4OO1F

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
207
Chain Sequence
DRRRLLGPAAAKPMAFEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 53
structure length 207
sequence length 244
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 4oo1F00
1E3PA 3GMEA 4IFDC 2NN6B 1UDQA 2C37B 2BA0G 5C0XA 2PO0B 2JEAA 1E3HA 1UDOA 2PNZB 1OYPA 3L7ZA 2C38B 4IFDB 2PO0A 2JEAB 5JEAD 2PNZA 5C0XD 2BA1G 2BR2A 5K36A 2BA1D 2JE6A 2BR2B 2PO2B 5K36C 5JEAE 3M7ND 2JE6B 2PO2A 3M7NG 5JEAF 2NN6C 3M85D 5C0XB 4AIMA 4OO1E 3M85G 2JEBA 3L7ZB 2C38A 4OO1F 5C0XC 3B4TA 4IFDE 5JEAC 4AIDA 4IFDF 4BA1A 5JEAB 2NN6E 2PO1B 2C39B 1UDSA 2C39A 2PO1A 2NN6F 3GLLA 4AM3A 5C0XE 2BA0D 4OO1B 1OYSA 2C37A 5C0XF 1R6LA 2WP8A 4NBQA 5K36E 3H1CA 2NN6D 4BA1B 5K36F 5JEAA 3CDIA 2WNRA 4IFDD 3HKMA 4BA2B 1R6MA 3U1KA 2JEBB 2WNRB 1OYRA 3DD6A 4OO1A 3KRNA 4BA2A 4OO1D 1UDNA 4IFDA 5K36B 2WP8B 3CDJA 3GCMA 5K36D 4OO1C 2NN6A
chains in the Genus database with same CATH superfamily
1E3PA 3Q6NA 1KTVA 1Z5AA 4X62E 1UDQA 4DV6I 2BA0G 4LF6E 2PO0B 2JEAA 2CGEA 2V2ZA 4JYAE 2O1UA 4LCFA 4IFDB 5C0XD 4XTJA 4DU7A 4IZJA 3T1YI 4JI7I 2BA1G 4B3TI 2BA1D 1NHIA 2Z5BB 5LMNI 2BR2B 2UU9E 2PO2B 4X62I 4RPFA 1OJ4A 1H7SA 1XNRI 2ZITA 2UUAI 1Z0BA 1KIJA 2JT2A 3JAMC 1Z5BA 4ED4A 4EMDA 4OO1E 4LFCI 2HHHI 1FWLA 2JEBA 4OO1F 5C0XC 3PS2A 4IFDE 1H72C 4LF8I 2VQEE 4LFAE 1P42A 1FJGI 4DV5E 1I94I 3QT6A 1PIEA 2HK3A 3B78A 2C39B 2HKEA 4MQYA 3B82A 4DU8A 3U1YA 3QT8A 3T1HI 4OX9I 5C0XE 2XEXA 4WUDA 2O1WA 1ZM4A 4GKKI 4FW9A 2CZ9A 2WP8A 1MU5A 2IESA 4NBQA 4B3RE 4GKJE 4LF7I 1N32E 2LJPA 2GQ0A 4IZJD 2UUCE 3J7AM 1USUA 4URLA 2F4VE 2J7KA 4DPWA 1Z0TA 2IOQA 2ZM6I 3U1KA 2JEBB 2WNRB 3DD6A 3KRNA 4JI6E 3WU3A 1UDNA 4U3BA 4JG4A 3GONA 3OTOI 1HNWI 1Z0EA 4DV0I 2O1TA 5ELWA 1N36E 1K47A 2VF3A 4DPYA 4FWHA 1MX0A 1BKNA 2WP8B 3LPSA 4LF4E 1FWKA 3J80C 1B62A 2UUBI 2GS8A 2BV3A 2VESA 4DPTA 2BM0A 2NN6B 2C37B 3F0NA 4M1KA 3CWVA 4IZKB 