4ONTA

Ternary host recognition complex of complement factor h, c3d, and sialic acid
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
295
structure length
295
Chain Sequence
EFRDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement factor H
publication title Structural basis for sialic acid-mediated self-recognition by complement factor H.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 121
structure length 295
sequence length 295
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4ontA00
1N94B 2WIIB 1LD7B 4GTVB 1D8DB 3KSQB 4GTOB 2WY8A 4FXKB 1O1RB 2WY7A 2H6GB 1GXNA 1O1TB 3E34B 1TN8B 3K7XA 1GSZA 3OXUA 1O5MB 2G02A 3D5SA 3Q7FB 3DSWB 3E33B 2A73B 2IEJB 3E30B 1S64B 4BOJA 2H6IB 1FPPB 1GXMA 5FO9B 2BEDB 3D5RA 1KZPB 3DSSB 4D4CA 2XQWA 3PZ1B 1C3DA 4YDEB 3EUVB 2G0DA 1GXOA 3E32B 2H6HB 5FO8B 1N4QB 1N4PB 5AGDA 1O6QA 1JCQB 3HXEB 4D94A 1O1SB 3HXBB 3Q78B 3OEDA 1O79A 1H39A 3KQ4A 4GTPB 1X81B 1TNOB 4GTSB 4D4AA 3HXCB 3SFXB 1DCEB 1JCRB 3HXFB 4GTRB 1LTXB 1TNYB 2SQCA 2PN5A 4ONTA 3CU7A 4GTMB 5JPNB 4KKIA 1N4RB 1LD8B 1SA4B 3SQCA 4D4DA 1H3BA 3DPYB 1R76A 1O6RA 4GTQB 4D4BA 1QBQB 4C1SA 3Q73B 4L9PB 3EU5B 1W6KA 1H36A 2GOXA 1H3AA 2BB6A 4EHMB 4MBGB 3KSLB 1H37A 4V1RA 1FT1B 1NL4B 2WINB 2H6FB 4ZRPA 2V8JA 1TNBB 1W6JA 3DSXB 3SFYB 1HZFA 5FO7B 4FXGB 2NOJA 3PZ4B 1MZCB 2B39A 2V8IA 1TN6B 2V3PA 3DSVB 4ZRQA 3Q7AB 1N9AB 1O6HA 2BBCA 4LNVA 4YDOB 2R2LB 1SQCA 2F0YB 1JCSB 4V1SA 1S63B 2XWBB 3C72B 1SA5B 1N95B 3PZ3B 1QSJA 4GTTB 5JPMB 4ZH1A 1UMPA 1TNZB 2ZIRB 1FT2B 1D8EB 2V3NA 3KLSA 4BOKA 1QQFA 4LNBB 2BB5A 2ZISB 1KZOB 1N4SB 1NI1B 1TNUB 2I07B 1TN7B 2V8KA 2XWJB 4M76A 4MU9A 1GHQA 1H35A 3DRAB 5FOBB 3HXDB 1H3CA 3PZ2B 4LNGB 3RJ3A 3Q75B 2PMVA 3E37B 3DSTB 3G6JB 3DSUB 4KKJA 3Q79B
chains in the Genus database with same CATH superfamily
2BRVX 1IS9A 3WKGA 2XFGA 1F9GA 4FJQA 3KSQB 4GTOB 1GAIA 2H6GB 1TN8B 4TF4A 1O5MB 1H14A 1L1YA 4LIXA 1H54A 3Q7FB 3AFJA 5M7IA 3ON6A 4OJZA 2X03A 4BOJA 3TF4A 3M73A 2DROA 3QXFA 3D5RA 2DRQA 1CEMA 1HM2A 1N24A 5IK0A 2ONHA 3M72A 3W5NA 2G0DA 5CZLA 1N4QB 1N4PB 5AGDA 3HXEB 3S4DA 1G9GA 5KKBA 3Q78B 1N7RA 2GZ6A 2AHGA 2E24A 1O79A 1XWTA 3KQ4A 2CQSA 5ILHA 4GTPB 4GL3A 4WVCA 2J5CA 3HXCB 3SFXB 1JCRB 1LTXB 4ZG8A 4CJ1A 3CU7A 4KKIA 3SQCA 1H3BA 2EAEA 3QFZA 3WC3A 1O6RA 4D4BA 3A0OA 3W7SA 4L9PB 3EU5B 2BB6A 1OJPA 1UG9A 3KSLB 4MBGB 1WU6A 1KKTA 1V7VA 1X1IA 3DSXB 4YCRA 4CJ0A 1HZFA 3N0FA 4GAXA 2NOJA 3PZ4B 2V8IA 1TN6B 3Q7AB 1N9AB 1O6HA 