4ONTD

Ternary host recognition complex of complement factor h, c3d, and sialic acid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
126
structure length
126
Chain Sequence
FGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement factor H
publication title Structural basis for sialic acid-mediated self-recognition by complement factor H.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 126
sequence length 126
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4ontD01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4ontD02
1CKLA 3ZRZA 2YBYA 1C1ZA 4J38B 1OJYA 2XQWC 2W81A 3MQLA 1E5GA 2V8EA 4B2RA 4DJZA 4MUCA 2XRBA 2JRAA 3INBC 4AYEA 1VVCA 2IZ3A 2EHFA 3SW0X 4YNXA 1GKGA 2XRDA 2JGWA 4AYMA 1LY2A 4LOSA 3EJHA 1E88A 1GHQB 2MCYA 2XWJI 4PZ5A 2O39C 1SS2A 1Q3XA 5I0QB 2RL0A 5JPMG 1GPZA 5HYUB 2RLQA 2WIIC 3RJ3D 1HFIA 2KRIA 1H04P 1TPNA 2YRAA 1HFHA 2CG7A 4JHSA 2CG6A 1HCCA 1TPMA 3L89M 5HYPA 2B5ID 3O8EB 3OEDC 2BZMA 3CALA 2MCZA 4ZH1D 1TPGA 1GKNA 1QGBA 2ERJA 3T5OA 1H2PP 3KXVA 3IU3I 1OK1A 2UWNA 4IGDA 2RLPA 1SRZA 1Z92B 1QO6A 1MD8A 1OJWA 1G4GA 2A55A 1U5MA 1OK3A 4KKDA 2KMSA 4LOTA 4F4OC 1FBRA 2EC3A 3GOVA 5HZPB 4CSYA 1MD7A 4FXGG 1VVDA 2LOJA 2W80A 3NFPI 4A5WB 5HYTB 3KZJA 3R62A 1O9AA 1OJVA 1G4FA 2XWBF 2G7IA 3ERBA 3ZD2A 1H2QP 4AYIA 2CKUA 1OK9A 3GXEA 3ZD1A 4K12A 1NWVA 2RKYA 4B2SA 2IZ4A 4AYDA 3TVJA 1QUBA 4WJG2 4C16A 1UOTP 3M7PA 2RKZA 1ZJKA 1E8BA 1PPQA 2QY0A 3OP8A 5FO8C 3OXUD 1H03P 4ONTD 1OK2A 2JGXA 1ELVA 3IX0A
chains in the Genus database with same CATH superfamily
1CKLA 3ZRZA 2YBYA 4APLA 2I2LA 1C1ZA 4J38B 1OJYA 2XQWC 2W81A 3MQLA 1E5GA 2V8EA 3ZLEA 4B2RA 3FGRA 4DJZA 4MUCA 2XRBA 2JRAA 3WSYA 3INBC 3FGTA 4AYEA 1VVCA 2IZ3A 2EHFA 3SW0X 4YNXA 1GKGA 2XRDA 2JGWA 4AYMA 1LY2A 4LOSA 3EJHA 3NJAA 1E88A 3ZLDA 1GHQB 2MCYA 2XWJI 4PZ5A 2O39C 1SS2A 1Q3XA 5I0QB 2RL0A 5JPMG 1GPZA 5HYUB 2RLQA 2WIIC 3RJ3D 1HFIA 2KRIA 1H04P 1TPNA 2X2ZA 2YRAA 1HFHA 2CG7A 4JHSA 2CG6A 1HCCA 1TPMA 3L89M 5HYPA 2B5ID 3F6KA 3O8EB 3OEDC 2BZMA 3CALA 2MCZA 4ZH1D 1TPGA 1GKNA 1QGBA 