4ONGL

Fab fragment of 3d6 in complex with amyloid beta 1-40
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
216
structure length
214
Chain Sequence
YVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRIEAEDLGLYYCWQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3D6 FAB ANTIBODY HEAVY CHAIN
publication title Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 214
sequence length 216
ec nomenclature
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongL01
1KIUA 4F58L 4N8CH 2UWEB 4OLEA 2GI7A 4BSJA 2IANA 4PG2A 2GCYB 4TUJA 3X12A 3UYRH 3U0WH 3IDNB 2YD1A 3IRPX 3QBTB 4GRLD 4POZC 1F4YH 3GJFK 4RGMB 1LO5B 3V4VH 4ESKA 1PX3A 2OTUA 1T66D 2ZUQB 5GS3A 4HJGA 4MSWB 4XVSL 1DQLH 3MV9B 2QJDA 4P5TA 2MHAB 3DO7A 5I15L 2FWOA 4W6YB 5KANG 2A0LC 1XFPA 4P46C 3VFPB 2VN4A 2ZKHL 2CKNA 5JNYB 2WQRA 3GHEH 4EEEA 4G6ML 5E6IC 3LZFL 2I26N 3CU1A 5E95B 1YEFL 2CRZA 2Y7QA 5ESQB 1OP9A 3TT1L 3NA9L 5J12C 3AREC 5DR5H 5EOQL 4Z0XA 2W9EH 5CKGA 2RJMA 4XWGH 4HIEA 4XBEH 4JQXA 3QPXL 1AKJB 3LQZA 1EEUA 2BVQA 5FHBL 3VXSE 5JZ7C 3RX7A 2Q3ZA 4ZFGH 1DJSA 4H1LA 1H5BA 4JRXE 3QZWA 3WNLA 1W2KT 4U6XB 5I0DA 4G43A 4X6BB 3HR6A 3J7HA 3QQ4B 5SX5K 5ID1B 2J88H 4JHBA 3RPKA 4KQ4H 1OPGL 3DUHA 5BXFB 4I9WD 3OTTA 1GAFL 1KEGL 3QSKB 5GS0L 1JTOA 1KGCE 3CZFB 1KTLB 4PGEA 3ZMRA 5GS1B 4TUKL 3V0WH 5HYQB 3G5XB 1WJ3A 3EJYD 2HYMA 3DYOA 3OX8B 1ZLWH 2C1PA 1Q0YL 4PRNA 3ALXA 1IC7L 4I18C 4XBPB 1G0XA 2ESVD 1T5WB 2V17L 1NC2B 3VGEA 4OFVA 3GO1H 1UQSA 3L3OA 3H7LA 4UQ3A 3IDXL 4LKCB 4YE4L 1A4KA 4M6OH 1JYNA 5DJDB 4TUOB 5M95B 3S37X 1PZ5A 3HCVA 5HGDB 3HUJE 2D9QB 3BIKA 5IROA 3IS0X 1OP3K 5CGYC 4XNQA 4PS4H 4DKDC 5E8NA 2LVEA 4OFYA 3MLYH 1EFQA 3QCUH 4MB5A 3ULVF 2EDKA 4JFFA 1MI5A 5JUEL 4HUWB 4U31A 3QR2A 1OARH 2DMCA 3BH9B 3L95A 5E00B 4YZFF 3REWB 1N26A 2G75A 3DGCR 1M7DA 3VJ6B 2DQHH 4Y2OA 5B3NA 1H3WM 1KF9B 3T2NH 3B5HA 1JHLH 5AZ2H 5C0JB 5I1KH 4DFIA 4YHYB 2Q7YB 2GITB 5T3ZL 2VXVL 3TNMB 4M6MH 1VKXA 3W39A 2DQTH 3UJTH 1FNEA 5TPWL 1UVQB 2OJZH 4EUPH 3FONB 4J6RL 4WW2B 3U0PA 3MV7E 3QJFB 1YEGL 3SDDA 4NRZA 5F71A 1I8IB 1LWRA 2A6DB 4FOMA 4MCZA 3VH8B 4BSWA 1MY5A 3OMZA 1S9YB 3S5LB 1SYSA 1K6QH 5EZLA 1A7RL 4MJIA 1OT1A 4QT5A 1CDHA 2VDLL 4R90H 3VWKD 3GMQA 3MA7A 5D1ZC 2Q76A 3FT3A 1P53A 1YMMB 3ARTA 3SGKC 4DAGH 2IADA 2OR9H 4R0LA 2F53B 4PV8B 3RGVA 4BFBD 4KUCD 4HCRL 4R97C 4TRPH 2I07B 1DQJA 4QCIB 4Y2DC 4GBXB 5K9JH 1I7TB 1OP5H 5HHOB 3VI3E 1U2CA 5J1TC 2BOBA 2C7UA 4WTWA 2YSSB 4G6FD 2GT9B 1CVSC 1M4KA 4X99B 5JPNA 3M8OL 1EBAA 3QIBA 4FQXC 4KAQL 2ADJA 1CE1L 5JO5A 2XQBL 4X7DC 4NCC1 5CINH 3D69A 4P9MH 4JZNA 4HJJL 3BEWA 4PJ8D 5EU6E 2ITCB 3K46A 4K3GA 3ABZA 2VDOL 5ESAB 2VLKB 3ISWA 1MIEH 3Q6GH 2BCKA 2HA1A 3GMLA 4JY5H 3BKCL 3CCHA 1AQKH 2EEBA 3CUPB 5T5NF 3VFSB 3D1MC 3EYUH 4Z5RA 3C6LC 4HUUB 1MQ8A 4HS6B 3EYSH 5C0BE 2IQ9L 3WUWA 2RB8A 1MI5D 2DIAA 1DZBA 1A6VH 4JY4A 5GGQH 5A2JH 2ATPB 3IFLL 3T3ME 3FRUA 4P48A 3M1BA 2DQIH 2YUVA 1P9MC 2AEPH 5C0DB 2IGFL 2XKNB 1IAMA 3PQYA 2I5YL 3QNYB 4IOIA 1MPAL 1A7QH 4MQSB 4NRXB 3F12A 1BM3H 2ZOLA 2X9YA 1N7ML 3LEYH 4WFHD 4IRSB 5HHQB 5E8EA 1JYXA 1TNNA 3P0VL 4X6CE 4C58B 4LFHD 1DLFH 5DJ6A 2VLME 5A16A 5EU5B 4N8PA 1CQKA 4OLWL 3TBYB 2HFTA 1FYTD 2O5XL 3MFFA 4JO3L 3MXWH 5JLZB 2AP2A 3QUMB 1VGEH 3OR7A 1PSKH 4MNQA 4X9BA 3QCVH 1OY3B 2V2WB 5GGVL 4NO0A 3Q6FA 2VL5B 2OZ4H 3NPSB 2X1WL 4K8RC 4QWWD 5JA8B 1HXMB 5H94B 1EFXB 3SOBH 5B38G 3STZB 2FR4B 4PJCB 4LPWA 5IVXB 1FP5A 3KPOB 4BQ9A 4LSSL 1XF2B 4PP1C 3TA3A 4C83B 3JUZA 1T2XA 4FFVD 4TULH 3VRIA 2D0HA 1PJ9A 4X0KB 2BNRD 5DGRA 1YYLL 4F9PC 1E4KC 3BGMB 4BK4A 1FNHA 3W9DB 3QWQB 4JPIB 1QFWH 2HKFL 3OKLB 4PJIA 2Q87A 5DMJB 3PL6A 1UWGL 3WLWC 3HI1B 4G6JL 3FHAA 3KPRE 2NR6C 1EHLL 3GSQA 4KQ3H 4AZ8A 3F7RA 4POZD 2H2PC 1KCLA 1DBBH 1FFQA 5EOTA 1LO4H 2DWDA 3OKNB 1QFUH 3C5SB 2JIXB 3DECA 2ICWI 3TBVB 1XGRB 1UYWH 3CK0H 1CD9B 2UVEA 1QRNE 3W11C 1G9NC 1SY6H 4HC1L 4C56A 3CH8A 4MS8D 3GI9L 2WLZA 2A0LD 4P46D 5EUKA 1EPFA 2ICCA 5E6ID 4I13B 4Y19B 3MOAH 1KIQA 3S9DB 1JF1B 3ARED 1FGNH 4QOKD 5F3HA 3L7FA 3HZYB 1RZ8A 4ZYKB 2E9WA 3MJ9A 5DUBA 3U7WH 2VZ1A 5JZ7D 3ES6A 3QFJE 2ZCKL 3X17A 5L2KB 1AI1H 1NLDH 5C6WH 3VXQA 3C60D 3U2SB 2VSCA 43CAB 1D5ZB 4WU5B 1U9KA 3UTSA 3FOMA 4JZJC 1IAIH 5GGRA 3VU2A 1NGPL 3CFJA 2NNAA 3ULUE 4MNQD 1CFBA 3MV8B 4PRHB 5DFWH 2ARWA 4G6AC 3QPQC 3O2DH 2DLIA 3S35X 3O6FC 5D5MB 3UZEA 4PJXE 4NQDE 1MF2L 3HZMA 3P4OB 5DJ8A 4LVNC 4G8GD 2P45B 4U1NA 3KYNA 4AT6B 3OWEA 4Y4FC 3UTTD 2E5EA 2IPTL 2P5ED 4N9GA 4Y1AA 3UZVB 1G9MC 4OM1H 1MELA 5E08L 2HRPL 5L8LB 4NZRL 4TSAL 1I8LC 3RZWA 3QDMA 1R5VA 1RJZA 1JWSA 5T1LD 1RUQH 4UQ2A 3KNBB 3QUXB 5CWSB 5IW1A 1FCCA 5T3ZE 1WZMA 4K7PH 4PJEF 2QLVB 3AXLB 4UINL 3GJEA 3LKOB 4BFIB 2AEQH 1UA6L 2CK0H 4U7MA 4PJ5A 1TETL 2O26U 3B4NA 4XAKE 4RBPK 2JELH 1FFOB 3N1QC 4FQHA 1FLTX 8FABA 3VRJA 5F88B 4XP9H 1FNGB 3T4AB 1HNFA 1YECH 4FQLL 2QKIB 2VAJA 3LEXB 3CFCH 3DUSB 1AR1C 1T1XA 2A83B 3AAZA 2SEBB 1MHEA 3FFCE 1XF4B 4LCWB 3T77A 1T3FA 1F4WL 4V1DB 4N0FA 4WEMB 2FEEI 5ETUB 2BFVL 1DE4A 4X6FB 1R5IB 3SDYH 3QRGL 4PB9L 2QEJA 1W0YT 4Y16C 1T4KA 3QUMH 4QRRE 3RIFK 3IDJA 5D1ZD 1JZ3A 1F45A 2IALA 4OLZL 4AM0A 1T5XA 4NQEA 5LQBL 2XFXA 1QSVA 5E6ZA 4EXKA 3WD5L 