1KSCA 4YDOB 2RGKA 3LZ9A 1SQCA 2F0YB 1J0NA 1JCSB 4V1SA 1S63B 3RX8A 2BRPA 3K11A 3G4FA 2XWBB 2GH4A 1N95B 5ILKA 4J5TA 5JPMB 1HV6A 2EADA 4MMIA 3RENA 1TNZB 4ZH1A 1V7XA 1D8EB 5IK9A 1KS8A 3PYBA 3VW5A 3SDVA 1LF9A 2BB5A 3PMMA 1NI1B 2I07B 3S4AA 3X17A 2AHFA 2XWJB 1GHQA 1VD5A 3HXDB 3N0GA 1X1JA 3M77A 3G6JB 3E73A 3NFVA 3G4DA 3M01A 4FNVA 2RI9A 2QNOA 3SDRA 1N94B 4L0GA 1LD7B 5ILZA 3W7WA 3QSPA 3W7TA 1GXNA 4XUVA 2VN4A 2D8LA 3K7XA 3E80A 4L6XA 1FMIA 2IEJB 3E30B 1NC5A 5IL3A 1FPPB 4AYPA 1GXMA 4Z4LA 3PYAA 5FO9B 2BEDB 3EZ8A 3W5MA 3DSSB 4Q2BA 1HXCA 1F9DA 3EUVB 2CQTA 3EU8A 3CIHA 1FBOA 1GXOA 3E32B 1HCUA 2H6HB 1JCQB 5JMFA 4JJJA 3M74A 3H3KA 3D3IA 1AGMA 1TNOB 4GTSB 4OK4A 1G6IA 4GTRB 3QWTA 1LF6A 1V7WA 3E6UA 4WU0A 3EQAA 1QAZA 4DOEA 1RWGA 1LD8B 1SA4B 3DPYB 1R76A 1HXGA 4C1SA 1EGUA 1GAHA 3P5PA 4V1RA 3W7XA 1NL4B 2WINB 3WUXA 4OZWA 3RRSA 1WU5A 1AYXA 3GT5A 1UT9A 3ACSA 2JG0A 4ZRQA 4ZH5A 1N7OA 4OZVA 4DI5A 4LNVA 2P0VA 1DOGA 4EL8A 5IK6A 3SAEA 5CD2A 5C05A 3C72B 1WZZA 3A3VA 1FT2B 3WIWA 2V3NA 1GA2A 4BOKA 1FAEA 1QQFA 3S4BA 1KWFA 3M7EA 1N23A 3M00A 5FOBB 3RX5A 1I8QA 1CB8A 1RWFA 1N7QA 3DSUB 2B4FA 3Q79B 1XW2A 2WIIB 1K72A 3S4CA 2FV0A 1FP3A 2JJBA 3M71A 3WKFA 3E34B 3M75A 4FUSA 4CE7A 1GSZA 3OXUA 2G02A 2F6DA 1G9JA 3D5SA 2ZZRA 3DSWB 5IKHA 1HMUA 1KFGA 2A73B 5ILIA 3WIQA 2YIKA 2FUQA 1W3YA 3VSMA 5DHKA 2H6IB 4AYRA 1KZPB 1GLMA 4D4CA 3M02A 2A8ZA 2XQWA 4DODA 4KTRA 2EABA 2D5JA 4MMHA 1LOHA 4AYQA 5FO8B 1V5DA 1O6QA 1RQ5A 1RW9A 1HMWA 2ZBLA 3HXBB 3SDUA 5IKAA 1H39A 1N22A 1X81B 1N21A 5GZKA 1HX9A 5DGQA 2Q1FA 3WIRA 5IM1A 3WKIA 1DCEB 4RNQA 1OJOA 1TNYB 3P2CA 2SQCA 2PN5A 5MEHA 1N7NA 4KTPA 5E2JA 1N4RB 4D4DA 3QRYA 4GTQB 3WKHA 2AFAA 3E7JA 5GY3A 3ANJA 1W6KA 1FT1B 1XWQA 2H6FB 3QG0A 5DHIA 4Q88A 2FUZA 5EAUA 5FO7B 4FXGB 1MZCB 3M7LA 2B39A 1FCEA 2V3PA 3SDTA 1LXMA 4OK2A 1KRFA 1OJMA 3S9VA 1SA5B 3PZ3B 1N1ZA 1DL2A 1UMPA 4F13A 2ZIRB 1JS4A 1H12A 1CLCA 3AFLA 1N20A 4LNBB 2ONGA 1N4SB 1TNUB 1TN7B 2V8KA 4MU9A 4M76A 3T33A 1HM3A 1H35A 3DRAB 3RJ3A 3PZ2B 4LNGB 2PMVA 1IA6A 1C82A 1IA7A 4GTVB 4AYOA 1ULVA 1D8DB 3GZKA 3ACTA 1NXCA 2DRSA 2WY8A 1WU4A 4FXKB 1O1RB 5GW7A 2NVPA 2WY7A 4E1YA 3RSYA 1HXAA 1O1TB 3ANIA 2BRWA 1F9OA 3E33B 4WVAA 2EACA 1FO2A 5CA3A 1N1BA 1S64B 2E22A 1RWHA 2VN7A 4TXTA 3PZ1B 3QXQA 3VSNA 1C3DA 4YDEB 3H7LA 5IL8A 3QT9A 3M76A 2WCOA 3W7UA 4D94A 1O1SB 3OEDA 1J0MA 3QPFA 4D4AA 5ILDA 3HXFB 4ONTA 1FO3A 4GTMB 5JPNB 3RX7A 1L2AA 1F1SA 1OJNA 3NNBA 2WYNA 3QT3A 1TF4A 5EASA 3QDEA 1QBQB 3Q73B 