4ONFL

Fab fragment of 3d6 in complex with amyloid beta 1-7
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
218
structure length
218
Chain Sequence
YVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRIEAEDLGLYYCWQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 3D6 FAB ANTIBODY HEAVY CHAIN
total genus 54
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4onfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4onfL01
3PWVA 4LRIA 5DTFA 3F62A 4DFHA 2ADFH 3QULA 2XV6B 4RZCB 3BPLC 1FP5A 4U1IB 1DBML 1RUAL 2C1OA 5I17B 5KSBF 2QADB 3IETA 3OZ9L 4WY7H 4OIAA 3ARFD 3RKDC 3IGAA 3IB4A 1QR1B 4YR6A 1FH5L 5E9DB 4R2GC 5I8KH 2UWEB 3T2PA 5IBTL 1CE1H 1MFAH 4JFEB 3EJZD 5F1SA 5DRWB 5EZLB 5T33L 2PN5A 5EZIL 2FJFA 4TVPH 2QQKH 1K4DB 4MLSA 2DQJH 1MWAL 5LGKA 1KXVC 1FAIL 1TZHB 3ZE2F 5KVGH 4FXKB 3WIFB 1NMAH 1PSKH 3EO0B 1FE8H 5BS0A 2VC2L 1X4ZA 2W59A 4AZ8A 4Z78A 5C0CA 1MVUA 5DJ0B 2DL2A 5EBMB 3MJ9L 3TO4C 2FCBA 3K81A 3OF6D 5MERB 1OTSD 3CFDB 4HWBL 1KXQE 4EN3C 3UJJH 2DD8L 3ARXA 1BOYA 1MCKA 3TVMB 4ZG1A 1GIGL 4NQEE 2DKMA 4PJ7F 4RGOH 5CEXA 1PZ5B 1OTUC 3PXJA 5KSBB 3EBAA 1R5VB 4K7PL 3RVTD 1YUHA 3SCMC 2O5YH 3GB7A 1AC0A 4GT7A 3MFFA 4KRPB 5FYKD 1P5UA 2LAGB 2DJUA 5AD0B 3IT8D 4I13B 4PRBB 4GRMB 3IKCB 4BZ1L 1LO3L 2BSSB 3GIVB 1EO7A 5SWSA 4OAWA 1A6UL 4ZFFB 4X7FC 2X4RB 3GSWB 5J11B 1U91B 1ZVHA 4YFDB 1MY5A 4WHTB 3VXPA 3JUYA 3GSQB 1J12A 1F97A 1KB5H 4PJIE 3ZKNC 1JHLH 3LHPH 3TYGL 1CFSB 5B39A 5CIPA 4OFYD 3C8KB 2YBRA 4WI3A 4R3SB 1CTOA 3SE4A 3MLXL 4OLZL 2J6EH 3CXDL 1QZ1A 3UC0H 2QQNH 3C8KA 2FL5B 4HJGB 3ULUD 4QRRB 4TPRL 3KPOB 5B38A 4I18A 6FABH 1QUNA 3BZEB 3MLRH 1C7SA 4X99B 3VFRA 1KPRA 3PWUA 4GW1A 3QDGE 4OGAC 3UPRA 3SKOB 5I6XC 4QHKJ 5GS0D 1U8HB 1V7NL 1S7WA 3CFBB 1RHFA 3UBXI 3FO0L 3LSOB 3U6RA 1MI5B 4NM4L 3B9DA 3QQ3B 3G6JA 1E27A 1PAMA 1UB5B 4I77H 3OKYA 1K2DA 4HZLA 4IRSD 4KTDH 1NJ9A 4X4ZA 1WBZA 3GB7B 3VJ6A 1S9WB 2IQ9H 2AJYL 2DB8A 7FABL 5HYQB 4KDTC 3IDMB 3SJVB 4TOYL 3SKOA 4TN9A 5IB3B 3EDKA 4JKKA 1FSKB 2ARJQ 1HIMH 2OLDA 1A7QH 3S98A 2P24B 3WN5B 3X3FH 1BHGA 3L3DA 4L8DB 2AERT 1RK0A 3BZFA 2I60H 4NKIL 4GMSH 3V5KB 5C0CB 4Z78B 1N5AA 5EUOE 1CU4H 4XBEL 3LMJH 5IQ7H 2BRRL 2ICES 4ZS7L 1S5IL 1VPOL 2MKWA 1TJGL 4KQ3H 4XTRD 4G42B 3GI8L 2P5EB 3H6JA 3O41B 4LOUC 3BKCH 3J8F7 4DJMA 3QNXB 4S1SL 3VMPA 4HAGA 4L4TB 3LDBC 1FZJB 3T3ME 2R0KH 1AGBA 1MIML 2EYSA 3MJ7A 3ZHLA 4OI8A 3IGAB 4R2GB 5KW9H 5HI3D 2J7LA 2HFFB 3B9AA 4K2UH 2JJWA 4E41E 1QFWH 2JELL 3A67H 4LSUL 3VRJB 5F9WC 1JPST 4OBSA 2DIJA 2F54A 1OB1B 2C3XA 4ZSOE 1A1MB 2AXHA 3JV0A 3TJHC 2IMNA 4ORZC 4R8WL 1M1SA 4KKNA 4RDQF 4MCYA 4U05A 3IFLL 1ADQH 3U0WL 3BGMB 4U3XA 2WWKO 1CDBA 5TGBA 4LDOB 2VLRA 4YDIL 4XWGH 3BO8B 1DQQB 4X5WB 5I16B 1U8QB 2M26A 3L7FA 1AP2A 5EA0H 3T0EA 5D7KE 5L88L 1X3DA 5FK9B 2AK4A 3C8DA 3LN9A 4I3SL 5HI4C 1WV7T 1AQDA 3RY6C 4NZDA 3WFDH 1GGCH 4YXKH 3Q3GA 3MCLH 3NCEB 3STBA 3VMNA 4Y4FC 1OW0C 2ESVE 3MRBB 1D9KC 1UWGH 1OSPL 1ZHLB 5HGBB 1CT8B 1MJ8H 5F7DB 1FVDB 2V9TA 3WCYA 4KV5E 3MLUH 4OZIE 2IFFH 2P5EE 1L9NA 2OL3L 5IJKC 4AG4H 2E7CA 2P46B 3W11D 4F58H 4Q9QH 4JRYD 2PXYD 3NZHL 4N8VA 4JKWA 4MJ6A 3QXVA 2K9UA 1NGPH 4GSDH 4MQTB 3HS0B 2IAMB 2OQJB 4KKAD 1CVRA 5FYJU 3FT3A 5CP7B 1RUML 3TF7C 5GS0H 1HHJA 1DQLL 2H32B 2R1WB 5J12C 5IV2B 2VJXA 3GSNH 3MXVH 4IS6B 5JORA 1MAML 4K23H 1NCDH 4K2UL 4ERSL 4QY8A 4WNQA 1KTDB 3ZKSD 5IB1B 3FFCA 3BIAX 3VH8A 4KDVA 4BM7A 4G43A 3OBAA 1M6OA 4UDTB 2NMSA 3B83A 1HHKB 4RFOL 1WCBB 1JBJA 2EYRB 1CICC 1M6OB 3O2DL 2GTWB 5D1ZA 1KN4L 3S36L 1QBLH 4V2BA 3UBXB 2YEZA 3P3YA 1V7NH 3BE1L 3RZCB 1GGYA 4JDTH 5CGTA 2VSCA 3P4MB 4JO4L 1HXMB 4JPKL 3MOAH 3MBXL 3NFPA 3WMSA 4ZD3L 1FZKA 5IFHL 3C2SA 1WTGT 4OUOA 1A4KA 1U95A 1R0AH 1Q8MA 1OCWH 4X0KA 2Z31A 3K80A 4OGAD 4PJIB 3EIFA 3ARQA 4P2RE 1GGCL 2HFGL 4N68A 1GSMA 3SY0A 3EYQC 3JTSA 1NFKA 4GLRI 5GRVL 3VD4A 5F9OH 12E8H 1WBYA 4XH2A 4X8XA 4HUWB 3DTXA 3HZVB 4O51B 4OCSL 4LSQH 5DYOA 1SM3L 5C09A 4YDLB 2V2XB 3F7YB 3BD4A 4S0TD 4G5ZH 4CDGC 1C7TA 3LEXB 1UM6L 1FO0B 1J5OH 1A7NH 1D5BB 3VWJB 1SJXA 4L4VE 4ZXBD 5HVGB 4XNMB 3I3BA 4PV8A 3L5XH 5DMKB 1GAFH 5DMGC 4H0IA 3NA4A 1Z9LA 4YGVA 2F5AH 4S1QH 3D3VB 1X7QB 1EFXD 1K3IA 3MLXH 3S37H 5DD1L 1J0HA 5GS3A 4CN4A 3RWGA 2VERN 2Y6SD 1A6TB 4XWGL 4WU5B 4YIQA 4HUVB 3I50L 4FFVD 5I19H 4TQEL 2W9EL 5IHBA 4WI5A 1IQDB 1NFDA 5FA4B 3U1SL 1CE6B 1SYSA 4I4WB 1PSKL 4H25B 2VDPL 4P2OA 1U2HA 1RZKL 4JFDA 3RDTB 4IRJD 1C5DB 4RGNE 5LJYH 4A6YH 3PHOA 1VFBA 5DUMH 2OR9H 2R2HB 5CEZD 1YQVL 2VLJE 3LMJL 1DE4A 2DYPD 5ALBL 3L5WA 4EUPB 3OKNB 5C9JA 2IPTH 2V2XA 1YN6B 2BDNH 4HS6B 5D7LE 1JPSH 4JEGB 3RY4A 4HUWA 4PJHF 1LO0L 3FFCE 4JFFB 5EU3A 1WBYB 4YAQA 2HTLC 2XFXB 5ID1B 4MVBD 2WIIB 5D5MF 2NY2C 1JZ4A 1I8KB 2JIXA 3GJFK 3GBNL 1ZA3A 4G9FA 3LS5H 3DURB 5CS7A 4AL8L 4HT1H 5IIEB 4CVXB 1E4XL 4HIHB 4LU5H 4N5ED 1T66C 3P30L 1FQ9C 1FNFA 5F7FA 1OAUL 1PKQA 3NTCH 4WFEE 3L3IB 1OP9A 4FQPA 2FIKB 5ICXA 4MXVE 4XMLL 5JUEL 4L3EB 3QUXB 3OB8A 3B6SA 3MLUL 3EOAB 5F1NB 1CD1A 4TSAL 3OF6A 5IEKA 2QTEA 1R3JB 4XBGB 3VI3E 1M05A 4DGIH 4F7EB 4QOKD 4FRWA 5KN5A 1UB5A 2Q86B 3PGDA 4UUJA 2R0WH 4J3XA 4WU5A 4PY7A 4YIQB 1EZVX 1JF1A 4G3YL 4RMWA 2GITB 3BPOC 1IL1B 1SYVA 