5C0XA 4YY3I 1XMOI 4JI3E 1N36I 2C38B 3QT5A 4B3ME 4B3TE 3V5RA 2PNZA 4DV7I 2E1RA 4FW3A 4P52A 4DV1I 3P76A 1FNMA 4DPXA 2Z5CA 5A2QQ 4JI4E 2PNLA 2UXDE 4MYUA 4OZEA 3M7NG 5EL9A 4FW6A 5GMDA 5JEAF 4DV5I 4DV2E 2R42A 1ZM9A 1EA6A 2ZBKB 4DUZI 1KVKA 4AQYI 2C38A 3K17A 4QNJA 4USMA 1ZM3A 3WU5A 4JV5I 5LMNE 3J81Q 4AIDA 1RR9A 4LFBI 2VQFI 2BM1A 4DR6E 2R3VA 4JI0E 4LCGA 1N0UA 2PO1A 2X7IA 2A2CA 4DUYE 4JI5I 3P3CA 1IBKE 1HK7A 1Z0GA 2BA0D 4OO1B 2UXBE 2C37A 1Y5YA 3LNUA 2UUCI 4X64I 4MU0A 4DXLA 1Y4UA 1HNZI 4LF6I 1RREA 2Z5BA 4DR2E 2PNMA 1FJGE 3H1CA 3P3GA 4DR6I 4QNKA 4U3DA 4BA1B 2WNRA 3HKMA 2UXBI 5IT9Q 4DR4E 5DRQA 2UU9I 1N33I 1HR0I 4JI4I 4MU1A 4OO1A 1XNQE 3ZZ0A 4X65I 1IBLI 4K0KE 1J5EI 1VI7A 4LF7E 1XMOE 4LCHA 3ZKDA 4Z7YA 5K36D 4USKA 3LTOA 1Z5CA 2EFGA 2Z5EA 1NHHA 1NHJA 5FWKA 1Y4SA 5FLXC 4B3SE 3PS3A 3ZKBA 1HR0E 4LF9I 2NPFA 3V2UC 1USVA 3PYEA 4PRXA 2UXDI 4JI8E 4FW7A 2PNZB 3T1YE 5JEAD 1S16A 3J80Q 4J3DA 1IBME 3D4JA 4LF5E 5K36A 3B8HA 1EI1A 5LMUE 4NXNE 3K85A 1XMQE 2V2VA 5K36C 1NZ0A 5DNXA 5JEAE 4YHHE 3M7ND 4Z7CA 2PO2A 4DR5I 4I3HA 2X36A 4HY1A 4X66I 2VQFE 4LOMA 4ZVIA 2DEJA 3PRYA 3L7ZB 1ELOA 2AJ4A 1IBMI 1XXEA 1S4EA 3P06A 4YY3E 5JEAC 5LMUI 4DV4I 4X64E 5A2QC 2PO1B 1UDSA 4MU4A 1ZXNA 4DR1E 1FI4A 4GQUA 4P7AA 4OX9E 4DR7E 2V34A 1H73A 1U2RA 5DRRA 4R1FA 1OYSA 1RHYA 4FW4A 1Y6ZA 3HJCA 1YH8A 2AE8A 4OKGA 3NZKA 1HNXE 3ZM7A 1N32I 3J81C 1YHCA 2HKJA 4HACB 4DV6E 5K36E 4IZJB 2NN6D 3PYFA 4JI0I 3M6AA 5K36F 2UXCE 4DR1I 1A6FA 1Z0CA 5JEAA 1Z0WA 4KHPE 1IBKI 1Z59A 1H7UA 2HFUA 4IFDD 1Z0VA 3QT7A 1D6TA 1OYRA 5GMEA 3HULA 1KKHA 2F1DA 3K1JA 4PU9A 4FW5A 1XHKA 2E5LE 4IFDA 5DRPA 1QZRA 4JYAI 5IWAI 2O3ZA 4JI7E 3H4LA 3GCMA 4FWDA 3ZZUA 4OO1C 5LL6R 2NN6A 1HNZE 3Q1QA 1FKAE 5IT9C 1N34I 3GMEA 5EKWA 4IFDC 2GO4A 3Q6MA 4UT4A 4DPUA 1XMQI 4KQVA 3JAMQ 4DR3I 4GKJI 4B3RI 1E3HA 1UDOA 4K0KI 1OYPA 3L7ZA 1I94E 2PO0A 4JI2E 2JEAB 1WUUA 1B63A 2HHHE 4DV3I 4MYTA 3UHMA 2BR2A 4DV7E 