1V5CA 3M7BA 1H36A 2GOXA 1FBWA 1H3AA 5M7YA 1KREA 4EHMB 1H37A 1G87A 3M7CA 4ZRPA 1KSDA 2V8JA 2OKXA 3H2WA 1TNBB 2FBAA 1W6JA 4NEIA 3SFYB 3ANKA 3GLYA 3SDQA 3DSVB 2JF4A 1H13A 2BBCA 2R2LB 5JMDA 5DGRA 2Z07A 4WVBA 1X9DA 5ILJA 1QSJA 4GTTB 2WDAA 1RWAA 1N7PA 3KLSA 1RWCA 2FV1A 5ILYA 2DRRA 2ZISB 1KZOB 1LXKA 1HN0A 3VXDA 2RI8A 4QT9A 2FUTA 1H3CA 3QFYA 5EATA 3Q75B 3P5RA 3E37B 4F10A 3DSTB 4KKJA 3M78A 1X1HA 4Z4JA
chains in the Genus database with same CATH topology
1IS9A 3WKGA 2XFGA 3KSQB 4GTOB 1GAIA 2H6GB 1TN8B 4TF4A 1O5MB 1H14A 1L1YA 4LIXA 1H54A 3Q7FB 3AFJA 5M7IA 3ON6A 4BOJA 3TF4A 3M73A 2DROA 3QXFA 3D5RA 2DRQA 1CEMA 3M72A 3W5NA 2G0DA 5CZLA 1N4QB 1N4PB 5AGDA 3HXEB 3S4DA 1G9GA 5KKBA 3Q78B 2GZ6A 2AHGA 1O79A 1XWTA 3KQ4A 2CQSA 4GTPB 4GL3A 4WVCA 3HXCB 3SFXB 1JCRB 1LTXB 4ZG8A 4CJ1A 3CU7A 4KKIA 3SQCA 1H3BA 2EAEA 3QFZA 3WC3A 1O6RA 4D4BA 3W7SA 4L9PB 3EU5B 2BB6A 4MBGB 1UG9A 3KSLB 1WU6A 1KKTA 1V7VA 3DSXB 4YCRA 4CJ0A 1HZFA 2NOJA 3PZ4B 2V8IA 1TN6B 3Q7AB 1N9AB 1O6HA 1KSCA 4YDOB 2RGKA 1SQCA 2F0YB 1JCSB 4V1SA 1S63B 3RX8A 3K11A 2XWBB 2GH4A 1N95B 4J5TA 5JPMB 2EADA 3RENA 4ZH1A 1TNZB 1V7XA 1D8EB 1KS8A 3PYBA 3VW5A 3SDVA 1LF9A 3PMMA 2BB5A 1NI1B 2I07B 3S4AA 3X17A 2AHFA 2XWJB 1GHQA 1VD5A 3HXDB 3M77A 3G6JB 3E73A 2RI9A 2QNOA 3SDRA 1N94B 4L0GA 1LD7B 3W7WA 3QSPA 3W7TA 1GXNA 4XUVA 2VN4A 2D8LA 3K7XA 4L6XA 1FMIA 2IEJB 3E30B 1NC5A 1FPPB 4AYPA 1GXMA 4Z4LA 3PYAA 5FO9B 2BEDB 3EZ8A 3W5MA 3DSSB 4Q2BA 1F9DA 3EUVB 2CQTA 3EU8A 3CIHA 1FBOA 1GXOA 3E32B 1HCUA 2H6HB 1JCQB 4JJJA 3M74A 3H3KA 3D3IA 1AGMA 1TNOB 4GTSB 1G6IA 4GTRB 3QWTA 1LF6A 1V7WA 3E6UA 4WU0A 3EQAA 4DOEA 1LD8B 1SA4B 3DPYB 1R76A 4C1SA 1GAHA 3P5PA 4V1RA 3W7XA 1NL4B 2WINB 3WUXA 3RRSA 1WU5A 1AYXA 3GT5A 1UT9A 3ACSA 2JG0A 4ZRQA 4ZH5A 4LNVA 2P0VA 1DOGA 4EL8A 3SAEA 5CD2A 3C72B 1WZZA 3A3VA 1FT2B 3WIWA 2V3NA 1GA2A 4BOKA 1FAEA 1QQFA 3S4BA 1KWFA 3M7EA 5FOBB 3RX5A 3DSUB 2B4FA 3Q79B 1XW2A 2WIIB 1K72A 3S4CA 2FV0A 1FP3A 2JJBA 3M71A 3WKFA 3E34B 3M75A 4FUSA 4CE7A 1GSZA 3OXUA 2G02A 2F6DA 1G9JA 3D5SA 2ZZRA 3DSWB 1KFGA 2A73B 3WIQA 2YIKA 2H6IB 4AYRA 1KZPB 1GLMA 4D4CA 2A8ZA 2XQWA 4DODA 4KTRA 2EABA 2D5JA 4AYQA 5FO8B 1V5DA 1O6QA 1RQ5A 2ZBLA 3HXBB 3SDUA 1H39A 1X81B 5GZKA 5DGQA 3WIRA 3WKIA 1DCEB 1TNYB 3P2CA 2SQCA 2PN5A 5MEHA 4KTPA 5E2JA 1N4RB 4D4DA 3QRYA 4GTQB 3WKHA 2AFAA 5GY3A 3ANJA 1W6KA 1FT1B 1XWQA 2H6FB 3QG0A 4Q88A 2FUZA 5FO7B 4FXGB 1MZCB 3M7LA 2B39A 1FCEA 2V3PA 3SDTA 1KRFA 3S9VA 1SA5B 3PZ3B 1DL2A 1UMPA 