2EYRA 1P7KB 3H3PL 1HHGA 3HI1B 5F1IB 1AHWA 3MUGB 3BAEL 3HG1E 4J3TA 2XTJC 1A7NL 3A6BL 1J1OL 1NLBH 5IWLA 3QJFA 4MA8L 3IS1X 2HJKB 1Q1JL 2BNQE 2FL5A 1ZHBA 1TNMA 1CXEA 3HE7A 2ZCKH 2EDOA 3EDJA 1R3LB 5F7HA 2NX5E 1FRGL 1R3IH 3ZDZF 4NRZA 1VB9A 4P46B 3I3DA 1DLFH 3NPSB 4Z7QF 2X4PB 3F7YA 3ZDYE 4IS6A 3KPNA 3QDMD 2BMKB 4J1UA 1JGEB 1HHJB 3PJSB 2FH6A 3T8XA 4KTEL 5C3LD 2I5YH 3LKNA 5BXFB 2I9TB 3BQUB 4GG6F 2P44B 2A74A 5M95B 3SY0B 5JOFA 3K8KA 4IRZL 4OD3L 5DRZA 2QADD 3S4SB 1L0QA 1UCBH 1W72H 4NUGH 4H1LB 4P23A 1HI6A 3UJJL 1EVUA 2R0ZL 4HGMA 4OTXL 1AKJA 3BKJH 4U49A 2X1XR 1KJMA 5CCKL 2F58H 4JB9L 3CFCL 3LS5L 3GDBA 1EAJA 3VXQA 1KJ2B 2QKIA 3T77A 3HPJB 3R06A 3CSBA 1JV5B 1VGKB 2B4CL 3EW3B 5DRNB 2OMBA 4TSCL 3X12A 4LEOB 3VG0H 3HNTH 5CKAA 5IQ7L 5KVGL 4OQTH 3BDBA 2HJLB 5IVZA 3RRQA 4PJFF 3VGDA 1JGLH 4DOHB 4PIRF 2V6HA 5GIRB 2OI9B 1MCJA 4XP6H 3ME0A 2CJUH 4FXLA 4EN3A 1Q9KB 3BE1H 4L8SA 2Q7YB 1A3QA 4MXVF 1UH2A 3DIFB 5KSAB 1FYTE 4WEBH 3PDOB 5F3HA 4N0YH 1RUAH 1YEJL 3OKOA 5DRWA 1ND0B 1GZPB 1I1YB 1KCRH 1FZOA 5MHSE 1DVFC 4PRHD 4LPYA 3VCLA 3O6FA 1FDLH 1Z5LB 4LGRB 2BSED 3CLEH 4RAVA 4JZOB 1ZANH 1S78C 2R2BA 3EFDL 3DRTA 4LPUA 4NQTA 1CDYA 3P0VL 1KCSL 4AENB 4ZO8A 4S2SA 4KI5F 3QNXA 4WHYH 1KFAH 2YPKB 4JFOB 1FN4A 4WFHD 5D7SH 2H6PB 3V6FA 4ELMB 3P77B 4NIKB 3HA0A 2G75B 1KGCE 4UU9A 5JOEA 4LLWA 2VXSH 5L2KB 2MTPA 3HNVL 2CMRH 1N6VA 1UM6H 1J5OL 3GRWA 4JO2H 1MJUH 3VXRA 3B2VH 4OZHE 4X98B 1A7OL 2E6PA 3L7FB 4WFGE 4QO1A 2OBGA 2WZPD 2RHEA 4G6ML 2VE6B 4RAVB 4LF3B 1SY6A 1XF4B 1CDIA 1A2YA 3GMPB 1S9WA 1MNUL 3D9AH 5D5ME 1BIHA 4RFEB 4ZUVA 4YXHL 2OXHA 2DQFA 4OI7A 2MHAB 4M7ZC 3VFVA 1A1MA 1IAKA 4X9FA 3ZDXF 3RVVD 3GJEA 4NN5C 3PL6A 5DS8A 4WO4A 4C59B 5E08L 1IEBB 1KACB 1EGJL 1OP5K 4GKNB 3MGOA 5DHXB 4OLVL 2Q8AL 3TWCH 4PBWD 5AYUL 4PJ5B 3SPVB 1MCDA 1GOFA 4XNUH 1T1ZA 2V2TA 1KBGL 3MNVB 4JN1H 1Z6JT 4P9HC 2SEBA 2A6DA 2I24N 1JGLL 3LAFA 3CZFA 1S5IH 1T7YA 4MA1C 3SN6N 2OMNA 4F33A 1Z9OA 1AI1H 4OZIA 3IRPX 3X3GL 4HFUH 4Z0BH 4M6ML 3W5NA 1NL0L 3REVB 2PYFA 2CDFA 1IAIL 2VXQH 4JCMA 2XPGB 4KJQD 3FRPA 1LE9A 4BSJA 5CD5C 4F57L 1GC1C 1P2CA 5D71H 3UXFA 1I9IL 5BOZG 4P2QA 3MRIA 4ODWB 4OF6A 5I1IH 3WFCH 3LKNB 5BXFA 4DN4H 5C9KA 3MFFB 1RZIB 2AEQL 1FL3B 1LWRA 3GMLA 4M7LH 1R5VA 3BKYL 3RWIA 3U30C 4CVXA 5FOBB 2IC2A 1VDGA 2LV4A 1K2DB 4HZLB 5I9QC 2FYYB 3GI9H 1RUQH 3FB6A 4NRYA 1IAOA 1F4AA 4RWYH 1LD9A 1G6RH 5DZNA 3FONB 4ZAKD 1NEZG 1IGFL 3MV7A 5C70A 2CRZA 5TQ0L 3ARFB 1YEEH 3O3AA 2NY3C 2W9DL 2DLFL 3IU4H 3TH4T 2DWEA 2CMRL 2V7NA 4PFEA 5I8OL 5MENA 4YFLF 2R2HA 5GSVA 5EIIB 1KPUA 1Z2KA 2A6IA 5I8EB 3QFJB 4WTZA 5FV1L 3RWEA 4U1SB 3WNLA 4FQ2H 1MHPH 5BVJB 1G84A 4UI2A 3CXDH 1QSZA 5ITBL 3TBTB 1EX0A 4M7KH 4KWUA 4EQ3A 1L7IL 4WCYL 1N0LA 3WNKA 2EIEA 4QHMA 5JHDB 1QYGH 3QNZB 4PRBA 1S7UA 5EU5A 4HF5L 5I76A 4LSRH 3TA3B 5ACZB 1A5FL 2LABA 4DK3A 5LGJA 4N1EA 4Y19A 1RZKC 5HYJD 1MCOH 2XFXA 4Z8FH 4UV4L 3V79C 35C8H 3AUVA 4KMTH 5EU4A 4FFYL 1MFCH 2APTA 4BUGA 1W0VA 4KJPD 4AIOA 3CMOH 3VWJA 4JN2A 4PP2B 4KZDL 4QRTB 4WU7B 3ARDC 3H42L 3VMOA 2Y5EA 5HYIA 4K3GA 4L1DA 2F53B 1N8ZB 3PWLA 1MQ8A 2RFXA 3QEQD 3O9WC 3O9WD 3BPOB 3HUJF 1A02N 3OJDB 5DJAB 4GG8B 4M61A 1LO2L 1EMTH 1EEYB 2GK0B 4HWBH 4Y5VB 4Y5XB 2AVGA 2HT4C 1D5ZB 4PJDF 4N8VG 4CVZA 1IMHC 2BP3A 2VLRD 1A9EA 3H7BB 3AC0A 3WFZA 5AAWA 5EZJB 3OXSB 3DYPA 4XC3L 1PG7W 4MAUL 4ELME 4KK6D 4NN7B 2H2SD 3MCKB 4EI5C 5IB5B 3QUZC 5I1CL 3UTZA 4M43H 2W65B 5J6GA 1M4KA 1NANI 1CFQB 3DV4B 2XWBB 3OAYH 3MC0A 4JKPH 1DBBL 3T1WA 3PWPA 3PWVB 4Y1AE 1BFSA 2N56A 3OX8B 1FC2D 2CRIA 1DCLA 4A6YB 4X7EC 1P7HL 2UYLB 2WQ8A 3O2WL 1SVCP 3GKWH 4NC1E 5KS9F 3RWDB 2APFA 1FYTB 3SDCA 4ZUWB 4IRSB 3TNMB 1SEQL 2B20A 4LLMA 2VQTA 5GISL 3MV7E 1KTLA 1T89C 3L6FB 2EDHA 5HGHA 1RIHH 4M5ZL 5DEGA 3QI9B 5GRYA 1W8OA 3RDTC 3CFKA 3CAFA 4XXCA 3TA3D 3KPMB 5E1AB 4PJ8A 4YWGH 5MENE 1H3VA 2H9GA 1NQBA 3ARBC 4YNYB 2MOVA 1CXLA 1YEGH 5K9JL 4PRNA 5T1KD 4KVCL 3CZJA 3LEVL 1VHPA 4JHWL 4HKZB 5EZJA 1E4XI 4E0RB 4UMGA 3L95B 4P46D 3KXFD 4QF1B 3QFJE 1D5ZA 4HKZA 3W11C 2EH7L 2AAVA 3AREB 3GMMA 5D9SA 4EXKA 4JVUA 5H8DA 2H9GB 5HHOA 1NCBH 1DN2A 4G7YH 3WLBA 4JJ5B 1U93A 2DWDB 4X6FB 2A2QT 5HGGS 1E4KA 5BV7H 4FFYH 3QG7H 5LCVL 2OR7A 2XKNB 4A6YA 1F6AA 4JN2B 5EH1A 1I1RA 1W2KT 3RNKB 5IF0B 2NY5L 5D7IA 5EO9A 1CLOH 3FB8A 4X9GA 1T04B 4TSBL 4NKOB 2OCFD 1BFVH 1I9RH 4EN3D 4NFCA 1BZ9A 2JCCA 3Q2CA 2YOCA 2CQVA 4JM4H 2NCMA 5C07E 2BK8A 1N5YL 2BVPA 5D9SB 5DI8A 5LQBL 1OAKH 4WENB 1GC1L 3NAAL 1RZKH 1J9CT 1H0DA 5DK0B 1C1EL 1JTPA 5CSZA 2MCPH 4DQOL 3WV0A 1J10A 2J8UF 3MRCA 3D39E 4M1CC 3IFNH 1GHFH 3ZT7A 4N9GA 4Z7NF 1I85C 4LP5A 4OKDA 1CICB 3TCLB 4H1LH 1S9KC 2F53A 4WW1A 3VGAB 2GEEA 3P0YL 3MREB 2NXYB 3BESR 2ZWLT 1IZJA 4U3HA 3LVEA 2YD1A 1MF2H 4K71C 1RZFL 4Y4FD 3OKDA 1CDGA 2Z93A 4NKDB 3QPXH 1OCWL 1XCQB 4MCZB 4D9LH 1FC1A 1A21A 4X7SH 1T20B 3HAEA 4JE4B 4M6OH 4OFKA 3OB0K 4MD5A 3ARUA 4G80A 1I1AB 4WV1C 1AO7E 3OR6B 1ETZA 2ZUVA 3TA3A 3TCXA 3W0WA 2MMXA 3MO1B 1HKFA 2KKQA 3HRZB 5B3JE 3H3PH 2QR0A 2X05A 2CRYA 2OJZH 1QFUH 4LVNC 5J6GB 2AJVL 1H5BA 4H5SA 3VFGH 5H2BA 4MYWB 3QQ3A 5C1MB 1GH7A 1S8DA 1MIEH 3UTTD 1N3NA 4PRIB 3SQOL 2VIRA 2VH5H 5J1SC 2G5BB 5IMOA 3HNSH 5E7FA 4L4TA 