4OO1F

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
207
Chain Sequence
b'DRRRLLGPAAAKPMAFEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 53
structure length 207
sequence length 244
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1F00
5K36E 4IFDA 5JEAA 2NN6D 5K36B 1R6LA 1UDOA 5JEAC 2WNRA 3M7ND 5K36A 3M85D 2JEAB 5C0XD 1E3HA 3DD6A 2PO1B 1OYSA 5JEAE 2JEAA 1UDQA 4IFDF 5JEAF 4OO1D 2PO2B 4AIMA 2PO1A 2NN6C 2WP8A 2PNZB 3GLLA 1R6MA 5K36F 2BR2B 2PO2A 3L7ZB 2BA0D 3U1KA 2BA1D 5C0XC 3L7ZA 3M7NG 2NN6B 3GMEA 3M85G 1OYRA 4OO1C 2PO0B 4BA2B 4BA1B 2NN6A 3CDIA 5C0XB 2PO0A 4BA2A 4BA1A 2C39B 1UDNA 4IFDD 2JEBB 3H1CA 5C0XA 4OO1B 2PNZA 2C38B 2BR2A 2BA0G 4NBQA 5K36D 1UDSA 2NN6E 2BA1G 2NN6F 4OO1A 2C37B 3CDJA 2WNRB 3HKMA 2C37A 5C0XE 5C0XF 4IFDC 3GCMA 5JEAD 4OO1E 4AM3A 4OO1F 2JE6B 5K36C 1E3PA 2C39A 2JEBA 2WP8B 3B4TA 4IFDE 4IFDB 5JEAB 2JE6A 4AIDA 3KRNA 2C38A 1OYPA
chains in the Genus database with same CATH superfamily
2Q2EB 5JEAA 5K36B 4DU8A 3HJCA 2UU9E 4LFCE 4LF5E 4YHHE 4DR7E 3PYEA 4JI5I 2WNRA 2O1UA 2ZM6E 3M85D 4RPFA 4AQYI 2JEAB 3QT8A 4IZKB 1E3HA 2PNMA 4DV3E 1VI7A 4B3RE 2E1RA 4FWGA 1PVGA 3P3EA 3B8HA 5JEAE 1N36E 4IFDF 4MU1A 5A2QQ 4OZEA 2OI2A 4LCHA 3J80C 4Z7CA 1XXEA 4LF8E 3P76A 4J3DA 2PNZB 5IT9Q 5DRQA 4MQYA 4K0KI 5K36F 4X66E 1Z0TA 3ZZUA 3U1KA 4X65E 1Z0BA 4DPYA 1H72C 2VESA 4HACA 1Z59A 2UXCE 4NXMI 4DV7I 4JYAI 2Z5EA 1FJGI 4DR3I 1USUA 2AE8A 2NN6A 4GKKI 3PYFA 2IOPA 2DEIA 1WUUA 5FLXC 5C0XB 4JI8E 1N0VC 1EI1A 2HHHE 4LFAI 4BA1A 4DV2E 4IFDD 4LF4I 4DV6E 3H1CA 4MU4A 4OO1B 2PNLA 2PNZA 2UXDI 1XNRI 5K36D 1UDSA 2NN6E 4JI0E 1Z5CA 2BV3A 1I94E 4DPWA 1XMOE 2NPFA 1MU5A 4DR5E 4KHPE 1OJ4A 1HNWE 2C37A 4JI7I 5C0XF 4IFDC 2HFSA 3Q6MA 5EKWA 5BR8E 3T1YI 4DR1I 4MYTA 4AM3A 1D6TA 4OO1F 3ZKBA 5LMNI 5IWAE 1N32I 4P52A 4URLA 4JV5E 4JI4E 5K36C 4ZVIA 2UUBI 2WP8B 4IS9A 5JEAB 2JE6A 4AIDA 1XMQI 1S4EA 5A2QC 4DV4I 2IESA 2CGEA 4Z7YA 1UDOA 4LF6E 2UXBE 1FKAE 1J5EI 2O3ZA 3K17A 3PS3A 1IBLI 4LF9E 4FW4A 4NXNE 2F4VI 2LJPA 1ZM4A 5C0XD 2UUAE 4OX9E 4LFBI 1K47A 3ZZ0A 4LPFA 1HR0E 1OYSA 3LPSA 1S16A 4X62E 2GO4A 1UDQA 3P3CA 2GQ0A 5JEAF 2E5LE 4OO1D 1N0UA 1N33I 3OTOI 3QT6A 4X64I 4AIMA 2WP8A 5LMUE 4HACB 1R6MA 