4OO1F

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
207
Chain Sequence
DRRRLLGPAAAKPMAFEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 53
structure length 207
sequence length 244
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1F00
3CDJA 2C37B 4BA2A 2C39A 4IFDC 1UDOA 2JE6B 4IFDE 4IFDB 2PO2A 5C0XA 2PO0A 4IFDF 2NN6E 2JEBA 5JEAA 4BA2B 2C39B 5C0XC 1E3PA 2C38A 1E3HA 2PO2B 5C0XB 2PO0B 3M7ND 5C0XF 5JEAC 5JEAE 2JEBB 5JEAB 1UDNA 4AIDA 2PO1A 2NN6A 2C38B 2JEAA 3M7NG 5K36D 4OO1A 5JEAF 3H1CA 1R6LA 3B4TA 2BA0D 2NN6C 2PO1B 2NN6B 4OO1C 4OO1E 2JEAB 4AM3A 2PNZA 2BR2A 3U1KA 4OO1B 4BA1A 2BA0G 2NN6F 1UDSA 4OO1F 3GCMA 5K36E 2WNRA 2PNZB 2BR2B 4IFDD 4BA1B 2BA1D 2BA1G 2WNRB 1OYSA 2WP8A 3L7ZA 5C0XD 5K36A 4AIMA 3KRNA 3GLLA 1OYRA 5JEAD 5K36C 2WP8B 3L7ZB 4NBQA 5K36B 3HKMA 3M85D 1OYPA 1R6MA 5K36F 3DD6A 3M85G 2NN6D 2C37A 5C0XE 2JE6A 1UDQA 4IFDA 3CDIA 4OO1D 3GMEA
chains in the Genus database with same CATH superfamily
3CDJA 3ZM7A 2VQEI 4DUZE 1HNZE 2HKJA 5LMNE 2E5LI 4IFDC 1UDOA 4IFDE 4ED4A 3LPSA 4R1FA 4DV7E 2Z5EA 4JV5E 2PO0A 5DRQA 3PYDA 4OX9I 2F4VI 2V34A 1XHKA 2DEIA 4IFDF 4HYMA 3GONA 2UUAI 2NN6E 4FW4A 5IT9C 4BA2B 4LF5I 1MG7A 4FWDA 5C0XC 4QNJA 2PNMA 4UT4A 1HNZI 4OKGA 5LMNI 1N33E 1RREA 3T1HE 2ZITA 5C0XF 3OTOE 4DPYA 5JEAB 1UDNA 4DPXA 4IZKB 2C38B 4LCFA 1FWKA 3M7NG 4OO1A 1IBME 2AE8A 4DUYE 2ZBKB 3M6AA 1A6FA 5BR8E 1H73A 4FWHA 1Z0CA 4PRVA 2NN6B 2Q2EB 4DU8A 5LMUE 1IBLI 3U1YA 3K17A 5EKWA 4BA1A 2O3ZA 4ISAA 1NHHA 2HHHE 2UU9E 4FW3A 5FLXC 4DV2I 4DUYI 4LF6E 4DR3E 5BR8I 2BR2B 4LCGA 3LNUA 5LMUI 2CG9A 2O1TA 4K0KE 5LL6R 4DV5E 1HK7A 4MU1A 4X62I 4LFCE 2UU9I 1PVGA 4USKA 2WP8A 4LFBE 4JI1E 4AQYE 4LF6I 5K36A 3P3EA 3PYEA 1FNMA 2CGEA 4GQUA 4B3ME 2UXDI 1N32E 4MDTA 4LF4I 4GKKE 1XNQE 2J7KA 4FW9A 3J81Q 3WU5A 4LPFA 2Z5CB 1Z5CA 1MU5A 1Z0GA 2X36A 3HULA 3JAMQ 1XXEA 4PRXA 4B3MI 1PKPA 2HK3A 2JE6A 1UDQA 1K47A 4OO1D 3B78A 2UXCI 4JI7E 2Z5CA 1D6TA 4JI5I 4DR1E 2C39A 2UXBI 1KKHA 4ZVIA 4B3RI 1KIJA 4DU7A 5IWAI 1ZXNA 4B3TI 2E5LE 1RR9A 2JEBA 4FW7A 4DR5I 1E3PA 2F4VE 4OX9E 4YY3I 4Z7YA 2PO0B 2HKEA 3J80C 4DR1I 5DROA 1USUA 5JEAC 4LF5E 1H7UA 1Z0EA 5JEAE 4N3OA 2LJPA 1FJGI 3CWVA 5K36D 5JEAF 2OI2A 1R6LA 