 4PRHD 5I8KL 1N3NA 3UJIL 3IFPA 4TNWF 3MGOB 4K8RH 3IDJA 5IB3A 2OR9H 1A1OB 2X1WL 1AO7A 4X4ME 3RAJH 1FH5L 1JNLL 3CXDH 4CADA 2UZIH 3VFVA 3PGDB 4X9GA 2EXWD 1MFEL 1VFAB 4OZHB 1Q1JL 3DETC 4NRYA 1OF2A 1RHFA 3I6LE 4QKXB 4OZFH 4WIQA 3H9SE 2CRMA 1BECA 2BERA 1Z9LA 1H3PL 3GO1H 3C2AH 4HW6A 4EI5A 1NC2A 4OD2A 4P2QB 1NPUA 3OX8B 5CEZH 1KPVB 1BF2A 3MYJA 4K23H 1BVLA 4Y5VA 2AJXH 4R0LB 1J87A 4D0CB 3RVUC 1YN7B 5E9DB 4HKJA 4HS8L 2YC1A 4PTTB 3QIUD 3VXNB 1MCIA 3CSGA 4NJ9H 5CZXC 4Y4FB 3L6FB 4L3EE 1WCBA 3ZYZA 3BW9B 2IQAA 4XB8A 2DIAA 1UACL 1MJJA 2H32B 1MJ8H 3KLAB 3MACH 1WZ1H 2VQ1B 4Y5XC 3TBWA 3SE9L 3DURA 4L8CA 1AXSA 4LPUA 4IRZL 4XP5H 2X70B 3BEWA 5TFSL 1BQUA 2O5ZH 3D2UD 1TJGL 2I5YL 3HG1D 5L2JA 3P0GB 5DJ2B 5H37G 3SGEI 3VFNA 4P46A 4NQDB 1MAML 2OL3A 4X7EC 3KYOB 3HNVH 4ZFOA 2CRYA 1GIGL 1BREA 5KVDL 5HYJD 4OBRA 3FQNA 5IQ9A 1X9QA 2DTML 2IAMD 2VDPH 3S34L 1KTDA 1S7UB 2YUWA 3C6SA 5IMMB 4PGCA 4U1NA 4XXDB 1HHGB 1TJHL 1T5WB 1ED3A 1N5AA 4OF3A 4GT7A 5ICYB 2VABB 2ZSVA 1DBJH 4XCFH 1J8HA 2X40A 4LIQH 4PV8B 3SDXA 3O3AB 4L9DA 3G9AB 4KKAD 1QKZH 4LARH 4LLWB 5D93C 5H35B 3KLSA 3WBDA 3Q6FB 3K4DA 2FRGP 4E42A 1WBZA 1J86A 4F7PB 2HVKB 3ARQA 2OQJA 3O2DL 5D96C 1R3IL 1NMCB 3VDCA 4CVXB 4JN1H 3TC9A 4PJIE 3E6FB 4H1LH 4HIXL 3T0VA 1KJ2B 1INEL 2DKUA 5HBBA 1S3KH 5AG9A 1B9ZA 4F37F 3MCKA 5I1JL 1DBKH 5C2BL 2G9HA 5DC9B 4OCRH 1IKFL 4AZ8A 1ZMYA 3BO8B 1Y6NR 1KCSH 4KKBD 1QVOA 5LWYH 1IT9L 3FRPG 2M8XA 4MD0B 3OJVC 1T04A 3F7RA 5JHDA 3FB5A 4NC1C 5KSAC 3SBWC 2IPKA 1NCAL 1VGKB 4LCWD 3GHBH 4AIZA 5AAWA 3RL1A 3EHBC 3TT1H 5BRZD 4PJ7E 1IGJA 4PJGA 4RGMB 2YA2A 3P4NA 1T5XA 2H2PD 2QR0A 1SVCP 3U2SA 5FYKU 2BRRL 5JNYB 1MCCA 3H3KA 2GJ6E 2X4OB 4K23L 4KU1A 4KFZC 1SM3H 3HMXL 2CXGA 4DGVL 1MCKA 3V5KB 2ITCB 1I75A 4JM2C 4YHIB 3SDCC 3RWIA 4OLUL 5HYEA 2E7LA 3I50H 3UC0H 3IF1B 5KANG 4EN3B 3M07A 3HPLA 4XNXH 1HHHA 3PNWB 5DD6B 3T0AA 2NY1D 1BBDH 3G6AB 3MREA 1IGTB 1MEXH 1JWMA 2X4PA 4KZEL 1FE8H 1JUFB 3QISA 1FYHB 3WL9B 5DJYA 3RWGA 4XP5L 5BXFA 4U7SA 3B9KD 3V9FA 4XVSH 4L5FL 1MCBA 4WU7A 2NY7H 3O2WH 4NFBA 4MA8L 3MRQB 1AY1L 3ZKND 1FFQA 2BCKA 5EN2A 4U31A 3VMOA 3WNPA 1L6XA 2D31B 1BQSA 1PLGL 4MQTB 4D0BB 2VDRH 1S9VA 1R3JB 1ZHBA 1FV1A 5GGRB 5HPMA 4GAYA 4P5TA 3RP1A 4ELME 4MB5A 2HRPL 5J1TC 1GRWA 4G6JH 3WDHA 3ZYJA 2DQGH 2XTJE 5IJVA 4HK3N 3QHZL 1SYSB 25C8H 3NAAH 4U6XA 3W0WD 4LARL 1G7IB 2FHBA 1HI6A 2Y5EA 1ZT1A 4GFTB 5C6PB 2DQUL 1NJ9A 5BJTA 3PIQA 4S0TD 5AWNL 2A1WL 2FD6H 3OXRB 1YUHB 32C2A 3MV7E 4PRHB 5IVNA 3P9WB 1MJ7L 1ZLWH 1HE7A 5CINL 4M5ZL 3MFFB 4NBXB 5DJCB 5MEND 3J7HA 4JDVA 3ARBA 4OZHA 3LEYH 5DQ9B 4EUPH 1DE4B 4HH9B 3FQWA 4OCRL 2DD8H 2HWZH 4NCC2 1XH3A 4RCAA 4OV6F 1LO5B 1BF8A 5LWYL 3B2VH 3TNNB 5LGJA 3INUH 1QFWH 3DX7A 5GRXG 1OL0A 2B1AH 5JIIA 1NDMA 2XWTA 3OHXB 4O02L 1X6NA 1XGTA 3OSKA 3GHBL 2X42A 3WFHA 4IEFB 2WP3T 1YN7A 3TGXA 3CX5K 4ZOCA 3NIDE 4OFDA 1FNSL 2CLVA 3QXVA 1F3JB 1MCDA 4DOHE 4Y4FA 3PDOB 3ARDA 4MJIE 4Y2DD 5DVNA 1BD2A 5EOCH 1MRDH 1MWAB 3S35X 4JFYA 1FL5A 4A6YB 1BVKA 5IW1A 5ANME 2V9QA 4JY5L 3P0VL 4EQ2A 2EDXA 4ELKB 4E9LA 3K4AA 1JYNA 2Y9RT 2X09A 3QIUB 4HXAH 3C8KB 3UC0L 3LMJL 5HHXL 6FABL 5TGBB 5CEZE 1RJZB 1BJ8A 1CR9L 4FG6D 5FA3A 2VE6A 4XNXL 1WEJH 1CLCA 5CILL 2W60B 4KJPD 5FAAA 5F7LB 4N0FA 4J7RA 2B1HH 3OXSB 1QFOA 4KUCF 1I9JL 1Q9OB 3S98A 3D87B 5AD0A 3NFPB 4HBCL 4AM0B 4ENED 2F5BL 5D2LF 4NO5A 3FRPA 3I6KB 3T4AB 4UB0H 3Q48A 1EHXA 2O5XH 2VL4A 5EPMB 4CMHC 1BFOA 3D2UB 2PYED 4Z7WF 4Y8AA 3ARED 1JMZA 2EKSB 3HG1B 2BRQA 3G5ZB 1HHGA 