2ERJA 3T5OA 1H2PP 3KXVA 3IU3I 5DN4A 1OK1A 2UWNA 2Y8RA 4IGDA 3K3TA 2RLPA 1SRZA 1Z92B 1QO6A 1MD8A 1OJWA 3WSXA 4YIZA 1G4GA 2A55A 1U5MA 1OK3A 4KKDA 2KMSA 4LOTA 4BWCA 4F4OC 1FBRA 2EC3A 3GOVA 5HZPB 4CSYA 1MD7A 4FXGG 1VVDA 2LOJA 2W80A 3NFPI 4A5WB 5HYTB 3KZJA 3R62A 1O9AA 2Y8SA 2ZYCA 1OJVA 1G4FA 2XWBF 2G7IA 3ERBA 3ZD2A 1H2QP 4AYIA 4MSLA 2CKUA 1OK9A 3GXEA 3ZD1A 4K12A 1NWVA 2RKYA 2Y8TA 4B2SA 2IZ4A 4AYDA 3TVJA 1QUBA 4WJG2 4C16A 1UOTP 3M7PA 2RKZA 4PO7A 3CI0J 1ZJKA 1E8BA 3VWOA 4N7EA 1PPQA 2QY0A 3OP8A 5FO8C 3OXUD 1RLHA 1H03P 5DN5A 4ONTD 1OK2A 2JGXA 1ELVA 3IX0A
chains in the Genus database with same CATH topology
1CKLA 3ZRZA 2YBYA 1C1ZA 4J38B 1OJYA 2XQWC 2W81A 3MQLA 1E5GA 2V8EA 4B2RA 4DJZA 4MUCA 2XRBA 2JRAA 3INBC 4AYEA 1VVCA 2IZ3A 2EHFA 3SW0X 4YNXA 1GKGA 2XRDA 2JGWA 4AYMA 1LY2A 4LOSA 3EJHA 1E88A 1GHQB 2MCYA 2XWJI 4PZ5A 2O39C 1SS2A 1Q3XA 5I0QB 2RL0A 5JPMG 1GPZA 5HYUB 2RLQA 2WIIC 3RJ3D 1HFIA 2KRIA 1H04P 1TPNA 2YRAA 1HFHA 2CG7A 4JHSA 2CG6A 1HCCA 1TPMA 3L89M 5HYPA 2B5ID 3O8EB 3OEDC 2BZMA 3CALA 2MCZA 4ZH1D 1TPGA 1GKNA 1QGBA 2ERJA 3T5OA 1H2PP 3KXVA 3IU3I 1OK1A 2UWNA 4IGDA 2RLPA 1SRZA 1Z92B 1QO6A 1MD8A 1OJWA 1G4GA 2A55A 1U5MA 1OK3A 4KKDA 2KMSA 4LOTA 4F4OC 1FBRA 2EC3A 3GOVA 5HZPB 4CSYA 1MD7A 4FXGG 1VVDA 2LOJA 2W80A 3NFPI 4A5WB 5HYTB 3KZJA 3R62A 1O9AA 1OJVA 1G4FA 2XWBF 2G7IA 3ERBA 3ZD2A 1H2QP 4AYIA 2CKUA 1OK9A 3GXEA 3ZD1A 4K12A 1NWVA 2RKYA 4B2SA 2IZ4A 4AYDA 3TVJA 1QUBA 4WJG2 4C16A 1UOTP 3M7PA 2RKZA 1ZJKA 1E8BA 1PPQA 2QY0A 3OP8A 5FO8C 3OXUD 1H03P 4ONTD 1OK2A 2JGXA 1ELVA 3IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKL A;  3ZRZ A;  2YBY A;  1C1Z A;  4J38 B;  1OJY A;  2XQW C;  2W81 A;  3MQL A;  1E5G A;  2V8E A;  4B2R A;  4DJZ A;  4MUC A;  2XRB A;  2JRA A;  3INB C;  4AYE A;  1VVC A;  2IZ3 A;  2EHF A;  3SW0 X;  4YNX A;  1GKG A;  2XRD A;  2JGW A;  4AYM A;  1LY2 A;  4LOS A;  3EJH A;  1E88 A;  1GHQ B;  2MCY A;  2XWJ I;  4PZ5 A;  2O39 C;  1SS2 A;  1Q3X A;  5I0Q B;  2RL0 A;  5JPM G;  1GPZ A;  5HYU B;  2RLQ A;  2WII C;  3RJ3 D;  1HFI