3PS1A 1N0VC 2VQEI 4LFAI 2JE6A 5BR8I 4NXME 4IS9A 2ZM6E 2HK2A 2HFSA 1J5EE 1N34E 5FLXQ 4GKKE 4DR5E 2JE6B 4LF9E 3OTOE 1HNWE 4HYMA 1ZM2A 2NN6C 4FN5A 2CVEA 3M85D 5C0XB 4AIMA 4MU3A 4AQYE 4HXZA 2UXCI 3M85G 4JI2I 4LPFA 2UUBE 5L3JA 4LFCE 2J65A 1UEKA 4JI1I 2V8PA 3B4TA 4LF5I 1N33E 3ZZTA 2A2DA 4HACA 1XNRE 2V2QA 4LF8E 4IFDF 4BA1A 4FWGA 1IBLE 5JEAB 2NN6E 4IZKA 3WU6A 4WUBA 2C39A 2NN6F 3GLLA 4AM3A 2DEIA 4LF4I 2F4VI 3T1HE 4NXNI 4JI5E 3J7AG 4MDTA 4DV1E 3PYDA 2GO3A 1ZXMA 4JI1E 5C0XF 4B3SI 1Y60A 4N3OA 1HNXI 1H74A 1R6LA 2Q2EB 4DV4E 4DV0E 4WUCA 2CG9A 2O1VA 4JI8I 4DR3E 1VISA 3PYGA 2UUAE 4DR2I 5DROA 4UTGA 4KHPI 4PRVA 2E5LI 4DR7I 3CDIA 4JI3I 4DUZE 2OI2A 2IOPA 4BA2B 1DARA 1R6MA 3P3EA 4JV5E 5BR8E 4NXMI 5DNLA 4DR4I 4YHHI 4ISAA 4BA2A 4OO1D 1PKPA 4JI6I 1XNQI 4LFBE 5IWAE 4X65E 4X66E 1PVGA 2IERA 3WU4A 4B3MI 5K36B 3CDJA 2WW4A 1MG7A 4DUYI 4DV2I 2Z5CB 4DV3E
chains in the Genus database with same CATH topology
1E3PA 3GMEA 4IFDC 2NN6B 1UDQA 2C37B 2BA0G 5C0XA 2PO0B 2JEAA 1E3HA 1UDOA 2PNZB 1OYPA 3L7ZA 2C38B 4IFDB 2PO0A 2JEAB 5JEAD 2PNZA 5C0XD 2BA1G 2BR2A 5K36A 2BA1D 2JE6A 2BR2B 2PO2B 5K36C 5JEAE 3M7ND 2JE6B 2PO2A 3M7NG 5JEAF 2NN6C 3M85D 5C0XB 4AIMA 4OO1E 3M85G 2JEBA 3L7ZB 2C38A 4OO1F 5C0XC 3B4TA 4IFDE 5JEAC 4AIDA 4IFDF 4BA1A 5JEAB 2NN6E 2PO1B 2C39B 1UDSA 2C39A 2PO1A 2NN6F 3GLLA 4AM3A 5C0XE 2BA0D 4OO1B 1OYSA 2C37A 5C0XF 1R6LA 2WP8A 4NBQA 5K36E 3H1CA 2NN6D 4BA1B 5K36F 5JEAA 3CDIA 2WNRA 4IFDD 3HKMA 4BA2B 1R6MA 3U1KA 2JEBB 2WNRB 1OYRA 3DD6A 4OO1A 3KRNA 4BA2A 4OO1D 1UDNA 4IFDA 5K36B 2WP8B 3CDJA 3GCMA 5K36D 4OO1C 2NN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3P A;  3GME A;  4IFD C;  2NN6 B;  1UDQ A;  2C37 B;  2BA0 G;  5C0X A;  2PO0 B;  2JEA A;  1E3H A;  1UDO A;  2PNZ B;  1OYP A;  3L7Z A;  2C38 B;  4IFD B;  2PO0 A;  2JEA B;  5JEA D;  2PNZ A;  5C0X D;  2BA1 G;  2BR2 A;  5K36 A;  2BA1 D;  2JE6 A;  2BR2 B;  2PO2 B;  5K36 C;  5JEA E;  3M7N D;  2JE6 B;  2PO2 A;  3M7N G;  5JEA F;  2NN6 C;  3M85 D;  5C0X B;  4AIM A;  4OO1 E;  3M85 G;  2JEB A;  3L7Z B;  2C38 A;  4OO1 F;  5C0X C;  3B4T A;  4IFD E;  5JEA C;  4AID A;  4IFD F;  4BA1 A;  5JEA B;  2NN6 E;  2PO1 B;  2C39 B;  1UDS A;  2C39 A;  2PO1 A;  2NN6 F;  3GLL A;  4AM3 A;  5C0X E;  2BA0 D;  4OO1 B;  1OYS A;  2C37 A;  5C0X F;  1R6L A;  2WP8 A;  4NBQ A;  5K36 E;  3H1C A;  2NN6 D;  4BA1 B;  5K36 F;  5JEA A;  3CDI A;  2WNR A;  4IFD D;  3HKM A;  4BA2 B;  1R6M A;  3U1K A;  2JEB B;  2WNR B;  1OYR A;  3DD6 A;  4OO1 A;  3KRN A;  4BA2 A;  4OO1 D;  1UDN A;  4IFD A;  5K36 B;  2WP8 B;  3CDJ A;  3GCM A;  5K36 D;  4OO1 C;  2NN6 A; 
#chains in the Genus database with same CATH topology
 1E3P A;  3Q6N A;  1KTV A;  1Z5A A;  4X62 E;  1UDQ A;  4DV6 I;  2BA0 G;  4LF6 E;  2PO0 B;  2JEA A;  2CGE A;  2V2Z A;  4JYA E;  2O1U A;  4LCF A;  4IFD B;  5C0X D;  4XTJ A;  4DU7 A;  4IZJ A;  3T1Y I;  4JI7 I;  2BA1 G;  4B3T I;  2BA1 D;  1NHI A;  2Z5B B;  5LMN I;  2BR2 B;  2UU9 E;  2PO2 B;  4X62 I;  4RPF A;  1OJ4 A;  1H7S A;  1XNR I;  2ZIT A;  2UUA I;  1Z0B A;  1KIJ A;  2JT2 A;  3JAM C;  1Z5B A;  4ED4 A;  4EMD A;  4OO1 E;  4LFC I;  2HHH I;  1FWL A;  2JEB A;  4OO1 F;  5C0X C;  3PS2 A;  4IFD E;  1H72 C;  4LF8 I;  2VQE E;  4LFA E;  1P42 A;  1FJG I;  4DV5 E;  1I94 I;  3QT6 A;  1PIE A;  2HK3 A;  3B78 A;  2C39 B;  2HKE A;  4MQY A;  3B82 A;  4DU8 A;  3U1Y A;  3QT8 A;  3T1H I;  4OX9 I;  5C0X E;  2XEX A;  4WUD A;  2O1W A;  1ZM4 A;  4GKK I;  4FW9 A;  2CZ9 A;  2WP8 A;  1MU5 A;  2IES A;  4NBQ A;  4B3R E;  4GKJ E;  4LF7 I;  1N32 E;  2LJP A;  2GQ0 A;  4IZJ D;  2UUC E;  3J7A M;  1USU A;  4URL A;  2F4V E;  2J7K A;  4DPW A;  1Z0T A;  2IOQ A;  2ZM6 I;  3U1K A;  2JEB B;  2WNR B;  3DD6 A;  3KRN A;  4JI6 E;  3WU3 A;  1UDN A;  4U3B A;  4JG4 A;  3GON A;  3OTO I;  1HNW I;  1Z0E A;  4DV0 I;  2O1T A;  