1NFDB 2FX9L 2ZUWA 4K3JL 1IJ9A 1NBYA 4HQQH 2DMKA 4Y0GA 4JFDA 3ULVH 1AGEB 1BEYH 3KS0J 5GPRA 5E9DA 1ZWIA 3B9KD 4D94A 1DVFA 2RBLA 1RIHH 5DLML 4E0RA 3EOAB 4WDIB 4U6VL 3QI9A 4FQXD 2O93L 2Z92A 3GMPA 1FYHB 1ODAA 4K71B 4JRWA 1PG7H 1YA5A 3X11A 1Q0XL 1MY7A 1E4JA 2I9LA 4OZHE 1WBZA 4DGYL 1VERA 5KBNC 2FBJL 3MLZL 1JF5A 4KKAD 5EN2A 3BP4A 1SM3H 4TSBH 1AD9B 3ARVA 3RWEB 3H7BB 1L7TL 4NC1C 4Y1AD 2EICA 2VDPH 4CNIA 1A3RH 4M1DH 5IHLB 4KMQA 1Z3GH 4MA1C 1GOHA 4HK3J 3P4NA 3LKQB 5FOJA 3VXNB 3TT3L 5IF0A 1GHFH 3S96A 3T0EA 4V2CB 2L7JA 4PGCA 5DJCB 5IFJB 4UIKL 1UEMA 1Z2KA 5HHNA 1DBJH 2DF3A 5KSBB 2NY4B 1FBIL 4IDJL 5DZLA 1WQVT 3ARYA 1MHHA 1PY4A 2DQDL 1AO7B 3KJ4B 2OL3L 1EO7A 4XPTH 5CIPH 4HKXB 4HWEH 4Z0BH 5INCA 1U36A 5KSVB 3DSFH 2JB6A 1PYWB 4M93B 4P59L 4LCYB 5FA4B 3RZCC 4D0DA 2VR5A 4HS8H 4NQSA 4PRID 5I30L 5SWSB 2D7QA 2VLRD 5IV2B 2Z31D 4LLWB 3X3FL 2HVJB 4HKJB 3TJHC 4GQPH 4OZGA 5I1HH 2DM4A 1KJMB 2X89A 4HPOH 4F37K 1ZHBB 1IGYB 3ZO0A 5ITFB 4I9WE 4I0PA 1N0XH 5HYEA 4NKMB 2X05A 1CIUA 1G7MA 4WUKL 3RUGA 2J8OA 2VDRH 3QUYA 4O4YL 4YDKL 2B7DT 4I1NB 4TOYL 2XZQH 4ALAH 5JHLH 4OKVB 5FA3A 3OKDB 3QULB 4KMTL 5IEKB 4P5KA 5CLWA 1WWWX 4WWKD 1A6WH 2R1XB 3E2HB 4M02A 4WI9A 4RFNB 1JGLL 4F7PA 2ESVE 1ORQB 5F7NC 4UTAL 1U2HA 5ERWB 4WENB 2IPUG 1HHGB 2UUDH 3UPAA 5E2TH 5L6YL 2DQEH 1V8HA 4LASL 4MXWH 4UUJB 5HPMA 5HXMA 3BJ91 4CADB 1G9EA 4U33A 3JV6B 1K4DB 3M17A 4MB3A 4L4VA 4O9HH 2BHYA 1UADC 3ETBF 2LTQB 2FH6A 2NXZC 4HF5L 2VLLA 4QXGH 1IILE 5C08B 3KJ6H 3MRPB 3W11D 3TO4B 3CDCA 5KSAB 1U8IB 1UGNA 4NZDA 3QISA 4U1KB 4OLVL 2IANE 1FFPB 4XNUL 3SDAB 3RNQA 3V8OA 1EHNA 1G7JA 3ARDA 4JY6B 5FO9A 3G6DH 2W1NA 3R4DA 3RL2B 1XGQB 2DWEB 5BW7A 1NBVH 4KK8C 4NN6B 3BO8A 3L3DB 2NY0D 4CKVX 1WBXA 3UTZA 3PHSA 4HV8B 2WLYA 5I1DA 3GHBL 3WE6B 3RY6C 4L4TB 3IFOB 3SKUD 1CE6B 2OJEA 2V2TB 4X4MA 2J8UA 4RMSA 3WIFB 4WI5A 2I9TB 2VITA 1JGDB 1LGVA 3O11A 1FL3A 3HI6L 4Z77B 3Q5OA 1CG9B 3PP4H 4LCUB 3MJ7A 1O0VA 3L5JA 1FQ9C 1VSCA 1OAZL 4HEME 2YPLB 4PD4K 2D3VA 5EU7C 4PJFA 1OAUL 4OM0H 1BQLH 4QRTA 4W68A 1R3KA 2XWTA 3CFKA 5C0GA 2Q8BL 2X9XA 2ADGB 5IMLB 3U82B 1LK3L 3MBXH 1FRGL 4L8CA 5EIIB 3FJTA 4QNPF 4YX2H 5TDPA 3FO2A 2GUOB 3WHXA 1QBML 4NDMB 3V5HA 2X70A 1JGVL 3DROB 1A6ZA 3LSOA 3QPQD 3MOQA 4U1LB 1YUHB 5FDWA 3O6FD 3D3VB 4XMKL 3N1MC 3MJ9L 3DTXB 1MFEH 1F90L 5HVGB 4GKZB 4K2UL 3B2VL 2EDRA 1NGWB 4HX1A 5GJTL 5E8OB 5GGUB 4Y4FD 1K8DA 4ONFH 3ZKXC 2VDQL 1J8HD 3NCJL 3MX0A 3MCKB 4G8IA 2R56L 3K1DA 1YYMH 1Z5LA 5EC2B 1RZJH 1CICC 1N6QH 2R1YA 4ODBD 2H2SC 4OSUL 2KL6A 1S9WA 2P8LB 4Z9KB 1UB5B 1MFAH 1PAMA 1L4IA 1MCWW 1QFWI 4MD5B 2VXQL 1U8KA 2WINA 1EAPB 3O0RH 3NVQA 4RFEB 1CXFA 5E5MA 4NO2B 3IJYB 1FGVH 4G8FA 5FGSA 5T1MB 3BXNB 5F96H 1KLGA 1PW3A 2CRYA 5ICXB 3X3GH 3EDFA 5IFHL 1AHWB 3F58L 1MI5E 1YNTA 3BMVA 3I6GA 4IIQC 5BJTA 1MCBA 3V6FA 5C0CD 1A2YA 5I74B 2PTTB 1QG3A 1DEEB 4WFFD 4WV1C 5IQ9A 1OWWA 1U8OB 4YHIB 3LD8B 3WKML 4G80A 5ISZA 1AR1D 4ZFOA 3EJZC 2G9HA 2HKHL 4NO3B 3GSNB 3Q0HA 3MRHB 3VXSB 4GG6F 5DQ9A 2EYTA 2MPAL 4P2QA 1C08B 2HG5A 2OTPA 2PNDA 3HI5L 4ODTH 5GRYA 5EO0A 1NAKL 3C08H 3RKDC 4GKNB 2X42A 2EDOA 5IQ7H 3CFDB 5FB8B 3REVB 4YHNB 5M7QA 4M5ZL 1F97A 1HHKA 1EJ6A 3Q5YA 4Q0XH 2EIEA 1G7IB 1S7WB 4U0RC 1JPFB 4AJ0A 2HT4C 1NUDA 2AJXH 4X6EA 4LHUD 1FV1A 1SBSL 3PHOA 5KOMC 5I76B 2DKMA 1BFVL 4M61A 4MJIE 4W4OA 2A73B 1IGFH 4OCYL 5FUOH 2WQ8A 1MIMH 1G7QA 2OXGA 1I9JL 3G6AB 1KCSL 1K5NA 2AJYL 4ZAKC 2PYEA 1BLNA 1KB5B 4YBLC 3MRQA 4CU7A 3V6BR 4S1DC 3LN4A 1F3DJ 1KJ3L 1IAII 3MNVA 1N8ZB 3H3KA 4DN3H 3HUJB 3TLRA 4O00A 1I75A 3QWRA 3OPZH 1D9KA 2BNRE 5BRZD 1JWUB 2IPKB 5F6IB 3V4PL 4Y4HD 3KPSD 2XTJD 4KI5E 1A0QL 5IHZA 3MRJB 4ZTOH 4HFUL 1U3HB 4L9LB 4EI5B 3FN0L 5F1NB 1WK0A 5F7DA 3MTRA 2NTFB 4XC1H 3KYAA 1HZHH 3LQAH 4D2NA 3ZE1E 1KIPA 1R3JA 1PZUB 4CU6A 1KCVH 2Y36L 4MCYA 3FQXA 2FATL 5EBWB 3GIVB 2FH8A 5F9JA 1SVCP 1AGBB 3ZE2E 1FH5H 1B2WL 4JFOB 5BVPL 5KVDL 4CW1B 3TPUA 1AXTH 1JGUH 5I1LB 4X83A 3TYFB 1JI1A 4O51B 1OLZA 3MV7B 1YNKH 4L3CB 5BQ7B 1BJMA 2P5WA 2X41A 3BVNB 3C8KB 5CJXC 3RZCD 1J11A 4QHKJ 4NGHH 1S3KH 4IS6A 1G9NL 3MJ8B 3LKPB 3W82A 4N0UE 4ZO6A 2B1AL 2YUWA 3MROB 3MNZA 4A6YA 3KLAA 1IRAY 2VIRB 1MCFA 3HN3A 1G0DA 5C0NC 4FABH 2NMSA 3ZKNC 4NQCA 3S34H 3HE7C 2Y23A 4H20H 2DKSA 2R29L 1TCMA 2UV3A 1ZHKA 5GGSY 3BT2L 3K1KC 5GS2H 4IOFC 2NX5A 4H26A 2XA8L 4WUUA 1WZ1L 3W5NA 4WRLA 1J10A 4HIIB 3C6SA 3UYOD 3VXTA 3ZE0F 1H5BC 4OUUA 4MNQE 1F3JA 5ESVA 3SEPA 3BP7A 3BRGC 3WIIH 4YO0A 3WL9A 5ALBL 1M05A 3PWJB 4M6NH 3SGDH 5EU6B 2H3NA 3WS3B 3R1GH 1I7ZB 5JHDD 3P30L 3D0VB 5EBMB 1CK0L 4G8GE 3DV6A 4XNXH 4UT6L 1JTTA 3RWIA 4HMDA 1I1YA 4NKQB 3IJSA 3QWRD 2C3WA 1NEZB 5CJQL 1IC5L 2AK1L 2VDNH 5F97E 1KCUH 4LHJB 3K80A 1IEBB 2FHCA 2NXZD 4Z7UF 2MNUA 5C0BB 4MZ2A 2HFGL 1YZZA 4PJIE 2VISA 5AWNL 4BH7B 1ACZA 1TTFA 5A2FA 4NP4H 3K2MC 4G3YL 2AKRB 5DHVH 1DANU 4HH9B 4U7SA 1BQHA 1KN2L 3DX9B 3K4AA 2YS4A 5JW3L 2D7PA 1G9ML 3HNTH 4PRPD 1FVDA 4AEFA 1MAMH 4LPXA 2ORBL 2X1OA 3MUHL 2NY5H 4GRWF 5EUOA 1Z9LA 5E2WH 3MYJB 1U8PB 4K3EL 2BXZA 2VQ1B 4KK8D 4FMKA 3V8CA 1SEBA 5CEYA 3GSNH 1IZJA 3BSZH 2GK0B 1MVUB 3PXJA 1GGBL 1NAMH 2PTVA 4C56E 4MNHB 1M7IA 1V7NH 1CFTA 3MNWA 4X6CB 4GH7B 3ZKQD 1WIPA 3STBA 