2ZIRB 1JS4A 1CLCA 4LNBB 1N4SB 1TNUB 1TN7B 2V8KA 4MU9A 4M76A 3T33A 1H35A 3DRAB 3RJ3A 3PZ2B 4LNGB 2PMVA 1IA6A 1IA7A 4GTVB 4AYOA 1ULVA 1D8DB 3GZKA 3ACTA 1NXCA 2DRSA 2WY8A 1WU4A 4FXKB 1O1RB 5GW7A 2NVPA 2WY7A 3RSYA 1O1TB 3ANIA 1F9OA 3E33B 4WVAA 2EACA 1FO2A 5CA3A 1S64B 2VN7A 4TXTA 3PZ1B 3QXQA 1C3DA 4YDEB 3H7LA 3QT9A 3M76A 3W7UA 4D94A 1O1SB 3OEDA 3QPFA 4D4AA 3HXFB 4ONTA 1FO3A 4GTMB 5JPNB 3RX7A 1L2AA 2WYNA 3QT3A 1TF4A 3QDEA 1QBQB 3Q73B 3M7BA 1V5CA 1H36A 2GOXA 1FBWA 1H3AA 5M7YA 1KREA 4EHMB 1H37A 1G87A 3M7CA 4ZRPA 1KSDA 2V8JA 2OKXA 3H2WA 1TNBB 2FBAA 1W6JA 3SFYB 3ANKA 3GLYA 3SDQA 3DSVB 2JF4A 1H13A 2BBCA 2R2LB 5DGRA 2Z07A 4WVBA 1X9DA 1QSJA 4GTTB 3KLSA 2FV1A 2DRRA 2ZISB 1KZOB 3VXDA 2RI8A 4QT9A 1H3CA 3QFYA 3Q75B 3P5RA 3E37B 3DSTB 4KKJA 3M78A 1H12A 4Z4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N94 B;  2WII B;  1LD7 B;  4GTV B;  1D8D B;  3KSQ B;  4GTO B;  2WY8 A;  4FXK B;  1O1R B;  2WY7 A;  2H6G B;  1GXN A;  1O1T B;  3E34 B;  1TN8 B;  3K7X A;  1GSZ A;  3OXU A;  1O5M B;  2G02 A;  3D5S A;  3Q7F B;  3DSW B;  3E33 B;  2A73 B;  2IEJ B;  3E30 B;  1S64 B;  4BOJ A;  2H6I B;  1FPP B;  1GXM A;  5FO9 B;  2BED B;  3D5R A;  1KZP B;  3DSS B;  4D4C A;  2XQW A;  3PZ1 B;  1C3D A;  4YDE B;  3EUV B;  2G0D A;  1GXO A;  3E32 B;  2H6H B;  5FO8 B;  1N4Q B;  1N4P B;  5AGD A;  1O6Q A;  1JCQ B;  3HXE B;  4D94 A;  1O1S B;  3HXB B;  3Q78 B;  3OED A;  1O79 A;  1H39 A;  3KQ4 A;  4GTP B;  1X81 B;  1TNO B;  4GTS B;  4D4A A;  3HXC B;  3SFX B;  1DCE B;  1JCR B;  3HXF B;  4GTR B;  1LTX B;  1TNY B;  2SQC A;  2PN5 A;  4ONT A;  3CU7 A;  4GTM B;  5JPN B;  4KKI A;  1N4R B;  1LD8 B;  1SA4 B;  3SQC A;  4D4D A;  1H3B A;  3DPY B;  1R76 A;  1O6R A;  4GTQ B;  4D4B A;  1QBQ B;  4C1S A;  3Q73 B;  4L9P B;  3EU5 B;  1W6K A;  1H36 A;  2GOX A;  1H3A A;  2BB6 A;  4EHM B;  4MBG B;  3KSL B;  1H37 A;  4V1R A;  1FT1 B;  1NL4 B;  2WIN B;  2H6F B;  4ZRP A;  2V8J A;  1TNB B;  1W6J A;  3DSX B;  3SFY B;  1HZF A;  5FO7 B;  4FXG B;  2NOJ A;  3PZ4 B;  1MZC B;  2B39 A;  2V8I A;  1TN6 B;  2V3P A;  3DSV B;  4ZRQ A;  3Q7A B;  1N9A B;  1O6H A;  2BBC A;  4LNV A;  4YDO B;  2R2L B;  1SQC A;  2F0Y B;  1JCS B;  4V1S A;  1S63 B;  2XWB B;  3C72 B;  1SA5 B;  1N95 B;  3PZ3 B;  1QSJ A;  4GTT B;  5JPM B;  4ZH1 A;  1UMP A;  1TNZ B;  2ZIR B;  1FT2 B;  1D8E B;  2V3N A;  3KLS A;  4BOK A;  1QQF A;  4LNB B;  2BB5 A;  2ZIS B;  1KZO B;  1N4S B;  1NI1 B;  1TNU B;  2I07 B;  1TN7 B;  2V8K A;  2XWJ B;  4M76 A;  4MU9 A;  1GHQ A;  1H35 A;  3DRA B;  5FOB B;  3HXD B;  1H3C A;  3PZ2 B;  4LNG B;  3RJ3 A;  3Q75 B;  2PMV A;  3E37 B;  3DST B;  3G6J B;  3DSU B;  4KKJ A;  3Q79 B; 