3JWOC 4IDJL 1XCQA 1W8NA 4KRPC 4P2RE 5HYJB 1RY7B 3O3AA 3CC5B 5IJKC 2IAMB 5H35A 5EU6A 5CUSH 1I1AD 1NLBH 3ULVH 5FM4A 4NZRH 2A0LD 3HUJA 4PJAA 5C08A 1LO0H 5IF0A 3CZFA 4ONOA 4GW4B 1S7SA 3NAAL 4PRDB 4DFIA 1A14L 3GJFK 1KJ2A 1GH7A 2NY1C 4PJEF 3BZFA 5GZOD 2QKIA 3BP7A 2WM0A 5C0CD 2OL3H 2HVJB 4C83B 3QXAA 2XZQH 2JB6B 3CU7A 4LIQE 3LY6A 3VD3A 4C54A 3FRUA 1LE9A 1RULL 2AJZA 1U2HA 3PQYE 4EIZC 1JNNL 1SJXA 2PW2B 4M93B 1VGKA 3ZDXF 1L7IH 5D7JA 3L3KA 3ZKNC 1KG0A 2KBGA 5HI4D 3ESVF 2DLIA 2M26A 3B2VL 3RPIA 3KPSE 5GGUB 1ROWA 4KRNA 3B2UC 4AL8L 2PYFA 3OR7A 5F21B 1U91A 5BRZB 4UTAH 4IOIB 4QXUH 3GMPB 5IROC 3BDXA 1YNLL 4EN3A 5MHSD 1HQ4B 4EDXB 2E5EA 5JUEH 5IMOB 2XN9D 3G6AA 4NC0B 4AEEA 1LK2B 5EC2A 4HXAL 1MI5B 3BYTA 1K4DB 2Z92B 2FGWL 4JZNB 3D48R 4P59H 3BKCH 4GAGL 4UINL 3EYSH 4JM4L 4AJ0A 5LGHL 4CGTA 2EC9T 5JW5A 4PB0H 1CLYH 1UB6A 4LHQB 2NY1B 1HINL 3HPJA 3WD5L 2B1HL 4UIMA 3QFJD 1UWEH 4K8RC 2VLJB 4IMLA 5I19L 1NEUA 1EO8H 4PJCF 4I3RH 1YPZE 3B9KB 3QG7L 3MRIB 3WE6B 4BFIB 2DQTH 3KLHC 5H2BB 3QUKB 2Q7NA 5FHAL 5L7XH 3OAYH 2DQCH 5T1DH 5T1KA 2VN7A 3SGJA 2DDQH 5TE7H 2JELH 5DDHA 5JLZB 3IJYA 4UI2A 2J6EL 1CK0H 4BKLA 5CD5C 4KJYB 1YZZA 5HHME 1I8KA 5KTEH 2PCPB 4YDLB 3ULVL 4NZRL 1RAMA 1VSCA 1FO0A 1GZQB 3QQ9D 3EYUL 4WHCA 2RJMA 5IGXH 4PJXB 5KS9A 4HFUH 4KPHL 5C07D 3NN8A 3W0WB 2IPUG 5EWIH 2DQDH 1MIML 4HH9A 4HDIB 1T89A 4PREB 4HZAA 1NAKL 1UWGL 1T4KA 5AUMA 1TFHA 5DMKB 3R06B 1XGRB 3QUXC 4ZFFB 5MENB 4K7FA 5C09E 3OHXA 4G43A 2ICWB 3I9GL 4JO2L 1PW3A 1X5HA 1OAZH 2HG5B 1DQML 3ROLA 2YA0A 2ZUUA 4IIQB 2GIYA 1ZGLP 4K94C 5DMGC 1DEDA 3T2OA 1XFPA 4LF3B 1R5IA 4XZUB 2FX9L 4KDWA 2FCBA 4JHAL 4RMTA 1HKFA 4XPFH 3RJDA 4M61B 1I1AC 4UTAL 3UDWA 3IKCA 1C1EH 5TDNA 5I66B 5MP6H 3QIUA 3JUYA 4I3GA 1H3XA 1NGWA 2JJSC 4Y2DB 3KDMA 4R4ND 5EOQL 4FQQB 3F7VA 3RKDD 4JZOA 1UA6H 5IHZB 5EUOB 3O4LD 1HHKB 3F65A 2F54A 1N7MH 5H37H 1IVLA 4R90H 3OKLA 1CDIA 1YEGL 3K0WA 4PUBL 1AO7E 1DQQB 2BVQA 3HR5B 1GOGA 4JKWA 2D7QA 4XMPH 5ENWB 12E8L 2VITB 1DANU 1EBAA 4K71C 3QCTL 1QQDB 1U8QA 1UEMA 1CLYL 4G9FD 4PB0L 1FGNH 4O51B 1U3ZA 1LNUB 3N1FC 2ZCHH 3TA3C 3FQTB 5DQJA 1TZHA 4X6EB 1UWEL 1CD8A 2AI0L 1JJUA 1DTUA 1YY9D 1EO8L 4LEXL 1VACB 4KTDL 4I3RL 3QUXB 4HWBA 1KC5L 2H32H 1EXUB 4ZS6C 3I75A 3JV6B 3R0MA 3CC5A 5E1AA 2PYEB 3BGMB 4G6AC 3EUUA 3AREB 1TVHB 3BHBA 2DQCL 3ZE1F 4LCCA 1A21A 3HC4H 1AKJD 5KSBF 4Z0XB 3N9GL 5LAXA 4FQ1H 4OT1H 3MOAL 5EOCJ 4M1GL 4TVPH 2DM4A 1GC1H 3KYNB 4QRQB 1I1AB 2AKRB 4G5ZL 1Z0NA 5HI5D 4JKKA 4DGIL 5DEZA 3ZMRA 2DIJA 1ES0A 3TIEB 3R0NA 1KN2H 1E4XH 2WW8A 1NGQH 3ULVE 5T5NF 5C0CB 4TSBH 4H8WH 2VR5A 1KEMH 3IU4L 4KUZL 5KVEL 2I27N 2K7PA 4MA3A 1IARB 3HZKA 2X4NA 1KLGB 5GGUA 2LVCA 4NN5B 3LQAH 5IHUH 3STLB 1NBZB 4CDGC 3PXJA 3BT2L 3RWFB 3UBXI 3K74B 4LCWA 4BQBA 4G8GE 5J12C 1EEYA 3TA3B 3VXRE 3NIGE 2XKNA 2C1OB 5JOFA 1KJ2H 4OKDA 4U1KA 4X6DA 1T1ZA 5DJ6A 3CFBA 1HQ4A 1J8HE 3GJEB 4XWGL 2IPTH 3B5TA 4QHUB 5IMOA 1I9EA 2DBLL 3OGCB 2R0WL 3DOSA 3SDXE 3RI5K 4XMLH 2ICEB 5D7LE 1WSST 1CU4L 5JOEA 1HXMA 4WWID 4KUCD 2A9NH 2Z92A 3CFDB 4HKXA 4JG1H 4JFFD 1CXLA 1EZVY 3CFEB 3O6FD 5E6IC 5TQ2H 4Y19B 3WJJC 4ALAH 2RCSL 2XN9B 1N7ML 4LVOC 3TT3L 4ZTPL 1TETH 3AS1A 1BIHA 2R1XA 4JRWA 1QLFB 1ZEAL 3NCMA 1YEEL 4HF5L 1S7TB 2AABH 4K7PL 4MB4A 3WE6A 1LMKA 4NRXA 5E8DH 2ZCHL 4GH7B 3QFJB 3SO5A 1GGCH 1IGMH 1OAXH 4YHOL 5BZDA 3BPCB 3HRZB 2VLKB 1IKNA 4GKZB 4PJGE 4H25B 5DJXA 2VC2L 1JTPA 4LP5A 3MMEB 4ZODA 4YC2C 3QWRD 4PRPD 3T0EC 4P4RB 5J12B 2PW1B 4APQD 2DLFL 3FQUA 4K3GA 4OM0H 