3AY4A 1X3DA 2X4PB 4ZO7A 4H0HB 5T1KB 3BPCB 3O8XB 1FAIH 1MEXL 4RIRB 4XVUC 4IDLA 1Q94B 5F7YC 2AV1B 4J3WA 1U95A 5D2NB 3GSUB 2ZP0T 5BO1L 4DGVL 1X5YA 3NCBB 2ICWA 3BWAB 5C7XL 1MFCH 2CH8A 3BZ4A 2IFFL 1N3NA 3DOSA 3X14B 5BZDB 5I19H 4E9LA 3QWOA 2AXGA 3WJJA 3OL2A 5GRJL 3DETD 2YK1L 1KB5H 1S7VB 2BRRH 3SKOB 3TEUA 3ZSTA 1I1AB 2MCPH 4JEGB 3MACH 4JCLA 4CL7A 2IFGA 4R9HA 2RAMA 4YWGH 3R06B 5DUML 5MEPA 3N1FC 2IMNA 4ZTPH 3UTSE 5A3IC 4X4YB 3ARFA 1ERNA 5DS8B 4AYFA 2ZCLH 5ICYA 5INDB 2YBRB 4LGPB 1CDYA 4XNYH 1CFQA 2LAGB 4R0LC 3RAJL 5I2IB 4PP2B 2IAMB 5I17B 3KPRB 5GSRA 1ZLSL 2GQHA 2B2XL 1CICD 5EO9B 2H2SD 2N4IA 2EDJA 1OL0A 5DRZB 1C5CL 2Y06L 2CUIA 1BJ1J 2YXMA 2A9NH 5BZWA 2HWZL 1ZHNA 4Y1AE 5C0FA 1IAKB 1N4XL 5FGCE 5KJRL 5DMYA 4YHKL 1UG9A 5AUMA 5KANI 1MCWM 5D96B 3QDME 3GSVB 4NNYB 2QHRH 5EZJA 5DO2D 4MAYD 5TFSH 4QTIH 3VXMD 2HJFB 4U1MA 4APQB 1HEZB 2PO6B 2XWJB 4HZLA 2CDGB 3EJZD 3WNMA 3IVKB 5C0AA 4XAWH 4M7JL 4XXDB 3PP3K 2JB5L 1AY1H 3QFJB 1QSFD 4WEUD 3SE4A 2V6HA 4POYA 12E8L 2HJKB 2R0WL 3HPJA 3AB0C 1G7HA 4S1SL 3RWHA 3IKCA 2Z8RA 2D7MA 3RTQC 1UKTA 2X44D 4WHTB 3S6CA 4MVBC 2VLJD 2VLRE 5L88L 5D7IE 3JTSB 3FT4A 3RDTA 1HHHB 4Z7NF 1BHGA 2HT4D 3HNSL 4G6KH 4EZMA 2EC8A 1IBGH 4X98A 4YR6B 2HT2C 4EI6A 3HNVH 3D85B 3BQUC 2X4TA 4M5YH 2V7NA 4LFHG 2XWBA 1NDGA 4ZAKD 4NQEE 4PJXB 4Z7UB 2GYSA 2PR4H 3DYPA 4ZUTB 4KPHL 4KHXL 1PKQA 3VW3L 1P6AB 4UOJA 2R0LL 4JFDE 2VZTA 4OIAA 1LMKA 4WO4A 5EFIA 4XP1L 3QG7H 1A7PH 5E9DE 3SE8L 1H15B 1DQMH 1W0VA 4JHWH 4OTXH 2LV4A 5AEAA 1BREA 1VADB 1ZT7B 2OX5A 3V0AC 1IM9B 4UV4L 2X1PA 2ZNWA 2EXWD 4P9HL 1FLRH 3WFEH 3WFDH 3GNMH 4F9LC 5E56A 2WZPD 4H0GA 4U1JB 1F5WA 4PPTA 3GSWA 5I71B 1T0MA 1BZ9A 5E7FA 2IQAB 1DR9A 3VRLE 3KXFB 3MUGA 4ZSOA 4NWUH 1WIOA 1IEAA 1H3XA 1SJVA 2XNAB 1QLFB 3QUKB 1TNMA 3L1OH 1YN6A 3OJDA 1TVBB 3S36X 3O45A 1LO2H 1E27A 1QSEA 3VDCA 3EYQC 2NY2C 4R26H 4KZEH 3FQRA 5D7LD 5ANMA 5TF1H 3VGFA 3FFCB 1PKOA 4DKEL 3SJVA 5HHVH 3T0AA 3G04B 4P2OC 3QEQD 1D3CA 5GRVL 3FQNB 4LIQL 1N6VA 1F58H 2VAAB 3L3GB 3UTOA 4LKXB 4WTZG 4FXKA 4QRRB 4CMHC 3U0TA 1YJDC 3HS0A 1XGYL 4S1RH 5C0ND 1C1EH 5I1GH 2LU7A 3SKMA 2OS7A 1F4XH 2M26A 3B9AA 4KJYA 3HE7D 4L8SC 1CGSL 1I9RL 2DQGH 1FSKB 3R8BB 5I18L 4IOFD 4MNGA 3JWDC 3VFUA 2YEZB 1U93A 4OZGE 5DHXB 3ARBC 1NMAH 2BSTB 4N68A 2EYRB 1Y6NR 3DMMB 4EKXA 3GMMA 2Y25A 3B43A 5C07A 3WEXB 4ZOCA 2NXYC 2YN3A 1JWMA 4A6YL 4XVSH 1TVDA 2PCPB 4XCEA 1J5OL 1XGTA 4OD2B 5DD5L 3RUGE 4NSKB 1ZSDA 3U1SL 3STLB 4P23C 4PR5A 5I15H 4OZHB 3LDBB 5FOBB 4KY1L 2VYRE 1MCPL 4MJ6B 3PNWB 1FVEA 3CAFA 3QIWB 1GGIL 4FQIH 1J8HE 4G9FD 4KUCF 3T1FA 4NKIH 5CJ8A 2F5BL 5IWLA 3U4EA 4XPGL 4OGXH 1TZIA 1YEFH 4EUPA 1P2CA 3A6CH 4DZBB 3TT1H 3NA9H 5EOQH 3VFMA 1U8HB 3LN5B 5CJ5A 1ZLUK 1H0DB 3QPXH 1RY7B 4MA8H 1T89A 3T2OA 4JFYA 5DEFA 4PJDA 3HZVB 5C71A 1RVFH 2WBWB 3OKMA 4IRJB 1UC6A 4KMLB 2HN7B 3U36A 3VFNB 4RGNC 1YY9C 4PGDA 2APFA 4PGZA 3TCXA 3P73A 1CTNA 1EJOL 3FTGA 4WFFE 1Q0YH 1ZGLP 4J4PD 2W65A 3L7EA 1HQ4A 5C6PB 1ED3A 3GRWH 3PWLA 5C86A 2NY3B 3IDXH 2V9TA 1A3QA 4HUVB 1IAOB 1YC8A 4KDTC 4XVUD 5F1IA 4DKFL 4P2CG 4X4ME 5JA9A 2GKIA 4YHOL 2J8UE 1IGML 2GCYA 1JHTA 5TDOB 1BIHA 5TQ2H 3IDNA 3TZVA 1LO5A 1MCEA 2VDML 3BFOA 3UJIL 3LKRA 5JUEH 3TIDA 4GMSH 2X4RB 5GSVB 4PJFE 2ESVB 5BOZG 2WSKA 2MHAA 4P57B 5A3ID 2EECA 5FGBA 1B0RB 1RHFA 1CS6A 4JPVL 4DWHA 1TQCC 4EIZC 2BVPB 4HBCH 3GFUA 2CLRB 4GRWH 4GKSB 1QFOA 3RI5F 1S9KC 5ELIA 2BP3A 1TJGL 5T3ZH 2VXVH 3ARGC 5BRZE 4H25B 1TTGA 2WUBL 5DD3H 1DVFC 5TPWH 1YEDA 1AKJA 1C16A 5J6HA 5FUZL 3SGDI 4MLSA 2XTJE 4JKPL 3O6LL 4MGXA 1YEGH 4GXUN 3VFOB 5KW9L 3VE0B 4LL9A 4U6XA 1JF6A 1AD0A 4Q58C 5ID1A 3MRBA 4JLRA 2IANB 5BXFA 4TUJB 3X12B 1A7RH 5ABDE 3V52H 2VDLH 3UO1L 2VTFA 2OTUB 1KTLA 4HJGB 5GS1A 5HYQA 3QXAB 1DQQB 1GJIA 2OZ4A 1HHJB 5C09D 4P5TB 3DO7B 5EDXA 2FWOB 1VPOL 4BZ2H 1C5BL 3VGAB 4W4NA 1NC2A 3IDGA 5IMKB 3ZE1F 4QXTB 4U3HA 3SBWA 4N0CC 5HY9B 3BEVA 4LKCA 3Q48A 5I75C 4BQBA 3GK8L 4CDHA 2GJJA 2I60L 5DJDA 3G5VA 3KAAA 3RTQD 3ZTNH 2JCCE 4Z0XB 5IEHB 5HGDA 4ZNCD 4MVBD 3M8OH 4L1HA 4HIEB 4KAQH 3VWKB 3BYTA 4YNYA 3QHFL 4DGIL 2H26A 4P2QE 5FM5O 4HJJH 2HT2D 2VXSL 4G43B 3JWNC 5D6DC 3BQUD 4XCYA 4HUWA 5CSBA 4G9DB 2VDOH 3BX7C 1HWHB 3REWA 5E00A 1U91B 3BKCH 4YUEH 3VJ6A 1HI6A 2DQUH 2P8PA 3OBAA 2KQNA 1IC4H 4PGEB 3ECBB 3KYMA 5C0JA 4G6FB 4JGMA 1J1OL 2IQ9H 3LS5L 1SY6A 5FHAL 4PRNB 5K59E 5DEGA 3TNMA 3NIDF 4I0PC 3U7YL 4HKBA 2YKLL 4RMUA 3IFLH 1J1XH 2OMNA 1UQSB 4EOWL 3L3OB 4UQ3B 4PJ8B 4JJ5B 3FONA 4WW2A 1A4KB 4CVXA 3QJFA 1JZ6A 4Q9QL 3KPPB 5JHDE 1P7HL 3WFHB 1N6UA 3TBSB 1MPAH 2GJZA 3WFZA 5JORB 1S9YA 4R4FH 1AGFB 3BIKB 5D9SA 3W0WD 1R3LB 3V7MA 2QL1A 1F4YL 3CXHJ 2Z4QA 4PTTA 5D6CA 5E8NB 2ICWJ 4L5FL 3G9VA 1KENL 5D93B 4GG8B 1F6FB 1MI5B 4XP4H 1DQLL 4OLWH 1T1ZB 1IE5A 3F5WA 2G75B 4PLJC 2F53A 4LIQE 4E41D 4JO3H 4PV8A 25C8L 3OGOE 4J23A 4PRPE 2NY2D 4QCIA 3QT2A 2OP4L 4GBXA 3KGRA 3MQIA 4LLYA 3UZQA 3GHEL 3ZDYE 2YD7A 2FEEL 2GT9A 3L3IB 3MFGB 5I6XC 5DR5L 4P2OD 4LSSH 4X99A 4L29A 1VKXB 3O2DA 4XWGL 4XBEL 4YDJA 2MTPA 3MBEC 4C55A 3FO1A 5CBAB 3ARDC 4PY7A 3OGCA 1YYLH 1CDJA 4ZFGL 3KHQA 1RQ5A 5IBLC 2ITCA 2P5WE 5BW7C 2EC9U 4BSWB 4E5XB 2J88L 1JYVA 1T0PB 1YEEH 4LSUH 4YDLC 1SYSB 