4ONTD

Ternary host recognition complex of complement factor h, c3d, and sialic acid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
126
structure length
126
Chain Sequence
FGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement factor H
publication title Structural basis for sialic acid-mediated self-recognition by complement factor H.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 126
sequence length 126
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4ontD01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4ontD02
3KZJA 3ZD2A 1HCCA 1H04P 1O9AA 2JGWA 3ZD1A 1Z92B 2A55A 1OK9A 2XRBA 1OK2A 1CKLA 2XWJI 3GXEA 1FBRA 3L89M 2RKZA 1H2QP 2YRAA 2O39C 2XWBF 3T5OA 1VVDA 1ZJKA 5HYTB 3ERBA 1TPNA 2MCZA 2MCYA 1QGBA 2G7IA 1OK1A 3SW0X 2JGXA 1GKGA 2IZ3A 2CKUA 2XRDA 3KXVA 2CG7A 1SS2A 1TPGA 1SRZA 2WIIC 2RLQA 1PPQA 1MD8A 3INBC 3MQLA 3O8EB 4FXGG 4C16A 1GPZA 1QUBA 2V8EA 1HFIA 1HFHA 5HYPA 1U5MA 3EJHA 2RKYA 1E8BA 1H03P 2EC3A 1G4GA 2CG6A 1GKNA 4CSYA 4PZ5A 1Q3XA 4B2RA 2LOJA 2ERJA 3RJ3D 1E88A 2RLPA 2XQWC 4F4OC 5HZPB 3CALA 3OXUD 2IZ4A 4AYDA 1E5GA 2W80A 2YBYA 1LY2A 4AYIA 4IGDA 2KMSA 4LOSA 2B5ID 2BZMA 2EHFA 5FO8C 1TPMA 1G4FA 2RL0A 4JHSA 1ELVA 1C1ZA 1NWVA 1VVCA 4K12A 5I0QB 3R62A 2KRIA 3ZRZA 3M7PA 2W81A 2QY0A 3OEDC 1OK3A 3GOVA 4J38B 1H2PP 1GHQB 1MD7A 2UWNA 1OJWA 1QO6A 4A5WB 4AYMA 4LOTA 4ZH1D 3IU3I 5JPMG 2JRAA 3OP8A 4AYEA 1OJYA 3TVJA 3NFPI 4ONTD 4KKDA 4DJZA 1UOTP 4YNXA 4B2SA 4WJG2 1OJVA 5HYUB 4MUCA 3IX0A
chains in the Genus database with same CATH superfamily
3KZJA 3ZD2A 1HCCA 1H04P 1O9AA 2JGWA 3ZD1A 4APLA 3FGRA 1Z92B 2A55A 1OK9A 2XRBA 1OK2A 1CKLA 2XWJI 3GXEA 1FBRA 3L89M 2RKZA 1H2QP 2Y8SA 2YRAA 2O39C 2XWBF 3T5OA 1VVDA 1ZJKA 5HYTB 3ERBA 1TPNA 2MCZA 2MCYA 1QGBA 2G7IA 1OK1A 3WSXA 3SW0X 2JGXA 1GKGA 2IZ3A 2CKUA 2XRDA 3KXVA 2CG7A 1SS2A 1TPGA 1SRZA 4PO7A 2WIIC 4MSLA 2RLQA 1PPQA 1MD8A 3INBC 3MQLA 3O8EB 4FXGG 4C16A 1GPZA 1QUBA 2V8EA 1HFIA 1HFHA 5HYPA 1U5MA 3EJHA 2RKYA 5DN4A 3CI0J 3NJAA 1E8BA 1H03P 2EC3A 1G4GA 2CG6A 3ZLEA 1GKNA 4CSYA 