3S35X 1RQ5A 4P5MB 3O8XA 3O6LL 5AWNL 3IDYC 5E70A 2DBLL 4R7NB 2RQ8A 4Y5XA 4N8PA 4LLVA 5LGHH 2MQ0A 3L3KA 5SWZD 1RJLA 1J1PH 1OD7A 5T1MB 3U0PB 4XPHH 2WBKA 1CR9H 2H32H 3OPZH 2MSPA 3DETD 5I73B 1I3GH 3CZFB 2H8PB 2V5YA 5HHOE 2D7MA 3NMEA 2GJ6A 5T1DL 1JPSL 3R1GH 3F58H 4KVNH 2VLMD 3QUML 3QH3A 4YQXH 4F8QA 2NY1D 4EVNB 2WBJD 5D8JH 2VXQL 4NQCB 3RAJH 5MEPA 1NCDL 1IEBA 3JV5A 4YFEA 3GSUB 2CKNA 1JWSA 1K8DB 4OZGB 3V5DB 2P8PA 1B6UA 4KTEH 4RAUA 2O5ZH 1KLFA 4DAGH 2NLJA 2IPKB 1A0QH 3MLSL 3DMMC 5TDOA 1XF3B 3BKJL 3JV4A 1HSAB 4Z7NE 1R3IL 3KYMB 4K7FB 1G9MH 2IANE 1MWAB 3OHXA 4ZO9A 1WSST 2FRGP 4G8EA 3PDGA 1YEHH 4QRRA 1BJ8A 3RIFK 4XZUB 3KAAA 1NGQL 1MF2L 5C0AD 4H26A 4K3DL 4U1MB 5HDQL 1J8HB 1T6VN 3L9RB 3WHXA 3ARPA 4DVBA 2NYYC 3IF1A 3KGRA 4B7LA 3C87A 3MLTA 1RJYB 43C9A 5FUCC 3N50A 4WHTA 3VXPB 3S8WA 1RURL 5IVOA 2BCKA 5IB2B 1J8HD 1KC5L 5IOPA 1KF9B 2EIDA 3GIVA 5CP3H 4DFIA 5ACLA 3PL6B 1FO0H 1N6QL 1OP5H 5ADOH 3BUTA 2FYYA 1TQCC 4MJ5A 1KENH 3RWIB 5FM4A 3U9UA 1RIVH 3EJJX 4LLQA 4KRPC 1B0GB 1R5WB 4PR5B 1KIPB 2YPVH 3B8YA 1FGVH 5SWSD 3KPSD 3QISA 2YD6A 2E6QA 4HKJA 4MD5B 2BSRB 3TN0D 3TVMC 1D3CA 2FR4A 4GRWH 1JYNA 2I60L 1EJOH 2QQQA 4Y4HB 4GRWF 4KKBD 1UXSA 3REVA 3IDJB 4KZDH 2YHGA 3C6LA 1NFDF 2COQA 2XKSA 1FDLL 3WFHA 4ZTOH 2BSTB 4LVOB 1QQDA 3TZVA 5C8JA 3OPZL 4LGSB 3MCG1 1G6RB 2CXKA 1YA5A 4LNRB 1YY9D 4J3UA 1BF8A 2QSCL 2G5RA 2EDWA 2I25N 3E6FB 3PWNB 2J8OA 4RDQG 4YHPB 3D2UA 3RY6A 1KCUL 1T1XB 5E6ID 3O11B 1XGUB 5JW4R 1N59B 1ERNA 3BT2H 5EU7C 3MGTA 2VLKE 2I5YL 2OZ4H 3HI5H 2LVCA 5FO8A 1UG9A 3ESVF 3QDGA 4KMLB 3QJHA 4TNWK 3AAZB 4HWBA 2F74B 4MGXA 2HYMA 3LH2L 1Z5LA 3O6FB 3S35L 1HE7A 5JDSB 3CFIC 3WO4B 3VA6A 4YZFF 1SEQH 3QNYA 3KLAB 2F58L 2W07A 3NH7L 4JB9H 1OOAA 2VB5A 4PB0L 3HR6A 3BPCB 2IF7A 4DW2L 4IHOB 5HHQA 1P4BH 1ZHBB 1IGJB 1EBAA 5I73C 5IW1B 4OD3H 2FIRT 4NO3A 2VKXA 1U93B 2DWDA 5IMMB 4JJ5A 3CD4A 5AG9A 4KDWA 2J6EL 5DGRA 3T2OA 1N7MH 3P4OB 3O6KL 5DD3H 4LL9A 4K71B 4TULL 5FHBH 5D93B 2PW1B 1I3UA 5I1HL 5DHVH 3RAJL 1EIBA 2HVJB 1HI6B 1DUZB 4HBQA 2VL4A 3VGAC 3QFJD 4HPOH 2R15A 5DRNA 3QXDB 4TNVF 3EYFB 1CK0H 1FNLA 5GZOC 3WE6A 4YNYA 4LSTH 1I8MA 3W5MA 3VFPA 3BEVA 1HINH 25C8L 3HAEH 3LB6D 3VCLB 3GGWB 3IJSA 4HFUL 4BSVB 4X6DE 5D6CB 5DFVC 4GXVH 4G9FB 2JIXB 3LQMA 5EUKA 5JO5B 1BVLB 4TSBH 5F6IC 3NCYS 4FZEL 1RZJH 3QWOA 3RU8L 4ZPTA 4U7SA 1MRDL 4N0FB 1A14H 2UYLA 5C9JB 1P84J 3HCVA 5I75C 5FYLD 3BN9D 3T0VA 4LKXB 5FGCB 3MACL 5E00B 4N8CH 2OSLA 1MCPH 5GGTH 2H2SC 1EGJH 1YY8A 1EUTA 1RUMH 2VABB 4UUJB 3P30H 4OZFA 4NZJA 4ZS6C 3TEUA 1VGKA 1VKXA 1XH3A 1IL1A 1SYVB 3T77B 2YC1A 2GITA 5ITBH 1IRAY 1HHIB 2NXZD 4LLUA 3CCHA 3D9AL 4G6FD 3I9GH 5BRZE 3CCHB 4ETQB 5DD0H 4NO2B 4J7RA 1Y18B 4U1GB 1LEIB 4LSPL 2WNGA 2ICWJ 4OGXL 1I8KA 3UZQA 2WP3T 3OKKA 2GFBB 1BAFH 5ICXB 1I7UA 3DJ9A 3MJ6A 1U8IA 4HC1L 2XXMB 3AU1B 3TESA 4D0BB 1ZGLB 4JFZH 1FJ1A 3HPLA 4IRSC 1YDPB 2JB5H 4PJBB 4BZ2L 1FO0A 4HH9B 3ECBB 4FQLH 1GJIA 4AEFA 5HGDB 3PGFH 5SV4A 2H26A 5FV2A 4P2YA 5GRWA 4UQ3A 1XEDA 3EFDH 5C6PB 5BV7B 3AREC 2J5LC 1KGCD 1K6QL 1ZHKA 1XGTB 4JKPL 1BFOA 4QLRA 1TITA 1O0VA 4NOBA 1K85A 4PRPA 2WWMC 4LRIC 1QLFA 1N64H 1IKFL 3HUJB 4LRNL 3GUTB 5CUSH 3O6ML 1I8MB 4HK3N 4JHZA 2YR3A 4ODHH 1I75A 1MCPL 3V4UH 1X44A 5IEKB 4JO3H 2PKDA 1I85A 3TO2B 4GG6B 1MJJB 1VKXB 1SJHA 3VDAA 1DSFH 5C6WH 3BGAA 3P4MA 5F89B 4Z0BL 4Y16C 5MHSD 4U3CA 5EN2A 4O2EA 5KSUA 3QG6B 3RJQB 1WISA 5FF6B 3EDEA 2YEZB 3IAPA 2ZUWA 4XPAH 4UINH 1A6TA 4KZEL 3STZA 4DCQB 2X9WA 3S34H 5LQBH 2NZ9C 2OSLB 3I85A 1URLA 3KYKL 3F7RA 5DK2B 3WIHH 4P2RA 3U83A 2NQCA 3LS4L 5KS9E 4JM2D 4ZPTB 1AE6H 3FOMA 3F65A 5AG8A 2AI0H 4RFNB 3QEQB 4R4BA 4TNVK 4HDIB 4X4ME 3GZKA 4B5EA 5D5MA 1G9NC 2L7JA 3EHBC 1X5YA 1QRNB 2XWTA 5MEOB 2UZIL 4TTDC 5FOBA 4I48A 1JHTB 4X83A 4EOWL 1QEWA 2VXVL 3BKMH 3C9NB 3MJGX 3GK8H 1S7SB 4PJBE 5M94B 4EI5B 1TETL 4XH2B 2WWKT 3QP3A 4P57B 3FT3B 4IOSD 4LAJH 4OZHA 3C08H 5E6YA 5F44A 4MSWB 5FIEA 5KZCB 3U2SA 1WGOA 1UB6A 1B6DA 4LHJB 5B21A 2Y07L 5L2JB 2EH7H 5HBBA 3O2WH 2Z31B 1HWGB 1XFPA 4Y5XC 4YFLI 4TOYH 4HKXB 1NAMB 3BEVB 4X7CC 4ISVA 1A4KB 1U95B 3SOBH 5IBUG 2E9JA 4I3SH 3RNQB 5JPNA 5I1DA 1TENA 1L6ZA 4Z7UE 4Q58C 5B3NA 1RIHL 3FQTA 1ZE3C 1ED3B 4FQIL 4M5ZH 5TFSL 4F15B 3VXOA 4Z6AT 2DS4A 4LCUA 1G7HA 4LVHC 3GBLA 5FK9A 1P84K 5DT1H 4MA3A 5DQDH 4PGDB 1GZQA 2AW2A 3ARDB 3D0LA 3D5OF 3Q48A 4N5EC 3NIDE 3VH8B 5I16A 1Q94A 3FQRB 5E6ZA 4G9DA 4XWOD 4WNQB 5EG6C 5ICYB 3KXFA 3T0XA 4QNPE 1A3RL 5MP6H 4QRSB 4M7LT 5IT2L 1TCMA 5FGCE 2ARJB 5I18L 2UY7A 3SDDB 5FUZH 2DI8A 3RVXD 4P4RA 2R69H 1G0YR 5F3BB 4APQB 3MODH 5IK3A 2QQLH 4PJXE 5IUSA 4UILL 3BPCA 1JPFB 4JY6B 1WBXA 4OKVA 2AK1H 4U1LB 1EV2E 2AV1B 5DJ6A 2V5RA 1OAUH 5FKPB 2R1WA 2PF6A 3B2UC 4XAWL 1SJEA 4YC2B 3KPRA 4LF3A 3E3QE 5EUOA 1RPQA 1ZWIA 1FYHB 1RULH 3BWAB 4MMZC 1DBJH 3EO1A 3MYJA 1A6ZA 5FO8B 1YEIH 4OZFH 3CSPA 3ILQD 5EPMA 1OVZA 1UACH 5JW4N 3D0VA 1ZLVK 4L9DA 2DI9A 3D25B 3BPNB 2JJVA 1A6WH 4PJHE 5HGBA 1J8HE 5J56B 3BDYL 2FHFA 1MWAH 3HZKB 1FV1A 3UTSE 3VXSE 3VXRD 3Q3GB 1MRCL 1QO3A 3TO4A 1E28A 1WCBA 4Y4HA 3V95A 4YHYC 3TZVD 3ES6A 3INUH 4G8IA 4BQ8A 5FO9B 4OTXH 4ETYA 3WN5A 2V7HB 4PPTA 2HRLA 3IJYA 3PUCA 4IHOA 3LQZA 1IAIM 1DN0A 