4DV1I 3B8HA 2J65A 3Q1QA 4DPTA 4NXMI 2NN6C 4IZJA 1H72C 5A2QQ 2A2DA 1Z59A 1XMQI 4OO1B 2GO3A 2NN6F 1OJ4A 1XMOI 4X65E 3P06A 5GMEA 4UTGA 1IBLE 3ZZUA 5K36E 2WNRA 4DR2I 4KQVA 1KTVA 4BA1B 1BKNA 4FW5A 4J3DA 4DV2E 2VESA 5DRRA 4U3BA 4DR6E 4LFAE 3PYGA 4X65I 3L7ZA 4X64I 3K85A 4DV4E 1J5EI 2NPFA 4PU9A 1OYRA 4MYUA 4X62E 4DXLA 4WUDA 3QT5A 2V2QA 4JI0E 1ELOA 2WP8B 4NBQA 5K36B 3HKMA 4DR6I 4LFAI 3M85D 2UXDE 1B63A 4OZEA 4B3SE 4DV4I 1ZM4A 4LF4E 4WUBA 5IT9Q 2C37A 4JG4A 3V2UC 3J7AM 3ZKBA 5ELWA 1IBKI 4IFDA 3GMEA 2CZ9A 4JI0I 4DV0E 2GS8A 4HACA 2GQ0A 3QT7A 4IZJD 1H7SA 1N36I 2ZM6E 1S4EA 4B3SI 2UXCE 2JE6B 3PS1A 2PO2A 1Z0BA 5C0XA 1WUUA 4LF8I 3ZZTA 3B82A 3P3GA 4JI5E 2DEJA 3P76A 2UXBE 3HJCA 4FW6A 4DV0I 4DV3E 4B3RE 2C39B 5IWAE 4B3TE 1HR0I 2X7IA 2ZM6I 3QT8A 2Z5BB 2F1DA 4LF9I 2O1UA 4DR5E 2JEBB 5FLXQ 4JI4E 1Z5AA 4YY3E 1ZM9A 4AIDA 1HNXI 4DV6I 4JI3E 1Z0TA 2PO1A 4DPWA 1KVKA 2JEAA 2IOPA 4DV3I 4XTJA 3H1CA 2BM0A 2UUBI 3T1YE 1FJGE 3B4TA 2BA0D 2Z5BA 2A2CA 2V2VA 4OO1C 3WU4A 4FWGA 4OO1E 4JI4I 2PNZA 4DV1E 3U1KA 4JI3I 4NXME 4MU0A 4YHHI 4JI8E 4OO1F 4LCHA 4NXNE 2HFUA 4IZJB 3T1YI 1XMQE 1Y5YA 3ZZ0A 1ZM3A 4JYAI 1EI1A 4IFDD 3K1JA 1NZ0A 4X66E 1XMOE 2O1VA 1MX0A 1ZXMA 4WUCA 3UHMA 2VQFE 2BA1D 4M1KA 3ZKDA 3QT6A 4IS9A 1Y6ZA 4DR2E 4GKJE 4JI8I 4MYTA 2WNRB 1OYSA 4NXNI 4LOMA 2V8PA 5C0XD 1YH8A 2IESA 1VI7A 4X66I 3PS2A 4URLA 3P3CA 4QNKA 2VQFI 1ZM2A 4X64E 4KHPI 1VISA 5L3JA 1J5EE 4LF7E 5K36C 3L7ZB 1N34I 5EL9A 5DNXA 4GKJI 1FKAE 1FI4A 4DR7E 1OYPA 1R6MA 5K36F 1N0UA 1XNRI 3DD6A 1U2RA 3M85G 5C0XE 2IOQA 4DUZI 2R3VA 3CDIA 4DPUA 3J80Q 4DV7I 4LF7I 4FN5A 4JV5I 3PYFA 3F0NA 1IBKE 2R42A 2C37B 4BA2A 4HXZA 4DR7I 1USVA 4IFDB 2JT2A 3J81C 3WU3A 4HY1A 4JI2E 4EMDA 4HACB 1Z5BA 1N33I 1N36E 3T1HI 3JAMC 5JEAA 2HK2A 4I3HA 4IZKA 3OTOI 2C38A 4P52A 4LF8E 3J7AG 1E3HA 2PO2B 5C0XB 2E1RA 4MQYA 3M7ND 1H74A 1PIEA 1UEKA 1IBMI 4JI2I 1Y4UA 1DARA 1Z0VA 2HFSA 3Q6NA 1HR0E 2NN6A 4MU3A 1Y60A 1HNWE 4LF9E 1N0VC 1P42A 3H4LA 3NZKA 4USMA 2V2ZA 1HNXE 4DV6E 3Q6MA 2XEXA 2HHHI 2PO1B 2UUBE 2JEAB 4AM3A 2BR2A 4DR3I 5DNLA 3PRYA 2UUCE 2BA0G 1UDSA 4MU4A 1QZRA 3D4JA 3GCMA 1HNWI 4RPFA 3V5RA 4K0KI 4DV5I 5DRPA 2GO4A 2WW4A 4DR4E 2PNZB 2IERA 4LFCI 1S16A 1RHYA 4P7AA 4YHHE 4LFBI 4JI1I 1EA6A 4AQYI 1Z0WA 2O1WA 2UUCI 4JYAE 3WU6A 1I94E 1B62A 5A2QC 2BA1G 3PS3A 1N32I 4GKKI 1Y4SA 2BV3A 1XNQI 5FWKA 4AIMA 3KRNA 4DR4I 4JI6E 1NHJA 3GLLA 1YHCA 5JEAD 1FWLA 4Z7CA 2EFGA 2PNLA 5GMDA 1I94I 2BM1A 3LTOA 2VQEE 4U3DA 1NHIA 2VF3A 4KHPE 2CVEA 4JI7I 1N34E 4JI6I 2NN6D 2UUAE 2AJ4A 1XNRE