A;  2KRI A;  1H04 P;  1TPN A;  2YRA A;  1HFH A;  2CG7 A;  4JHS A;  2CG6 A;  1HCC A;  1TPM A;  3L89 M;  5HYP A;  2B5I D;  3O8E B;  3OED C;  2BZM A;  3CAL A;  2MCZ A;  4ZH1 D;  1TPG A;  1GKN A;  1QGB A;  2ERJ A;  3T5O A;  1H2P P;  3KXV A;  3IU3 I;  1OK1 A;  2UWN A;  4IGD A;  2RLP A;  1SRZ A;  1Z92 B;  1QO6 A;  1MD8 A;  1OJW A;  1G4G A;  2A55 A;  1U5M A;  1OK3 A;  4KKD A;  2KMS A;  4LOT A;  4F4O C;  1FBR A;  2EC3 A;  3GOV A;  5HZP B;  4CSY A;  1MD7 A;  4FXG G;  1VVD A;  2LOJ A;  2W80 A;  3NFP I;  4A5W B;  5HYT B;  3KZJ A;  3R62 A;  1O9A A;  1OJV A;  1G4F A;  2XWB F;  2G7I A;  3ERB A;  3ZD2 A;  1H2Q P;  4AYI A;  2CKU A;  1OK9 A;  3GXE A;  3ZD1 A;  4K12 A;  1NWV A;  2RKY A;  4B2S A;  2IZ4 A;  4AYD A;  3TVJ A;  1QUB A;  4WJG 2;  4C16 A;  1UOT P;  3M7P A;  2RKZ A;  1ZJK A;  1E8B A;  1PPQ A;  2QY0 A;  3OP8 A;  5FO8 C;  3OXU D;  1H03 P;  4ONT D;  1OK2 A;  2JGX A;  1ELV A;  3IX0 A; 
#chains in the Genus database with same CATH topology
 1CKL A;  3ZRZ A;  2YBY A;  4APL A;  2I2L A;  1C1Z A;  4J38 B;  1OJY A;  2XQW C;  2W81 A;  3MQL A;  1E5G A;  2V8E A;  3ZLE A;  4B2R A;  3FGR A;  4DJZ A;  4MUC A;  2XRB A;  2JRA A;  3WSY A;  3INB C;  3FGT A;  4AYE A;  1VVC A;  2IZ3 A;  2EHF A;  3SW0 X;  4YNX A;  1GKG A;  2XRD A;  2JGW A;  4AYM A;  1LY2 A;  4LOS A;  3EJH A;  3NJA A;  1E88 A;  3ZLD A;  1GHQ B;  2MCY A;  2XWJ I;  4PZ5 A;  2O39 C;  1SS2 A;  1Q3X A;  5I0Q B;  2RL0 A;  5JPM G;  1GPZ A;  5HYU B;  2RLQ A;  2WII C;  3RJ3 D;  1HFI A;  2KRI A;  1H04 P;  1TPN A;  2X2Z A;  2YRA A;  1HFH A;  2CG7 A;  4JHS A;  2CG6 A;  1HCC A;  1TPM A;  3L89 M;  5HYP A;  2B5I D;  3F6K A;  3O8E B;  3OED C;  2BZM A;  3CAL A;  2MCZ A;  4ZH1 D;  1TPG A;  1GKN A;  1QGB A;  2ERJ A;  3T5O A;  1H2P P;  3KXV A;  3IU3 I;  5DN4 A;  1OK1 A;  2UWN A;  2Y8R A;  4IGD A;  3K3T A;  2RLP A;  1SRZ A;  1Z92 B;  1QO6 A;  1MD8 A;  1OJW A;  3WSX A;  4YIZ A;  1G4G A;  2A55 A;  1U5M A;  1OK3 A;  4KKD A;  2KMS A;  4LOT A;  4BWC A;  4F4O C;  1FBR A;  2EC3 A;  3GOV A;  5HZP B;  4CSY