2ZYCA 5DN5A 4PZ5A 1Q3XA 4N7EA 4B2RA 2LOJA 2ERJA 3RJ3D 1E88A 2RLPA 2XQWC 4F4OC 5HZPB 3K3TA 3CALA 3OXUD 2IZ4A 4AYDA 1E5GA 2W80A 2YBYA 3ZLDA 1LY2A 4AYIA 4IGDA 2KMSA 4LOSA 2B5ID 2BZMA 2EHFA 5FO8C 3FGTA 1TPMA 1G4FA 2RL0A 4JHSA 4BWCA 1ELVA 1C1ZA 1NWVA 1VVCA 2I2LA 4K12A 5I0QB 3R62A 2KRIA 3ZRZA 3M7PA 2W81A 2QY0A 4YIZA 3OEDC 2Y8RA 1OK3A 3GOVA 4J38B 1H2PP 1GHQB 1MD7A 2Y8TA 2UWNA 1OJWA 1QO6A 4A5WB 4AYMA 4LOTA 4ZH1D 3IU3I 5JPMG 2JRAA 3WSYA 3OP8A 1RLHA 4AYEA 1OJYA 3TVJA 3NFPI 4ONTD 4KKDA 4DJZA 1UOTP 4YNXA 4B2SA 4WJG2 1OJVA 5HYUB 3F6KA 4MUCA 3VWOA 2X2ZA 3IX0A
chains in the Genus database with same CATH topology
3KZJA 3ZD2A 1HCCA 1H04P 1O9AA 2JGWA 3ZD1A 1Z92B 2A55A 1OK9A 2XRBA 1OK2A 1CKLA 2XWJI 3GXEA 1FBRA 3L89M 2RKZA 1H2QP 2YRAA 2O39C 2XWBF 3T5OA 1VVDA 1ZJKA 5HYTB 3ERBA 1TPNA 2MCZA 2MCYA 1QGBA 2G7IA 1OK1A 3SW0X 2JGXA 1GKGA 2IZ3A 2CKUA 2XRDA 3KXVA 2CG7A 1SS2A 1TPGA 1SRZA 2WIIC 2RLQA 1PPQA 1MD8A 3INBC 3MQLA 3O8EB 4FXGG 4C16A 1GPZA 1QUBA 2V8EA 1HFIA 1HFHA 5HYPA 1U5MA 3EJHA 2RKYA 1E8BA 1H03P 2EC3A 1G4GA 2CG6A 1GKNA 4CSYA 4PZ5A 1Q3XA 4B2RA 2LOJA 2ERJA 3RJ3D 1E88A 2RLPA 2XQWC 4F4OC 5HZPB 3CALA 3OXUD 2IZ4A 4AYDA 1E5GA 2W80A 2YBYA 1LY2A 4AYIA 4IGDA 2KMSA 4LOSA 2B5ID 2BZMA 2EHFA 5FO8C 1TPMA 1G4FA 2RL0A 4JHSA 1ELVA 1C1ZA 1NWVA 1VVCA 4K12A 5I0QB 3R62A 2KRIA 3ZRZA 3M7PA 2W81A 2QY0A 3OEDC 1OK3A 3GOVA 4J38B 1H2PP 1GHQB 1MD7A 2UWNA 1OJWA 1QO6A 4A5WB 4AYMA 4LOTA 4ZH1D 3IU3I 5JPMG 2JRAA 3OP8A 4AYEA 1OJYA 3TVJA 3NFPI 4ONTD 4KKDA 4DJZA 1UOTP 4YNXA 4B2SA 4WJG2 1OJVA 5HYUB 4MUCA 3IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZJ A;  3ZD2 A;  1HCC A;  1H04 P;  1O9A A;  2JGW A;  3ZD1 A;  1Z92 B;  2A55 A;  1OK9 A;  2XRB A;  1OK2 A;  1CKL A;  2XWJ I;  3GXE A;  1FBR A;  3L89 M;  2RKZ A;  1H2Q P;  2YRA A;  2O39 C;  2XWB F;  3T5O A;  1VVD A;  1ZJK A;  5HYT B;  3ERB A;  1TPN A;  2MCZ A;  2MCY A;  1QGB A;  2G7I A;  1OK1 A;  3SW0 X;  2JGX A;  1GKG A;  2IZ3 A;  2CKU A;  2XRD A;  3KXV A;  2CG7 A;  1SS2 A;  1TPG A;  1SRZ A;  2WII C;  2RLQ A;  1PPQ A;  1MD8 A;  3INB C;  3MQL A;  3O8E B;  4FXG G;  4C16 A;  1GPZ A;  1QUB A;  2V8E A;  1HFI A;  1HFH A;  5HYP A;  1U5M A;  3EJH A;  2RKY A;  1E8B A;  1H03 P;  2EC3 A;  1G4G A;  2CG6 A;  1GKN A;  4CSY A;  4PZ5 A;  1Q3X A;  4B2R A;  2LOJ A;  2ERJ A;  3RJ3 D;  1E88 A;  2RLP A;  2XQW C;  4F4O C;  5HZP B;  3CAL A;  3OXU D;  2IZ4 A;  4AYD A;  1E5G A;  2W80 A;  2YBY A;  1LY2 A;  4AYI A;  4IGD A;  2KMS A;  4LOS A;  2B5I D;  2BZM A;  2EHF A;  5FO8 C;  1TPM A;  1G4F A;  2RL0 A;  4JHS A;  1ELV A;  1C1Z A;  1NWV A;  1VVC A;  4K12 A;  5I0Q B;  3R62 A;  2KRI A;  3ZRZ A;  3M7P A;  2W81 A;  2QY0 A;  3OED C;  1OK3 A;  3GOV A;  4J38 B;  1H2P P;  1GHQ B;  1MD7 A;  2UWN A;  1OJW A;  1QO6 A;  4A5W B;  4AYM A;  4LOT A;  4ZH1 D;  3IU3 I;  5JPM G;  2JRA A;  3OP8 A;  4AYE A;  1OJY A;  3TVJ A;  3NFP I;  4ONT D;  4KKD A;  4DJZ A;  1UOT P;  4YNX A;  4B2S A;  4WJG 2;  1OJV A;  5HYU B;  4MUC A;  3IX0 A; 
#chains in the Genus database with same CATH topology
 3KZJ A;  3ZD2 A;  1HCC A;  1H04 P;  1O9A A;  2JGW A;  3ZD1 A;  4APL A;  3FGR A;  1Z92 B;  2A55 A;  1OK9 A;  2XRB A;  1OK2 A;  1CKL A;  2XWJ I;  3GXE A;  1FBR A;  3L89 M;  2RKZ A;  1H2Q P;  2Y8S A;  2YRA A;  2O39 C;  2XWB F;  3T5O A;  1VVD A;  1ZJK A;  5HYT B;  3ERB A;  1TPN A;  2MCZ A;  2MCY A;  1QGB A;  2G7I A;  1OK1 A;  3WSX A;  3SW0 X;  2JGX A;  1GKG A;  2IZ3 A;  2CKU A;  2XRD A;  3KXV A;  2CG7 A;  1SS2 A;  1TPG A;  1SRZ A;  4PO7 A;  2WII C;  4MSL A;  2RLQ A;  1PPQ A;  1MD8 A;  3INB C;  3MQL A;  3O8E B;  4FXG G;  4C16 A;  1GPZ A;  1QUB A;  2V8E A;  1HFI A;  1HFH A;  5HYP A;  1U5M A;  3EJH A;  2RKY A;  5DN4 A;  3CI0 J;  3NJA A;  1E8B A;  1H03 P;  2EC3 A;  1G4G A;  2CG6 A;  3ZLE A;  1GKN A;  4CSY A;  2ZYC A;  5DN5 A;  4PZ5 A;  1Q3X A;  4N7E A;  4B2R A;  2LOJ A;  2ERJ A;  3RJ3 D;  1E88 A;  2RLP A;  2XQW C;  4F4O C;  5HZP B;  3K3T A;  3CAL A;  3OXU D;  2IZ4 A;  4AYD A;  1E5G A;  2W80 A;  2YBY A;  3ZLD A;  1LY2 A;  4AYI A;  4IGD A;  2KMS A;  4LOS A;  2B5I D;  2BZM A;  2EHF A;  5FO8 C;  3FGT