3NCJH 3OKKB 4YUEH 4J3XA 4JFOA 4TVPL 3C5ZD 3DI2B 4MJ5A 5IM7A 4YIQB 2OK0L 5HJ3A 3X17A 1DBMH 4X5WA 1I3VA 1BZ7A 3RRQA 1QOKA 3GSNB 3K8KA 2E9IA 3FTGB 4DW2H 3P4OA 2AJVL 5FUOH 5HDBE 3ZHKA 2VUYA 5C07B 3HNSL 3MRJA 5LXGL 2C3XA 1R0AH 4HLJA 5E5RB 1NGQL 4H8WL 3GMQA 5DJ8A 4C4KT 1SYVA 2BY0A 2HG5A 4Q2ZB 5E03A 5B4MD 4P5MB 2FECL 1U6AH 4P3CH 1I1FA 3G04A 3TPKA 5FYLD 5GS0H 4JO3H 4JY4A 3K46A 5IHUL 1F4XL 2CUMA 4HIEA 4GRWB 1A5FH 2FEDC 1FO0H 4Y5VC 3WFBH 3MXWH 3WHXA 4JFQB 3P0YH 4KK8D 2NW3B 5FDWB 4UMGA 1QRND 2DMBA 2VQTA 4Y2DA 3WUWA 3IDGB 4CBPA 3P30L 2AGJH 4L29B 1CGTA 4HUXB 1RZJH 3TN0D 1ZVSB 2PF6A 3MV8D 1U8LB 4MA1C 3T0EB 2CSPA 3GMOA 2A77L 3E6HB 1JIBA 5BV7C 1JGEB 3HR5A 2G2RB 5ALCL 5ENWA 2A9NL 3D25A 3MBXL 4TTDD 1FZOB 4ZXBD 1KBGH 1QQDA 1KPUA 3RWDB 2H26A 3O4LB 1IM9A 5D7SH 2YD9A 5D6CB 1TETL 3DLQR 5CEXA 5A2LH 4OZHE 2DM3A 4CDHA 4LNVA 5GGSB 2Y4SA 4PJ5A 1KFAH 3CIQA 4G9FB 1EXUA 4AEHH 1P1ZA 2G5BB 4P2QE 4YHKL 3PUCA 1TVHA 1ZHKA 3EJYC 1MCPH 3IXAB 5DUML 3NVQA 3CFCH 4NKDB 1OAXL 1WVZA 3L7EA 3ZHDA 5E9DE 5SX5H 2H8PA 1PZUB 2QQNH 1DFBH 4X80L 4YDIL 1NFDB 3ARXA 1BD2E 4OSUL 4WEUD 2R0LH 1ZHNB 1AD9A 1BWWA 1AKJB 4Q6IA 2AP2A 4YUEL 3WLBB 3WDJA 3TZVA 2N56A 3DIFB 1W8OA 2CKBB 4LK4A 5EBLA 1IQWH 5E8EA 1DBML 1WAAF 4X98B 3ILPA 4CU6A 4U1GC 4MAYA 3ZE0F 5FUZL 4HWBH 5FUOL 3RVTC 4RFOH 3MLTB 1KLGA 4TVPE 1VFBB 1NQBA 1A6ZB 1CL7L 1UM5H 1L7TL 2IFGA 3U79A 3ZKQD 4NQDE 5D2NA 1HKLL 3CU1A 2NW2A 1SJEA 2E27H 1MCOL 2R2BA 3V5HA 4PJDA 5HHOD 3QDGB 1D5XB 2AEIT 2V2XB 4FS0A 5LKNA 4NOBA 3G5YB 5GS0L 1YMHA 5B38G 3GJFA 4Z7OE 4ONGL 3DSFL 4M7LL 1FAIH 3V6ZB 5DF0A 4OF5A 4AT6B 1ZA3A 2LAAA 3SKJL 5ADOH 3H6JA 4DZBA 2FDBP 5BVPH 4BK4A 3B6SB 3C08L 3QDAA 2Q86B 1SHMA 4HAGA 1MF2H 3F62A 2E7LC 4MHHI 1I7UA 3BE1H 4ODTH 1A7QH 4KVCH 3B3IB 4X99A 2AEPH 2I07B 1CBVH 3MODH 5DUBB 2D7PA 5J1SC 5JXEC 3EDKA 3LPWA 1MHPL 2XXCB 1MHEB 1QLFA 1R3HA 1WWAX 5JO5B 2NY4C 2VISB 5D2LB 3O6FB 3TYFB 3GMNB 2EYRB 4K9EH 3O3DB 1MREL 2YD2A 1Q72H 4XPBH 1TVDA 3D39D 2R8SL 2NXZD 5IMKA 1PEWA 3UPCA 2EYTB 4U1SA 4Z7WB 1MWAL 4LVHC 2FX8L 4A6YL 3HRZA 4KXZH 3DSNA 3O81A 4K3DH 1KB5L 2O93L 2EDNA 4ODWB 4UU9B 2WLYA 4O9HL 3QUYD 3OB0H 2ARJA 2LFGA 4DUVA 1S7RA 3IFLH 5I74C 2GK0A 3W11C 2FR4B 4PS4L 3VXPB 5CIPB 4GG8B 2XWJA 4QTIL 5DJ0B 5E7FA 4EIGB 5ACLA 1Q8MA 3PWVA 4U3XA 4UV4H 1KJ3H 3BPLB 4M6NH 3GMRA 2UYLB 4H26B 4MQ7B 4U6VH 1SMOA 5F7MC 4ZAKA 3MNVB 2CIKA 4D9RD 5JTWA 4PRPB 2NCMA 4PJEB 3GSNA 4APQB 1I7RA 4M62H 1CXFA 1R24A 4JFPB 1MCHA 4QHMA 3P73A 2YBRB 3MV11 2VLLA 4MD4B 3VI3F 5C07A 4F9LA 4CVUA 3BQUC 4JE4B 3PP4H 1OWWA 4X83A 3ZDZF 5I30H 2DQFB 1BEYH 1S5HA 4PBVC 4RIRB 3X12A 4RFOL 1AE6L 2GSIA 4CJ0A 5FCUH 5HGBB 3U7WH 5DJDA 2A2QT 3MLRH 1GZPA 3FB7A 2VDOL 3UMTA 4KROC 3DX9B 2FHFA 4K7PY 3VG0L 2VLRD 3MPCA 2GSGB 5CSBA 1UYWH 4NNXA 3LV3A 3I6GB 4O4YL 2CMRH 4KQ4H 5GHWH 5J56B 5EO1B 1X7QB 3EOAA 4KKLC 1P4LA 3ARDC 4UBDD 2HT2C 3MV9A 5JW4Q 1MHCA 4OZGF 1M4KA 1J18A 1ERNA 1N4XH 2IH1A 5IVOA 4E41D 1KTLB 1KCRL 3OV6A 5I74B 5IW6B 2M1KA 4XAWH 3KPNA 1E28A 3RY6A 5BVPL 5IEKB 2GJZA 3FB6B 3GSUB 2G2RA 1NAMB 1QRNB 4FQ2H 3D85D 3MROA 5EZLB 1FZOA 2HRLA 3C5SB 3HZMB 3TN0B 3CLEH 3MV8B 4PRHE 3O4LA 1JNHA 5EB9A 2AEPL 4WENB 4AEIH 1G9MH 3QO0A 3SKOB 3UO1H 1OW0C 1AFVH 4ZUWA 4KDVA 4PBWD 4Y16D 1VKXA 1KACB 1CE6A 3VD4A 3WN5C 5FKAA 4TULL 5J13C 5F9JA 5TDPA 3WLWC 5HHNB 3GSWA 2HH0L 1MFBL 3ARUA 4ZXBB 3EYQD 3RWEB 4G9FA 1S8DA 4PJCB 3JVGA 1HSAB 5DK3A 2G5BA 1EO7A 4CU7A 5K9JL 3JWOL 4CNIA 3OJDA 3IXAA 2JLLA 3HNTH 4JDTL 3PG2A 