3DV6A 4PJCE 3VXMB 3O2DA 4NN5B 3O6MH 4KGJA 1RZ8A 2BVQB 3RGVC 1XF3A 3JV4B 4PJAB 2HFEA 5ISZB 1A7BA 2ZCLH 1EXUA 4GS7B 2W9LA 3ZKMC 4YXHH 1YYML 3MV8A 3MJ7B 5AZEH 2KQNA 1U3HC 5IT2H 2D2OA 5LBSH 5L6YH 3BISA 3QRFM 1EO8H 3K4ZA 1XR9A 3VD9A 3MLYH 1F3DJ 4N1HB 5EC1B 1MFEH 1TJHL 4S1RL 1FVDA 3QH3B 4PP1D 1LDPL 2P4AB 3V8OA 2ADFL 4JG1L 4G42A 1NC2D 2VZ1A 3DXAE 5I0DA 4PTUB 2HAZA 3VFMB 2EIZB 3V6ZB 2EZ0D 5KVDH 1A1OB 5FOJA 1YNTA 1JZ7A 5B39B 5B8CB 2APXA 2BSTA 4ZYKB 4JRWA 2P24A 3DOSA 3O8XB 1SMAA 3QEUA 1YMHB 1IBGH 3MRNA 2XT1B 5DGQA 2BFVH 3IU3B 3MXWL 4PS4H 3IDNB 2R29H 2BSSA 3EYSL 4GS7C 2IPUG 3NBNA 3V0WL 2BSRA 1WBZB 1FNGB 1CGSH 1UZ8A 1ZKAA 3TJEL 4POYA 3DO3A 2QQNL 3ARGD 3QDJA 4LPCA 3QXAA 3T8XB 1XAUA 3T0ED 2VDRL 5CHNA 5BW7C 3GBNH 3QCUL 3QXAB 1X5KA 4D3CL 3H9YA 1HXYA 5I1CH 3TT3H 1W0YT 3K2UH 5B38B 3V5DA 2DBLH 4W6WB 1Z0MA 3CSYA 1K8IB 3EJYC 3CVIH 1FFPB 4KKCD 4MAYA 5D1QD 1XCQA 5EOCL 4JY5H 4NQDE 4P9MH 4OQTL 2LU4A 2BHUA 3O4LE 2C3VA 3P11H 3NACL 2XA8L 1KTRL 1HKLL 4PY7B 2X41A 1K4DA 1P1ZA 1YQ2A 3BP6A 3ULSA 4Q2ZA 4NHCH 1HQRA 2D4FA 4LMQI 4L4VD 3BPNC 4IOFC 2AXFA 3O3UN 4OLVH 2WM0A 4JHAH 4I0PA 4YE4H 2ZNXA 2HRPH 2EYTA 5HI5C 5J4MA 3AXLB 1YEFL 4GRLD 4S1DC 3KPPB 1NMBL 1NSNL 3IDMA 2EDXA 1UM4L 4MXQC 5EC2B 3SJVA 4I0KA 3PP3H 1OWWA 2E27L 4KHXL 3C5JA 3BJLA 2Z31C 1S8DB 4NWUL 4AQOA 4NFDA 3T3PE 4HF5H 1L0XA 1F4WL 5J6HA 4KRPD 1DFBH 2FBJL 4Q6IC 2J4WL 4JFFA 4L8BB 4NQVB 5E5MA 5L2KD 1NC2A 4XVSL 1GGIH 3TT1H 3ULVL 2Y06L 5HGAB 5KJRL 2VLME 4FS0A 3EYSH 4MX7B 2Z93B 3ULUC 3VFRB 1S7QB 2HJFB 1VCAA 4PB9H 3G9AB 1QRND 3O9WA 4I18B 1JYVA 1X5FA 1BWMA 1U3JA 2VXSL 2X1WL 4HWZA 1KNOB 1S9YB 3WLBB 4Y4KA 1EEQA 4OB5H 1VFBB 3HMXL 2ZUUA 2BX5A 3TPUB 3U7WH 1WC7A 2L4OA 2UZYB 2YZ1A 5E8EA 4L8CB 4NRXB 4QTIL 2MPAH 2ZOKA 2X4NB 4UOW0 3T0WA 4PYHA 1G6RL 1INDH 4OLYH 3OJVC 4JREC 5C0BA 1C12A 1RMFH 1M7IB 4KRMB 1QR1A 4XCFH 2IQAA 2HN7A 4PRHE 1CD0A 2ATPB 2DMKA 1T03L 3WNNA 1QBLL 4P2QE 1T2QL 1QBMH 4WEBL 1JF5A 2X4UA 5HGHB 1YUHB 3NCCB 4Q9CA 4U1LA 4PJDA 4ZFZB 3I6GB 2XKUA 3GBMH 1S7RA 3P40A 5CGYC 1B0RB 3RWFB 3QUYC 1TIUA 1T4KA 3N1FC 3VW3H 1ES0B 5DD0L 5KSVA 1KIQB 1IILE 3JWOH 5FECB 4L9LB 1A3LH 2E5EA 4GKZB 1MCWM 3RNKA 3RBGA 1RUPH 4PRPE 2YD2A 5ECJE 4YZFE 5E4EC 1TJIH 1U58A 1TNNA 3H9SD 4X6BB 1SBSH 5HI3C 5IROA 1DL7H 4ENED 4DKDC 4NC0B 1M7XA 3EYOA 4DEPC 4ZUTB 4Q9RL 1IM9B 1BBDH 3CVIL 1YZZA 2QLVB 5GGSY 1KCVL 1IKNC 4XHJD 1AO7A 4MJ4A 5CWSA 5DA4A 4F7MB 3C60A 5E1AA 1Z0NA 3MRJA 5E2VL 3C60B 2F9BT 1V8HA 3MV9A 3MCLL 4WO4D 4X6BA 1AJ7H 1FZMB 2F5AL 4S1QL 4Z7WA 4M61B 3UTSD 3MUY1 2EXYD 2GJ6E 4PLJD 3QEGH 3U7AA 1V3LA 3MODL 2J5LB 3RWJB 3V8CA 2EXWC 3UEZA 3RWFA 3KG5A 4FFVC 1X5XA 5DD5L 4PJDB 1MCSA 3T2NH 4QXWA 3WYRA 2HTKD 4NNYB 1JI1A 5T5FL 3BGFB 2NY0B 3QQ9D 3S96B 4QHKI 1T4KB 3QUZD 4X7TA 3KS0J 4HS3B 5FDWB 2HFGH 5I1AB 4ZS6D 5IB5A 2AK4E 4CN6A 3FFDB 2QHRH 3FMGL 4HBCH 5HYJE 3QIBC 1EERB 1U2CA 2O5YL 1LDPH 3ORJA 1U8NB 5DHVA 3HMWL 3DV4A 1G7QA 1V3JA 4POZC 4L1HA 2DTMH 4OZGF 4Y5YA 3MNWB 3PP4L 4NRXA 5T5NF 1ZHLA 4F7MA 4DN3L 3QDAA 5C0BB 5FYKE 4X6CB 5HHXL 3WIIH 1YMMB 1JZ5A 3RZCC 3WXVL 1MLCB 4R26L 3KPMA 4X6EB 4WGWB 4JFQB 5D7IF 4W4NA 2GQHA 4CADB 1N2RA 5J9PB 4D8PA 2DQUL 1BFOB 2H3NA 3BI9X 3QWRD 4QRTA 5EO0A 4O58L 1KIRB 4UTBL 2VLRB 5AYQA 3MJ8A 4EDWH 4DKEH 5KG9B 5FAAA 1AIFB 4PJDE 5FA3B 1CLYL 1CF8H 4L9LA 3N1PC 5EBLA 1H15B 4K9EL 3V9FA 4GAJH 2EKJA 1REIA 3HZYB 4ZQKB 3ULUE 1QD0A 5I66A 4WWKC 4ODXB 1IM3B 3CDCA 3KPSE 3BIBX 3KPRE 5FM8A 3DBXB 2CUMA 4M62H 4I2XE 1MPAH 1JTTA 3QHTC 5FDYA 4M1DL 1DLHA 1FG2B 5C2BH 1ZLWK 1T2QH 1JK8B 4CJ0A 3A6CL 4Q74A 4ETQA 1LQSR 1J1XH 2CDFB 4JQVA 2DLTA 4XCFL 5FUOL 1A9EB 3H7BA 3QEUB 4C4KO 2GJZA 3OB0H 3MSPA 4XVSH 5JXAH 1JGVL 4LRNH 2ZKHL 3HE6B 5E8EB 4L8CA 2P5WE 1RAMA 4NO5B 3ULVF 3V5HB 4ZSOA 3I3EA 1H8NA 1J0YA 4AMKH 3ULSB 1G7LA 3OJDA 3P9MA 3VFMA 1WFUA 2FWOB 5A16A 3KWWB 3CSYB 1SJVA 3LKSA 1QP1A 3BIKA 3QHZH 1KLGA 4M00A 3L3GA 4CL7A 5IQ9A 3O81A 4OQTA 5CMAB 4LVOC 2Y6SC 4JO4H 4WHYG 2AS5M 3C8HA 3LIZL 5I74C 3LZFL 4MAYB 2R1XA 1DTUA 5T3XE 1A0QL 3MLZL 2F8VA 3FB6B 4NC1C 2O5ZL 4P2RD 5ANMA 4P49A 3A67L 4LSUH 1I9EA 4XPFL 3WJJA 1FNGA 3WO4C 2HFEB 3VI3F 4RA0C 1S7UB 1XT5A 4RCAA 5EU5B 3AGVA 4FQCH 3CX5K 5D7JD 5J1AA 4JKMA 2GCYA 4N0UB 3QZWB 3NCJH 1AJ7L 2D9CA 5F9WB 4FHBD 3QDMB 4ZXBA 3PWUB 1UM5H 4GW1B 3E8UH 3QDJB 3QUMH 4YQXL 2X7LB 4KPHL 3MRIB 4ODWA 4HIEA 5GJTH 2ILLA 3RWEB 3VRLF 1HILA 3B8SA 4NQDD 4HJGA 3GIZL 4DZBB 5EWIL 5F7KC 1D5IH 2Y72A 2ZCHH 3SE8L 3NIFE 3MOAL 1E0OB 1IGTB 2CK0L 5CJOH 1UVQA 1F3JB 4W4OC 4TNWF 5GXBB 3T1FB 5SX5H 2XTJD 4KI5C 3CH1A 4NFBA 1BGXL 1MFBH 2VDQH 3FB7B 3I6LD 1U8JB 4QXTB 3VXTB 2B7DT 1KB9K 3D0VB 4WV1A 3WIIL 2BVYA 5BRZD 5SWSB 4F37F 1LEKB 1A6ZB 1ZWIB 4RBPH 3CC5A 5D1QB 2R4SL 2C7UB 4JY5L 4XC1L 4EEEA 1TTUA 3D1MC 1OQOA 4RNRB 4E5XB 4KRLB 4PP1C 3ULVC 4XTRC 4O4YL 1AH1A 3QQ9C 1ZSDA 1XF4A 3SJVD 1JUFA 3CMGA 1I8IB 3OKOB 1KENL 3ZDYF 2CDGB 2X4OA 2ICWI 4EBQL 3QJHB 4DVRL 3QQ4A 2DQFB 4MNGA 1T6WA 1CN4A 4G8IB 4LSSH 1ADQL 3ES6B 5I2IB 1A2YB 4PG2C 5D1QC 2APBA 1S7XA 3MGTB 2BNQD 2W0FB 1A22B 3WLWC 2G60H 3LKQA 1DN0B 5HHMB 3VXMA 1ORSA 5D70H 3BRGC 3ARDD 1KEGH 2QJDA 2I07A 2EXYC 3MRDB 4OSUH 3D0LB 2VDKL 1GZQB 