chains in the Genus database with same CATH topology
3CDJA 2C37B 4BA2A 2C39A 4IFDC 1UDOA 2JE6B 4IFDE 4IFDB 2PO2A 5C0XA 2PO0A 4IFDF 2NN6E 2JEBA 5JEAA 4BA2B 2C39B 5C0XC 1E3PA 2C38A 1E3HA 2PO2B 5C0XB 2PO0B 3M7ND 5C0XF 5JEAC 5JEAE 2JEBB 5JEAB 1UDNA 4AIDA 2PO1A 2NN6A 2C38B 2JEAA 3M7NG 5K36D 4OO1A 5JEAF 3H1CA 1R6LA 3B4TA 2BA0D 2NN6C 2PO1B 2NN6B 4OO1C 4OO1E 2JEAB 4AM3A 2PNZA 2BR2A 3U1KA 4OO1B 4BA1A 2BA0G 2NN6F 1UDSA 4OO1F 3GCMA 5K36E 2WNRA 2PNZB 2BR2B 4IFDD 4BA1B 2BA1D 2BA1G 2WNRB 1OYSA 2WP8A 3L7ZA 5C0XD 5K36A 4AIMA 3KRNA 3GLLA 1OYRA 5JEAD 5K36C 2WP8B 3L7ZB 4NBQA 5K36B 3HKMA 3M85D 1OYPA 1R6MA 5K36F 3DD6A 3M85G 2NN6D 2C37A 5C0XE 2JE6A 1UDQA 4IFDA 3CDIA 4OO1D 3GMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CDJ A;  2C37 B;  4BA2 A;  2C39 A;  4IFD C;  1UDO A;  2JE6 B;  4IFD E;  4IFD B;  2PO2 A;  5C0X A;  2PO0 A;  4IFD F;  2NN6 E;  2JEB A;  5JEA A;  4BA2 B;  2C39 B;  5C0X C;  1E3P A;  2C38 A;  1E3H A;  2PO2 B;  5C0X B;  2PO0 B;  3M7N D;  5C0X F;  5JEA C;  5JEA E;  2JEB B;  5JEA B;  1UDN A;  4AID A;  2PO1 A;  2NN6 A;  2C38 B;  2JEA A;  3M7N G;  5K36 D;  4OO1 A;  5JEA F;  3H1C A;  1R6L A;  3B4T A;  2BA0 D;  2NN6 C;  2PO1 B;  2NN6 B;  4OO1 C;  4OO1 E;  2JEA B;  4AM3 A;  2PNZ A;  2BR2 A;  3U1K A;  4OO1 B;  4BA1 A;  2BA0 G;  2NN6 F;  1UDS A;  4OO1 F;  3GCM A;  5K36 E;  2WNR A;  2PNZ B;  2BR2 B;  4IFD D;  4BA1 B;  2BA1 D;  2BA1 G;  2WNR B;  1OYS A;  2WP8 A;  3L7Z A;  5C0X D;  5K36 A;  4AIM A;  3KRN A;  3GLL A;  1OYR A;  5JEA D;  5K36 C;  2WP8 B;  3L7Z B;  4NBQ A;  5K36 B;  3HKM A;  3M85 D;  1OYP A;  1R6M A;  5K36 F;  3DD6 A;  3M85 G;  2NN6 D;  2C37 A;  5C0X E;  2JE6 A;  1UDQ A;  4IFD A;  3CDI A;  4OO1 D;  3GME A; 
#chains in the Genus database with same CATH topology