3ME0A 4XNUH 3JTTA 1AP2A 3P77B 4F33B 3DROB 1FSKB 4OIAA 5B38A 3HE7C 1YQVH 4QHLB 1FNAA 2K9UA 3NACL 4KROB 3QT2A 4LCUB 4YXKH 1U93A 2AQ1A 1MCWW 1NFDA 2VWEC 3CH8A 3RZCC 1IZKA 1ZHNA 4UDTB 5I18L 1T2XA 4QRUB 3PHOA 4OGYH 3T77B 1D5MA 2IANA 4WEBL 2FZ3B 2P4AB 1QHPA 2ZKHL 4S1DC 1H0DB 4G80B 4I1NB 3ALPA 3GEWB 1MFDH 4LQFH 5J11B 1JPST 5EC1A 1DQLL 4P9HH 2I9LA 3HB3C 4M62L 2OCFD 3OBAA 1CIDA 1A6ZA 1X5LA 3B5HA 4QOKB 1UVQB 3QP3A 3PP4L 1GGBH 4XNMB 5C0EB 3VFGH 5D7JC 2QSTA 3RVVC 3AY4A 2VXUH 3EYFB 5KG9B 3HG1E 3L5HA 2W9EH 3HS0B 4OGZA 5FGSA 1S7QA 4ZSOA 3RGVA 2VDLL 5EIIB 3V6ZA 3NPSC 2BNUB 4F3FA 5HHOB 5HYJE 5DVOA 2AQ2A 5IOPA 2JTDA 4GG6F 2Q8BL 2BK8A 2PR4H 5E95B 5TPWL 1NLDH 2CMRL 2YPVH 4QWWD 1UADC 3CK0H 3TP4A 1RZKH 2IADA 3TBSA 3HE7B 4OFKA 1N4XL 1OSPH 4BM7A 2R4SL 4C56D 3AMKA 1MCNA 3IXTB 2X44D 1TCMA 4XAWL 2C26A 4JO4H 5DK2A 1JPFB 1T0MB 2A9MH 4K07A 3TO4D 1Q94A 5IFHL 4JFFA 5GRVK 4OCXL 2R56H 1SY6L 5TDOA 4G8IB 5LBSH 3FO2A 4JFZH 1VENA 3O45A 1PAMA 3E3QC 3W5NA 4UDUB 5JZ7D 4NKMA 4Z0BH 4MNQA 2YA1A 4FOMA 1YQ2A 4WJ5B 1AGFA 2ZG3A 3C6LC 4KQ3H 4KRLB 5GGRY 3D39B 2NXZB 1F4WH 3ULUF 2XY2A 4LCWE 1ZA6B 4QO1A 1SEBA 5FO7B 4EI6B 4PLKC 3D9AH 1G7LB 3UAJD 3JV5A 4XNUL 5BRZE 3LZFH 3BGAA 1QSZA 2Z31D 4BSVA 5KSBB 4NGHH 4MQ7A 4YXKL 1EV2E 3F7YB 3TCLB 1D5BA 2Z35A 3H7BA 4JZJB 3ARFA 5DRZA 4EDWL 2YN3A 4PRPA 3AVEA 4LEOB 1OGTB 5GJSL 4OLZH 2BFVL 2FJFA 1JGUL 2RIKA 4IRSD 4ZUUA 4OQTL 3VI4F 4M3KB 5DHVB 4B0MM 4MD4A 3C5ZA 1KJVB 5DT1H 1JGLH 1T89C 5CD3B 1H8SA 3T3MF 3GSRB 1WT5A 1ZGLB 2FJGB 4JCMA 3GSOA 2D3VA 3FN9A 2MPAH 5FO9B 4ZS7H 1DVFA 5FXCH 1M71A 1IGCL 1FNGA 4MVBD 3O3EA 1L9NA 3DX9A 4K94L 1JN6A 2WUBL 3VFGL 1WZKA 4NQTA 4HT1L 2V2TB 2IEPA 3D5OF 2PN5A 3VGEA 1X7QA 2EICA 1LEGA 2WZPD 4Z7UA 1P7KB 4YQXH 2G75B 3F7PC 3GSNH 3ZKSD 5DJAB 5T1MB 1AR1D 5BZWB 5A3ID 4ZUVB 4IHOA 5I9QC 4KTYA 3UDWC 3FB6A 2YPVL 1GXEA 2IQ9L 4HCRA 3FHQA 5CJOL 3MO1B 4Z95H 3U46A 1QRNA 5L8KB 1S9YA 5C0NC 4IS6B 3NTCH 4TPRL 4LLVB 3L3IB 3PWUA 2WINA 4N0YH 3REVA 3FONB 1BAFH 2Y6SC 4E41B 4PLJD 2B5IB 2C3VB 4MAUH 5IVZB 5T5NG 5FM5O 4JO4L 3DO7A 4FABL 5FV1L 3GMMB 4PP1C 1P53A 4GRWH 4QY8A 3JWDC 4MSWB 1RUAH 3VXOB 3D85B 3KXFD 5M94B 4ZXBA 1XGUB 3RWEA 3QNXB 1I8IB 3M8OH 3S35H 3V6BR 5MENE 2VDKH 4Y16B 3S97C 2BVPB 5I1GH 4PJFA 3MGTB 2BVOA 3QWOB 3V7MA 1F90H 4YHNA 3MRLA 4QRTA 2HJFA 1FNEA 3KPMB 5JORB 2ADIA 1J5OH 4NNYA 5HVGB 4H5SB 5JA9A 2M2DA 3LKNB 4KQ3L 3V4UH 4G6KH 4OIIH 4YFDB 5D1XC 1Y6MR 4UQ2B 1A22B 3VA6A 1S9XB 3D9AL 4OFPA 2Z4QA 1AGEA 3SN6N 3FFCA 4XPGL 1NMAL 2FZ3A 2Q6WB 2YUVA 3QEGH 3WIFB 1YEFL 4KHXH 2XPGA 5DZLA 3X3FL 5I1AB 3VFUB 4U2ZA 3VW3H 1NUGA 4PRBA 4FQIH 4OLZL 2HT3D 1FGVL 2BNRD 3ARZA 3HFMH 2RFXA 1E6JH 4WFHD 2ICWJ 2EYSA 3LDBC 4IBLT 1B0RB 5CMAA 1KELL 4YPJA 2GUOB 4DN4H 3TJHD 4PD4J 2YR3A 1UVQA 4HIHA 4XC3H 4XNMA 1ZLSL 1WK0A 4Z7VF 4CMMB 3MBEA 2NZIA 3IS1X 2LTQC 4LKXB 4LRIA 1Z9SA 2PTVA 1NL0L 4PJ5E 5C9JB 3UTPD 1U8MA 3QPQC 2QQLH 2NY6C 2F8VA 3QUML 5HHOA 3D0LB 2NR6C 2RQ8A 2GCYB 2PYEE 3VWJD 5DJZB 1JHTB 4XBPB 4EOWL 4NN7C 3PV6A 4YQXL 4HIJB 3X11B 1NGZA 4F15B 3NPZB 3SGDI 4FNLH 2FIKA 4RWYL 1OY3B 3PWLB 4J6RH 3RI5F 5F1IB 4AYFA 4G7YL 2FBJL 3HAEB 3P9MA 4WVRA 4HJGA 3MRDA 3MRRB 4JPIA 1IBGL 1MCLA 1F6AB 4XHJD 1XF5B 3ZL4H 1CZ8L 1TZIB 5EU7E 4C56B 5DVKA 1XAUA 5I1CH 3CDYA 4HC1A 3U1SL 1WV7T 4X9IA 1T03H 4WHTB 2MNUA 5C0DB 1EBPA 2RGSA 5INDB 1RUAL 3TO4B 3VWKD 4U7KA 1U58A 3O2VL 4NO2B 3BGFC 3LDBB 4R96A 2DLEA 4MVBC 3MFGB 1PGRB 1HZHH 2FL5B 5DTFB 3S35L 4KRMB 3D39A 3OGOE 1IEBB 5I1GL 5FK9A 5JPMB 4I18A 5FUCE 2R9HC 2LAGB 4J8RA 4JB9L 4PJDE 4XBEH 3T08A 5DD3L 3U4BH 2VZSA 2GK2A 4LSVH 1LP9A 4NQCD 3LEXB 1IKNC 5TE6H 1OTTD 3V4UL 3FN3A 3EGSA 2W0FB 3QUYA 2NY6B 3HAEG 1VCAA 4LEOA 4G8EB 2VERN 4ISVB 3U30B 1LD9A 3QG6A 1OTUC 2P24B 2Z31B 4NN7B 1A9EB 1NFKA 3QEGL 4R3SA 4XP4H 5MHSE 4PLJC 4XPAL 3FHAA 1I8LA 1HDMA 3PDDA 1DUZA 5DSCA 4N9GB 2DBJA 4IRSB 2Q7YB 1PEZA 3MJ6A 3QO1B 1FVCB 4OGXH 1E6JL 1YJDC 1TTGA 2X4RB 1ZGLA 2FJGA 5DVLA 1B0GB 3O6LL 2LU3A 4QRSA 4DN4L 4HIIB 1OARH 5I6XB 3ZKXC 1WIPA 5CIPH 3VFTA 5ESQB 1X4YA 1A6TA 4V2CB 2HFEB 5CGTA 1XMWA 2X7LA 2MFNA 5EIQA 2DL2A 2I25N 1MH5A 3K8MA 1YMMA 5GZNC 2G75A 1H8NA 1MQKH 2X4QA 1WWBX 2VLRA 5CJXA 5T1MA 4C59B 5A2JH 3GNML 5BZWA 3NFNB 4MS8C 4OD1L 5C6TL 3PWJA 2CKBL 4JHBA 1NCTA 5E5UB 1BFSA 1IGYA 1JK8B 2YD1A 4IS6A 3TV3H 4LLVA 2C9AA 4JRYA 1QNZL 3WSQL 4E41A 5BV7L 2IBZX 3DX8B 5F3BB 4Q7DA 3HLAB 1Q9KB 5IVZA 2OP4H 3ILQD 5L6YH 4NFCA 2XI9A 4PPTA 4GXUM 5I0DA 3D85A 2DKSA 2EIZA 1UZ6E 1XGUA 2OTPA 3C09C 4ZUSB 4LSTL 1QR1B 5KW9H 4ZOBA 4L8SC 2R15A 5C07E 3VFPA 1A4JA 4YHML 3QNYB 3ULUD 3AC0A 2A6IA 3FFDB 1QSFD 4R2GD 3D69B 4D0DB 3J8F7 3VFSB 1LK3H 3TWCH 3LKNA 4JEGB 3BKMH 1PKQA 1NAMH 1PG7H 4GRWE 3NFSL 4DKDC 3BIAX 5E00A 3SGEH 2VL5B 4LASL 3LIZL 1DEEB 2VXTL 5JXAL 3BP5A 2Q6WA 4J4PD 4LVNC 2NY2C 3BX7C 4JPWL 3H9YA 3ARSA 2EDOA 3WIFA 1ADQA 1FG2A 3MRBB 1EAPA 1YEKH 2DI8A 1ZT4A 1GAFL 5E8PB 2E9JA 5IT2L 4I13B 4C57C 1P2CA 1FQ9C 2NY5C 3CSYA 1FZMA 3CJJA 3GB7B 4Q6IC 3NA4A 3TZVC 1INQA 4L4VD 4XP4L 2DKMA 4YZFE 3FJTA 1ZLVK 1T0NA 3O4LE 5DA0B 2IG2L 3GIVB 5IMLB 4XB7A 5ICXB 4MAYC 4CMMA 4UILH 4BSJA 2YOCA 4X4YA 1S9WA 1EH9A 1IFHL 3C09B 5D2NC 4ZDHB 4M7KH 1X5JA 4G9FE 4L8SB 4OUUA 5EO0A 5ISZD 2DS4A 1F11B 1INDL 4U33A 4ORGB 1JZ5A 1S5IH 4XNQB 4M6ML 3MJ7A 1WWWX 3BKYL 5I16A 2FJHA 2UVFA 4HUUB 1GSMA 4X7CC 3TIDB 2YK1H 4HIJA 2GITA 5F3HB 4XT1C 5CBEB 1A9BB 4XPTH 5EOTA 4S11A 1FJ1B 5GS3A 4F7EB 4XHQA 1R3KB 4ODBD 5AYQA 1L9MA 3VWJB 1NFDE 4DN3H 2X89D 4YHPB 3LPGA 2MHAA 1JTOA 3WIHA 1LP9F 2DQJH 1T21A 3IU3B 3PL6D 4R4BB 5A16B 4YJZL 3QIWD 2VXSH 4LVNB 1GGIL 3EIFA 4Z77B 4NQED 1JZ8A 2IANE 4LSQH 4BK5A 4XH2B 1GCFA 1Q0XL 3RVXC 3NOIA 4CJ1A 4UT6H 2HJLB 2OXHA 2IJ0C 2OP4L 4WHTA 4QHKJ 5L6YL 5C0DA 1KGCD 4LL9A 3BWAB 3JTSB 1VHPA 3BVNB 2GAZB 4MDJB 3NZHH 5KOMC 2NZ9D 4RMSA 4BA8A 4E0RA 2F5AL 4S0SD 5BO1L 5KW9L 1N59A 2V7NB 2W07A 5DTFA 2XRAH 5FYLL 5HYIA 3T04D 1FVEB 3GI8H 4LLUA 4WCYL 4MLSA 4Y2OA 3VWKB 4R26L 4WW1A 5DO2C 3FOLB 4O00A 3PHQA 5E5MB 3G6JA 4JQVC 5I17A 1MFCH 3OWEA 2XIDA 4JJ5B 1M05B 5D70H 1XGPA 4KY1H 4RNRB 1J1XH 4FN0A 2X1XR 5GGQH 4NQCB 5IB1A 1KIRB 4HC1H 2FHCA 1BIIB 3LKQB 3QSKB 1IGFH 1JZ4A 4ZAKC 3MLWH 4U0RB 1EFXD 5IFJA 4IRSA 1H3TA 2Q7YA 3QO1A 1Z2KA 1FVCA 2X4RA 4NQUA 1PZ5A 1EEUA 4HPOH 5FCSH 2X6MA 3EDJA 3GDBA 5AAMA 4PG9B 4JFFE 3TH2T 1IILE 4KDTC 4HUVA 2OBGA 2A83B 4R4FH 4N8PA 3BKJH 1PX4A 4UILL 2F8XC 5CBAA 4Z7WE 4OZIF 1QFUH 4IOFC 1N6QL 3GZKA 1ZLUK 1Q9WB 3U6RB 4FQHB 4X6CA 1NCBL 2C7UB 2UUDH 3TNMA 3BDBA 2Q8AL 1MIEH 2ZUQB 4LSDA 1YEIH 1U2CA 2R2HA 2XQBL 1T20A 4P2OC 2YK1L 1P9MC 1NFIB 3B8YA 4HK0B 2YSSA 2BMKA 1JPSL 1VFUA 2GTZB 1A6VL 4P4KA 2ATPA 3T09A 5B8CA 4JFXB 2YPLA 3DUSA 5JDSB 1UJ3A 3PE9A 43C9B 1YEDB 3TO2A 4PRPE 3RY6C 2HKHH 3GKWL 3PGFL 4PJEE 4WTXA 5DEGB 1HXYA 3FT4B 1A1MA 4TN9A 1JPGB 4FQXC 3GIZH 2V5TA 2VXSL 3MA9L 4F57H 2WIIB 2EH7L 3QPXH 4MNGA 4Y5YA 4I8DA 2LQRA 1WBYB 2J8UF 3LPFA 3SE4A 1DP0A 5DD0H 5GGSY 5HY9A 1U3HC 3OQ3B 3QNYA 1NBQA 3RNKA 3KXFA 3VXTA 2AK1H 5TH2A 3H42H 