2IAMD 3WDIA 3UBXG 3B9VA 2X10A 2D7OA 3SDXB 1JJUA 2F19H 3TZVC 3HPJA 3R06B 1CLZH 1JNJA 4I3RH 2SEBB 2N1KA 1F8TL 4LCWE 3JTTB 4QHUB 4XNZC 5L2KA 1FV1B 3FTGA 3JVGC 2ADJA 4YR6B 1V5JA 2V2TB 2EDRA 4MD0B 4M3JA 5L7XH 1EEUA 4NWTH 2W0FA 1CCZA 1IC7H 1ZEAL 2ICEA 4PJ5E 4U1IA 4JQIL 5I1KH 1JFQL 4KK5D 4GFTB 1TVHB 4KFZC 5JXED 1MCNA 1AGCB 1X5IA 4PR5A 4LIQH 5JA9A 5I6XB 1LO2H 2ZJSL 1G7PA 4Q9BA 2XI9A 3ABZA 5C07D 5JXAL 5E9DD 4I48B 4LVNB 4W6YB 1GGBL 3RX7A 5DFVD 3VG0L 4PJGB 4WIQA 2E8YA 2AJ3A 1H3UA 5IGXH 1MAJA 3IJYB 3TJHD 1P7QD 5CD5D 3FTGB 5HDBE 2WLZA 4HCRH 2Q87A 2MCPL 3ARDA 4R4FH 2VAJA 4K3JL 1FE8L 5IESL 3SDAB 4U1JA 2Y36L 3IDYB 4O02L 4UAOB 1HNGA 1KJ2A 4G9DB 1AD9B 1FVCA 3INUL 4GXUN 5DVMA 2AJUH 2QQKL 2Q8BL 2FEDC 4Z7VF 5T33H 1EHLH 4LSVL 5DFWH 3ARVA 4LHQB 4KHTH 3RHWK 4XZUA 5F6HJ 1HILB 1I7RA 5EOCH 2I27N 1R3KA 2FIKA 1I8IA 1DBAL 1CIDA 4TUOB 4XPFH 4U1KB 1LP9A 3KPNB 4PRPB 3QYCA 5DRZB 5D1XA 1QSFE 1EHXA 1YYLL 4HIXH 4OFVA 5DSCB 4DK6A 1XGTA 4E5XA 2WUCH 1GZPA 1QPXA 3D3VD 4KUCD 3LIZH 5D7LB 1FBIL 2CO7B 4NUJB 4ONOA 5FFLA 1OAQL 3EDFA 1KG0A 2AK1L 2AV7B 2IWGA 1KPVB 2QV2A 1NAMH 3EAKA 4HHAA 5FCUL 4WV1B 3AROA 3DX7A 3KHQA 1YPZE 4PJ9A 4M8QA 4GAFB 5H94B 3ZE2E 1EFQA 4MB5A 4PGBB 3UC0L 3SDYL 4JHBA 5IVZB 1G9EA 3WFDL 2CSPA 4GBXA 5HYSG 3HFML 1LEGB 1UZ6F 2RGSA 5KS9A 3QPQD 3OKKB 2C4FT 4HFWB 4IDLA 4PJHB 2EDNA 3B9KD 4HG4J 4H25A 3B3IA 2GUOA 3PQYE 2X7LA 5JLZB 1KB5L 1NLBL 2DM3A 4Z7UA 1T21A 2AGJL 5L8JB 3DUUA 1A6VL 3T0DA 5FYKU 1QSEA 3U4EA 4HS8H 5JHLL 2GHWB 1U92A 5CZVH 3QUKA 1I7ZB 5FB8B 2O5XL 2DQGL 4GRWE 5INDA 1JWUB 4IJ3C 3X3GH 3BQUA 3RA7H 1OAZL 2WIIA 4ZO7A 3ULVD 1EH9A 4HS6A 3RTQD 3QRGL 1BFVL 1I9RL 5T1KA 4KH2A 4HIHA 5GS1C 3DHJA 2NY0C 3P2TA 3IFOA 4BFBD 1FIGL 1G7IA 2H26B 2W1NA 1UWXK 3RVUD 4KJYB 5IBUB 5K59F 5DR5L 4XCNA 3S37X 3WNOA 4LSRL 3T65B 2FD6L 4MMXC 4CVWA 4P4KA 4EUPA 5EO0B 4P2RB 1HOCB 5D6CA 4NO5A 4YGAB 1C16A 1QVOB 1XGYL 5AZ2L 1T5WB 1S9VB 3SKJH 3GSNA 2VZSA 2DLEA 3DRQA 1YMMA 1JE6A 4R97C 3TO2A 4M9OA 3SDYH 4CGTA 1SEBB 1D9KD 3N85L 4QRQA 4HFWA 1IGCL 4PJHA 4PJEA 3D69A 2PTTA 4O5LH 2YRZA 1CD9B 2OR9L 3VWKD 1OAQH 2PCPA 3F7VB 4YXLH 4LLUB 1JGDB 5E8PA 1QVOA 2OJZL 3TBYB 5CZXC 4MQ7A 1XMWA 2ENSA 3BGFC 3X14B 1LK3H 4X7TB 4BK5A 4J12A 5EUOF 2FO4B 1KPVA 4M7KL 4Y4KC 3MV01 1CXHA 3SGEI 5EO9B 1DBAH 3HZVA 1JYWA 2DQIL 3FFCB 1T1WA 2RBLA 5ENWA 5FO7B 3VDBA 1OF2B 4YPGB 1VACA 1CDJA 3WXWH 1I7TB 3U9PH 1FAKT 3E0GA 4PJXF 4XXCC 2A9NL 1U3YA 2E7BA 3QUZB 1CFBA 4X6FA 2J2ZA 2VLJB 3BH9A 1U8IB 4BFGA 5I1IL 1NGZA 3DX8B 4ZTPH 3AAZA 3QCTH 2PO6D 4FP8H 1B0WA 5IB4B 4JQVC 4MJ6B 2PUQT 5EFIA 1Q72L 4NO2A 4AK1A 1I7ZA 4RGNB 4HKBA 2BY1A 2X2YA 3BW9B 5HYEA 5BO1L 1PG7X 5JIPA 3IS0X 4TVPE 3PQYA 5C92A 2VR5A 5MEND 4PBVC 1T80A 4R90H 5GGUA 1UCTA 3RWHA 3ZYZA 1DFBL 5IP4A 2AJSL 4LGPB 2GTWA 1IAIH 1CG9B 1QSEE 1RVFH 1D5XA 2D3VA 4JZJB 1G6RA 3RUGB 4PRAB 3SBWA 1YJDH 3HC3H 2B4CH 2FLBT 4WHDA 3DVGA 3G5ZA 1JRHH 5B4MC 1NFIA 1DQQA 1KTLB 5D72H 5DC9B 4Z76A 1F11B 1XZ0B 4GKZA 3WSQL 5HI5D 2PYEA 3RWJA 3ARFC 4AIXA 2LQRA 3KJ4B 1W72A 1BJMA 3D87B 1AC6A 3FQXA 4KRNA 5L7XL 5CINH 3SO5A 3K8LA 1J1PL 1WIUA 3JTSB 5DSCA 1E4JA 4LASL 5BZWB 1JZ2A 4JR9H 2VDNH 1CGSL 4JREB 2DF3A 5E03A 1RZGB 4F9PC 1QG3A 4OSUL 2B1HL 4UOJA 3BH9B 3SQOH 1C12B 4Z7VE 5BRZB 2VLJA 3P4NA 4Y2OA 1QNZL 1VEPA 2X4QA 2ZCKL 1F2QA 3DGGB 3HE6D 5DHYB 3E2HC 3OXSA 3HB3D 2Z35A 2CKBH 4MZ2A 1CDCA 4ZTPL 1XGUA 3Q0HA 3QUMB 4ESKA 3KPQA 3X13A 3TPUA 2IH1A 3G5VA 4K7PX 5HPOA 3W81A 2H1PL 3BO8A 1X6NA 1KIUA 2W9DH 5C0NC 1E4KC 3H3BC 5JPMB 2X4SA 1WIPA 3IDGB 4ONFH 4HUKB 3QFDB 3CSGA 4PLNC 4GO6B 4X5WA 4RMRA 4PP2A 4FQQB 3RGVA 2BNQA 2ZSVB 1XIWD 4NO0B 3ARZA 3KYAA 4ZFZA 4FMKA 4WWKD 1KYOK 3MUJA 4S10A 1H5BC 3CX2A 5DA0B 3VJ6B 4YHML 1A8JH 3EOTH 4K8RH 1A7PH 3PHQA 4D9RD 2Y25A 4JJHA 5C2BL 5ERWA 4O5LL 3BUYA 2IAMA 2OM5A 1AXTL 1K8DA 2OJEB 1DQDL 5DR5H 3CX5J 5KAQG 4FG6D 1FZJA 3BVNA 4X99A 5C0AB 1U8JA 4U0RC 5KTEH 4M1GH 3UYOD 2OZ4L 4PJFB 3HC3L 4C56E 2QHLA 1WLHA 3T1FA 4KJYA 1QKZH 4HD9A 3HNTL 3LS4H 2WUBL 2NY4D 5DURD 1KPUB 2ESVA 4ODTL 4TUKH 4JR9L 5CBEA 3RVVC 4LLDA 1TPXB 2FNBA 1GCFA 1AP2B 4YHKL 2FEEI 2YD5A 4FFWD 3MRDA 3MR9A 3W2DH 4HIEB 1CI5A 4U1MA 1BP3B 2IBZY 1H9VA 2HJFA 2JJTC 4H88L 1BX2A 3STLA 1U91A 2EC9U 3QDMA 4M6AA 1FFOA 5D2NA 3KXFE 4P2CG 5CKGA 2IH3B 4NRYB 3VFOB 1CK0L 5I8CA 5ALCL 1J0IA 5E8OA 3MRRA 5ETUA 3ZTNH 4JRYB 4JFDD 1K6QH 3KPPA 5KSBA 4Q7DA 2W0KA 1NDGB 4FTVA 4IOFD 1DVFB 2YUXA 5I8CB 5KS9B 4AEEA 1U8OB 5J3HC 4PG2A 5D1QA 2NY0D 2ZPKH 1NMCC 1IQWH 2HG5B 4GW5B 5KVEL 2NY6D 3O8XC 4NQCA 3BAEH 3O3EB 4WGVB 5DZLA 4EVNA 4CNIB 4HPOL 1XF5A 4AEIH 2AK4D 1MVFA 4XGZB 5B8CA 4FXKA 4YHYB 2IAND 1KC5H 3GSRA 4PLKD 1K9TA 5D1XD 2BHYA 2R2EA 2CUIA 2R23A 1WVZA 4WVRA 4OV5B 3V0VB 4BYHA 2R8SL 4Y4KD 4NYLA 3GSWA 3N85H 2BC4B 2YBRB 5CJ5A 3IRZA 5I18H 1FPTH 1L7TH 2DLHA 1T2JA 4NKMB 5C0CE 1LP9E 2G60L 5FUOH 3LD8B 2DQEL 3NZ8B 2F53D 4TUOA 1P4BL 2MJWA 1MWAA 5F1KC 3SDXF 1R3KB 4OFIA 1KEMH 4YDVA 2ZCLL 1MJ7H 2GJ6D 5CHNB 2OJEA 1FNSL 3EHBD 4HUXB 5GQBA 5CSBA 5HDLA 1KN4H 5ERWB 2ED9A 3S35H 3GSVA 1EEZA 5JNYB 2R0LL 2EDLA 4YXLL 1E6OH 4QGTA 4TVSa 3WIHA 1UKSA 4APQC 2ZUTA 5KSAC 3C5SA 4G7VH 1OGAE 1NBZB 3C5ZB 3SKNA 1HN1A 4RISL 