1FYTB 2HKFH 5ESAA 2VLKA 3CVHH 5EZLB 3O6MH 4MJIB 4QT5B 4K7PX 4ZPVB 2FLBT 3CUPA 4X7EC 1HSAB 3D48R 5HDBE 3GMQB 1XR9B 3MA7B 3OR6B 4HUUA 2Q76B 3PDOB 1EHLH 2NY1C 3V0WL 4XVTL 2IADB 1FO0L 3IETA 2YMXH 3H9YA 5HDLA 3RHWK 5AZEH 4RA0C 2ATPA 1DQJB 1JUFA 2BNRB 3F65A 4Y5VC 3TO2B 2NX5E 4GFTB 2XZCH 4HC1H 4WUUE 4Q6YA 2C7UB 2KZ1B 5C0DA 1HILB 3GI9H 1TZGH 4M6OL 1OTSC 5JPNB 4A2MA 4M8QB 4NRXA 3QIBB 2ZUSA 3QHTC 1U92B 3KR3L 3W81A 4IRSA 3GSRB 5JO5B 4JG0H 4RGOH 4PS4L 4JZNB 1FZJB 4PJ9D 3RIFF 2OL3B 3N50A 3QCUL 3JUYA 1CD1A 5A1AA 5F6HJ 3LRGA 1OARL 2P46B 2BCKB 3TNNA 3GMLB 2ZCKH 4M3KB 3CCHB 2DQHL 3E0GA 3QAZB 1KIRB 5JLZA 5FV1L 1FORH 3QUMA 4KKLD 4P3CL 2V2WA 1LE5B 2I27N 5MEQB 5AZ2L 3DX6B 4P46B 4ZDHB 4RGND 1YY9D 2FR4A 1KUMA 5E6IB 5HYJA 4JY4B 4M7LT 4M6ML 4C83A 5J12B 2X7LB 3GUTA 1FAKT 4RNRB 4N0UB 2WWMC 1FFNB 4JM2C 3QFDA 5EUOE 1FZKB 1PG7X 4BFGA 4IOIB 4BYHA 1N64L 2ZOLB 3W9DA 1MF2H 4JPIA 4CDGC 4ZOAA 3OKLA 4ETYA 3NCMA 4R90L 5D7KE 5IW3A 4NN7C 1I7UB 3C60B 1HYSC 2IPTH 4FFWC 1QA9A 3ROLA 15C8H 2HRPH 4NZRH 4TSAH 3HKFA 3IAPA 3DURB 4HIHA 2JIXA 1XIWA 3TBVA 4MNQB 3BI9X 4TRPL 4IMKA 3Q6FB 1UKSA 1BOGB 5D7IF 3S4SG 4FS0A 4N0YH 3DBXA 2ZNXA 4PB0H 2GFBA 4LHUG 1UA6H 3NN8A 4Y5YC 4G8GB 2Z0BA 4Y19A 3VRIB 2A6KB 4MD0A 1KXTB 32C2B 3Q3GB 3SDCC 4P9ML 3EOTH 4XB7A 4UU9B 2CUMA 3ARGD 5CIPA 1BP3B 3HZYA 4W70A 1YEHH 4X6DF 4LLVA 3L3JB 3QA3B 4XWOC 1IZKA 4KKBC 5SWZA 5T1LB 1MIEL 4PJIB 3OAYH 4JY5L 3PL6B 4OB5L 1L9NA 4LEOA 2HRLA 3RL1A 4XXCC 2XKSA 3EYUL 4P99A 5MI0B 2BFVH 1GIGL 5EOTB 3EYSL 1D5ZA 3R0MA 1A6VL 4OLZH 3PDDA 1NC4D 1WFUA 5GGQL 3VFTA 3HE6C 5LQBH 5C3LD 5GRZA 3FRPA 3P77B 1PQZB 1HIML 5IR1B 2FYYB 2FX9H 2DQIL 3MV8A 4PRHA 4C56B 4Z7QF 4F8QA 4EN3A 3B8SA 5EUKB 2EIZB 1EH9A 4F15B 1A7QL 3PGFL 4N0CD 5BCAA 1G7LB 2EDXA 3L6FA 5IUSA 2IF7A 4M7ZC 5D7LE 5DEZA 3LEYL 3DRTB 3P4OA 1NKOA 2VZVA 5DLMH 1T04B 2V9RA 3L7FB 1I8KA 1RZ7H 2WBJC 1RZ8B 4U6VH 3TC9A 5J1SC 5J9PB 1LDPL 2X6MA 1DLFL 5C0AE 3CC5B 4MA7L 3EGSA 5D1QC 4JPWH 2M1KA 4ZQKB 1S7XB 4J1UB 5F70A 3MXWL 1VGEL 1WFOA 2F15A 3KNBA 1WT5C 4DGYH 3QUXA 1MLCB 4YC2B 3MLZH 3ZT7A 5D1XD 5CWSA 5K93A 5IVNA 1T1WA 3MO1B 4R97B 3WN5C 1HWGB 3ALPA 2RCSH 3SOBL 3WBDA 2GSGB 3LKOA 3B9KB 3UDWA 3UTSB 1GOFA 1YJDL 5DI8A 1HCVA 4KV5E 3QQ9C 3D2UA 1NPUA 5GGRB 3CFJB 3TT3H 4YPJA 4TULL 4FN0A 4JVWA 1UJ3C 4JG1L 1FFOA 4ZXBA 5K9KB 5JDJA 1YC7A 4QHUB 4QRSB 2VKWA 1AE6L 4FNLL 1FBIH 2NYYC 1QNZL 4IDJH 2AJVH 2PXYD 4JHZA 1VEPA 3HZMB 3DUSA 4OGAD 2A83A 2OL3H 1PKQE 1IMHC 4RWYL 2SEBA 4U1NB 3KYNB 3O4OB 1QRKA 5JW4Q 4LCWA 5A40E 4V1DA 4Y1AB 3NZHL 4KI1A 4KQ3L 5FGCB 4P59H 5ETUA 2OYPA 1DBBL 4X6FA 1LO4L 1NKRA 5GZOC 1KEML 1Y6MR 1KC5L 1JWSB 3X3FH 4UQ2B 1KLUB 1GC1C 4BZ1H 1FL5B 1E6OH 3GEWB 3MSPA 1ETZB 1SY6L 2HTLC 3CSYB 5B39B 1BVZA 1D5BA 2CDFB 2ERJC 1HHIA 4ZSOE 4NFBA 1CZ8H 4R4BB 3MOAL 1VHPA 2Y9RT 1FGNL 4FQHB 1S7RA 5DRXB 3V6OC 3EOAA 4TOYH 4WDIA 3MBED 3VFRA 3VFGH 3QDJD 2VLRB 1QSEE 2Z31B 2MOVA 4LVOC 5D7IB 1JGLH 4WY7H 2AJZA 4JM4L 4UTAH 2IH3B 5ANME 1AI1L 4KRMB 3T77B 3VWJC 4OFDA 4U1GC 5E4IA 1T3FB 4N0FB 5C6TH 4BA8A 5L6YH 5IKCB 1DE4B 1AD9A 1W0WB 1U0QA 4YEEA 3H7BA 3O3EB 4DVRH 1T4KB 2IALB 4U6YA 2F54A 5SX4H 1T5XB 4NQEB 4AK1A 4PBXA 1IAIL 1I85C 1RULL 3VXNA 3PWPD 4HF5H 1NBYB 3WLBA 4OD1L 4WJ5B 5DJCA 2P1YA 4WWKB 2CLZB 3B2UD 5I9QC 4FZ8H 4ODWB 4MNGE 4J8RA 2AAVA 2E7HA 5E9DB 3LRSA 1UZ6F 5T3XD 4DUVA 2UYLA 2BVOA 5FKAB 1OB1A 4HKXA 1OLLA 5HDQH 1JMZA 1IFHL 3QI9B 5KSVA 5C07E 2KKQA 5JW4R 1PYWA 4ZXBD 4CJ1A 4OM1L 1A7BA 4GLRH 4GAFB 1I7RB 1R3IL 3CNKA 2HTKC 3K8KA 4B53A 2I9LB 4LLWA 1OAXH 2HVJA 3ARFC 2QSVA 2FJGA 3CZJA 3GZKA 5EORH 3HI6H 5T33H 4NO5B 1T7WA 1IGYA 2CK0L 1CF8L 4Q6IC 3ZYZA 5C70A 5ITFA 4H88H 2VZSA 3KHOA 5HYSG 1UWXK 9CGTA 1PBYA 1OAUH 4D9RE 2JELL 1L6ZA 4PGCB 1N5YH 3UX9B 5HHNB 4XP9L 5HGBA 2NY0B 5FO8A 3K2UL 5IEKA 3QULA 3LN9A 1YECL 2E9IA 5C09E 4PJDE 4OCLC 4PJEA 1MHHB 1QBMH 3B3IA 4JM2D 5LKNA 3OB0H 1FN4A 4GT7A 3TP4A 4XMKH 5ERWA 3MJ9H 2JK5A 1HHGA 1V3MA 4YBHA 1KLFA 5D70L 3B2VH 5DK3A 5DMGC 1J9CT 1NGQH 4D0DB 4UUJA 4NQSB 5GJTH 1K4DA 1OAQH 4FFWD 5EOCH 2KPNA 5B8CC 1G84A 4OZGB 5H35B 3QQ3A 4C57C 2X4QB 1YY8A 4HQQL 2NW3B 5C08A 1RURH 2JCCF 2CUHA 3MRPA 1F2XK 3TO4A 4MHHI 4NZTL 1U8IA 2GSIA 4ZS6C 3O6FB 1OQXA 4MQTB 5LG1A 2DIBA 1H3UA 1ND0A 4UDTB 4JY6A 3QUYB 2HAZA 2VDKL 4LVNB 4HIJB 4DTGL 3RL2A 1XGQA 5FA3B 5IFHH 3F58H 4P5KB 4Y4FB 3RJDA 3L3DA 2XICA 1J8HB 3SDCD 1XGUB 4F7PB 1WFNA 5F1KC 4L4TA 5HGHA 4ONGH 4P5MB 3IFOA 1CE6A 4MLIA 2V2TA 1RAMA 4XWOD 3WKMH 4KKBD 4AQ1B 3D5OF 1RK1A 1JGDA 1SM3L 2KBGA 4Z77A 5B38A 2FO4B 2MPAH 3V6ZA 4LCUA 5GRVK 5K59F 3HI5H 4WO4C 5JQ6L 1A3RL 4M1DL 4D0BB 1NAKH 4RISL 1Z3GL 4ISVB 5IHBA 3W0WE 3SE9L 2YPLA 1JYWA 2H9GA 3CJJA 3HMWL 4M5ZH 2VLLB 2XZZA 1II4E 4FZEL 5IMLA 3HE6D 2ADGA 4QF1B 1KSRA 1DBJL 4YIQA 3UC0L 2GUOA 1SBSH 4NDMA 4TYUA 3DROA 3RNQB 1YUHA 4XPTL 1G7JB 4HWEL 1WVZA 4Z0BL 3DTXA 1VFOA 3DSFL 1KCSH 4GKZA 3BO8B 3QXDB 5I1DB 3JWOL 1AC6A 3UTZB 1NGWA 3NCEB 1WAAE 4HUXA 5GGUA 3S3JA 2WBJD 3KPQA 3H3PL 2OJEB 1KJ3H 3WMSA 4MX7B 3ILQC 4Q74A 5I1HL 3S3SA 1FL3B 1I3GL 4HPOL 4LSTL 5BMFL 3V4PH 2FIKB 3TBTA 1UB5A 2A38A 1A0QH 3SO3B 5DTFB 1N0XL 5LCVH 1MRDH 4BZYA 3ZT5A 5IB2B 1EAPA 1Q9LB 4HFUH 