#chains in the Genus database with same CATH topology
 2BRV X;  1IS9 A;  3WKG A;  2XFG A;  1F9G A;  4FJQ A;  3KSQ B;  4GTO B;  1GAI A;  2H6G B;  1TN8 B;  4TF4 A;  1O5M B;  1H14 A;  1L1Y A;  4LIX A;  1H54 A;  3Q7F B;  3AFJ A;  5M7I A;  3ON6 A;  4OJZ A;  2X03 A;  4BOJ A;  3TF4 A;  3M73 A;  2DRO A;  3QXF A;  3D5R A;  2DRQ A;  1CEM A;  1HM2 A;  1N24 A;  5IK0 A;  2ONH A;  3M72 A;  3W5N A;  2G0D A;  5CZL A;  1N4Q B;  1N4P B;  5AGD A;  3HXE B;  3S4D A;  1G9G A;  5KKB A;  3Q78 B;  1N7R A;  2GZ6 A;  2AHG A;  2E24 A;  1O79 A;  1XWT A;  3KQ4 A;  2CQS A;  5ILH A;  4GTP B;  4GL3 A;  4WVC A;  2J5C A;  3HXC B;  3SFX B;  1JCR B;  1LTX B;  4ZG8 A;  4CJ1 A;  3CU7 A;  4KKI A;  3SQC A;  1H3B A;  2EAE A;  3QFZ A;  3WC3 A;  1O6R A;  4D4B A;  3A0O A;  3W7S A;  4L9P B;  3EU5 B;  2BB6 A;  1OJP A;  1UG9 A;  3KSL B;  4MBG B;  1WU6 A;  1KKT A;  1V7V A;  1X1I A;  3DSX B;  4YCR A;  4CJ0 A;  1HZF A;  3N0F A;  4GAX A;  2NOJ A;  3PZ4 B;  2V8I A;  1TN6 B;  3Q7A B;  1N9A B;  1O6H A;  1KSC A;  4YDO B;  2RGK A;  3LZ9 A;  1SQC A;  2F0Y B;  1J0N A;  1JCS B;  4V1S A;  1S63 B;  3RX8 A;  2BRP A;  3K11 A;  3G4F A;  2XWB B;  2GH4 A;  1N95 B;  5ILK A;  4J5T A;  5JPM B;  1HV6 A;  2EAD A;  4MMI A;  3REN A;  1TNZ B;  4ZH1 A;  1V7X A;  1D8E B;  5IK9 A;  1KS8 A;  3PYB A;  3VW5 A;  3SDV A;  1LF9 A;  2BB5 A;  3PMM A;  1NI1 B;  2I07 B;  3S4A A;  3X17 A;  2AHF A;  2XWJ B;  1GHQ A;  1VD5 A;  3HXD B;  3N0G A;  1X1J A;  3M77 A;  3G6J B;  3E73 A;  3NFV A;  3G4D A;  3M01 A;  4FNV A;  2RI9 A;  2QNO A;  3SDR A;  1N94 B;  4L0G A;  1LD7 B;  5ILZ A;  3W7W A;  3QSP A;  3W7T A;  1GXN A;  4XUV A;  2VN4 A;  2D8L A;  3K7X A;  3E80 A;  4L6X A;  1FMI A;  2IEJ B;  3E30 B;  1NC5 A;  5IL3 A;  1FPP B;  4AYP A;  1GXM A;  4Z4L A;  3PYA A;  5FO9 B;  2BED B;  3EZ8 A;  3W5M A;  3DSS B;  4Q2B A;  1HXC A;  1F9D A;  3EUV B;  2CQT A;  3EU8 A;  3CIH A;  1FBO A;  1GXO A;  3E32 B;  1HCU A;  2H6H B;  1JCQ B;  5JMF A;  4JJJ A;  3M74 A;  3H3K A;  3D3I A;  1AGM A;  1TNO B;  4GTS B;  4OK4 A;  1G6I A;  4GTR B;  3QWT A;  1LF6 A;  1V7W A;  3E6U A;  4WU0 A;  3EQA A;  1QAZ A;  4DOE A;  1RWG A;  1LD8 B;  1SA4 B;  3DPY B;  1R76 A;  1HXG A;  4C1S A;  1EGU A;  1GAH A;  3P5P A;  4V1R