A;  1TPM A;  1G4F A;  2RL0 A;  4JHS A;  4BWC A;  1ELV A;  1C1Z A;  1NWV A;  1VVC A;  2I2L A;  4K12 A;  5I0Q B;  3R62 A;  2KRI A;  3ZRZ A;  3M7P A;  2W81 A;  2QY0 A;  4YIZ A;  3OED C;  2Y8R A;  1OK3 A;  3GOV A;  4J38 B;  1H2P P;  1GHQ B;  1MD7 A;  2Y8T A;  2UWN A;  1OJW A;  1QO6 A;  4A5W B;  4AYM A;  4LOT A;  4ZH1 D;  3IU3 I;  5JPM G;  2JRA A;  3WSY A;  3OP8 A;  1RLH A;  4AYE A;  1OJY A;  3TVJ A;  3NFP I;  4ONT D;  4KKD A;  4DJZ A;  1UOT P;  4YNX A;  4B2S A;  4WJG 2;  1OJV A;  5HYU B;  3F6K A;  4MUC A;  3VWO A;  2X2Z A;  3IX0 A; 
#chains in the Genus database with same CATH homology
 3KZJ A;  3ZD2 A;  1HCC A;  1H04 P;  1O9A A;  2JGW A;  3ZD1 A;  1Z92 B;  2A55 A;  1OK9 A;  2XRB A;  1OK2 A;  1CKL A;  2XWJ I;  3GXE A;  1FBR A;  3L89 M;  2RKZ A;  1H2Q P;  2YRA A;  2O39 C;  2XWB F;  3T5O A;  1VVD A;  1ZJK A;  5HYT B;  3ERB A;  1TPN A;  2MCZ A;  2MCY A;  1QGB A;  2G7I A;  1OK1 A;  3SW0 X;  2JGX A;  1GKG A;  2IZ3 A;  2CKU A;  2XRD A;  3KXV A;  2CG7 A;  1SS2 A;  1TPG A;  1SRZ A;  2WII C;  2RLQ A;  1PPQ A;  1MD8 A;  3INB C;  3MQL A;  3O8E B;  4FXG G;  4C16 A;  1GPZ A;  1QUB A;  2V8E A;  1HFI A;  1HFH A;  5HYP A;  1U5M A;  3EJH A;  2RKY A;  1E8B A;  1H03 P;  2EC3 A;  1G4G A;  2CG6 A;  1GKN A;  4CSY A;  4PZ5 A;  1Q3X A;  4B2R A;  2LOJ A;  2ERJ A;  3RJ3 D;  1E88 A;  2RLP A;  2XQW C;  4F4O C;  5HZP B;  3CAL A;  3OXU D;  2IZ4 A;  4AYD A;  1E5G A;  2W80 A;  2YBY A;  1LY2 A;  4AYI A;  4IGD A;  2KMS A;  4LOS A;  2B5I D;  2BZM A;  2EHF A;  5FO8 C;  1TPM A;  1G4F A;  2RL0 A;  4JHS A;  1ELV A;  1C1Z A;  1NWV A;  1VVC A;  4K12 A;  5I0Q B;  3R62 A;  2KRI A;  3ZRZ A;  3M7P A;  2W81 A;  2QY0 A;  3OED C;  1OK3 A;  3GOV A;  4J38 B;  1H2P P;  1GHQ B;  1MD7 A;  2UWN A;  1OJW A;  1QO6 A;  4A5W B;  4AYM A;  4LOT A;  4ZH1 D;  3IU3 I;  5JPM G;  2JRA A;  3OP8 A;  4AYE A;  1OJY A;  3TVJ A;  3NFP I;  4ONT D;  4KKD A;  4DJZ A;  1UOT P;  4YNX A;  4B2S A;  4WJG 2;  1OJV A;  5HYU B;  4MUC A;  3IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...