3BRDA 3H6JA 3SCMA 3IJYA 2VDRL 3MCG1 5F7MC 1R3KB 2XWTB 3CFKB 3QQ9D 5C0GB 3QH3B 5T1MA 1PLGL 3BXNA 4ALAL 2GAZA 4KJWC 4X7TA 4FG6C 1AHWA 1IC1A 5TDPB 3FO2B 5DHVA 5IB5B 3WHXB 3RIAK 2X70B 1NLBL 1A6ZB 3LSOB 3ILPB 4NM8L 2Y36H 2YRPA 3ESVF 3SGJA 2PTTA 5E03A 3BUYB 1DEEA 1EEYB 5BRZB 4JRYD 2C5DC 4YHIA 4ZNEA 5E2TL 5KVDH 4P49A 4NO3A 4NN5B 1NCBH 4Y4HB 2XTJB 3GSNA 5JXEA 4HX1B 4KUZH 3VXSA 3QO0B 1K8DB 2EE9A 1NAMA 4M8VA 1EVUA 1ACYH 2AERT 1G9NH 4YHNA 1AGDB 1QYGL 5GZOD 3BD4A 4OKDA 1DP0A 2R1YB 5B21A 5D71H 5T3XL 1S9WB 1G7IA 1S7WA 4W81A 4URTB 1JPFA 3KJ6L 3VXRD 1ZVHA 2HTLD 1B4JL 1SJHB 1RMFH 5MEND 2R29H 2YC1B 3G6DL 4G8FB 4I77H 1RIVL 3G6AA 4OCSL 4YGVB 4NCDA 2QSCL 1IGTA 4HWBH 1X5HA 4LHQB 4Z18A 1NBVL 3RVWC 1S8DA 2XA8H 1GGYA 3I6GB 1WZ1H 1KB5A 1XAUA 5BJTB 1S5IH 3LAFA 1T89C 2EDBA 3BE1L 4HULB 2F53E 5DQDH 2JCCB 5I73C 2O61B 1N8ZA 4OQTL 1H9VA 2CIIB 4G80B 4K9EC 3TF7C 1JWUA 2E3VA 1A1NA 1JRHI 2OR8A 3PV7A 3B5GA 3BP5B 5ALBH 5JXAH 3VWJD 4JREB 2E7BA 5EO0B 5K9OA 3D39A 4RX4A 3P30H 5CD3B 4GAYA 1CK0H 3TH4T 3CXHK 5TH2A 1U3HA 1JN6A 4UT6H 4OM0L 4EI5A 4F2MA 1BD2A 4N5EC 4OBRA 5F1NA 3VXUA 2GJ6A 3MXVL 5CJQH 2NTFA 1JZ2A 2ICEA 4OGZA 2AK1H 5DJYA 2EE2A 2WMPA 4X6EB 4YX2L 5IESL 1FV1B 2EYSB 2NW2A 1NFIA 1YNLH 4HUNB 2HFGH 5DC0A 5F9WC 1G0YR 5EBWA 5AWNH 2OXHA 1J05B 1G7QB 2FB4L 1PGRB 3PWVA 4G3YH 2DJ4A 4JFOA 1MFEL 2P4AB 1K5NB 3AS0A 1BF2A 1G9MH 1OGAD 1ZANL 5I0ZA 1EZVX 1BLNB 4RGMC 1YPZF 2ORBH 5JHDB 5BQ7A 4ONFL 1LVEA 4LPCA 2ZUQC 3LN4B 3MNVB 3BVNA 1IGIL 3C8KA 1YYML 3MLUL 3MJ8A 1D9KB 3LKPA 1N6QL 4F7EA 4DW2H 2R0KH 3MROA 5FGBC 2DYPD 2NXZB 2DDQL 3H9HB 1MFAL 3QP3A 4JN2B 1T22A 2J3SA 3MLXH 5FIEA 1FGVL 4KTDH 1ZE3C 2VZOA 4N90D 3RBSA 4WI2A 5F96L 3BESR 4PRPB 2APTA 5DD1L 3X3GL 5CEZD 1QR4A 1OAKL 4M9OA 5CILH 4BUGA 4DGVH 1R3JB 5C7XH 3VGBA 4YEFA 3O3AA 4HIIA 5EIQA 5GQBA 2IFFH 3B5TA 3FQXB 3TWCL 4X9GA 2EDHA 5F9JB 5IBUG 1D7FA 5GHWH 5HPOA 3JV0A 5GRJH 2IEPA 3TPUB 1CDGA 2JJSA 3HR5A 1EZVY 5EU6A 2XN9A 2VERN 2P5WB 5HYJE 5DMGD 1I7ZA 4JB9L 5EBMA 4IS6B 4PLNC 4YZFE 1A6PA 4A6YB 3RAJH 3KLAB 4Q0XL 3PIQA 3LEVH 3NIFF 2B2XH 1NCNA 2AJXL 3MJ6A 4OCWL 2XPGA 1JL8A 3SY0B 5BV7L 1F42A 3D39D 4GG6A 5D7JA 2EDEA 3HMXL 1IGFL 1C5CH 2Y06H 1T83A 1MIML 1ZHKB 4M00A 1NGYB 1MAKA 4X5LA 2GJ6D 4HH9A 2NX5B 4XP5H 3CH1A 4WUUB 1UWEL 2YZ8A 4P2YA 3C6SB 3VXTB 2CLVB 5LGHL 3MYJA 2VQ1A 1YEJL 4OUUB 1F3JB 5ESVB 3QEHB 3CDFA 1EXUA 4PREA 3FB8A 3LQMA 1S9VA 2A9MH 2GK0A 1MVUA 4GS7B 4YO0B 1CICB 3GGWA 4MNHA 5KN5B 1OD9A 4ZTOL 3DV6B 4OGYH 3BPCA 4TNVF 3RWIB 5FF6A 5IT2L 4YHYC 3VD3A 5F7KC 2C1OA 1H8NA 12E8H 4RIRA 2BK8A 2R0WH 1Q94A 3VDAA 2AV1A 4NC2B 2C26A 4S1SH 5D2NA 3WNPA 3GSUA 2FECI 1HZHL 4GLRI 1Q8MA 4YAQB 1ULVA 3BWAA 5SWZE 4JR9H 1INDL 1NBZA 1KCVL 1RI8A 2VISB 4N5UA 1I9IL 4IIQB 5BZDA 3HNSH 4MAYB 1VFBA 3NA4A 5ILTL 1JGUL 4WV1B 2Y1VA 1E6JL 3VFVB 4JVPA 1FVDB 1YNKL 3DIFA 1KTDB 3FB7A 4OZIF 5EUOB 4Q9CA 1ZLWK 4ZOEA 3T0DA 1GC1L 1QFWM 4LGRB 5F9DC 4NGHL 1S3KL 5CEYB 5INDA 2YBRA 3RU8H 1S7QB 3DVIA 2E8YA 4JFHE 3WXWH 4KHXH 3KPLB 4KRNA 1IGJA 2XTLA 3VW3H 5I2IA 4PP2A 2IAMA 3MNWB 5I17A 3KPRA 3ILQD 3QDJE 1RK0B 4XP1H 4I5BA 4GBXC 5EO9A 4FABL 2CXKA 2B20A 1YPZB 5DRZA 3T08A 1XGPB 1R0AH 1LEGA 3TN0A 3S34L 1JPST 4H20L 4RQQB 4L3ED 4P9HH 4F7CB 1B6DA 4HH8A 3RQ3A 1OGTA 1I3VA 2R8SL 3QNZA 1S7TA 2OSLA 1CGXA 4ZAKB 5IB4A 3BZ4B 1U3JA 1OM3L 3P4MB 4ZFFA 2C4FT 4FG6D 1FE8L 5D7JD 3PWPE 1EUUA 3MMEA 4NNYA 5DFVC 4DCQA 4OCNC 2RQ8A 1WIUA 1MCQA 1ZVSB 1CT8B 2JKXA 1HEZA 4M6NL 1L0QA 1J1PL 2XXMB 3BH8A 3R1GL 2CDGA 3IVKA 2W0LA 4YLQT 1ADQL 1HXYB 4XXDA 4NPYB 4XNXL 2FX8L 1CVRA 1I1FB 1PX4A 5F44A 3RNKA 2HJKA 3RX8A 3U4BH 5FXCH 5GSRB 3SQOL 4DKEH 1J86A 1KCUL 4WHTA 3GRWA 2EDLA 1L7IH 2OCFD 1HHHA 1RFDH 1IKNA 3IT8D 3MRDA 4NP4L 1VACB 2R0ZH 5B3JF 2W0FB 4YR6A 5BZWB 2WP3T 4V1DE 1BFTA 1H3PL 4QTHB 1BQSA 1MCSA 3HNTL 5AUMB 3B9EA 1CGSH 1I9RH 3TH3T 3DXAD 1A3LL 5E2WL 2P49B 5I18H 4X7CC 3RVWD 2DI9A 1CGYA 4LP5A 5D7LB 3H0TA 1QFPA 4Z7UA 4CN4A 2AJUL 3CDYA 4QRQA 1NAML 5IW6B 1BAFH 4HZLB 4S0TD 4ZUSA 5JR1L 3NPSC 5C0AB 4QXUL 4N1HB 2Q1EA 5CEZL 1H15A 4YBQD 4Q7DA 5DZNA 5DD5H 5CCKL 3U1SH 2AXJA 5IB3B 5HVHB 1IM9A 1FAIL 4O02H 3ULVC 4NC0B 1G7HB 3IKCB 1SBBA 2AK4D 4N5ED 4DJMA 3MREA 1GGIH 4OLXL 4J7RA 4U1JA 2F5BH 3V9FA 4NYLB 3RDTB 2IQAA 4WI4A 4FTVA 1RSFA 3KXFA 1JNJA 1I1RA 4X98B 4EI6B 3S97C 1EIBA 4JGJA 3VD4A 2X4TB 2XNAA 3QUKA 1QLFA 4HDIB 2LU4A 4YWGL 2Z8VC 4XHQA 3I75B 4ZTPL 2F54E 4PJBF 3PHQB 1HSBB 3O9WC 2XA3A 2ZCLL 3DO3A 4XNYL 3QHZL 2FJHB 3L3KA 1PKQB 4HLJA 3QJHB 5GZNC 4XPFL 3MV9D 3OKYA 1Y18B 3K74B 2B8OT 1NJ9B 3B6SA 5J6GA 2DRUA 5L0QC 3FQNA 3K81A 4LKXA 3O2VH 4OZIB 2W9DL 4YHPB 5DSCA 4MDIB 3QIUD 4WU7A 2A9NL 1FJ1B 4IMLB 5KG9B 5DD0L 3WXVL 2R39A 4K94L 1OT2A 3GSWB 4UOW0 1EAJA 5JIIA 1T0MB 2FD6L 5FM4A 4HJ0C 3MUGB 4ZSOB 2E7LA 2YEZA 4OI8A 2DLHA 3TFKC 4YHOH 2QHRL 1IGMH 1REIA 5TFSL 5IJKA 4NJAL 3EYOB 3OF6A 1KCRL 5DYOB 3WS6C 3WCYA 2EXYC 2R4SL 1YN6B 4XI5D 2DTMH 5E1AB 5HI4C 3UJIH 3KPTA 4XAWL 3S8WA 1E27B 1F8TH 1QSEB 1AY1L 4LLQB 2J12B 2PCPA 3FQRB 1FO0B 4Z7VF 4JPVH 2N1KA 4MJ6A 3FT2A 3UXFA 4PJEE 3QIWA 1RZKL 4FXKB 2D4FA 2VWEE 3U0TB 4ORGB 4WFED 2OBGA 1IBGL 5J7CC 4GRLA 3MUZ1 5FO7A 3HNVL 4Z95L 3EDDA 