2IALA 2ZNWA 4QTHB 3VGAC 3VXQB 3DV6A 1W0WA 2ZCLH 3CMOH 5ALBH 5FKPB 1MFNA 4LVEA 1UXWB 4PBXA 3MCLL 1I3GL 1HN1A 2NLJB 4MNHB 1CFBA 2AXGB 4OLXL 1QSFB 4R2GB 1BBJB 4TUJA 4XNZC 4AEFA 5FYLE 1ETZB 3H2WA 1PJ9A 4BZ2H 3MRBA 4Z7UE 3QAZC 3DXAA 3KPOA 4U1JB 2GT9B 2ZNXA 4HKZA 5E8PA 1MCJA 3OPZL 5JW3H 4PJ9D 5EO9B 3CVHB 3E0GA 4NIKB 1J88A 3QDHA 5FF6B 1J1PL 3MUY1 2F58H 5HTSA 3QCUL 2I9TB 4LAQL 4NWUH 5F9OL 2C3HA 4K3JL 3GM0A 4P2OB 3CXHJ 3W9DB 1RJLA 4Z78A 3EO0A 1HH9B 1QRNE 4DGYL 2DMKA 4TQEL 1MLBB 4X6BA 4ZYKB 2Y72A 4NDMA 4O2CB 3V8CA 5GJTH 3MV8E 2ADFH 3TYGH 2BNRA 3UBXA 3QEQD 3V5DB 5IMLA 2MKLC 2P42B 4JKPL 3SPVB 3P4MB 3HCVB 1Z6JT 2OSLA 4CN4A 2B2XL 3ELAT 4I4WA 4L4VB 4FQXB 4OIBA 4RGNC 5IBLC 2ZSWB 5GSVA 1KCLA 4ZDHA 3GK8L 4MWFB 1GHFL 2VKXA 5IKCB 4R4FL 3O11A 4U1MB 3BKJL 3EO1B 4S2SA 5KAQF 3AY4C 5F7FA 1ADQH 1XIWA 5IP4A 2BDNH 4WHDA 2HTKD 3EOBA 2JJTA 1RURL 2KPNA 4U2YA 3RGVC 4GRMA 3ECBB 3TBVB 2VZOA 3WNMA 5ISZB 1FJ1A 4PLNC 3NCCB 5AZ2L 3UTTD 5FA4B 4XP9H 3O41A 4XPHL 4Y4KD 2Q3ZA 1UENA 3MNZB 1CG9B 4X6FA 3R8BB 3TESA 4OLVH 5D7IF 1P6FA 3KAAA 4JFDB 2PO6A 1G0YR 3WFCL 5F6HI 1NGYA 4BZ1L 4ZUTB 4HGWA 4M8QB 1DSFL 5ITBH 4M1CC 1HOCB 4XI5D 1EVTC 4OZ4B 1GYAA 3PWPD 2N4IA 3BWAA 4L8DB 4P23D 5T3ZD 3FMGH 5M95B 2J1KA 2WAHA 2F53D 2GAZA 3BVNA 3QFDB 4Y4HC 3GIZL 1DANT 3QIWB 2VZVA 4NQEB 3JV4B 1NBVH 1IL1B 3VJ6B 3WKML 2GTWB 2OR7A 3KYMB 5DD0L 5DYOA 3HZVA 4B41A 2MWCA 1LDPL 3VWKA 2AK1L 1DQDL 3L5XL 2N7AA 4RGNB 3DYPA 2HN7A 4OLYL 1KUMA 4LSRL 1A7NL 1CL7I 2ZPKH 5ALBL 1FIGL 1EHLH 3WIHH 2XNAB 4RFNB 4S1SL 2EEDA 3IFNL 1M05A 4HHAB 4WW2F 5HHOE 4B53A 1OPGH 1ZS8A 3RIFF 5F8RC 2AAVA 4NQCA 1G7JB 3QJFA 5CLWA 2CXKA 4BZ2L 4M48H 1KIUA 3S4SB 3ZKMC 1CGSH 4QRRA 3UJTL 4U7MA 2P8MB 5DXWA 4YBLC 2I24N 1GPOH 3BPOB 1N5YL 3KYAA 3Q6GL 4NQVB 3AFLA 1FLRH 1EFXB 1CWVA 2F74A 1LO3L 1FYTD 4NQSB 5D9SA 1XZ0A 4G8FB 4RISL 4OJFH 5DFVC 1OT1A 4CVZB 1WT5C 3E2HC 4Z7VB 1S7VB 1XR8B 4KK6C 4WFFD 5I71C 1D7FA 3A67L 1DVFC 1Q9WA 2UWEA 1NC4D 3MRKB 4KK9D 2WBJD 5D5MA 1R5VB 2YHGA 2ZOLB 2R2EB 5T3XL 4DCQB 1YEJH 4IJ3C 1CXKA 1ORSB 1LEKA 3D39E 1JPTL 1JFQH 1RJCA 2EZ0D 2G60L 4OGAD 3IGAA 3DTXB 5HI3C 1JGVL 3BEVB 2B39A 1NFIA 1KNOA 5TQ0H 3TVMA 5I1IL 1ZSDB 5E2VL 4X4ZA 3S4SG 4KMTH 4FZ8L 43C9A 1YEDA 5E2TL 1O7SA 3I2CL 4WV1B 5MEQB 3KLDA 4XMKL 4FMKA 4OLVL 2H2SD 4PRIA 3FB8B 5J1AA 1E4WH 3VFRB 4TSAH 4YFLF 4LU5L 1YDPB 4GSDH 5BOPA 1V05A 2VSDA 4HWEH 2YUZA 1H5BC 4NZTL 2NNAB 4GUPB 4ODVH 3KPPB 4D9RE 4HJ0C 1WUNT 2AJSL 3ARGC 2XG5A 3MUHL 4PJ8C 4RBPH 1KCVH 2XZZA 3BJLA 1KULA 4GQ9L 1F2QA 1JGDB 2QBWA 1K2DB 4X5XA 3BDYH 4QTHA 4PV9A 4TRPH 1QZ1A 4M1DL 1AXTH 1NBVL 3QI9C 1ZXQA 3NGBB 1CF8H 5J3HC 2YRZA 4XBGA 2OMBA 4U6HB 1T1XB 5C86A 1UXWA 2NQCA 5I1DB 3RUGF 3X13A 3CZJA 5H8DA 1B4RA 1TVBB 4KMLB 1MFAL 5ETUB 1BBJA 3VXMD 3V7AE 5C3LD 2BNQD 7FABH 3MJ9A 3QCVL 5I71B 4POUB 5IK3B 3M17B 2CUHA 2EDWA 5IBTL 1I7ZB 5JW4N 2ZPKL 4GS7B 8FABB 2FB4L 3RIAF 5FYJD 2Z9TA 2VLRE 1XF2A 3NIFF 1CDBA 3KWWB 3MRNB 5EORH 1MPAH 1T2QL 4HUWB 5IFAL 2BZDA 5C0AD 5T33L 3BH8A 4J4PA 1FRGH 4JDZB 4I48B 5GXBB 4MJ6A 5D1QD 4V1DD 4Z5RB 1R3LB 4O2CA 1CGSL 3WHE0 5GISH 3O9WD 4PJ9B 3UZEA 2G5RA 4E41E 4DK3A 1T66C 5BMFH 3LRSB 2EECA 3PABA 1GPOL 1XF4A 4NN6B 2VH5H 4NSKB 3GUTB 1EGJA 4YXLH 2ZSWA 5I2IB 1RHHA 2D7NA 4NKOA 1FLRL 3L3DB 3MRMB 3QEQB 5L0QC 1H5BB 1YN6A 1C12A 1TJIH 2Z8VC 1ZLWK 4PJ8B 1RIUH 3ARGB 3MBEC 3HC0A 2RR3A 4R7DA 4FQCL 4GW5B 3T3PF 2FH8A 4RRPG 4LRIC 4UUJB 4WY7H 1WQVT 3IETA 4ZPVA 3QI9B 4L9LC 3LB6C 3MR9B 3TBVA 15C8H 1YEJL 