2VF3A 2BR2B 4P7AA 4ED4A 4JI3I 1ZXNA 1FNMA 4WUBA 3UHMA 1UEKA 5C0XC 1Z0GA 3M7NG 4B3TI 1B63A 1NZ0A 1MX0A 2NN6B 2V8PA 1HNZE 1Z5AA 1OYRA 4OO1C 4BA1B 1NHIA 1XHKA 2CG9A 4DR6E 4K0KE 1Y6ZA 2PO0A 2BM0A 3PYGA 1HNXE 1IBMI 4LFCI 2UU9I 3WU4A 4LF5I 2JEBB 4YHHI 4DR7I 4U3DA 3P06A 1FWLA 4JI2E 4NXME 4KQVA 4DV7E 4DUZE 3WU6A 2ZM6I 4JYAE 1IBKI 2C38B 2BR2A 4DV1E 4NBQA 3M6AA 1P42A 2BA1G 2A2DA 2NN6F 4DV3I 4DR2I 3Q1QA 4LF7E 2C37B 4B3RI 4USMA 4GKKE 1RR9A 4DV5E 1N36I 4XTJA 4DPTA 4LFAE 2HK2A 4UTGA 4LF8I 2R42A 5DRRA 4FW3A 1VISA 4X66I 3CWVA 3K1JA 4B3SE 3NZKA 5DROA 1ZM3A 3ZM7A 1H7SA 4ISAA 4X65I 2JE6B 3PS2A 1DARA 5L3JA 2V34A 2UXCI 1E3PA 2VQEE 2HKJA 5GMEA 2JEBA 4OKGA 3U1YA 2WW4A 1FWKA 4IFDE 2GS8A 3B78A 1EA6A 4IZJB 2CZ9A 4DUYE 2C38A 1N34E 4DR4E 3JAMQ 4JI1E 3WU3A 5K36E 4LCFA 2NN6D 2EFGA 4DV0E 2HHHI 3D4JA 4FW5A 2HK3A 1Z5BA 4DV2I 4GKJE 3M7ND 4DV6I 3T1HE 2ZITA 4FWDA 2Z5CB 3P3GA 4YY3E 3DD6A 4R1FA 4JI6E 1XMQE 4JI0I 1KTVA 4B3ME 2V2QA 3ZKDA 1I94I 2PO1A 1H73A 1XMOI 2NN6C 1PIEA 1Y60A 2X7IA 4DR5I 4GQUA 4KHPI 4IZJA 4MDTA 1HNWI 3PRYA 2PO2A 1Y5YA 2VQFE 4FN5A 1Z0CA 5BR8I 2BA1D 5DRPA 4WUCA 2HKEA 1HK7A 3L7ZA 3QT7A 4JV5I 3GMEA 4JI4I 4DU7A 3J7AM 2J7KA 2HFUA 2UUCE 2PO0B 2Z5CA 4MYUA 1ZM2A 3CDIA 2DEJA 5ELWA 2Z5BA 4U3BA 4BA2A 1XNQI 4JI5E 5GMDA 1FI4A 1RHYA 4AQYE 4LF6I 1H74A 4NXNI 4LOMA 2BA0G 3H4LA 2UUAI 4OX9I 1RREA 4USKA 1B62A 2IOQA 3CDJA 1HR0I 4X62I 3PYDA 4FWHA 2AJ4A 2E5LI 1A6FA 1Z0VA 3HKMA 3JAMC 1IBME 3HULA 5LMUI 2BM1A 5DNLA 5DNXA 3GCMA 2O1WA 5JEAD 3J7AG 1IBKE 3ZZTA 4PRVA 5FWKA 3J81Q 4DR2E 2O1VA 1KKHA 3V2UC 3B4TA 2IERA 3QT5A 1FJGE 4DR3E 1HNZI 4LCGA 4FW9A 4M1KA 3K85A 1OYPA 4DR6I 2V2VA 3B82A 4IFDA 4DPUA 4N3OA 1Y4SA 2A2CA 2XEXA 4LF4E 1R6LA 5JEAC 1HNXI 3LNUA 5EL9A 1U2RA 2UXDE 1BKNA 5K36A 4JI2I 1XNRE 4QNJA 1KIJA 4DUZI 3GONA 3Q6NA 4DV1I 2PO1B 4LF7I 2JEAA 4HYMA 4IZKA 2PO2B 1MG7A 4DV5I 4JI7E 4PU9A 5LL6R 4EMDA 3GLLA 3T1YE 4QNKA 3LTOA 4JI8I 4DR1E 3L7ZB 2BA0D 5LMNE 1N32E 4B3SI 2UUBE 4MU0A 1NHHA 3V5RA 3M85G 2VQEI 1NHJA 1QZRA 3F0NA 1Z0WA 2Z5BB 1H7UA 4BA2B 3J80Q 3PS1A 4DUYI 4DV4E 1Z0EA 1N34I 4DR4I 1YH8A 4JI1I 4DPXA 2C39B 1UDNA 1J5EE 1IBLE 2F4VE 4DV0I 5C0XA 4UT4A 4GKJI 4PRXA 4FW6A 4LFBE 1USVA 3T1HI 3J81C 1PKPA 4HY1A 4YY3I 1KVKA 4I3HA 5IWAI 4OO1A 4JI6I 1N33E 2ZBKB 1ZM9A 3OTOE 4X64E 2V2ZA 4B3MI 2WNRB 4HXZA 5FLXQ 4MU3A 5C0XE 1XNQE 5IT9C 1YHCA 4JI3E 1ZXMA 2J65A 2O1TA 2F1DA 4IZJD 3WU5A 2VQFI 2CVEA 2GO3A 4OO1E 1Y4UA 2X36A 2R3VA 2JT2A 2UXBI 4LF9I 4B3TE 1ELOA 2C39A 4FW7A 4IFDB 4DXLA 3KRNA 2UUCI 4WUDA 4JG4A