4RDQG 5LVEA 1WAAF 5JDSA 4JKPH 5E0QA 3O6LH 4XPAH 3WNKA 1KN4L 3TJEH 3T04D 2CGRL 4MNGB 1HH9B 1AJ7H 3HZVA 3IGAA 1A6TA 2QQLH 2PR4L 3L5XH 5TE4L 3B8YA 4WEBH 3UO1H 2HN7A 3VFNA 4WGWB 3CSGA 3GMMB 4YXLL 5IMMB 3ZT6A 3S36L 5C07B 5KVGL 4BUHA 1BVLA 2CJUL 1NSNH 4OTXL 3IDUA 4XCEB 4BK5A 4JRYE 3CMOL 4X80L 3KLHC 1VPOH 1C5BH 2R9HC 5AG9A 4GXVH 4I2XE 3WFDL 1FVEB 1G6RH 1CXKA 2A2QT 3U4EB 1KTRL 1TZIB 4EUPB 1J18A 1P2CB 3ZKMD 2I60H 5IBUB 3E3QE 4NWUL 4LQFH 5CZKA 3KYOA 3I02B 4AIZB 2LVCA 1TQBB 3QHFH 4MQ7A 1WTGT 3CVHA 3IJHA 1BQUA 3L1OL 2LU3A 3S98A 1JMXA 2VXSH 5DEFB 4Z7OF 1QVOA 4PJDB 1LO2L 5C09B 3TESA 5MENE 2YPLE 2X4RA 5GSVA 1FNSH 4R26L 4DUWA 2ESVA 3NGBC 5GGVY 5DHYB 1NH6A 5TF1L 1QEWA 3U36B 1YMMD 3QEUA 1B0RA 4BSVA 4HLZG 4RWHA 4EQ3A 2BVPA 2EDTA 5E94A 3P73B 4GKSA 4KROB 1F58L 3FTGB 3LS5H 1VCAA 3VXOB 1BOYA 3QDGD 5FHAH 4HC1A 3OG6B 4KK6D 4OZ4B 4S1RL 5HHOD 3U7YH 3L7EB 4P2RD 4H25A 1HQ4B 4PJ7F 1ED3B 3CFIC 3MLWH 4EOWH 3HG1D 3O3BA 4Y4KA 2DQGL 2UZXB 2F5AH 4C4KO 4HK0A 4Q9QH 3BPOB 3VE0A 2BXYA 1NCDH 4S11A 3SKJH 1YQVL 1JHTB 1JK8A 4X8JA 1NMAL 3TZVB 2EO9A 1OW0C 4Z8FH 4PD4J 2CXGA 3WJLC 2F9BT 4LNRA 2G60L 5DFVD 4L5FH 1KENH 3LKRB 2HFEB 3TIDB 5HBBA 3QXAA 1DQQA 1UEYA 1X4ZA 1RZJC 1HHJA 1R3HB 25C8H 4QHNA 1ZGLM 5IMKA 2OP4H 4HWUA 4QXTA 5HY9A 1DUYA 3MRIB 4FQIL 4NKIL 2BVTA 2JE8A 4OGXL 3DPBA 5FYKD 3A6CL 2BRQA 2NY4C 5IEHA 3W0WB 3ZDXE 1G1YA 4ZNEE 1U41A 5KVEH 3VWKA 1YEDB 1GH7A 1C16B 5J6HB 3KJ4C 4MA8L 1G1CA 1XH3A 4Z7VB 5F72S 5EIVA 4LEXL 1D5XB 5J3HC 4OLYL 2PW1B 1JV5B 1AD0B 4JFPB 4MWFB 4M93C 3MRBB 4R2GB 2VMFA 4JLRB 3SE3C 2L7UA 4G9DA 1RVFL 4E41B 2VABA 4N90E 3DGGB 1U91A 1WV7T 3BKJH 5CEZE 3QUZD 3EOYG 4CN6A 3MPCA 3ECBA 4XVTH 1FO0H 3PWNA 4P2OB 5B22A 3I3DA 3OJVC 2MJWA 3SO5A 1ZT1B 4LCIL 4NQVB 3IDGB 3WO4B 1EFXD 3GRWL 5ALCH 4MZ3A 4PJ8A 1MH5A 3BEVB 4JJ5A 3BZEA 2DQFB 5DQJB 4L8SB 3KPPA 3WFHA 3OXRA 1XR8B 2PYFB 1ZT4A 2ARJA 3G5VB 4HIXL 1UENA 5CP3H 2A74A 3TBSA 2AQ3A 5JORA 5KS9F 3E2HC 1AGFA 3T0WA 4RFNC 5TQ2L 1EEZA 3KR3H 1R3LA 3L5WA 4YNYB 4EBQH 3F7QA 2J5LC 2FHFA 2W92A 1VDGA 1T21A 2H26B 3O4LD 1N0LA 4LPVA 4PRAB 4Y4KD 4GG8A 4HGWB 1F6AA 2F8XC 3D39E 4XCYB 3FMGH 2Y07L 3G9AB 4GMSL 35C8H 2FHBA 4RDQF 6CGTA 1T1ZA 1BD2E 3VXUE 4OD3L 2GJ6E 3O9WD 1HI6B 2P8PB 3ZTJG 4P3CH 1FC1A 3AGVA 4HBCL 3KYMB 2LTQC 1NCWL 3I2CL 2A6IA 5GZND 1KPUB 5LAXB 4UNUA 3L3IA 5DEGB 2V5YA 2HJLA 2PETA 5KSAC 1YMHA 4HKBB 5KZCD 4LLDB 5DD3L 1EMTH 2WWKT 4PJ9B 3SDAC 3OG4B 4CVXB 5CBAA 1HDMB 3I6LE 2NZ9C 3Q2CA 3SHSA 3MGAA 1CFSB 4IRZL 2GJZB 4E5XA 4NN6C 1N64H 2JJTA 1V3LA 4U1HA 5AYQA 4QNPE 1FYTA 1FC2D 1U8MA 2VZUA 4YDIL 5D9SB 2ARJQ 3V52L 2Z4QB 4PTTB 4ZPVA 5D6CB 1HSAA 1M6OB 3TFKD 2AGJH 2VJXA 5IB1B 1XR9A 2BSSB 3OR6A 3PDOA 4RGNB 4PJ7B 2R2HA 4HZAA 4I8DA 2B0SH 1MQKH 2UY7A 5L2KD 3LPWA 1UM6H 1CI5A 1KYOK 2EXYD 3F5WB 5DVOA 3V0VB 4PY8J 5HI4D 4BZ2L 3NH7H 1T7YA 1JP5A 2VUYA 3P9LB 2BNRA 4LLYB 3TO2A 3MGOA 3EW3B 5IJVA 4NNPH 1HILA 1QLRA 4UBDD 3ZTNL 3DLQR 4L29B 4NHCH 4M8QA 4X5XB 2NLJA 5DJ0A 1V3KA 4YDJB 4YGAB 1U92A 2UUDK 3GSRA 3FO1B 1WUNT 4PY7B 1OSZB 3OGCB 2CRMA 3C8HA 1K8IA 4JDVA 1FZJA 5DVKA 2OL3A 2XN9E 4TVPD 4LVHC 3PDGA 5DJAA 2EIBA 4KZDL 4PYHA 4Q9RL 4R4ND 2EDQA 3ET9F 4L3EE 4R96A 3WSQL 4OB5H 4YUEL 1KIRA 2DQUL 1JZ5A 1IC4L 1WCBB 5DWUL 5MEQA 1LE5A 3WDIA 3DX6A 4P46A 1GIGH 3IETB 3K8MA 5JTWA 4WTZA 4K23H 4P4KD 2CIKA 4ZDHA 4GG6E 1CGVA 5E6IA 1HKLL 2V5RA 2YA0A 4JQVC 2EEDA 3ARRA 1P1ZA 2X7LA 3AREA 4LSQH 4QOKA 5FYJD 1J1XL 1JUFB 3ARGB 1HIMH 4RNRA 4N0UA 4PBWD 3EYVA 1FFNA 3W9EB 3GMOB 2R9HD 1FZKA 3BISA 4D0CB 3PGFH 1BBJA 2AABL 2C3GA 4R4FL 3S7GA 2D2OA 5I74C 3CIQA 3EIFA 2NY5C 3G6JF 3LD8C 1I7UA 3C60A 5DJ2B 1CD1B 1LDPH 4XP4L 1YDPA 3MUY1 4MA7H 2JLLA 4HHAB 2EE3A 1NC4B 1WZKA 4F7MB 3WFCL 2UZYB 3TNNB 1MOEA 3DURA 1O7VA 3GIZL 4BQCA 4I18A 4LU5L 4PJGE 5D2NE 1BOGA 2OLDA 5HYJB 1YJDH 4KHTL 4G8GA 4PGJA 5L8JB 3GUTB 3H9SD 2A6KA 32C2A 3Q3GA 3UTTA 5C2BL 4JG1H 2HT3D 2P5EA 3SKNA 4UU9A 3QFDB 1KNOB 1CR9H 4J3UA 1AE6H 4BQ6A 4FNLH 1D5IH 1QNZH 3L3JA 3QA3A 1YEEL 4WVRA 4LSUL 1JVKA 3T4YA 3U30C 1BQHG 3CVHL 4JFEA 3O6ML 5T1LA 4F3FB 4RWYH 5D1XB 2D31A 4FQJL 4O5LL 4JM2F 3NZHH 1X5ZA 5K33A 1QA9B 1P7QD 3ROLB 2CKBH 1UB6A 5F6IC 2YMXL 3OQ3B 1KEMH 4HIHB 3OXSB 1FHGA 1XIWB 1KC5H 2BHUA 2V5TA 5AZEL 1LO0L 1NDMB 5FCSH 4O2CB 3P77A 4L9LC 4EI5C 3RWDA 1PQZA 3E1F1 5IR1A 2FYYA 4Y5XC 2FX7L 1BZ7A 2XZCL 3P2TA 1RHHB 2AW2A 4OI7A 1TZGL 3DBXB 3IXAA 4K3DH 5C92A 2PXYB 2GFBB 1JZ8A 2EIZA 1LEKA 3NN8B 1CYGA 4XNZB 1G7LA 4MJ4A 1F11A 5IBTH 3CXDH 3HAEG 1URLA 2KQMA 4MD0B 3DRTA 3EDJA 4JG0L 2FJFA 4RGOL 2CO7B 5DJZB 3QYCA 1T04A 4UAOC 1Z9SA 5GGTL 3RVVC 1KG0A 3S35H 3T3PF 5CIPB 4CUCA 5CZVL 4Q2ZA 3MOBH 3NACL 1AO7D 5J9PA 1KELH 1MLBA 4LLVB 4K07A 5D1ZA 3F62A 3CC5A 3WFBH 4KK9C 5SWZB 1EEQA 1A1MA 3SGKA 5J3HD 4JM4H 4ZQKA 4R7DB 1S7XA 4J1UA 4LCCB 4LEOB 3ZE0E 3RL1B 1FORL 4ACPA 1MLCA 2DI7A 3MO1A 5SWSD 4KDWA 3MA9L 5DUPL 2BNQD 2GSGA 2K7PA 4ODHH 3B9KA 2WM0A 3B9VA 1TENA 3VFTB 2CR6A 2NY7H 4HGKC 4O2EB 2KH2B 1RULH 4GW1B 5I6XB 1EGJL 5I1JH 3D18B 3OKOB 5HTSA 4FQXA 4UV7L 1B4RA 3MBEB 4OD1H 5K9KA 2AV7A 4EN3B 4QHUA 3QDJB 4QRSA 2B4CC 4NOFA 3L6FB 1A47A 3HRPA 3MRGB 1UCTA 1A21A 4R7NA 4Z7UE 1JPGA 2JF1A 4H8WC 