 3CDJ A;  3ZM7 A;  2VQE I;  4DUZ E;  1HNZ E;  2HKJ A;  5LMN E;  2E5L I;  4IFD C;  1UDO A;  4IFD E;  4ED4 A;  3LPS A;  4R1F A;  4DV7 E;  2Z5E A;  4JV5 E;  2PO0 A;  5DRQ A;  3PYD A;  4OX9 I;  2F4V I;  2V34 A;  1XHK A;  2DEI A;  4IFD F;  4HYM A;  3GON A;  2UUA I;  2NN6 E;  4FW4 A;  5IT9 C;  4BA2 B;  4LF5 I;  1MG7 A;  4FWD A;  5C0X C;  4QNJ A;  2PNM A;  4UT4 A;  1HNZ I;  4OKG A;  5LMN I;  1N33 E;  1RRE A;  3T1H E;  2ZIT A;  5C0X F;  3OTO E;  4DPY A;  5JEA B;  1UDN A;  4DPX A;  4IZK B;  2C38 B;  4LCF A;  1FWK A;  3M7N G;  4OO1 A;  1IBM E;  2AE8 A;  4DUY E;  2ZBK B;  3M6A A;  1A6F A;  5BR8 E;  1H73 A;  4FWH A;  1Z0C A;  4PRV A;  2NN6 B;  2Q2E B;  4DU8 A;  5LMU E;  1IBL I;  3U1Y A;  3K17 A;  5EKW A;  4BA1 A;  2O3Z A;  4ISA A;  1NHH A;  2HHH E;  2UU9 E;  4FW3 A;  5FLX C;  4DV2 I;  4DUY I;  4LF6 E;  4DR3 E;  5BR8 I;  2BR2 B;  4LCG A;  3LNU A;  5LMU I;  2CG9 A;  2O1T A;  4K0K E;  5LL6 R;  4DV5 E;  1HK7 A;  4MU1 A;  4X62 I;  4LFC E;  2UU9 I;  1PVG A;  4USK A;  2WP8 A;  4LFB E;  4JI1 E;  4AQY E;  4LF6 I;  5K36 A;  3P3E A;  3PYE A;  1FNM A;  2CGE A;  4GQU A;  4B3M E;  2UXD I;  1N32 E;  4MDT A;  4LF4 I;  4GKK E;  1XNQ E;  2J7K A;  4FW9 A;  3J81 Q;  3WU5 A;  4LPF A;  2Z5C B;  1Z5C A;  1MU5 A;  1Z0G A;  2X36 A;  3HUL A;  3JAM Q;  1XXE A;  4PRX A;  4B3M I;  1PKP A;  2HK3 A;  2JE6 A;  1UDQ A;  1K47 A;  4OO1 D;  3B78 A;  2UXC I;  4JI7 E;  2Z5C A;  1D6T A;  4JI5 I;  4DR1 E;  2C39 A;  2UXB I;  1KKH A;  4ZVI A;  4B3R I;  1KIJ A;  4DU7 A;  5IWA I;  1ZXN A;  4B3T I;  2E5L E;  1RR9 A;  2JEB A;  4FW7 A;  4DR5 I;  1E3P A;  2F4V E;  4OX9 E;  4YY3 I;  4Z7Y A;  2PO0 B;  2HKE A;  3J80 C;  4DR1 I;  5DRO A;  1USU A;  5JEA C;  4LF5 E;  1H7U A;  1Z0E A;  5JEA E;  4N3O A;  2LJP A;  1FJG I;  3CWV A;  5K36 D;  5JEA F;  2OI2 A;  1R6L A;  4DV1 I;  3B8H A;  2J65 A;  3Q1Q A;  4DPT A;  4NXM I;  2NN6 C;  4IZJ A;  1H72 C;  5A2Q Q;  2A2D A;  1Z59 A;  1XMQ I;  4OO1 B;  2GO3 A;  2NN6 F;  1OJ4 A;  1XMO I;  4X65 E;  3P06 A;  5GME A;  4UTG A;  1IBL E;  3ZZU A;  5K36 E;  2WNR A;  4DR2 I;  4KQV A;  1KTV A;  4BA1 B;  1BKN A;  4FW5 A;  4J3D A;  4DV2 E;  2VES A;  5DRR A;  4U3B A;  4DR6 E;  4LFA E;  3PYG A;  4X65 I;  3L7Z A;  4X64 I;  3K85 A;  4DV4 E;  1J5E I;  2NPF A;  4PU9 A;  