chains in the Genus database with same CATH topology
5K36E 4IFDA 5JEAA 2NN6D 5K36B 1R6LA 1UDOA 5JEAC 2WNRA 3M7ND 5K36A 3M85D 2JEAB 5C0XD 1E3HA 3DD6A 2PO1B 1OYSA 5JEAE 2JEAA 1UDQA 4IFDF 5JEAF 4OO1D 2PO2B 4AIMA 2PO1A 2NN6C 2WP8A 2PNZB 3GLLA 1R6MA 5K36F 2BR2B 2PO2A 3L7ZB 2BA0D 3U1KA 2BA1D 5C0XC 3L7ZA 3M7NG 2NN6B 3GMEA 3M85G 1OYRA 4OO1C 2PO0B 4BA2B 4BA1B 2NN6A 3CDIA 5C0XB 2PO0A 4BA2A 4BA1A 2C39B 1UDNA 4IFDD 2JEBB 3H1CA 5C0XA 4OO1B 2PNZA 2C38B 2BR2A 2BA0G 4NBQA 5K36D 1UDSA 2NN6E 2BA1G 2NN6F 4OO1A 2C37B 3CDJA 2WNRB 3HKMA 2C37A 5C0XE 5C0XF 4IFDC 3GCMA 5JEAD 4OO1E 4AM3A 4OO1F 2JE6B 5K36C 1E3PA 2C39A 2JEBA 2WP8B 3B4TA 4IFDE 4IFDB 5JEAB 2JE6A 4AIDA 3KRNA 2C38A 1OYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 E;  4IFD A;  5JEA A;  2NN6 D;  5K36 B;  1R6L A;  1UDO A;  5JEA C;  2WNR A;  3M7N D;  5K36 A;  3M85 D;  2JEA B;  5C0X D;  1E3H A;  3DD6 A;  2PO1 B;  1OYS A;  5JEA E;  2JEA A;  1UDQ A;  4IFD F;  5JEA F;  4OO1 D;  2PO2 B;  4AIM A;  2PO1 A;  2NN6 C;  2WP8 A;  2PNZ B;  3GLL A;  1R6M A;  5K36 F;  2BR2 B;  2PO2 A;  3L7Z B;  2BA0 D;  3U1K A;  2BA1 D;  5C0X C;  3L7Z A;  3M7N G;  2NN6 B;  3GME A;  3M85 G;  1OYR A;  4OO1 C;  2PO0 B;  4BA2 B;  4BA1 B;  2NN6 A;  3CDI A;  5C0X B;  2PO0 A;  4BA2 A;  4BA1 A;  2C39 B;  1UDN A;  4IFD D;  2JEB B;  3H1C A;  5C0X A;  4OO1 B;  2PNZ A;  2C38 B;  2BR2 A;  2BA0 G;  4NBQ A;  5K36 D;  1UDS A;  2NN6 E;  2BA1 G;  2NN6 F;  4OO1 A;  2C37 B;  3CDJ A;  2WNR B;  3HKM A;  2C37 A;  5C0X E;  5C0X F;  4IFD C;  3GCM A;  5JEA D;  4OO1 E;  4AM3 A;  4OO1 F;  2JE6 B;  5K36 C;  1E3P A;  2C39 A;  2JEB A;  2WP8 B;  3B4T A;  4IFD E;  4IFD B;  5JEA B;  2JE6 A;  4AID A;  3KRN A;  2C38 A;  1OYP A; 
#chains in the Genus database with same CATH topology