5BS0B 1KN2L 3MV9E 3DX9B 4RISH 4P3DA 2M8XA 3KPOA 4FABL 2A0LC 3RFZC 4R4ND 1MVUB 1H3WM 3VXRB 4UTBH 3JSSA 2VDQL 3NIDF 4NGHL 3SO3B 5EZLA 1FGVL 4C4KT 4IMLB 3WUWA 1QO3B 3OKEB 5KOMC 4JPVH 3N1MC 4TSCH 4WI6A 1LVEA 3H9SA 3E6HA 1CFNA 3MNWA 3HC0B 1JFQH 1V3KA 5FEBA 1TQBB 1UWEL 1JP5A 4DTGH 2Z92B 3ZSTA 1JI2A 4S2SB 5IG7A 2OR8A 5DHYA 1QLEL 3S9DB 3ARSA 3ISWA 2BVPB 4YC2C 2JCCE 2X1PA 4HG4K 1ORQA 1U8MA 5FDWA 1QYGL 2IADB 5C0FB 1H5BB 4H5SB 5ISZA 1RURH 5BZWA 5IVXA 3NPSC 2R8SH 2ORBL 3F6IA 2J8HA 5DI8B 3SE4C 3QEGL 2AEIT 1IM3A 1ND0A 1MNUH 2DM7A 2WSKA 3TNMA 1YEKL 3B9KC 3MLZH 4FQQA 5B4MD 1X6LA 3CGTA 1U36A 5TDNA 3ZKQD 2KQMA 4ZUSA 2VDMH 2IANA 4NKOA 4OZIF 2I07B 1C1EH 1Q1JH 3TBWA 4RFNC 5CUSL 4FA8A 3KXFB 3FQWB 3OKDB 5IROC 1F90L 1D9KA 4URTB 3ARED 4LHUA 1SVZA 2C5DC 4UIKH 5ITFB 5C08D 2DQHL 5BS0E 5E1HB 4CW1B 3TIDA 4XI5D 3O4LA 2VKWA 4G3YH 4EZMA 1F5WA 5GHWH 4JFQA 2FJFB 2ARWA 3RVTC 1CXKA 1J0ZA 2QKIB 3M17B 5E5RB 2X4QB 3MRCB 2ZG2A 3GMMB 1RU9H 4PRID 1I4FA 5E2VH 3REWB 2R9HC 4U1HA 1LE5B 3QB7C 1QLRA 1H0DB 5DK0A 3S4SA 3GHEL 2C1OB 2AJUL 4KTYA 5K9OB 2VXTL 3GK8L 1ACYL 2Y36H 4O02H 4ZFOB 3L6FA 2A74B 3P9WB 4JFFD 5CILH 2Y4SA 4G7YL 3LV3B 1IVLA 1NGWB 2K1MA 3QT2A 5DMIL 5TQ2H 3IXAB 1OWRM 5F7EL 2VQUA 2AEPL 4MDJA 4MD4A 2FJGA 1CR9L 2EEAA 1KIQA 4KI5E 1S7TB 3OG4B 1LO4H 3D48R 1ONQA 3CU1A 2ARJA 4XP5L 3CK0H 2HT2C 2HT2D 1LK2A 1CFVL 4WU7A 1QRNA 2W92A 2XWTB 3QR2A 3FT4A 5HY9B 1UVQB 1P9MC 1F11A 2CLVB 3CK0L 3VXUE 3KLHD 4Z76B 1W0VB 3U36B 1KB5A 4P9ML 2NW3B 1ITBB 5C71A 3HE7B 4R90L 1UM5L 2LE9A 1JTOA 1IGML 2F8OA 2AJXL 4CU6A 2DBJA 3GBML 4U7MA 1BLNA 2ZOLA 1IAMA 4XPAL 5DO2C 4H8WC 4GW4A 3W9DB 4AYFA 3O4LD 3LPFA 4OZFG 3MLWH 2CIKA 4WHCA 1EVTC 5BJTA 1NC4B 2YPLD 4PBXA 3QIBA 2PTTB 1S7VB 4OJFL 4YHNA 5KN5B 1KCLA 1RMFL 1MRDH 4GBXD 3BW9A 4CVZB 4YX2H 1G9NL 4FZ8H 4HUNB 4POZD 3L3JB 1BF2A 3T4AB 1ZLUK 3DI3B 3X17A 4MSWA 2R29L 2OP4H 4G6FB 3TT1L 1QLFB 4X9BA 1X5JA 1A9BA 2J4WH 4NSKB 2BERA 5C0EB 4DUXA 1LK3L 3PGFL 4XVUC 4C83B 3WS3A 3ARFA 3QZWG 4AEIL 1DJSA 3GSXB 4UQ3B 4GLRH 1BVZA 1A6AA 3QDHA 2VDML 2A83B 4RMSA 3QEHB 3V52H 1MJUL 1G9ML 1ZT4B 6CGTA 3ALPA 3BSZH 1B0RA 5B3JF 1MHEB 1UWGL 4MDIB 3QNZA 1G7MA 2H2PD 2CDEA 5F6IB 3OV6A 3HZMB 5JOPD 2YRLA 1DBKH 4WWKA 4R7DA 2AABL 4DAGL 1UA6L 2GFBA 4XC1H 1INEH 1DLHB 1FG2A 4AEHH 2VDKH 3GEWB 4I0PB 2HVKB 1QPPA 4JFDB 3RDTA 1D6VL 1QLEH 4J8RA 4KK8C 1JYXA 1AKJD 1QSEB 3U4EB 2CDEB 1Y6KR 3IVKB 2ZUSA 4TSAH 1IQDA 1NFDB 5FA4A 5C0CD 4PV9B 1IT9H 4P4KD 3MTRA 4JFPA 4OLWL 2RCSL 2X44D 3O3BA 1KXTB 1C5CH 1LP9F 5MENB 2P7TA 3PWPD 2QSQA 5TPWL 1NCTA 1S9XB 4HK3J 4UBDD 1JNHA 3ARWA 3NIFF 5CGMA 2ICWB 5J06A 3QFJA 4KUZL 2GT9B 5IMKA 1ZA6A 2VO5A 1CBVL 5BVPL 3VRLE 4Y4FB 4N8CL 3MV7B 4Y7MA 4TUKL 4Z7WE 2GT9A 1XGPA 4UTAH 2A9ML 2E6JA 4XNXH 1HH6A 3V7AG 3F7PC 3S88L 4GKOA 1S9XA 4U0QB 1C08B 3K8MA 4HK0A 1CLOL 2V2WA 3WL9A 3LEXA 3F5WB 5IJVB 1KCUH 2Z8RA 3TBSA 2KZ1B 1J0JA 2IJ0C 4K23L 1CVSC 2VR9A 2IAMC 3CPLB 3H9HB 2QHRL 4IJ3B 1IAKB 3ARGB 1PYWB 4O9HL 3W9EB 3QIUB 3WJLA 1JWUA 1RIVL 4XPGH 3OR7B 4R7DB 1MJ7L 4RFEA 3IU4L 3O45A 1NC4A 5BJTB 4PJIA 1Q9WA 4LDLB 3MA9H 4OM1H 3VFPB 1YMHA 3OKMB 3U1SH 4GXUM 4X80L 5HHPA 1JL8A 1FL6B 2E9BA 4U1SA 2RB8A 1OARH 1OGTA 5FYJE 4PD4K 5GGVH 1OGAB 5K9JH 1IBGL 5DD1H 2D0HA 4LCWD 2Z8VC 4KJWD 3KHOA 3QHFH 4U6HB 4I9WE 1IJ9A 4LLWB 5C0EA 2P8LB 1EAPB 1S7TA 3SDAC 2G2RA 3V7MA 4FTVD 5EC1A 1TCRA 5I1GL 2BXZA 3DRTB 3LZFH 1K4CA 3VXUD 4X4XA 2PXYB 4KROB 5HHVH 4Y4HC 2J88H 1PEWA 2DQDH 1UJ3C 1MPAL 1YC8A 4NZUH 3WN5C 1YEKH 2KDGA 1MH5B 1OD9A 2B2XH 4Y2DC 4BZ1H 4P23C 4RIRB 1AO7B 4F3FB 4ODUA 2DIBA 1G7PB 2VMFA 4WFED 3HI5L 4OCXH 5LXGL 4JPIB 4XAKE 3W82A 1QFWI 3LDBB 4LDEB 5DJZA 3PNWA 4X8JB 2ED7A 4LHUB 1GIGH 5C0DB 2GTZA 4EI6A 4TTGA 2NW3A 1KCVH 4OF7A 5ALCH 2E8ZA 3H42H 5D7LD 2A73B 4R4FL 4EDXA 1C5CL 1N59A 4C55A 5F8QC 4UAOC 2HT3C 1CL7L 4FFZL 1AXSA 4Y1AD 1WZ1H 4HGWA 4AM0A 5IBTH 4L8SC 1HHHB 4YHKH 1EDQA 5KANI 3OQ3B 1G1YA 1AGFA 2A77H 4GUPB 4IIQA 2O61A 2DQJL 2YZ8A 5D8JL 2AJSH 3MBEA 1MCWW 5HVWA 1F13A 3KPRB 4B0MM 1MCLA 4JFOA 3TH2T 4NQSA 1FHGA 1QACA 5DJXA 4U7KA 5EO1B 5FKPA 3NABH 2DDQH 1V05A 1FSKC 5J11C 3VFTB 1T3FB 4PG9B 5IR1A 2BOBB 4JM2A 4BZYA 3GMNA 4I1NB 1NMAL 1EXUB 3SDAD 4QTHA 5GS0L 3RY5A 5KSAA 4HIJB 4E41D 5CSGA 1J11A 5TE4H 5DK3A 4CW1A 1TQCB 1Q9KA 3FB5A 4G9FD 5F88A 5FM5M 1FGNH 2DN7A 1MUJA 5ADPH 2OL3H 5DMJB 3BMVA 3RIAK 1M71A 3UDWC 1DUYA 4I0PD 2XACC 4NP4L 1BZQK 4HX1A 2V7HA 1AGBB 4OZ4A 3JTTA 4YHPA 3ROOA 1Z9MA 2D7PA 2R4RH 4WUKL 4NZTL 4H8WH 4PJ9D 1KJ2L 2J12B 5ESQA 2EDQA 4CUCA 2RR3A 3HI6H 4OT1H 3FQUA 4MX7A 1RJYA 1AXSB 1WAAE 1ED3A 1EAPA 1HWHB 1CGXA 1NKRA 5E56A 3G6JE 3WFHB 5JPNB 3RQ3A 4L8BA 1DQTA 4JANB 4QRPE 1I1AD 2NY6B 3LHPL 3IJHA 3PGDB 1CQKA 4N9OB 1EPFA 3Q6FA 2YPKA 1J88A 1ZT1A 3G08B 4OIIL 1AR2A 1PX4A 1FL5A 2K7QA 3L3DB 4L8DA 4HAFA 4Z0XA 3ULVH 2CKBL 1WFOA 5HHPB 5INCB 1F02I 1WZLA 3NGBC 3RL2B 2ESVD 5FGBA 3FO1B 4WO4C 1IM9D 4X6DB 4H1LA 4ZFOL 5DVKA 3QZWA 4F3FA 1NBVH 4PY8I 3U9UB 2DMBA 4MJ5B 4ZPVA 3QO1B 5D1ZD 1WBXB 3QSKB 2X42A 1QRKA 5ANMB 4V1DE 2I9TA 4MAYC 3S34L 3UJTH 5IK3B 3LCYA 3CFBA 4OF5A 3VG9B 3DMMD 5A2KH 3DUSB 1LEKA 1LNUA 1J8KA 4ZDHB 4PJEE 2KUTA 2XZAL 4EN3B 2C3VB 