1OYR A;  4MYU A;  4X62 E;  4DXL A;  4WUD A;  3QT5 A;  2V2Q A;  4JI0 E;  1ELO A;  2WP8 B;  4NBQ A;  5K36 B;  3HKM A;  4DR6 I;  4LFA I;  3M85 D;  2UXD E;  1B63 A;  4OZE A;  4B3S E;  4DV4 I;  1ZM4 A;  4LF4 E;  4WUB A;  5IT9 Q;  2C37 A;  4JG4 A;  3V2U C;  3J7A M;  3ZKB A;  5ELW A;  1IBK I;  4IFD A;  3GME A;  2CZ9 A;  4JI0 I;  4DV0 E;  2GS8 A;  4HAC A;  2GQ0 A;  3QT7 A;  4IZJ D;  1H7S A;  1N36 I;  2ZM6 E;  1S4E A;  4B3S I;  2UXC E;  2JE6 B;  3PS1 A;  2PO2 A;  1Z0B A;  5C0X A;  1WUU A;  4LF8 I;  3ZZT A;  3B82 A;  3P3G A;  4JI5 E;  2DEJ A;  3P76 A;  2UXB E;  3HJC A;  4FW6 A;  4DV0 I;  4DV3 E;  4B3R E;  2C39 B;  5IWA E;  4B3T E;  1HR0 I;  2X7I A;  2ZM6 I;  3QT8 A;  2Z5B B;  2F1D A;  4LF9 I;  2O1U A;  4DR5 E;  2JEB B;  5FLX Q;  4JI4 E;  1Z5A A;  4YY3 E;  1ZM9 A;  4AID A;  1HNX I;  4DV6 I;  4JI3 E;  1Z0T A;  2PO1 A;  4DPW A;  1KVK A;  2JEA A;  2IOP A;  4DV3 I;  4XTJ A;  3H1C A;  2BM0 A;  2UUB I;  3T1Y E;  1FJG E;  3B4T A;  2BA0 D;  2Z5B A;  2A2C A;  2V2V A;  4OO1 C;  3WU4 A;  4FWG A;  4OO1 E;  4JI4 I;  2PNZ A;  4DV1 E;  3U1K A;  4JI3 I;  4NXM E;  4MU0 A;  4YHH I;  4JI8 E;  4OO1 F;  4LCH A;  4NXN E;  2HFU A;  4IZJ B;  3T1Y I;  1XMQ E;  1Y5Y A;  3ZZ0 A;  1ZM3 A;  4JYA I;  1EI1 A;  4IFD D;  3K1J A;  1NZ0 A;  4X66 E;  1XMO E;  2O1V A;  1MX0 A;  1ZXM A;  4WUC A;  3UHM A;  2VQF E;  2BA1 D;  4M1K A;  3ZKD A;  3QT6 A;  4IS9 A;  1Y6Z A;  4DR2 E;  4GKJ E;  4JI8 I;  4MYT A;  2WNR B;  1OYS A;  4NXN I;  4LOM A;  2V8P A;  5C0X D;  1YH8 A;  2IES A;  1VI7 A;  4X66 I;  3PS2 A;  4URL A;  3P3C A;  4QNK A;  2VQF I;  1ZM2 A;  4X64 E;  4KHP I;  1VIS A;  5L3J A;  1J5E E;  4LF7 E;  5K36 C;  3L7Z B;  1N34 I;  5EL9 A;  5DNX A;  4GKJ I;  1FKA E;  1FI4 A;  4DR7 E;  1OYP A;  1R6M A;  5K36 F;  1N0U A;  1XNR I;  3DD6 A;  1U2R A;  3M85 G;  5C0X E;  2IOQ A;  4DUZ I;  2R3V A;  3CDI A;  4DPU A;  3J80 Q;  4DV7 I;  4LF7 I;  4FN5 A;  4JV5 I;  3PYF A;  3F0N A;  1IBK E;  2R42 A;  2C37 B;  4BA2 A;  4HXZ A;  4DR7 I;  1USV A;  4IFD B;  2JT2 A;  3J81 C;  3WU3 A;  4HY1 A;  4JI2 E;  4EMD A;  4HAC B;  1Z5B A;  1N33 I;  1N36 E;  3T1H I;  3JAM C;  5JEA A;  2HK2 A;  4I3H A;  4IZK A;  3OTO I;  2C38 