A;  3W7X A;  1NL4 B;  2WIN B;  3WUX A;  4OZW A;  3RRS A;  1WU5 A;  1AYX A;  3GT5 A;  1UT9 A;  3ACS A;  2JG0 A;  4ZRQ A;  4ZH5 A;  1N7O A;  4OZV A;  4DI5 A;  4LNV A;  2P0V A;  1DOG A;  4EL8 A;  5IK6 A;  3SAE A;  5CD2 A;  5C05 A;  3C72 B;  1WZZ A;  3A3V A;  1FT2 B;  3WIW A;  2V3N A;  1GA2 A;  4BOK A;  1FAE A;  1QQF A;  3S4B A;  1KWF A;  3M7E A;  1N23 A;  3M00 A;  5FOB B;  3RX5 A;  1I8Q A;  1CB8 A;  1RWF A;  1N7Q A;  3DSU B;  2B4F A;  3Q79 B;  1XW2 A;  2WII B;  1K72 A;  3S4C A;  2FV0 A;  1FP3 A;  2JJB A;  3M71 A;  3WKF A;  3E34 B;  3M75 A;  4FUS A;  4CE7 A;  1GSZ A;  3OXU A;  2G02 A;  2F6D A;  1G9J A;  3D5S A;  2ZZR A;  3DSW B;  5IKH A;  1HMU A;  1KFG A;  2A73 B;  5ILI A;  3WIQ A;  2YIK A;  2FUQ A;  1W3Y A;  3VSM A;  5DHK A;  2H6I B;  4AYR A;  1KZP B;  1GLM A;  4D4C A;  3M02 A;  2A8Z A;  2XQW A;  4DOD A;  4KTR A;  2EAB A;  2D5J A;  4MMH A;  1LOH A;  4AYQ A;  5FO8 B;  1V5D A;  1O6Q A;  1RQ5 A;  1RW9 A;  1HMW A;  2ZBL A;  3HXB B;  3SDU A;  5IKA A;  1H39 A;  1N22 A;  1X81 B;  1N21 A;  5GZK A;  1HX9 A;  5DGQ A;  2Q1F A;  3WIR A;  5IM1 A;  3WKI A;  1DCE B;  4RNQ A;  1OJO A;  1TNY B;  3P2C A;  2SQC A;  2PN5 A;  5MEH A;  1N7N A;  4KTP A;  5E2J A;  1N4R B;  4D4D A;  3QRY A;  4GTQ B;  3WKH A;  2AFA A;  3E7J A;  5GY3 A;  3ANJ A;  1W6K A;  1FT1 B;  1XWQ A;  2H6F B;  3QG0 A;  5DHI A;  4Q88 A;  2FUZ A;  5EAU A;  5FO7 B;  4FXG B;  1MZC B;  3M7L A;  2B39 A;  1FCE A;  2V3P A;  3SDT A;  1LXM A;  4OK2 A;  1KRF A;  1OJM A;  3S9V A;  1SA5 B;  3PZ3 B;  1N1Z A;  1DL2 A;  1UMP A;  4F13 A;  2ZIR B;  1JS4 A;  1H12 A;  1CLC A;  3AFL A;  1N20 A;  4LNB B;  2ONG A;  1N4S B;  1TNU B;  1TN7 B;  2V8K A;  4MU9 A;  4M76 A;  3T33 A;  1HM3 A;  1H35 A;  3DRA B;  3RJ3 A;  3PZ2 B;  4LNG B;  2PMV A;  1IA6 A;  1C82 A;  1IA7 A;  4GTV B;  4AYO A;  1ULV A;  1D8D B;  3GZK A;  3ACT A;  1NXC A;  2DRS A;  2WY8 A;  1WU4 A;  4FXK B;  1O1R B;  5GW7 A;  2NVP A;  2WY7 A;  4E1Y A;  3RSY A;  1HXA A;  1O1T B;  3ANI A;  2BRW A;  1F9O A;  3E33 B;  4WVA A;  2EAC A;  1FO2 A;  5CA3 A;  1N1B A;  1S64 B;  2E22 A;  1RWH A;  2VN7 A;  4TXT A;  3PZ1 B;  3QXQ A;  3VSN A;  1C3D A;  4YDE B;  3H7L A;  5IL8 A;  3QT9 A;  3M76 A;  2WCO A;  3W7U A;  4D94 A;  1O1S B;  3OED A;  1J0M A;  3QPF A;  4D4A A;  5ILD A;  3HXF B;  4ONT A;  1FO3 A;  4GTM B;  5JPN B;  3RX7 A;  1L2A A;  1F1S A;  1OJN A;  3NNB A;  2WYN A;  3QT3 A;  1TF4 A;  5EAS A;  3QDE A;  1QBQ B;  