A;  1MD7 A;  4FXG G;  1VVD A;  2LOJ A;  2W80 A;  3NFP I;  4A5W B;  5HYT B;  3KZJ A;  3R62 A;  1O9A A;  2Y8S A;  2ZYC A;  1OJV A;  1G4F A;  2XWB F;  2G7I A;  3ERB A;  3ZD2 A;  1H2Q P;  4AYI A;  4MSL A;  2CKU A;  1OK9 A;  3GXE A;  3ZD1 A;  4K12 A;  1NWV A;  2RKY A;  2Y8T A;  4B2S A;  2IZ4 A;  4AYD A;  3TVJ A;  1QUB A;  4WJG 2;  4C16 A;  1UOT P;  3M7P A;  2RKZ A;  4PO7 A;  3CI0 J;  1ZJK A;  1E8B A;  3VWO A;  4N7E A;  1PPQ A;  2QY0 A;  3OP8 A;  5FO8 C;  3OXU D;  1RLH A;  1H03 P;  5DN5 A;  4ONT D;  1OK2 A;  2JGX A;  1ELV A;  3IX0 A; 
#chains in the Genus database with same CATH homology
 1CKL A;  3ZRZ A;  2YBY A;  1C1Z A;  4J38 B;  1OJY A;  2XQW C;  2W81 A;  3MQL A;  1E5G A;  2V8E A;  4B2R A;  4DJZ A;  4MUC A;  2XRB A;  2JRA A;  3INB C;  4AYE A;  1VVC A;  2IZ3 A;  2EHF A;  3SW0 X;  4YNX A;  1GKG A;  2XRD A;  2JGW A;  4AYM A;  1LY2 A;  4LOS A;  3EJH A;  1E88 A;  1GHQ B;  2MCY A;  2XWJ I;  4PZ5 A;  2O39 C;  1SS2 A;  1Q3X A;  5I0Q B;  2RL0 A;  5JPM G;  1GPZ A;  5HYU B;  2RLQ A;  2WII C;  3RJ3 D;  1HFI A;  2KRI A;  1H04 P;  1TPN A;  2YRA A;  1HFH A;  2CG7 A;  4JHS A;  2CG6 A;  1HCC A;  1TPM A;  3L89 M;  5HYP A;  2B5I D;  3O8E B;  3OED C;  2BZM A;  3CAL A;  2MCZ A;  4ZH1 D;  1TPG A;  1GKN A;  1QGB A;  2ERJ A;  3T5O A;  1H2P P;  3KXV A;  3IU3 I;  1OK1 A;  2UWN A;  4IGD A;  2RLP A;  1SRZ A;  1Z92 B;  1QO6 A;  1MD8 A;  1OJW A;  1G4G A;  2A55 A;  1U5M A;  1OK3 A;  4KKD A;  2KMS A;  4LOT A;  4F4O C;  1FBR A;  2EC3 A;  3GOV A;  5HZP B;  4CSY A;  1MD7 A;  4FXG G;  1VVD A;  2LOJ A;  2W80 A;  3NFP I;  4A5W B;  5HYT B;  3KZJ A;  3R62 A;  1O9A A;  1OJV A;  1G4F A;  2XWB F;  2G7I A;  3ERB A;  3ZD2 A;  1H2Q P;  4AYI A;  2CKU A;  1OK9 A;  3GXE A;  3ZD1 A;  4K12 A;  1NWV A;  2RKY A;  4B2S A;  2IZ4 A;  4AYD A;  3TVJ A;  1QUB A;  4WJG 2;  4C16 A;  1UOT P;  3M7P A;  2RKZ A;  1ZJK A;  1E8B A;  1PPQ A;  2QY0 A;  3OP8 A;  5FO8 C;  3OXU D;  1H03 P;  4ONT D;  1OK2 A;  2JGX A;  1ELV A;  3IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...