 2Q2E B;  5JEA A;  5K36 B;  4DU8 A;  3HJC A;  2UU9 E;  4LFC E;  4LF5 E;  4YHH E;  4DR7 E;  3PYE A;  4JI5 I;  2WNR A;  2O1U A;  2ZM6 E;  3M85 D;  4RPF A;  4AQY I;  2JEA B;  3QT8 A;  4IZK B;  1E3H A;  2PNM A;  4DV3 E;  1VI7 A;  4B3R E;  2E1R A;  4FWG A;  1PVG A;  3P3E A;  3B8H A;  5JEA E;  1N36 E;  4IFD F;  4MU1 A;  5A2Q Q;  4OZE A;  2OI2 A;  4LCH A;  3J80 C;  4Z7C A;  1XXE A;  4LF8 E;  3P76 A;  4J3D A;  2PNZ B;  5IT9 Q;  5DRQ A;  4MQY A;  4K0K I;  5K36 F;  4X66 E;  1Z0T A;  3ZZU A;  3U1K A;  4X65 E;  1Z0B A;  4DPY A;  1H72 C;  2VES A;  4HAC A;  1Z59 A;  2UXC E;  4NXM I;  4DV7 I;  4JYA I;  2Z5E A;  1FJG I;  4DR3 I;  1USU A;  2AE8 A;  2NN6 A;  4GKK I;  3PYF A;  2IOP A;  2DEI A;  1WUU A;  5FLX C;  5C0X B;  4JI8 E;  1N0V C;  1EI1 A;  2HHH E;  4LFA I;  4BA1 A;  4DV2 E;  4IFD D;  4LF4 I;  4DV6 E;  3H1C A;  4MU4 A;  4OO1 B;  2PNL A;  2PNZ A;  2UXD I;  1XNR I;  5K36 D;  1UDS A;  2NN6 E;  4JI0 E;  1Z5C A;  2BV3 A;  1I94 E;  4DPW A;  1XMO E;  2NPF A;  1MU5 A;  4DR5 E;  4KHP E;  1OJ4 A;  1HNW E;  2C37 A;  4JI7 I;  5C0X F;  4IFD C;  2HFS A;  3Q6M A;  5EKW A;  5BR8 E;  3T1Y I;  4DR1 I;  4MYT A;  4AM3 A;  1D6T A;  4OO1 F;  3ZKB A;  5LMN I;  5IWA E;  1N32 I;  4P52 A;  4URL A;  4JV5 E;  4JI4 E;  5K36 C;  4ZVI A;  2UUB I;  2WP8 B;  4IS9 A;  5JEA B;  2JE6 A;  4AID A;  1XMQ I;  1S4E A;  5A2Q C;  4DV4 I;  2IES A;  2CGE A;  4Z7Y A;  1UDO A;  4LF6 E;  2UXB E;  1FKA E;  1J5E I;  2O3Z A;  3K17 A;  3PS3 A;  1IBL I;  4LF9 E;  4FW4 A;  4NXN E;  2F4V I;  2LJP A;  1ZM4 A;  5C0X D;  2UUA E;  4OX9 E;  4LFB I;  1K47 A;  3ZZ0 A;  4LPF A;  1HR0 E;  1OYS A;  3LPS A;  1S16 A;  4X62 E;  2GO4 A;  1UDQ A;  3P3C A;  2GQ0 A;  5JEA F;  2E5L E;  4OO1 D;  1N0U A;  1N33 I;  3OTO I;  3QT6 A;  4X64 I;  4AIM A;  2WP8 A;  5LMU E;  4HAC B;  1R6M A;  2VF3 A;  2BR2 B;  4P7A A;  4ED4 A;  4JI3 I;  1ZXN A;  1FNM A;  4WUB A;  3UHM A;  1UEK A;  5C0X C;  1Z0G A;  3M7N G;  4B3T I;  1B63 A;  1NZ0 A;  1MX0 A;  2NN6 B;  2V8P A;  1HNZ E;  1Z5A A;  1OYR A;  4OO1 C;  4BA1 B;  1NHI A;  1XHK A;  2CG9 A;  4DR6 E;  4K0K E;  1Y6Z A;  2PO0 A;  2BM0 A;  3PYG A;  1HNX E;  1IBM I;  4LFC I;  2UU9 I;  3WU4 A;  4LF5 I;  2JEB B;  4YHH I;  4DR7 I;  4U3D A;  3P06 A;  1FWL A;  4JI2 E;  4NXM E;  4KQV A;  