5ELW A;  1N36 E;  1K47 A;  2VF3 A;  4DPY A;  4FWH A;  1MX0 A;  1BKN A;  2WP8 B;  3LPS A;  4LF4 E;  1FWK A;  3J80 C;  1B62 A;  2UUB I;  2GS8 A;  2BV3 A;  2VES A;  4DPT A;  2BM0 A;  2NN6 B;  2C37 B;  3F0N A;  4M1K A;  3CWV A;  4IZK B;  5C0X A;  4YY3 I;  1XMO I;  4JI3 E;  1N36 I;  2C38 B;  3QT5 A;  4B3M E;  4B3T E;  3V5R A;  2PNZ A;  4DV7 I;  2E1R A;  4FW3 A;  4P52 A;  4DV1 I;  3P76 A;  1FNM A;  4DPX A;  2Z5C A;  5A2Q Q;  4JI4 E;  2PNL A;  2UXD E;  4MYU A;  4OZE A;  3M7N G;  5EL9 A;  4FW6 A;  5GMD A;  5JEA F;  4DV5 I;  4DV2 E;  2R42 A;  1ZM9 A;  1EA6 A;  2ZBK B;  4DUZ I;  1KVK A;  4AQY I;  2C38 A;  3K17 A;  4QNJ A;  4USM A;  1ZM3 A;  3WU5 A;  4JV5 I;  5LMN E;  3J81 Q;  4AID A;  1RR9 A;  4LFB I;  2VQF I;  2BM1 A;  4DR6 E;  2R3V A;  4JI0 E;  4LCG A;  1N0U A;  2PO1 A;  2X7I A;  2A2C A;  4DUY E;  4JI5 I;  3P3C A;  1IBK E;  1HK7 A;  1Z0G A;  2BA0 D;  4OO1 B;  2UXB E;  2C37 A;  1Y5Y A;  3LNU A;  2UUC I;  4X64 I;  4MU0 A;  4DXL A;  1Y4U A;  1HNZ I;  4LF6 I;  1RRE A;  2Z5B A;  4DR2 E;  2PNM A;  1FJG E;  3H1C A;  3P3G A;  4DR6 I;  4QNK A;  4U3D A;  4BA1 B;  2WNR A;  3HKM A;  2UXB I;  5IT9 Q;  4DR4 E;  5DRQ A;  2UU9 I;  1N33 I;  1HR0 I;  4JI4 I;  4MU1 A;  4OO1 A;  1XNQ E;  3ZZ0 A;  4X65 I;  1IBL I;  4K0K E;  1J5E I;  1VI7 A;  4LF7 E;  1XMO E;  4LCH A;  3ZKD A;  4Z7Y A;  5K36 D;  4USK A;  3LTO A;  1Z5C A;  2EFG A;  2Z5E A;  1NHH A;  1NHJ A;  5FWK A;  1Y4S A;  5FLX C;  4B3S E;  3PS3 A;  3ZKB A;  1HR0 E;  4LF9 I;  2NPF A;  3V2U C;  1USV A;  3PYE A;  4PRX A;  2UXD I;  4JI8 E;  4FW7 A;  2PNZ B;  3T1Y E;  5JEA D;  1S16 A;  3J80 Q;  4J3D A;  1IBM E;  3D4J A;  4LF5 E;  5K36 A;  3B8H A;  1EI1 A;  5LMU E;  4NXN E;  3K85 A;  1XMQ E;  2V2V A;  5K36 C;  1NZ0 A;  5DNX A;  5JEA E;  4YHH E;  3M7N D;  4Z7C A;  2PO2 A;  4DR5 I;  4I3H A;  2X36 A;  4HY1 A;  4X66 I;  2VQF E;  4LOM A;  4ZVI A;  2DEJ A;  3PRY