3DX9A 2C9AA 3AB0C 5LCVH 1E4WL 4CNIA 5GIRA 1P53A 3B5TA 1F45A 4L3AA 3LB6C 4Z7VB 4BKLB 3U46A 2Q8AH 3TWCL 1Q94B 1TVBB 1XCTB 3U0TB 2CJUL 4ZNEA 2Z31D 1T03H 1J8HA 3L9RA 3OAZK 3WHXB 5E08H 5J57B 3JWDH 4P23D 1D6EA 4LCWB 1DVFD 3SE3A 2BNRE 4Y8AA 4OCMC 5IMKB 4NQCD 3ARBD 4ZMAT 5FYLE 4XAKD 1RZ7H 3RTQB 1JF1B 3OHXB 5SWQB 5E8NB 2CRMA 4JN1L 3WNPA 1AKJB 1QSED 4LQFH 3OKMA 1KULA 3WS6A 4EIZC 3KYMA 1JNLL 3QG7L 4K7FA 4NT6B 3SCMA 4MQXC 1PKQB 4Y8DC 2GCYB 2P5ED 1UB6B 3ARGC 5IIEA 1DQDH 4U6VH 3MNZB 2CLRB 2HLAB 3LQAC 4GAYA 4R0LA 5D6DA 3MRNB 1PG7L 3Q5TA 4OZGA 4WWKB 5E2TH 3RUGE 2ZUYA 5FHBL 1TTGA 1BAFL 3H2WA 4IM8A 4JDZA 1BEYH 3HI6L 4OT1L 5ID1A 2WLYA 4XRCA 4NJAL 5MERA 3LKSB 3S5LA 2CKBB 2XNAB 4MCZA 4XP1L 5MI0C 3BDXA 4JDVB 2MPAL 1H3TA 4MA7H 1AHWB 3BVNB 3VWKC 1HHGB 3HI1A 4G8GB 1OPGH 4UIKL 4YUEH 1G7JA 1E4XH 3Q6GL 4LLVB 4LU5L 5DC4B 3RP1A 3HMXH 3UZEA 4N0CD 1B4JL 2GJZB 4P5MA 3WFCL 4WI9A 2VXUL 5JW5A 1KCRL 1UYWL 2MQCA 2BRQA 3HTLX 4UT9H 5F89A 2PYEE 5F8RC 3QDGD 3QUYD 1CTNA 4C58B 4G8GD 4I0PC 1J86A 3LKPA 1U8PB 4NZTH 1OM3L 5DUPH 3IXTB 5I71C 2HVKA 3FQNB 4I4WA 5EBGA 3ZTJG 2R2CA 3U4AA 2A6KB 1HQ4A 2FO1A 4NCC1 3QIBB 2Y07H 3MGAA 3RZCA 4XCEA 2PW2A 4L3ED 4PV8B 1DANU 3QDJE 3ZL4L 1WFNA 4FQHB 5IFAL 2PO6C 3GJFH 4PJ8D 3BP5A 3HZYA 1MHEA 1P4LB 4L3CA 4N0FA 5DMKA 5EU3B 2NR6C 4K3JH 1EJ6A 1PQZA 3MACH 4LCYB 1FNSH 1YEIL 1YN6A 1KB5B 1LGVA 4F9LA 3AS2A 1OW0A 3H0TB 1MCQA 1OLLA 1RJZA 3ECBA 2HH0H 2JIXD 4HH9A 4PJBF 4W70A 4M5YH 2B5IC 3IFPA 2VZVA 4JGJA 2FJGB 4O51A 3E2HB 3RA7L 4JM2F 3SEPA 4TUJA 4FQCL 2PETA 5I0ZA 5EOCJ 4XP9L 4UB0L 3MLVL 1L7IH 2QQLL 1Y0LB 2NTSP 1A6VH 1FFQA 2AV1A 5DJ6B 1HINL 1M7DB 1MHPL 4FFZH 8FABB 1NGYA 2P5WA 4NO0A 4KK9D 5HHNB 1RHHB 2NY5C 1I3RA 5JOPE 1KOAA 2IQ9L 5T3ZE 5CZVL 4MHHG 4NQDB 1GGUA 3OXRB 5C08A 2A6JA 1FO0L 3FFDA 3QI9C 3SDDA 4PB0H 4I3GA 4WTZG 3G04B 1HDMA 3EGSA 4QRSA 4Y5VC 1B4JH 4N0CC 5AAMA 4GAGH 4R9HA 2DLFH 4JKLA 3BP4B 3FOLB 5D7SL 4JFFE 5D1ZB 5D1ZC 4ODVL 2X09A 1T89A 1IFHH 2B2XL 5HDBF 5HDQH 4C56D 3TBWB 4P5KB 3WXWL 3H7LA 3ZSSA 3QUYB 1L9MA 4HIIB 4NJAH 3VXOB 4P4KC 1J1XL 1ONQB 2WBWB 4G43B 4KKBC 3OXRA 3A6CH 3P9LA 5HHVL 3RNQA 3P4LA 5F7LB 3WO3B 2F54B 3OX8A 1ZXQA 1F4YH 1ZGLP 1YNKL 5GGQL 4BA8A 5EFIB 3HC4H 3K1DA 1UENA 3WFEL 3QDME 5K33A 4BH8B 4U6VL 4PJ5D 4N0UE 4XC3H 4JCLA 3REWA 4UNUA 5HSFA 3RX8A 3D2UB 1TJIL 3U82B 4ZFGL 1B90A 4ZAKC 4LAQH 4XVJH 4YBHA 1BECA 4PJ7E 3HLAA 4DWHA 5HHMD 3SGJC 1AFVH 3MLVH 2Q8BH 3OKLA 2ZOKB 3SDDD 1OF2A 4XMPH 1V3MA 4ZD3H 4K7PH 1MHHB 4OD1H 2ICCA 1WC7B 4FTVE 4L9LC 1P4LA 1WZ1L 4KMQA 2HT4D 3PWPE 4Y1AA 4RRPG 4NO3B 1PKQE 5CZKA 2UY6A 3JV6A 3O2DH 1R3HA 3TBYA 1JGDA 4WDIA 3O8XD 3CFEA 3ZE0F 5L9DH 5TPWH 5T3ZL 4Z9KB 2XZAH 4R2GD 3C5SB 4AEHL 3G6DH 1HSBA 4MS8D 1GVIA 1IGYB 2X4UB 3JUZA 4U6XA 3UO1L 3PDDA 2BZDA 5IM7B 5GGRY 2Z4QA 3NCBB 1VERA 4BQBA 1MI5A 2AJVH 4O2FB 2APVA 2I9LA 1U8HA 4AJ0A 5EC2A 1AD0A 3L5XL 3V52L 2UUDK 3PQYD 3UTSB 3B2UD 2BCKB 1F4HA 2DQDL 4D2NA 3UTTE 3QCVH 4JZNB 5FYKL 5KANG 1CFNB 1P6FA 4RMTA 4J3OC 4MA8H 4MQSB 2GAZA 3SBWC 1F3RB 4IIQC 1SY6L 2DKUA 3BP6B 1VGEL 3H9SE 3KNBA 5FHAH 4CU7A 1CD8A 1N5AB 4I18C 4XPTL 3FO2A 2VLLB 2XRAL 1QQDB 1UA6H 1RK0B 3BZFB 2VDNL 2R0WL 1U8QA 1BQLH 5E8PB 4BFIB 5GS1B 4XVUD 2L7UA 1S7QA 1I7UB 1G9NH 4FZ8L 3VD5A 3O3EA 1OARL 3FQNA 1GXEA 2DQTH 4GQ9L 2JB5L 2DJSA 1SM3H 1U92B 3AY4A 2YK1L 5J6HB 1A7RL 4J3WA 1HK6A 4JPKH 1JMZA 4Z5RA 1HXYB 3LN5B 3JXAA 4JHAL 4K07A 4YE4L 5DEZA 2W60A 3LSOA 3U6RB 2D03H 2YUWA 1U9KA 1WIOA 43CAA 5JIHA 4LLQB 5TJWK 4I0CC 1GC1H 3NAAH 4HXAH 3UDWA 5C07A 4HMEA 1CDHA 2EDFA 1MAKA 3LD8C 2Z91B 5EWIH 2NXZC 4JDVA 2FX9H 3K4AA 4LARL 1AHWC 1LEGA 1YY8B 1RVFL 3BHBA 1ZTXL 5J13B 4APQD 2H8PA 3BT2L 4ODSH 5B8CC 5JXEA 1KJ3L 5T1MA 4UTAL 3GSRB 1UFUA 4ZDHA 2HKHH 4PJXA 4UT6H 3BN9C 9CGTA 3MRQB 2YD8A 3LY6A 4PGEB 1KT2B 1NAKH 3QCUH 3L5IA 25C8H 4OAWB 2CLRA 5L8KB 1F58L 2UWEA 1WF5A 5GJTL 4WTWA 1NCBL 4LPWA 4G8EB 4E9LA 4XPBH 4HH8A 3NZHH 4FQ1L 4QXUH 4WEMB 1ZVSA 2AXJA 1U3HB 4FZEH 32C2B 1DP0A 4HJ0D 4TPRH 2X4RA 2Y5TA 4GKNA 4IRZH 4QRUB 4JRYA 3W0WE 3RZWA 1FL3A 3C2AH 3C5ZD 4OLZH 4PYGA 2W60B 8CGTA 3O6KH 2YUZA 1N7ML 3LN5A 3GMOB 3RTQC 2VDLL 4HUMB 1SQ2N 2D7NA 1A1NB 4JPWH 2CXGA 2IH3A 1INQA 1PLGL 1ACYH 4FQLL 4P9HL 4WW2B 5JDJA 2YSSB 3C6SA 1ZEAH 3FO0H 3RVUC 3LQZB 2EDDA 5IMMA 5IVXF 2VUOA 2ED8A 2QBWA 3KS0H 5C0BD 3AB0B 1F6LL 2BVTA 1A1OA 4MB3A 2MFNA 3KNBB 6FABL 2D0FA 3V6ZA 5D2LF 4KI5D 4PTUA 3AS3A 1KFAL 4FQXD 5GHWL 1EFXB 4OCNC 5DUBA 3D6GA 4U0RB 3D18B 1VEMA 4NCC2 1T1ZB 4LPTA 2H6PA 2Y7QB 2PR4H 3GSOB 2AQ1A 5KBNC 2DD8H 4JFDE 4KAQH 5D70L 1PY4A 2EE6A 4Y19E 3EO1B 3MYJB 4PRIA 3NGBB 2IBZX 4E42B 2XYCA 1MCFA 3MROA 1BZ9B 3IJHB 5H37H 1NAKL 4JANA 1XGQA 4M6NH 5D7JC 3C09C 3BQUC 1T1XA 4JM4L 5E7BA 2EDBA 3WDJA 4OCLC 5IFAH 1RJCA 5H35B 1FORH 4P59H 1T2XA 3QIWA 2X89D 2GSGA 3PP4H 3BXNB 5C09D 2PYEB 4OZ4B 1ZTXH 1BZ7B 4AIZB 5HYFA 5JPMA 1T0NA 4QRRE 4LAQL 3R1GL 3DECA 4WW2A 3LN4A 3DSNA 2Y9RT 4JO1H 5F88B 3FZUD 4JGUA 3L7EA 1JWMB 4PJ9C 1DEDA 4FQXA 4WUUE 1FN4B 1BD2A 4F15C 5KVFH 4I2XB 3VXMD 1CS6A 3OG6B 5EORL 5LGHL 3M45A 1AGCA 4XCCL 1QFHA 3P4NB 4XMPL 5ALBH 1MH5A 3PWJA 4JZOA 3DSFL 3CVHA 4NQEA 1NCNA 2QSTA 3HMWH 1MCIA 1BQHA 