4DV7 E;  4DUZ E;  3WU6 A;  2ZM6 I;  4JYA E;  1IBK I;  2C38 B;  2BR2 A;  4DV1 E;  4NBQ A;  3M6A A;  1P42 A;  2BA1 G;  2A2D A;  2NN6 F;  4DV3 I;  4DR2 I;  3Q1Q A;  4LF7 E;  2C37 B;  4B3R I;  4USM A;  4GKK E;  1RR9 A;  4DV5 E;  1N36 I;  4XTJ A;  4DPT A;  4LFA E;  2HK2 A;  4UTG A;  4LF8 I;  2R42 A;  5DRR A;  4FW3 A;  1VIS A;  4X66 I;  3CWV A;  3K1J A;  4B3S E;  3NZK A;  5DRO A;  1ZM3 A;  3ZM7 A;  1H7S A;  4ISA A;  4X65 I;  2JE6 B;  3PS2 A;  1DAR A;  5L3J A;  2V34 A;  2UXC I;  1E3P A;  2VQE E;  2HKJ A;  5GME A;  2JEB A;  4OKG A;  3U1Y A;  2WW4 A;  1FWK A;  4IFD E;  2GS8 A;  3B78 A;  1EA6 A;  4IZJ B;  2CZ9 A;  4DUY E;  2C38 A;  1N34 E;  4DR4 E;  3JAM Q;  4JI1 E;  3WU3 A;  5K36 E;  4LCF A;  2NN6 D;  2EFG A;  4DV0 E;  2HHH I;  3D4J A;  4FW5 A;  2HK3 A;  1Z5B A;  4DV2 I;  4GKJ E;  3M7N D;  4DV6 I;  3T1H E;  2ZIT A;  4FWD A;  2Z5C B;  3P3G A;  4YY3 E;  3DD6 A;  4R1F A;  4JI6 E;  1XMQ E;  4JI0 I;  1KTV A;  4B3M E;  2V2Q A;  3ZKD A;  1I94 I;  2PO1 A;  1H73 A;  1XMO I;  2NN6 C;  1PIE A;  1Y60 A;  2X7I A;  4DR5 I;  4GQU A;  4KHP I;  4IZJ A;  4MDT A;  1HNW I;  3PRY A;  2PO2 A;  1Y5Y A;  2VQF E;  4FN5 A;  1Z0C A;  5BR8 I;  2BA1 D;  5DRP A;  4WUC A;  2HKE A;  1HK7 A;  3L7Z A;  3QT7 A;  4JV5 I;  3GME A;  4JI4 I;  4DU7 A;  3J7A M;  2J7K A;  2HFU A;  2UUC E;  2PO0 B;  2Z5C A;  4MYU A;  1ZM2 A;  3CDI A;  2DEJ A;  5ELW A;  2Z5B A;  4U3B A;  4BA2 A;  1XNQ I;  4JI5 E;  5GMD A;  1FI4 A;  1RHY A;  4AQY E;  4LF6 I;  1H74 A;  4NXN I;  4LOM A;  2BA0 G;  3H4L A;  2UUA I;  4OX9 I;  1RRE A;  4USK A;  1B62 A;  2IOQ A;  3CDJ A;  1HR0 I;  4X62 I;  3PYD A;  4FWH A;  2AJ4 A;  2E5L I;  1A6F A;  1Z0V A;  3HKM A;  3JAM C;  1IBM E;  3HUL A;  5LMU I;  2BM1 A;  5DNL A;  5DNX A;  3GCM A;  2O1W A;  5JEA D;  3J7A G;  1IBK E;  3ZZT A;  4PRV A;  5FWK A;  3J81 Q;  4DR2 E;  2O1V A;  1KKH A;  3V2U C;  3B4T A;  2IER A;  3QT5 A;  1FJG E;  4DR3 E;  1HNZ I;  4LCG A;  4FW9 A;  4M1K A;  3K85 A;  1OYP A;  4DR6 I;  2V2V A;  3B82 A;  4IFD A;  4DPU A;  4N3O A;  1Y4S A;  2A2C A;  2XEX A;  4LF4 E;  1R6L A;  5JEA C;  1HNX I;  3LNU A;  5EL9 A;  1U2R A;  2UXD E;  1BKN A;  5K36 A;  4JI2 I;  1XNR E;  4QNJ A;  1KIJ A;  4DUZ I;  3GON A;  3Q6N A;  4DV1 I;  2PO1 B;  4LF7 I;  2JEA A;  4HYM A;  4IZK A;  2PO2 B;  1MG7 A;  4DV5 I;  4JI7 E;  4PU9 A;  5LL6 R;  4EMD A;  3GLL A;  3T1Y E;  4QNK A;  3LTO A;  4JI8 I;  4DR1 E;  3L7Z B;  2BA0 D;  5LMN E;  1N32 E;  4B3S I;  2UUB E;  4MU0 A;  1NHH A;  3V5R A;  3M85 G;  2VQE I;  1NHJ A;  1QZR A;  3F0N A;  1Z0W A;  2Z5B B;  1H7U A;  4BA2 B;  3J80 Q;  3PS1 A;  4DUY I;  4DV4 E;  1Z0E A;  1N34 I;  4DR4 I;  1YH8 A;  4JI1 I;  4DPX A;  2C39 B;  1UDN A;  1J5E E;  1IBL E;  2F4V E;  4DV0 I;  5C0X A;  4UT4 A;  4GKJ I;  4PRX A;  4FW6 A;  4LFB E;  1USV A;  3T1H I;  3J81 C;  1PKP A;  4HY1 A;  4YY3 I;  1KVK A;  4I3H A;  5IWA I;  4OO1 A;  4JI6 I;  1N33 E;  2ZBK B;  1ZM9 A;  3OTO E;  4X64 E;  2V2Z A;  4B3M I;  2WNR B;  4HXZ A;  5FLX Q;  4MU3 A;  5C0X E;  1XNQ E;  5IT9 C;  1YHC A;  4JI3 E;  1ZXM A;  2J65 A;  2O1T A;  2F1D A;  4IZJ D;  3WU5 A;  2VQF I;  2CVE A;  2GO3 A;  4OO1 E;  1Y4U A;  2X36 A;  2R3V A;  2JT2 A;  2UXB I;  4LF9 I;  4B3T E;  1ELO A;  2C39 A;  4FW7 A;  4IFD B;  4DXL A;  3KRN A;  2UUC I;  4WUD A;  4JG4 A; 
#chains in the Genus database with same CATH homology
 5K36 E;  4IFD A;  5JEA A;  2NN6 D;  5K36 B;  1R6L A;  1UDO A;  5JEA C;  2WNR A;  3M7N D;  5K36 A;  3M85 D;  2JEA B;  5C0X D;  1E3H A;  3DD6 A;  2PO1 B;  1OYS A;  5JEA E;  2JEA A;  1UDQ A;  4IFD F;  5JEA F;  4OO1 D;  2PO2 B;  4AIM A;  2PO1 A;  2NN6 C;  2WP8 A;  2PNZ B;  3GLL A;  1R6M A;  5K36 F;  2BR2 B;  2PO2 A;  3L7Z B;  2BA0 D;  3U1K A;  2BA1 D;  5C0X C;  3L7Z A;  3M7N G;  2NN6 B;  3GME A;  3M85 G;  1OYR A;  4OO1 C;  2PO0 B;  4BA2 B;  4BA1 B;  2NN6 A;  3CDI A;  5C0X B;  2PO0 A;  4BA2 A;  4BA1 A;  2C39 B;  1UDN A;  4IFD D;  2JEB B;  3H1C A;  5C0X A;  4OO1 B;  2PNZ A;  2C38 B;  2BR2 A;  2BA0 G;  4NBQ A;  5K36 D;  1UDS A;  2NN6 E;  2BA1 G;  2NN6 F;  4OO1 A;  2C37 B;  3CDJ A;  2WNR B;  3HKM A;  2C37 A;  5C0X E;  5C0X F;  4IFD C;  3GCM A;  5JEA D;  4OO1 E;  4AM3 A;  4OO1 F;  2JE6 B;  5K36 C;  1E3P A;  2C39 A;  2JEB A;  2WP8 B;  3B4T A;  4IFD E;  4IFD B;  5JEA B;  2JE6 A;  4AID A;  3KRN A;  2C38 A;  1OYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...