A;  4P52 A;  4LF8 E;  3J7A G;  1E3H A;  2PO2 B;  5C0X B;  2E1R A;  4MQY A;  3M7N D;  1H74 A;  1PIE A;  1UEK A;  1IBM I;  4JI2 I;  1Y4U A;  1DAR A;  1Z0V A;  2HFS A;  3Q6N A;  1HR0 E;  2NN6 A;  4MU3 A;  1Y60 A;  1HNW E;  4LF9 E;  1N0V C;  1P42 A;  3H4L A;  3NZK A;  4USM A;  2V2Z A;  1HNX E;  4DV6 E;  3Q6M A;  2XEX A;  2HHH I;  2PO1 B;  2UUB E;  2JEA B;  4AM3 A;  2BR2 A;  4DR3 I;  5DNL A;  3PRY A;  2UUC E;  2BA0 G;  1UDS A;  4MU4 A;  1QZR A;  3D4J A;  3GCM A;  1HNW I;  4RPF A;  3V5R A;  4K0K I;  4DV5 I;  5DRP A;  2GO4 A;  2WW4 A;  4DR4 E;  2PNZ B;  2IER A;  4LFC I;  1S16 A;  1RHY A;  4P7A A;  4YHH E;  4LFB I;  4JI1 I;  1EA6 A;  4AQY I;  1Z0W A;  2O1W A;  2UUC I;  4JYA E;  3WU6 A;  1I94 E;  1B62 A;  5A2Q C;  2BA1 G;  3PS3 A;  1N32 I;  4GKK I;  1Y4S A;  2BV3 A;  1XNQ I;  5FWK A;  4AIM A;  3KRN A;  4DR4 I;  4JI6 E;  1NHJ A;  3GLL A;  1YHC A;  5JEA D;  1FWL A;  4Z7C A;  2EFG A;  2PNL A;  5GMD A;  1I94 I;  2BM1 A;  3LTO A;  2VQE E;  4U3D A;  1NHI A;  2VF3 A;  4KHP E;  2CVE A;  4JI7 I;  1N34 E;  4JI6 I;  2NN6 D;  2UUA E;  2AJ4 A;  1XNR E; 
#chains in the Genus database with same CATH homology
 3CDJ A;  2C37 B;  4BA2 A;  2C39 A;  4IFD C;  1UDO A;  2JE6 B;  4IFD E;  4IFD B;  2PO2 A;  5C0X A;  2PO0 A;  4IFD F;  2NN6 E;  2JEB A;  5JEA A;  4BA2 B;  2C39 B;  5C0X C;  1E3P A;  2C38 A;  1E3H A;  2PO2 B;  5C0X B;  2PO0 B;  3M7N D;  5C0X F;  5JEA C;  5JEA E;  2JEB B;  5JEA B;  1UDN A;  4AID A;  2PO1 A;  2NN6 A;  2C38 B;  2JEA A;  3M7N G;  5K36 D;  4OO1 A;  5JEA F;  3H1C A;  1R6L A;  3B4T A;  2BA0 D;  2NN6 C;  2PO1 B;  2NN6 B;  4OO1 C;  4OO1 E;  2JEA B;  4AM3 A;  2PNZ A;  2BR2 A;  3U1K A;  4OO1 B;  4BA1 A;  2BA0 G;  2NN6 F;  1UDS A;  4OO1 F;  3GCM A;  5K36 E;  2WNR A;  2PNZ B;  2BR2 B;  4IFD D;  4BA1 B;  2BA1 D;  2BA1 G;  2WNR B;  1OYS A;  2WP8 A;  3L7Z A;  5C0X D;  5K36 A;  4AIM A;  3KRN A;  3GLL A;  1OYR A;  5JEA D;  5K36 C;  2WP8 B;  3L7Z B;  4NBQ A;  5K36 B;  3HKM A;  3M85 D;  1OYP A;  1R6M A;  5K36 F;  3DD6 A;  3M85 G;  2NN6 D;  2C37 A;  5C0X E;  2JE6 A;  1UDQ A;  4IFD A;  3CDI A;  4OO1 D;  3GME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...