4YDLB 1T1YB 5DGQA 3NAAL 4ELMF 4XX1E 4FFZL 1I8KB 1IFHH 5BS0A 3F7YB 1FPTH 5CGYD 3EGSB 4TVSa 15C8L 3ARWA 1R3IH 5TE7H 3TCLA 4KRLB 3PWUB 4GRWE 1R5WA 1RU9L 4JFED 4HS3B 5CUSH 3PWPB 1KLUA 1FL5A 1M71A 4OIIH 1T7VA 2GK2A 1RZFL 2UY6A 1T1WB 5GGRY 1ETZA 1L6XA 3H3BC 2W0KA 4Q9BA 4WHYH 4N0YL 3CSYA 2E7CA 4MJ5A 3KLSA 5B39A 2CDFA 4PB0L 1P9MA 5HI3C 5DI8B 4FTVE 5I8KH 1EO5A 1CF8H 3D2UB 3KXFE 4RMRA 4TVPL 1BX2A 4R4BA 1MFDL 1QR1B 1CLOL 4M7KH 1GZPA 1T83C 3CPLB 3EOTL 5DRXA 4ZXBB 5KSAD 4QY8B 1YEHL 3K2UH 1HKFA 4PLOB 4PRIA 5F89B 2EEAA 1CLYH 1DFBL 2VLRA 2Z31A 5D7IA 2FL5A 4UILH 3NCYP 5ECJE 2IH3A 1IQWL 1RJCA 4LSVH 3EFFB 5D70H 5IKCA 4KJPC 1W0WA 4L3AA 3QXUA 5FYJL 3O3EA 4RAHA 5D7SH 1INQA 4KC3B 5I8CB 4JGUA 4X6DA 4CVZA 3CX5J 1BJ8A 4OLUL 5I8OL 4OF5A 5E6YA 1U8NA 2DD8L 3D6GA 4UTBL 3O8XC 4WJ5A 5ACZA 1D5BB 4WWKA 2CLZA 3FQTB 3GKWL 1HHIB 3ELAT 1JRHL 4MD4A 2YD9A 4ODWA 4Y2DD 3T09A 4M1CC 1J0KA 4NZTH 4WW1B 4F9PA 4D9QE 1E4KA 1X4XA 4JE4B 5F3BA 3JVGC 5FKAA 3INUH 1X5JA 1IKFL 2VL4A 1S7RB 2VDKH 2DTSA 4DTGH 3TVMC 1RZ7L 5F1SA 1RUKL 3GI8H 2BMKA 3VFRB 3BMWA 1I1AC 2QV2A 1OWRM 3BPLC 3QDGE 3D3VD 1MHCB 1CLCA 4QHLB 1I7RA 4JPWL 2AJZB 4P2RE 4LAJH 2X1QA 4M43L 5IK3B 2V2XB 3VA2C 3HG1E 3N0PB 1VB9A 2DBJA 2YWYA 3AMKA 2LQRA 3E6HA 4NO5A 5BS0D 2RCSL 1A8JH 3C6LD 5JQ6H 4U6YB 2F54B 2R23B 3AROA 1KT2A 4RISH 1TZHA 3SE9H 1OTTC 3MRLB 4F7TA 4PJHF 3I84A 5L7XH 3HMWH 3ZYJA 3WLBB 4DZ8A 4FZEH 5C0EB 3SDCB 1XEDA 3UC0H 2BVEA 4J8RB 4GXUM 2AJVL 2LFGA 3LRSB 2QBWA 4HWBA 3BP6A 2UYLB 2BVOB 1OB1B 5GRWA 5D8JL 4Z7NE 3WIHH 3MGTB 3BZDA 5TQ0H 5CSZA 3JWOH 4EQ2A 4APQC 1KJ2H 2PO6C 2BY3A 3H3PH 4V2BA 2V5SA 5GS0C 4X7SH 4BZ1L 1E6OL 1MCOL 4JZJA 3HE6B 5H35A 2FJGB 4JRXD 2D7OA 1I3GH 2X4QA 5HYFA 4LSTH 4AENB 4A2LA 5BMFH 2NW3A 4MDJA 4OJFL 2D7TH 4K8RD 3ZDXF 5E2VH 5EZIL 1CZ8L 1MNUL 1MVFA 3O6FA 1MAJA 2WIIB 2ITDB 4UDTA 5BV7B 4C59B 4PP1D 4HIJA 1PLGH 5HGBB 1PY9A 5GGSB 5FO8B 3BIBX 2ZSWB 3CX2A 3VFGL 3ULUC 4Y4FA 4PJEB 3B3IB 1J8HA 4PJAE 2VXTH 1XGUA 5E5RB 4WY7L 4DQOH 1FN4B 1NLBH 2Z91B 4NM8H 3C5JB 2DJSA 4P5MA 4YK4C 2DB8A 3LHPH 1I8LA 2JK5B 1CFNA 5C6TL 5JIHA 1UZ8A 3WLWD 4DVRL 2FO4A 3WN5B 1E0OB 2NR6D 4D0BA 4WNQA 5EA0L 4ISVA 2H2PD 4D3CH 3QQ3B 1K3ZA 1QYGH 1EUTA 2MWCA 4P3WA 3O4LE 1YY8B 5T3XH 4M7LH 4QF1A 4O2FA 3BKYH 4FZ8L 2BNUB 4QYOB 2GSIB 1DDHB 5C0CA 2WAHA 3LV3A 1B4JH 1QBLH 2MSPA 1QSZA 4JRYB 1ND0B 5HDQL 4OCSH 1RIVH 2QSCH 4I2XB 1A14H 3QXDA 2AQ2A 2FECL 3CSPA 3RJQB 3RVVD 1MREL 3BE1H 1NGXA 3FB6B 5HGHB 1XF5B 3GB7A 4MX7A 5DDHA 1OAXL 4OQTH 4LLUA 1EERB 1X5XA 5KOVC 1RK1B 4OF6A 4UDUB 1DUZA 4F33A 2E27H 5EORL 3S4SA 5T33L 4PGBA 5B38B 3MRNB 3V6ZB 2EZ0C 2Q8AH 4LHUA 2B5IB 2FIKA 2Q86A 3VXPB 4GAGH 3DSNA 3DX7A 4ZO8A 4H88L 3NFPB 4XCFL 5DTFA 5MENB 5IB2A 2H9GB 3E8UH 1Q9LA 4MA3B 1WWCA 3PGCA 1I9EA 3LMJH 1N5YL 3QH3A 4KDVA 3MXVH 4YIQB 4XGZA 5IESH 3RWCA 5IB5A 4G6AD 3ILPA 1FSKC 4LVOB 3BUYA 3IDMA 2FB4H 5C3TA 1EEYA 5BRZA 2E7LC 4ZFZA 1C7TA 3ZYIA 5IJKC 3VWJB 1NGQL 1S78C 4U1GB 1ZANH 1UXWA 4Y4HA 3KPSA 3DMMC 4ONOA 4HUXB 3QO0A 3ZTJH 1H3GA 3KPQB 1OAQL 5EOCL 1LP9F 4DN4L 3F6IA 1IGIH 3MLUH 2ED8A 3BGFC 1AGDA 4HMEA 4TVPE 4LDLB 4XBGB 1RUAH 1CN4A 1J0IA 3LDBC 1IGCL 1VEMA 1T7ZA 4XX1G 4U6HA 1JPTL 1RURL 2DDQH 3TBTB 3UTPD 1E4XL 5I9QB 1FZOB 1AQDA 3QIWC 1D5MB 2MQ0A 1SJHA 4ODXB 1CDCA 4PTUB 5HI3D 2XYCA 3SCMB 5D72L 5DJXA 5FUCE 1UH4A 2YC1A 2J1KA 1OGAB 4YGVA 2GAZB 4X4ZA 5MEOA 5DD1H 5C0BD 4X7TB 1OAKH 3C09B 5DHVB 5BVJA 1T66C 2OQJB 4KK5C 3RZCA 4ONGL 3TWCH 3D9AH 3ARSA 2O61A 2JCCA 2EO1A 5FYJE 2CIIA 1KV3A 3EJJX 4B0MM 4YH6A 4IRJC 4RRPG 1C5DB 2DYPB 3V95A 5JW4N 1JNNH 3BP5A 4I0KA 2Q6WA 1NAMB 4MXVF 4WFHE 4W6WB 2IH1A 4JB9H 2D03L 1XCTB 2P43B 4KJPD 1JGEB 5CD3A 4Q6IB 2J6EH 1W72L 2ZUYA 4Y16D 3IS1X 4QHKI 2VB5A 1C7SA 4QO1A 1XCQA 3IXTA 3PV6B 2VLMD 5T1KD 1AXSB 3P0GB 2NY3C 4OCWH 2XG4A 2EYSA 2P24A 3O8XD 5BV7H 1FYTE 2R1WB 1RJLB 4OV5A 4HXAL 4I3SH 3HMXH 3ME0A 1J05A 4L8DA 3P11H 2VO5A 1IGTB 5I1AA 1S8DB 3KVQA 3VH8G 2C4XA 4J3VA 1UWEH 3S5LG 3T0VA 5J0BA 1SQ2N 3TVMD 1CXHA 5JHDA 3FFDA 5LGHH 1P69B 3EJYC 1I1AD 4PG9B 1YEJH 4GW5A 4PJGF 5B8CB 4K8RL 2VNCA 2AS5M 4JFZL 3C5ZC 1A1NB 4KVCH 4U1SA 3H9HA 4JKLA 4JN2A 5K9OB 3D39B 3NFSL 3GBNL 5LCVL 5KSUA 4GAYB 1MRDL 5TH2B 1JN6B 4F2MB 4YHMH 1BD2B 3VXUB 5IT2H 4JFXB 2GJ6B 5B4MC 2RHEA 2RGSA 4UT7L 1OTTD 1Z0MA 2ICEB 3KYKL 4NKOB 4PRPA 1OSPL 1F00I 5DJYB 3FOLB 4NQTA 5ADPH 4U0QB 2NW2B 1NFIB 4I48B 2H1PH 4ZUUB 1INDH 3C87A 1QRND 1I9IH 2APXA 4FFYL 2ENSA 3RY6A 2UVFA 3PWVB 1ZHLB 2GIYA 4PG2C 5ILTH 1E6JH 3IFPB 8CGTA 4DEPC 1NCBL 3V4UL 1WISA 3O3UN 4KUZL 3RPIA 5T1DL 2R2EA 4XPBH 1GC1H 5I16A 3F6LA 4APQD 2UWEF 1ACYL 1CXIA 2YN5A 4QOKE 2PO6D 4F7EB 4P5TC 3T8XB 5D71L 2E7MA 5GS0D 3TJHD 2C3XA 3VGAC 1FZMA 3QFJD 1T2QL 1T22B 2AJ3B 4HMCA 3SY0A 3VMOA 5LXGL 2AXFA 1RMFL 4PRDA 4YQXH 1WICA 1LP9B 4I77L 1NGYA 4G42B 3NIDE 5L2JB 4CU8A 4HWBL 2Y5EA 4NRYB 4JQXC 2R8SH 2BNQE 1U6AL 1CXLA 2IG2H 5E7BA 3UCRA 3O2WH 1NCTA 1FL6A 3W5MA 1S5IL 3O3AB 5FDYA 4I3RH 4RAUB 1S7SB 2CLVA 1OM3H 4QGTA 1GYAA 5DQDL 1FE8H 2YD3A 3D85D 3ULUD 4MMXC 4ETQA 1V7MH 3AM8A 1LHZA 3QEHA 1CBVH 1A1OA 3HR5B 4OF0A 4MHHG 1CICA 5JXAL 4X5WB 1LK2A 2XN9B 3FQUB 1J1PH 3DHJA 4NQDD 5KN5A 3X13B 2FEDC 5HYSA 