5LXGH 4YBLC 5TE6L 4OF8A 4YXKL 5LVEA 2DTML 5I30L 1KSRA 2NY7H 4R0LC 5D6DC 4JY4A 1P6AB 2XIDA 2DLIA 4KROC 1NGZB 4FFWC 4MAYD 4J1UB 43C9B 1W72B 4X4YA 2Q7YA 4L8SB 5DQDL 2VN7A 2B4CC 2NY2B 3IF1B 5HVHC 1VENA 4DVBB 2AGJH 5D7IB 3MRFB 2GIYA 4TQEH 5IFJB 4P46A 4X6CE 1CXFA 5DJ2B 3TFKD 5DDHB 2E3VA 4DZBA 5I2IA 1P9MA 3S4SG 4Y16D 4PGCB 3HG1A 12E8L 4PRAA 4PGDA 3VXSD 3DGCR 1FVEB 1BOGA 3HFMH 2X4OB 3CLFH 1BD2D 3K74B 3UCRA 4ODUB 4Y16B 1OP3H 3ZE1E 4IOIA 1L0YA 3FN0H 5FF6A 4QCIB 1VFAA 2BY0A 1UKTA 4GMTH 1UWXH 3FT2B 4MJ2A 5DWUH 1NAMA 4RNRA 5DEFA 4PJEB 4DN4L 1M7DA 8FABA 1MSPA 5CJBA 4E0RA 1CGTA 4M5YL 4O00A 4AT6B 3QAZC 1CD1B 4PJAF 1X5LA 3EOAA 5MEPB 5T1DH 3DRQB 3TBSB 2ADIA 1F58H 3ZYOA 5FYJH 1I3VA 1S9VA 3S36H 4AH2B 4H88H 4J4PD 4LCCC 4LQFL 5F93C 3BIKB 3MZTA 5E2UH 2XN9D 5D7IE 5IHLB 1BBDL 1ZHKB 4YK4B 5ICZB 1T7ZA 5CIPH 4XP4H 3OTTA 4F2MA 1VACB 2IPTL 1A3LL 4NC2B 3VFNA 1GGTA 4FABH 4ZSOB 1ZA6B 1T7XA 3UTPD 1JNHB 3QJFB 5E0QA 3I75B 5K93A 5JA8B 1XIWB 3K3QA 4CMMA 3O3BB 4WEUD 3DARA 3HE6C 4ACPA 1IC7L 4ZUUB 2MNUA 2EIBA 3STZB 4DCQA 4N0UA 4PTTB 4XXDA 4HGKC 2PW2B 4MNQB 4O2EB 2ITDB 2Q86A 3O4OB 4OV6F 1JHKL 4DGYL 1KJ2H 4YO0A 4Q6YA 4ODSL 4MNQA 1YNLH 4P2QD 3S7GA 3BRFA 4F58L 1OHQA 2OL3A 1HSBB 1YEEL 4NQXB 3MRHA 1NBVL 1I1FA 1X5ZA 2A6IB 3FAXA 3FRUB 4NNXA 5JW3L 3S37L 4X5XB 1B3JA 3R8QA 2FX9L 2BFVL 2GUOB 3VD7A 5IEHA 5IQ9B 5JLZA 5DJCA 1PW3A 4MVBC 1QFUL 2YC1B 4G8GA 1UYWH 1U0QA 1MFDH 4IDJH 4GAGL 4BK4A 2VYRE 3GSXA 3ULVE 1TDQA 5FHAL 1N6UA 2YK1H 2AEQH 3B5HA 3F8UB 1N2RB 4K8RL 4CADA 3BP7A 5E6IC 3MMEA 3LPGA 2VDOL 4HUUA 4EXPX 1NKOA 4XP1H 4RMUA 4D94A 3L3HA 2JCCF 5KOVC 2F54D 3ZE1F 1QRNE 1LO3H 1TJHH 4HHAB 4S1RH 2PNDA 1ZGLA 4J8RB 2FDBP 4FQJL 3W39A 4J3VA 1ZLVH 1F42A 1FCGA 4Y19B 4XPTH 2Q7NA 5K59E 3CLEL 5INDB 1G7QB 4QHMB 5JHDA 1FCCA 1Y18A 3UTTA 2DICA 4XCYB 4CBPA 3DBXA 5DJ8A 1Q9LB 4PY8J 5E2WH 4A2MA 5T3XD 3EYQD 1T21B 2NY5H 4NWUH 4MDIA 2D7QA 2D7TL 2P48B 1VESA 1MLBA 1JPTL 4Z95H 2ATKA 4DVRH 3QI9D 4Q0XH 2X40A 3P73B 3HR5B 4LK4A 2HRPL 1ADQA 3UYPA 4QRPA 1TLKA 1ACZA 1FAIH 1XCTA 3U0TA 1TJGH 4KQ3L 5I75B 4PRDA 1IEAA 2FX7H 3G9VA 2NX5B 2P5WD 3SPVA 1QHOA 3UMTA 3SDAA 5GRUL 5CP3A 1NGWA 5I8KL 4UDTA 3UTQA 4KU1A 1WK0A 2BVUA 1ZT7B 3GJEB 1MHHA 1IAOB 1WWBX 3MXVL 1MCHA 4LSDA 3HLAB 5IBLD 3D39A 1SHMA 3O4OC 1Y0LA 5KVDL 3NFSL 2HKFL 1T22B 3I02B 3DUHA 4OLUH 1YJDL 4J2XA 2F74A 3WKML 2VE6A 1F6FB 5GISH 2N7AA 3MOBL 1B88A 3Q5YA 4LVEA 3FO9A 1BD2B 1J18A 3MRGA 4OCRH 4Z0XB 4DEPB 5DURB 5D93C 1ZT1B 5C0RH 1LE9B 1PKOA 2ZKHH 3Q6FB 2HVJA 2JE8A 5D2LB 1WTLA 2N4IA 4YWGL 1NAML 3DYOA 5E4EB 4MWFA 3MRBA 1QSFA 4ONFL 4RMQA 4DW2H 1ZVYA 3P77A 3V6FB 1Q72H 2UWEE 4EI5D 3FQUB 4MDJB 4JLRA 5E9DE 2GJJA 4C56B 2YWYA 3UJIL 2GKIA 5K9KB 2YKLL 3SDCD 5C0AE 5CD3B 3JWOC 4OGXH 3PGCA 3BP4A 5HHQB 2OK0H 4YPJA 3OGOE 1ZS8B 1ORSB 2Q20A 1NEZB 1U42A 5TGBB 1HQ4B 3UTZB 1J0KA 4U1HB 4PJGA 4X4MA 4YBLB 5HPMA 2JLLA 4XT1C 4OD2A 3O2VL 2R39A 3UYRL 4MCYB 3N1QC 2JJTA 1RUKH 1BJ1H 3MPCA 4KHTL 2VQ1A 2XQYK 1QFWL 2L0DA 1YNLL 1JZ6A 1U8LA 4BH7B 1IM9A 1UEYA 3QQNA 1NGYB 4PG9A 3RX5A 3QPQC 2NNAB 2CLZB 3QXWA 1WZKA 4BJLA 1CL7I 3CUPB 1NFDE 1A6UH 5CJXC 1JPGA 2GW5A 3NOIA 4NM8L 4KY1L 4KJQC 4MD0A 4N90D 2RCSH 3CC5B 4UT7L 5CCKH 4M3KB 2DIAA 1RIUH 3SO3C 3VFUB 1A14L 3KYOB 1IC4L 3PWNA 1ZV5A 5IB2A 3RU8H 5IWLC 5F9JB 5HYSB 4XAWH 1T0MB 2HP4A 1OAKL 1ZLUH 3GJFB 5DXWA 1OAZH 3CH1B 3CDFA 1VA9A 4PJGF 2P5EA 3O41A 2C3GA 2K3TA 5EU4B 4PLJC 3G5XB 1F3JA 5C0IA 5TF1L 3GFUA 4OCXL 1FORL 4R0LB 1ODAA 2AQ2A 3CLFL 5HTSA 5JMRA 1KN2H 4ZFGH 1T5XA 4AENA 2FR4B 4IRJB 4KK9C 1A6WL 5FGBC 2R1YA 2A38A 4NZUL 4M1GL 5IMLA 2KPNA 2FBOJ 5D7JA 2Y5TB 3TGXA 4AY0A 2HTKC 2DYPA 4XHJC 3AVEA 3EJYD 5CEZE 2V5SA 3PJSA 2DQUH 3PV6B 2XQBH 3QA3A 1WWWX 1Q0XL 3S3SA 4CKVX 2Q1EA 4JFED 4JQXA 3V7AE 1BVKB 5EZIH 2HFFA 2V5MA 1VSCA 1HQRB 2FB4H 2IPKA 4F80A 1CGWA 3PL6C 4Q2ZB 5ESVB 2M2DA 3WXVH 5T3XL 1DEEB 2A9NH 1KNOA 2VL5B 1RUKL 4PJFE 1S5HB 5GGSB 2R23B 3DIFA 2PXYA 3CVHL 1JVKA 1OLZA 2X9YA 1KPRB 4QHLA 1XF1A 1EZVY 3VXTA 5FUCE 4JHWH 5DQJB 1Z3GL 4EQ2A 3QO0B 3B2VL 3DROA 4OUUA 4QWWD 4KV5F 1S5HA 4UNTA 5GGSA 1QR4A 1P5VA 1A1NA 1FFRA 4LQ1A 3N1GC 3WFBH 4MHHI 4F7EA 1PLGH 4LLYA 4KXZH 1CFSA 3VXQB 4OM0H 5KVEH 1I9IH 3FJTA 4NBZB 1WEJL 4X6DA 3IAQA 3FO1A 1K3ZA 1IARB 1SBBA 3VD3A 1H3PH 5IMLB 2G5BA 1R0AL 1RUPL 3VFSA 4HQQL 4M6MH 4OCRL 5LG1A 1KJVB 3JWOL 3ZYIA 3IDNA 5JOFB 2AQ3A 3SCMB 2NLJB 4OLUL 1YYMH 3T04D 2P42B 2XG5A 3SGDH 1JWSB 3T0EE 1E6JL 3DROB 1H8OA 2GSIB 3MR9B 4XHQA 5EU6D 2X1QA 4OZIB 1PZ5A 2ZUXA 2XWJA 2CR6A 2X4PA 4XGZA 5D71L 1I1AC 1XF5B 1OAXL 3OGCB 3OR6A 3WL9B 4LCWA 4NRZB 4KY1H 1C08A 1AE6L 3V6OE 3OMZA 5D2LE 1IEHA 3Q5OA 1TVBA 3A6OA 4G8FB 4WW2C 1OGAD 4N1CA 3MJ8B 4V2CB 3ZKND 5DJYA 3M1BA 3PHOB 2AI0L 3VFWB 1OTSC 1WICA 4ENEC 3AM8A 3WIFA 3MX0A 3MGOB 4LSVH 3SDXE 2PR4L 4OLXH 4GJTB 5LWYL 3QA3B 1CICA 4U4BA 3TCLA 5MEQA 1S3KH 4XB8A 5DUML 1KBGH 3GMRA 3WEXB 3O2VH 3MRPB 4N9GB 4Q0XL 4CMHC 5TQ2L 2Y1VA 1T3FA 1VFOA 2VIRB 2R1YB 5JHLH 2D03L 2D4DA 2F53E 4Y5YB 5AD0A 2EKSB 5I8OH 5LKNA 3ILQC 5F21B 4Y4HD 3FCTB 3I84A 3ZKXB 2BXYA 4NWTL 4E41B 5EIVA 4LSQL 5I1HH 1OPGL 1OSPH 5CD3A 2R56L 1OAYH 3MO1A 4XI5C 2O93L 1INEL 1X5HA 2IGFH 1IGFH