1HNGA 3IDMB 5FA4A 1CLOL 5EU4A 3KYKH 1GVIA 3VFMB 4ACPA 2QTEA 2DN7A 4X7TB 4RZCB 4JLRB 1QTYT 4POZC 2ARJQ 4U4BA 2KUTA 1HYRC 4O2EB 1PQZB 2V17L 4KMTL 2NX5D 2XV6B 4MJ2A 4M8QA 1P7QD 3DBXB 3AS2A 3X3GH 5SWQB 4HKBB 3V0VA 3A6BL 4WHYG 4Y4KB 2X89A 1U8IB 3MUGA 3PL6A 1IQDA 4IOSD 5CHNB 1C5CL 4TSAL 3UTQA 1UB5B 3V6FB 1IL1A 2OR8A 2VIRB 3VJ6A 4GSDL 2GTWA 2VZ3A 4W68A 2E9BA 3IVKB 4MQSB 4ODVL 1SBSH 5D72L 4Q9QL 3MRHB 1VEOA 4KAQL 3OZ9H 2F53B 4L3EA 1SEQH 3FQRB 4O5LH 4XTRC 1N64L 2Q76B 4PP2A 2DJ4A 5FHBH 2NY0D 5E2JA 1CF8L 3S7GA 3H3BC 3SQOL 3ZLQC 3MRPA 1T3FB 2EH8L 1D5IL 4HLZH 5IESL 5ITFB 4HHAA 5L0QB 1OP3H 4I18C 1P5UA 2QSQA 3QXTA 2P7TB 3SDDD 3VRJA 1OAKH 1F8TH 3L3OA 3QIBC 3O8XD 7FABL 2KZ1B 1NUDA 2UWEF 1OGAB 3FT2A 2Y5TA 5D5MF 3RNQB 4L9LB 1NGPL 3K2UH 1MY5A 4YR6B 4N0UB 2DQEL 1U8HA 4BZYA 2CLZA 1TQCB 2J3SA 4MXWL 1S7WA 3ROOB 4LHUB 1YYMH 2H2SC 1YY8B 4W81A 3DYMA 4ERSH 4PJBF 4PTUB 1QYGH 1Y0LB 3FO1B 2GYSA 1YJDL 1ZT7B 3CFIC 3LS5H 5B39B 5GISL 5SV4A 3KJ6L 3P11H 4C56E 4EEEA 3EOTH 4F7TA 3SCMD 3ARWA 3BRFA 1S7VA 1CFSB 1FFRA 3V6OE 3T2NH 1JHKL 4NHUB 5ID1A 4PYGA 2ICWI 2RHEA 5JPNB 4UAOC 1CDUA 1CFTA 3DWTA 4DCQA 2YPKA 1FL6B 2AXFB 4P57B 4DVRL 4XC1H 1RIUL 1VGEL 2JIXA 4UV7L 2WV3A 4YDVB 2YRPA 5GGTH 3L95B 3AMLA 4ESKA 1NC4B 2WBJB 3OKDA 4JHZA 4HD9A 1SJHA 3SO3B 5CJXC 3G6JE 2DIBA 5E99H 2BXYA 3EDEA 3KYKL 3QDMD 1X44A 4LHUG 1FORL 1TXKA 1ZOXA 2IGFL 5FB8B 4WWKA 3MTRA 3SKNB 3CFKB 1BLNA 3STZB 1G7QA 3GSVB 5B39G 1HHIA 4ZG1A 1YECH 4ODSL 4AH2B 2PTTA 2NNAA 4N5ED 4PG2A 3KPPA 1MHHA 1K4CB 4CKVX 3NZ8A 5ADPH 1CD1A 2CRIA 4U1LB 4NJAH 1QBMH 2CDEA 1K2DA 2GJ6A 4Z76A 2EEAA 4W6WB 3ZE0E 5ACZA 1C16B 4FXGB 4U6HA 5SWZD 3ZSTA 3RTQD 5I1DA 3RU8H 4F9PA 3TM6A 4D9LL 4O5LL 1A6WH 1EA9C 1EEQA 1XF3B 4MA7L 1UWXH 4JVPA 1QBBA 1I7ZA 1Q38A 3ZTJG 4QXTB 4KWUA 4O58L 4XCCL 8FABA 1FVDA 3ZT6A 2O61A 4JM2F 4DZ8A 1KTKE 1P4BL 1FN4A 3Q5OA 1M7DA 2VSCA 2F15A 4QRPB 4RAVA 4RMVA 5EZIH 3H3PH 1T22B 3VXMB 3PJSB 5DHXB 2BNQB 4HWUA 1C5DB 1ZAGA 1ZK9A 3TPUB 3BN9C 4KTEH 2H9GA 2HKFH 4M03A 2VDQL 3OAYK 3E8UL 5I8OH 3EFFB 3U9PL 1WISA 3TBYA 3FT3A 4G42B 3KNBB 2NY5L 4CN6A 1IRAY 4QLRA 2DMCA 4PGBA 3VFOA 3QZWB 5F89B 3UROR 4Z7NE 2K3TA 2JB5H 1BP3B 5HHQB 5C0AB 2YKLL 4Z6AT 2AEQH 1UFUA 1G1YA 5E8NB 5D1QB 1QYGL 5FEBA 4V1DB 5I2IA 1T1WA 3L3DA 5MEOA 4DKAA 1OSZA 3P11L 3QEQA 5C8JB 5ID0B 5D8JH 4MNGE 5E2WL 4JPVH 1TQBB 2DYPD 3L9RA 2A6DA 4OAWB 1A1NB 4UUJA 4D8PA 3LOWA 4HK3J 4XGZB 4OZIB 2J8OA 2VDNL 3CFJB 3CVHH 3KXFE 4MLIA 5CCKL 5I75C 2J4WH 2ZWLT 2J88H 2EDDA 5DHYB 3TEUA 5SWSD 2R23A 5HPOA 5J89A 4XXCA 3VFMA 3ARRA 3MV7A 1RIHH 5DRXA 2R4RL 4MCYA 1FZKB 2D0GA 3ABZA 4X7TA 3V95A 2FATL 2CDGB 4JLRA 1A2YA 4YBQD 3SDAD 1KXTB 1ND0B 3S88L 1RJYB 4DFHA 3S36X 3O2DA 1PQZA 4PLOB 1SVZA 3UTTA 3MRFA 4FXKB 2VYRE 1WJ3A 4Y4KA 1T7YA 1GOFA 3QZWG 1J05B 1EGJH 2VAAA 1A6UH 1J1OL 9CGTA 1TMCB 3FQXB 3ZTNL 2ADJB 4LLDA 1JBJA 1RUMH 5F88B 5E2UL 2YWZA 2R0KL 3X14A 3S3JA 1UB5A 4YX2H 2NX5B 2ZUVA 4LLMA 1FL3B 1G9NC 1EO5A 3DRQB 1JZ6A 1O0VA 1YECL 4P3WA 4ZTOH 2B4CH 3IVKA 1F97A 3DMMA 4OCMC 3V52H 3PWPA 5ADPL 1ULVA 2J8UB 4P23A 2BNRE 1RUPH 2NYYC 4EJ1C 4NRZB 4WFHE 3W81A 4I5BA 1MRFL 4MDIB 5ANMA 2R29L 4DKFL 5F7EH 1GJIA 2ZZUT 3STBA 4G9DB 5ITFA 1RFDL 3DYOA 3HMXA 4GAFB 1K9TA 4ZO7A 2YMXL 2NY0B 4PR5A 4I0PD 4Q0XL 4YDKH 1I4FA 3LEVH 3RNQA 4OFYD 4GLRH 4QXGL 5I75B 1B2WH 4D9QD 1U8KB 3UTPE 1IC4L 3LKOB 3SDDB 3WFZA 5FO8A 1RUKL 3HI6L 4PJIF 4HMEA 4NP4H 3H3PL 5C0FA 3O8XB 4KTEL 3TJEL 3PGCB 2ATKB 4FRWA 3S37X 3UYRH 4CU8A 