3Q73 B;  1V5C A;  3M7B A;  1H36 A;  2GOX A;  1FBW A;  1H3A A;  5M7Y A;  1KRE A;  4EHM B;  1H37 A;  1G87 A;  3M7C A;  4ZRP A;  1KSD A;  2V8J A;  2OKX A;  3H2W A;  1TNB B;  2FBA A;  1W6J A;  4NEI A;  3SFY B;  3ANK A;  3GLY A;  3SDQ A;  3DSV B;  2JF4 A;  1H13 A;  2BBC A;  2R2L B;  5JMD A;  5DGR A;  2Z07 A;  4WVB A;  1X9D A;  5ILJ A;  1QSJ A;  4GTT B;  2WDA A;  1RWA A;  1N7P A;  3KLS A;  1RWC A;  2FV1 A;  5ILY A;  2DRR A;  2ZIS B;  1KZO B;  1LXK A;  1HN0 A;  3VXD A;  2RI8 A;  4QT9 A;  2FUT A;  1H3C A;  3QFY A;  5EAT A;  3Q75 B;  3P5R A;  3E37 B;  4F10 A;  3DST B;  4KKJ A;  3M78 A;  1X1H A;  4Z4J A; 
#chains in the Genus database with same CATH homology
 1IS9 A;  3WKG A;  2XFG A;  3KSQ B;  4GTO B;  1GAI A;  2H6G B;  1TN8 B;  4TF4 A;  1O5M B;  1H14 A;  1L1Y A;  4LIX A;  1H54 A;  3Q7F B;  3AFJ A;  5M7I A;  3ON6 A;  4BOJ A;  3TF4 A;  3M73 A;  2DRO A;  3QXF A;  3D5R A;  2DRQ A;  1CEM A;  3M72 A;  3W5N A;  2G0D A;  5CZL A;  1N4Q B;  1N4P B;  5AGD A;  3HXE B;  3S4D A;  1G9G A;  5KKB A;  3Q78 B;  2GZ6 A;  2AHG A;  1O79 A;  1XWT A;  3KQ4 A;  2CQS A;  4GTP B;  4GL3 A;  4WVC A;  3HXC B;  3SFX B;  1JCR B;  1LTX B;  4ZG8 A;  4CJ1 A;  3CU7 A;  4KKI A;  3SQC A;  1H3B A;  2EAE A;  3QFZ A;  3WC3 A;  1O6R A;  4D4B A;  3W7S A;  4L9P B;  3EU5 B;  2BB6 A;  4MBG B;  1UG9 A;  3KSL B;  1WU6 A;  1KKT A;  1V7V A;  3DSX B;  4YCR A;  4CJ0 A;  1HZF A;  2NOJ A;  3PZ4 B;  2V8I A;  1TN6 B;  3Q7A B;  1N9A B;  1O6H A;  1KSC A;  4YDO B;  2RGK A;  1SQC A;  2F0Y B;  1JCS B;  4V1S A;  1S63 B;  3RX8 A;  3K11 A;  2XWB B;  2GH4 A;  1N95 B;  4J5T A;  5JPM B;  2EAD A;  3REN A;  4ZH1 A;  1TNZ B;  1V7X A;  1D8E B;  1KS8 A;  3PYB A;  3VW5 A;  3SDV A;  1LF9 A;  3PMM A;  2BB5 A;  1NI1 B;  2I07 B;  3S4A A;  3X17 A;  2AHF A;  2XWJ B;  1GHQ A;  1VD5 A;  3HXD B;  3M77 A;  3G6J B;  3E73 A;  2RI9 A;  2QNO A;  3SDR A;  1N94 B;  4L0G A;  1LD7 B;  3W7W A;  3QSP A;  3W7T A;  1GXN A;  4XUV A;  2VN4 A;  2D8L A;  3K7X A;  4L6X A;  1FMI A;  2IEJ B;  3E30 B;  1NC5 A;  1FPP B;  4AYP A;  1GXM A;  4Z4L A;  3PYA A;  5FO9 B;  2BED B;  3EZ8 A;  3W5M A;  3DSS B;  4Q2B A;  1F9D A;  3EUV B;  2CQT A;  3EU8 A;  3CIH A;  1FBO A;  1GXO A;  3E32 B;  1HCU A;  2H6H B;  1JCQ B;  4JJJ A;  3M74 A;  3H3K A;  3D3I A;  1AGM A;  1TNO B;  4GTS B;  1G6I A;  4GTR B;  3QWT A;  1LF6 A;  1V7W A;  3E6U A;  4WU0 A;  3EQA A;  4DOE A;  1LD8 B;  1SA4 B;  3DPY B;  1R76 A;  4C1S A;  