1QTYT 1ADQH 3IB4A 2FX8H 4L3EB 3ULSA 5F7HA 5E4EB 3UTTE 2P5EE 5FM8A 3PIQB 3OAZK 4B41A 2XQYK 3QO1B 2XY1A 3SQOH 3HAEH 1DL7H 1BVKA 4YAQA 2XPGB 4PJ8C 3FB5A 1YNLL 5DRNA 1ZA3A 4ERSH 4JFEE 4GG6B 5D7JB 4IIQA 5K9QG 4JDTH 3EUUA 4MAYA 1LNUA 4HWNA 4DVBB 3EO0B 5CMAB 2DM2A 3VXMA 1E28A 4WV1A 1H3PH 5IROC 2VH5L 3CH1B 4RA3A 3VFVA 1P5VA 4S1QH 1CGWA 1KTDA 3TBWA 2YUXA 5MP6H 3RGHA 3S88H 1A3LH 3BGAA 5D93C 1QSFA 1TITA 2YRLA 2X4UB 3MRMB 4CVWA 1EXUB 1S7QA 2AJUH 3FB8B 4PREB 1S9VB 4DW2L 3LS4L 3KPLA 2R0KL 5ADOL 3GGWB 5CHNA 2VLJA 1RK0A 5JR1H 3S3PA 2KDGA 1Y6KR 5DFTA 4QXUH 1RIUH 3MLXL 5CEZH 3FFCD 4HKZA 5J11C 2EZ0D 1YPZA 2NZIA 5FF6B 1XGPA 4XMLL 5CCKH 4IHOA 2C1OB 5IFAL 4RQQA 3GDBA 4KTDL 2P8MA 4F7CA 1NCAL 2ZCHL 3TYGH 2DBLL 2R4RL 4PJGB 1ZTXH 4QRRD 5CILL 3DXAB 4MAUL 2YD4A 4OLXH 4ZAKA 3AC0A 1NBZB 3SDDC 3MLTA 3P4MA 4TPRL 1VFBB 5GHWL 4GW4A 5I1CL 3MRCB 4LLMB 1P4IH 5JOPD 1ZVSA 1CT8A 3DIFB 3FB7B 5E2UL 3IU3B 4HPYH 3DX8A 3DMMD 1HXYA 3C2AH 3LVEA 4NPYA 3QHZH 3DWTA 1DANT 1IGJB 5A2IH 1I1FA 4FFVC 2H32H 3RGVC 4MXQC 4XPFH 3LEVL 5EB9A 4ODVL 3IAQA 4I5BB 3GMNA 2G2RA 4HAGA 4LSPH 4OT1H 3FRPG 5I66B 1G6RA 2W9DH 1LEGB 3TN0B 4S0SD 5HJ3B 2GW5A 3PGDA 4KI5C 2NY6B 5T5NG 1VACA 1MUJA 1OGTB 2W0FA 5DC9B 4X8XA 3QIBC 5BS0E 2W38A 2AXHA 3QDAA 4QTHA 5DD0H 1ONQA 4XP5L 4K94H 3WXVH 3QNZB 1S7TB 2OSLB 1KCKA 4JZOB 5IB4B 2FD6H 3IDIA 4ZFFB 4ZUVB 4YPGA 3MMEB 1EV2E 5D7LA 1MFBL 4DCQB 3K0WA 4I4WA 4KK5D 4OFKA 3TV3L 2P42B 5CJXA 4NJAH 2A9ML 1KCRH 3QAZC 5IW6A 2ED9A 3QEQA 2LAAA 3QEGH 2R4SH 1MJ7L 3VG9B 3BH8B 4IRJD 4MS8C 4R3SA 4CRPA 5EO1B 3R8QA 4OGYL 1CWVA 3QIUB 2WW8A 5IB3A 3RKDD 3RNKB 1FFRA 2VQTA 1UH2A 3HE7A 4DOHE 1T0NA 4PRIE 1RZKH 2DKUA 3VI4F 4JR9L 2P7TB 1P6FA 4NYLA 3HFML 4ZG1A 1A6UL 2NY3D 5GIRA 3MRDB 4OZFG 4Z95H 4HDIA 4M3JA 1SVZA 3MLSL 4AEEA 1KN4H 4NQXA 3I75A 3C60C 5ACLA 2CGRH 4QRUA 4X6DE 5TDNA 2ZOKA 3PHQA 5J06A 1HSBA 3H0TB 3RU8L 2QQNL 4NQUA 3WXWL 2FJHA 5TE4H 4S1DD 4QRQB 5ICZA 3QJHA 1X9QA 4YXLH 5J13B 3OJMB 3S36H 5JW5A 1CXEA 4G9FA 4ZUSB 5HGGS 1Y18A 1NJ9A 5KVGH 2CJUH 3PABA 3C5ZD 1EHAA 2FGZA 1WITA 1OAYL 4OZIA 1R0AL 3QCTH 4GRWB 4YHPA 2L4OA 3CMOH 3FQWB 4X80H 4MDIA 4XZUA 3TA3C 1FJ1A 4IMLA 5KG9A 3ULUL 4PJAF 5B4MD 3MREB 2QADC 3CX5K 4Z7QE 1A9BB 3K4DA 4FTVB 1GL4B 4PJCF 4X4XA 1A9EB 5IVXF 2DIJA 4JJHA 1NCUA 1UM5L 4NHUB 3T1WA 3EYOA 3PL6C 5DYOA 4OCRH 1IM3A 1LDSA 2IAND 3CFEB 4RZCB 3G5ZA 1KPVA 5E1AA 3VMNA 5MI0C 2DLTA 4Z7WF 4LLQA 1NCCH 4J4PA 3L3KB 1NEUA 4MJ2A 1FO0A 4N8VG 4LSDA 3U4BL 1IEHA 3RY4A 5DC4B 5F9OL 3LPGA 3B6SB 5J6GB 3MLPA 2DL2A 4KXZH 4P5TD 3NOIA 4WCYL 2HVKA 5EH1A 2J4WH 4YHLL 1L7IL 4L8BB 1N2RA 1RFDL 4ORGA 5DSCB 4L9DA 5JQHC 4F15C 2R0ZL 3DHMA 4WU7B 3MRKA 5D4QA 3UJJH 3ZKND 5CP3A 1CTOA 5GISL 1AIFB 5CJOH 4MQXC 2YD6A 4FQQA 1HH9A 1B90A 2H6PA 4K9EH 1YQVH 1CIDA 4LK4A 1NUNB 1ZLVH 5IMMA 2G60H 4DK3A 1BAFL 2ZUXA 2DQJL 4YC2C 2GTWB 1Y0LB 5IIEA 3QDGB 1Q38A 1VFUA 3B9KC 5ITBL 1GRWA 4P2RB 2FEDD 4O02L 5EZOL 4M9PA 1MJ8H 3HG1B 2WNGA 3VD5A 4OAWB 1DBMH 5FEBA 3FT2B 2CK2A 2A6JB 3FCTB 5H2BB 2VQUA 3THML 2XT1B 5MHSD 1TPXB 2OTWA 2X4NA 3OAYK 4UIMB 4GRLB 3BD3A 5FO7B 2OI9B 1LE9A 2X9WA 3I02A 4AIZA 4FQ2H 3UTPE 5JDSB 1UACL 3O4OC 4KKAC 4LEXH 4OLYH 5HYIA 2I25N 2UZIH 1NL0H 5J1AA 1MCIA 5C09A 3IGAB 1A6TB 5D5MF 4U7KA 4OFYD 3KPMA 4NUGH 5DHYA 2HLAB 3GJFB 1W8OA 4JFFD 1CL7H 5HHPB 1J0ZA 2IMMA 4XHJC 1BVLB 1HINH 2EDYA 5C0CE 3RTQA 3VXOA 3O2VL 1S9XA 2F74A 4J3XA 4OZ4A 3BPNB 1TXKA 2J8HA 4PJBA 4LCIH 1CLZL 2Y4SA 1OD7A 2VE6B 4Y7MA 3RKPA 2IBZX 5C2UB 5HHMD 3WHE1 4QHMA 3BQUA 3RI5K 4EDWH 4ODSL 4HIXH 3KYOB 2Z31C 3QUZB 1UZ6E 3VFWB 3SDDD 3GMRA 4MQ7B 3MR9A 3CVHB 3IJHB 5IMOA 2BY1A 2DTML 1QVOB 4MJID 2HFEA 3T0BA 1U8JA 2W07A 2Y07H 5JIKA 2F8OA 1F8TL 3BYYA 4PJAB 2BVYA 4OD3H 5FKPA 4NBZB 1QEWB 2YPVL 1R3HA 3QEUB 4BSVB 5CEXA 4ORZC 1JBJA 1DN0A 1H3VA 3BJLA 4XRCA 2X4SA 5E94B 2YA2A 3MRIA 5FECB 3RGVD 4MXQD 1NCWH 3I2CH 4F9LA 4WWKC 4LRNL 4I3GA 3W0WA 1JFQL 3F8UB 3SDXF 4ZPTA 4Z7WB 3O4LB 2IBZY 4KI5D 3TM6A 1CGTA 3KPSE 3O3BB 4Y4KB 3IYLW 1NFDF 4HK0B 4Z7VA 4XPAL 1D5XA 5F93C 3TJEL 3QI9C 2E8ZA 3QIBD 2PW1A 3ARUA 4NC1E 1JV5A 3A67L 4JFPA 1AJ7L 4IRZH 4MWFA 5F7EL 2QQLL 5J8OA 5GRUL 4E41A 1MWAL 1JK8B 3L5XL 4X8JB 4YDIH 3GSXB 3O9WB 1GXEA 2VC2L 3DGGA 4WEBL 1O7SA 2DOCA 4LNRB 2Z35B 1QUNA 2CPCA 3V7AE 1NSNL 1WAAA 4P2OA 3NIGE 2APVA 5L0QB 1NMCB 5KZCB 3HB3C 5CZXC 1DSFL 4RMVA 1ZT1A 2AEWA 4QHNB 4NQVA 4FA8A 1SHMA 4GXVL 1T03H 1G6RL 1DUYB 3T0EC 1JPSH 5FYLD 2DQFA 5DQJA 4L8SA 2COQA 2NY0C 4XCCL 1XR8A 2PYFA 1LEIA 1J88A 4HD9A 5KTEL 3OKKA 4LQFL 1U3ZA 1Q9WB 1NMBL 3PQYD 5DVNA 2MKWA 1XH3B 1KBGL 3M07A 3ARBA 3ROOB 1FIEA 1S7UB 5KVFH 2C3HA 3EOBA 3EO1B 4PRAA 4HGWA 1Q1JL 3GBLA 3QDHA 5KSBF 4KZDH 4C54A 2VABB 3ARQA 3NTCL 4Q9RH 1FNSL 5FGRA 5KVMC 3G08B 3WSQH 3N85L 4HSQA 5DVMA 4XH2B 1J0YA 4Q97A 2CKBA 5D2LE 3EFDL 4P23A 4B50A 2ILLA 2C3VA 5DWUH 3MLVL 3PWNB 1JJUA 3RVTC 4JVUA 2PKDA 5DK2B 1KPUA 5LAXA 3QB7C 4NO0D 1HKLH 2R2BA 4KKNA 3WHE0 3CSBA 3I50H 3HC3H 3RY5A 4LLDA 3MLWL 3OZ9H 4PJ9A 5TE6L 1MH5B 3QUYC 2F5AL 3BZEB 1A22B 3GM0A 3TA3D 1HDMA 2VR9A 1B9ZA 1INEH 3JV4A 1F3RB 3OXRB 1RZGA 1ZT4B 2ARJB 1CFSA 1UCBH 1NCDL 2A74B 3SKJL 5ENWA 1WF5A 4JHAL 2AABH 3CDGA 2QADD