4GBXD 4RGOH 5A40E 1G7HB 1Y0LA 3LKPB 2ZCKH 3T0DA 1ZT7A 5HYQA 1H15B 5B39A 4XCNB 1A3RL 1MRCL 1A6AB 3IFOA 1FZJB 4TUKL 3EYOB 4JPKL 5IWLC 1U8JA 3L7FB 5DLMH 5HVWA 1IM3A 1Y18B 5MERB 3CX5J 1S78D 3QQ3A 4Z18A 4OCYL 5JOPD 3ULUL 1AD0A 1B6UA 3GI9L 4WUUD 1FYTA 4PJ7F 4YXHL 1CT8B 1FL6A 4AIXA 3SCMB 4L4JA 1DQJA 1NCDL 3HI1B 3S5LB 5IQ7H 1AHWC 3O0RL 1NC4A 1RU9H 3CVHL 3EAKA 1U8NA 3OAZH 1CFVL 4XCYB 1YEHH 2L0DA 5DFWH 1DN0B 2YEZB 3OKEA 1E4KA 3OG6B 5I8EA 3PP3K 4J1UA 1OCWL 3VD9A 3CFKA 3N50A 5GS1A 3FN0H 3PQYA 3STZA 4M6OH 4NQCE 5D7IB 3VRLE 4YNYB 4MJ4A 3H9HB 1IEAA 4F2MB 4P4KC 5B8CC 3DETD 4JO1L 3QDMB 1OAQH 3CVIL 4LLYB 1A3QA 1UJ3C 1CGUA 3BP4B 3CAFA 4LKCA 1KJMA 1N8ZA 2E7CA 3VXUD 4M7JL 3BFOA 1H3UA 3U0PA 2V9TA 3H0TA 1FNFA 3L3GB 5IVXF 4OKVB 3RVUD 4QGTA 5B3JF 2P5WD 4C58B 5L9DL 3S5LG 1QLRA 2UV3A 4LLQA 1T1YB 4Z9KB 4TVSa 5EBMB 3L3JA 2JF1A 3WO3B 4R97B 5I8KH 5CZXD 4MZ2A 1UEYA 1QRKA 1XGQA 4QXTA 5DRNA 3ULSB 3VFWB 5I73C 5ELIA 4ELMF 4YGVB 2IWGA 5SWZB 3RTQB 4JQXA 1FH5H 3EBAA 3UEZA 4YFEA 3T4YA 4WW2B 4JKMA 1T22A 4NQXB 3UTZB 4GMTL 1AHWB 1RZFL 3LEVL 2E7MA 1Q1JH 4GQPH 2BC4B 4DUWA 1D6VL 1TDQA 3DX6B 1E0OB 3QZWA 3VE0B 3MA7B 2OI9C 1A4KB 1ONQB 2FSEA 1H3PH 5B3NA 3K7UA 2ZJSL 4PRIE 1AGBB 3O9WA 2NTSP 3EW3B 4IRJC 3EFDL 5EFIB 4HS8H 4HUNB 4RDQG 2BSSA 1A7RL 4TUOA 3F7QA 2C1PB 4M7ZB 4JANB 3FAXA 3NIDF 2XWBB 1UACH 5HGAB 1CN4A 3N06B 4I77L 2X4SA 1FZKA 2CDGA 3VG9B 1AXIB 5C0GA 3WIIL 1XIWC 2NMSA 3ULUE 3FOMA 1QSFE 1RZ8B 2IMMA 4WHYH 2APFA 3Q0HA 5SWSB 5C2UB 1JWUB 3BIKB 2XXMB 4HS3B 3QQNA 1XT5A 3G6DL 1TJGH 2P8LA 1J05A 1KLUA 2I5YH 3P2TA 3GM8A 3SDAB 3NCYS 5FGCB 5ICZA 1MAMH 4YE4L 2ED8A 3DARA 4HFWB 4M6OL 5C09A 2D7TL 1HHJA 3VI4E 1P7QA 3BZEB 3DRQA 2Z8WC 3IB4A 5KSAD 2E6QA 1OAQL 2DTMH 5DEFB 3S34H 4Y89A 2O26U 2XA8L 3TCXA 5C70A 1F58H 1RUQH 3EHBD 4KK5C 4LFHG 4EUPA 1TJHH 4BSWB 5J57B 2OI9B 1S78C 1NKRA 3F12B 2WNGA 4HEPG 2ITDA 4GW1A 4R7NB 5FM8A 4MDIA 1HILA 3MLYH 4L4VE 2Z91B 1FC2D 4MD5B 1ZANL 4IRJB 4JM2D 2HFGL 4Q9BA 3O2DH 3SDCD 1R3IH 1IGIL 2BY2A 3RUGB 5FGBA 4X0KA 2OX5A 4HIXH 1U3YA 1X4XA 1INEH 2W0PA 1J0JA 3BP6B 2P8PA 5I1JH 5C2BH 4YEFA 2JKXA 1IKFH 1J0HA 5BS0B 3O3UN 3O8XA 4LSUL 2J5LC 3PGCA 3WFDL 1XGYL 1IT9H 1JHLL 1I1CA 4I0PB 2D03H 2R69L 1DZBA 4XVJL 5EU5A 3RBSA 5L2KD 5T3ZH 2ORBH 2SEBB 3C60C 4P5KA 1OAYL 1NCAH 3R4DA 5SX5K 1G7PA 1A0QL 5E94B 3H9SD 1EMTL 2H1PL 4EVNB 5EU3A 2P43B 4GBXB 4I2XB 3AUVA 2BRRH 4HSQA 3DV4B 4N0CC 5KSVA 1UCBL 3HMXH 2NTFB 4DGVH 2IBGA 3VMPA 1IZJA 3D18A 1KGCE 2CK2A 3FCTB 3S5LA 4OLUH 3O6ML 1UZ8A 5INCB 3BXNB 5DRWB 3AAZA 4WUUB 3QEHA 3BH9A 3CD4A 3T8XA 2DB8A 2DWEB 3KG5A 3MLSL 1D6EB 1EJOL 3T2PA 4KZEH 2EDFA 4NFDA 1I85A 3K8LA 3MJ8B 1HH6B 3LS4L 2ILLA 5LCVL 3TVMC 1Z9MA 4NT6B 1T83A 3WFEL 1QA9A 3H9HA 5EBWA 1S7XB 4L5FH 4HCRL 1K8DA 4LCIL 3CH1B 3EOYG 4MA8H 4QCIB 1AY1H 2HA1A 4LSSH 2J5LB 4ONHA 1T7ZA 1RZGB 2EE9A 1PLGH 3CGTA 5F9WC 4G8GA 3VXRA 4WGVB 5FECB 4BH7A 3C60B 1F58L 1BQLL 1RUQL 3ES6A 2JCCB 5E7BA 5IG7A 1YPZF 2HRPH 3VXUB 3ZTJH 3B5GA 4ODUB 2PXYC 4Z7VE 4PJHA 3QHZH 1FNLA 4URTB 3MLYL 4BH8A 5D7LA 1UXSA 3BOVA 3QWQB 5DI8B 1EUUA 1C5BL 2DQUH 4RAUB 4N1EA 2P5WB 2HAZA 5CWSB 5AWNH 1Q9LB 4H20L 1ZWIA 2A1WH 5F71A 5GRYA 3WXVL 1KF9B 5FOBB 1MJ7H 3OKYA 2H3NA 4KI5E 4AG4L 2VRAA 3OKNA 5CINH 1N0XL 3VCLA 4M5ZH 3VD7A 1M7IA 1DLHA 3AU1A 3MRCA 4GKOA 5K33A 2HLAA 1VADA 2EDBA 3KPRD 4WU5B 1A4KA 4Y5XB 3OB0K 2D03L 1IAKB 1I1RA 4JFED 2ZOKA 5FDYA 5T3ZL 2ORBL 4O02H 2IPUK 2MQCA 1NBYA 5IB4A 3LQZB 4WTZG 1E4JA 1FNSH 2W92A 4GXVL 3DGGB