1GAH A;  3P5P A;  4V1R A;  3W7X A;  1NL4 B;  2WIN B;  3WUX A;  3RRS A;  1WU5 A;  1AYX A;  3GT5 A;  1UT9 A;  3ACS A;  2JG0 A;  4ZRQ A;  4ZH5 A;  4LNV A;  2P0V A;  1DOG A;  4EL8 A;  3SAE A;  5CD2 A;  3C72 B;  1WZZ A;  3A3V A;  1FT2 B;  3WIW A;  2V3N A;  1GA2 A;  4BOK A;  1FAE A;  1QQF A;  3S4B A;  1KWF A;  3M7E A;  5FOB B;  3RX5 A;  3DSU B;  2B4F A;  3Q79 B;  1XW2 A;  2WII B;  1K72 A;  3S4C A;  2FV0 A;  1FP3 A;  2JJB A;  3M71 A;  3WKF A;  3E34 B;  3M75 A;  4FUS A;  4CE7 A;  1GSZ A;  3OXU A;  2G02 A;  2F6D A;  1G9J A;  3D5S A;  2ZZR A;  3DSW B;  1KFG A;  2A73 B;  3WIQ A;  2YIK A;  2H6I B;  4AYR A;  1KZP B;  1GLM A;  4D4C A;  2A8Z A;  2XQW A;  4DOD A;  4KTR A;  2EAB A;  2D5J A;  4AYQ A;  5FO8 B;  1V5D A;  1O6Q A;  1RQ5 A;  2ZBL A;  3HXB B;  3SDU A;  1H39 A;  1X81 B;  5GZK A;  5DGQ A;  3WIR A;  3WKI A;  1DCE B;  1TNY B;  3P2C A;  2SQC A;  2PN5 A;  5MEH A;  4KTP A;  5E2J A;  1N4R B;  4D4D A;  3QRY A;  4GTQ B;  3WKH A;  2AFA A;  5GY3 A;  3ANJ A;  1W6K A;  1FT1 B;  1XWQ A;  2H6F B;  3QG0 A;  4Q88 A;  2FUZ A;  5FO7 B;  4FXG B;  1MZC B;  3M7L A;  2B39 A;  1FCE A;  2V3P A;  3SDT A;  1KRF A;  3S9V A;  1SA5 B;  3PZ3 B;  1DL2 A;  1UMP A;  2ZIR B;  1JS4 A;  1CLC A;  4LNB B;  1N4S B;  1TNU B;  1TN7 B;  2V8K A;  4MU9 A;  4M76 A;  3T33 A;  1H35 A;  3DRA B;  3RJ3 A;  3PZ2 B;  4LNG B;  2PMV A;  1IA6 A;  1IA7 A;  4GTV B;  4AYO A;  1ULV A;  1D8D B;  3GZK A;  3ACT A;  1NXC A;  2DRS A;  2WY8 A;  1WU4 A;  4FXK B;  1O1R B;  5GW7 A;  2NVP A;  2WY7 A;  3RSY A;  1O1T B;  3ANI A;  1F9O A;  3E33 B;  4WVA A;  2EAC A;  1FO2 A;  5CA3 A;  1S64 B;  2VN7 A;  4TXT A;  3PZ1 B;  3QXQ A;  1C3D A;  4YDE B;  3H7L A;  3QT9 A;  3M76 A;  3W7U A;  4D94 A;  1O1S B;  3OED A;  3QPF A;  4D4A A;  3HXF B;  4ONT A;  1FO3 A;  4GTM B;  5JPN B;  3RX7 A;  1L2A A;  2WYN A;  3QT3 A;  1TF4 A;  3QDE A;  1QBQ B;  3Q73 B;  3M7B A;  1V5C A;  1H36 A;  2GOX A;  1FBW A;  1H3A A;  5M7Y A;  1KRE A;  4EHM B;  1H37 A;  1G87 A;  3M7C A;  4ZRP A;  1KSD A;  2V8J A;  2OKX A;  3H2W A;  1TNB B;  2FBA A;  1W6J A;  3SFY B;  3ANK A;  3GLY A;  3SDQ A;  3DSV B;  2JF4 A;  1H13 A;  2BBC A;  2R2L B;  5DGR A;  2Z07 A;  4WVB A;  1X9D A;  1QSJ A;  4GTT B;  3KLS A;  2FV1 A;  2DRR A;  2ZIS B;  1KZO B;  3VXD A;  2RI8 A;  4QT9 A;  1H3C A;  3QFY A;  3Q75 B;  3P5R A;  3E37 B;  3DST B;  4KKJ A;  3M78 A;  1H12 A;  4Z4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...