A;  3L7Z B;  1ELO A;  2AJ4 A;  1IBM I;  1XXE A;  1S4E A;  3P06 A;  4YY3 E;  5JEA C;  5LMU I;  4DV4 I;  4X64 E;  5A2Q C;  2PO1 B;  1UDS A;  4MU4 A;  1ZXN A;  4DR1 E;  1FI4 A;  4GQU A;  4P7A A;  4OX9 E;  4DR7 E;  2V34 A;  1H73 A;  1U2R A;  5DRR A;  4R1F A;  1OYS A;  1RHY A;  4FW4 A;  1Y6Z A;  3HJC A;  1YH8 A;  2AE8 A;  4OKG A;  3NZK A;  1HNX E;  3ZM7 A;  1N32 I;  3J81 C;  1YHC A;  2HKJ A;  4HAC B;  4DV6 E;  5K36 E;  4IZJ B;  2NN6 D;  3PYF A;  4JI0 I;  3M6A A;  5K36 F;  2UXC E;  4DR1 I;  1A6F A;  1Z0C A;  5JEA A;  1Z0W A;  4KHP E;  1IBK I;  1Z59 A;  1H7U A;  2HFU A;  4IFD D;  1Z0V A;  3QT7 A;  1D6T A;  1OYR A;  5GME A;  3HUL A;  1KKH A;  2F1D A;  3K1J A;  4PU9 A;  4FW5 A;  1XHK A;  2E5L E;  4IFD A;  5DRP A;  1QZR A;  4JYA I;  5IWA I;  2O3Z A;  4JI7 E;  3H4L A;  3GCM A;  4FWD A;  3ZZU A;  4OO1 C;  5LL6 R;  2NN6 A;  1HNZ E;  3Q1Q A;  1FKA E;  5IT9 C;  1N34 I;  3GME A;  5EKW A;  4IFD C;  2GO4 A;  3Q6M A;  4UT4 A;  4DPU A;  1XMQ I;  4KQV A;  3JAM Q;  4DR3 I;  4GKJ I;  4B3R I;  1E3H A;  1UDO A;  4K0K I;  1OYP A;  3L7Z A;  1I94 E;  2PO0 A;  4JI2 E;  2JEA B;  1WUU A;  1B63 A;  2HHH E;  4DV3 I;  4MYT A;  3UHM A;  2BR2 A;  4DV7 E;  3PS1 A;  1N0V C;  2VQE I;  4LFA I;  2JE6 A;  5BR8 I;  4NXM E;  4IS9 A;  2ZM6 E;  2HK2 A;  2HFS A;  1J5E E;  1N34 E;  5FLX Q;  4GKK E;  4DR5 E;  2JE6 B;  4LF9 E;  3OTO E;  1HNW E;  4HYM A;  1ZM2 A;  2NN6 C;  4FN5 A;  2CVE A;  3M85 D;  5C0X B;  4AIM A;  4MU3 A;  4AQY E;  4HXZ A;  2UXC I;  3M85 G;  4JI2 I;  4LPF A;  2UUB E;  5L3J A;  4LFC E;  2J65 A;  1UEK A;  4JI1 I;  2V8P A;  3B4T A;  4LF5 I;  1N33 E;  3ZZT A;  2A2D A;  4HAC A;  1XNR E;  2V2Q A;  4LF8 E;  4IFD F;  4BA1 A;  4FWG A;  1IBL E;  5JEA B;  2NN6 E;  4IZK A;  3WU6 A;  4WUB A;  2C39 A;  2NN6 F;  3GLL A;  4AM3 A;  2DEI A;  4LF4 I;  2F4V I;  3T1H E;  4NXN I;  4JI5 E;  3J7A G;  4MDT A;  4DV1 E;  3PYD A;  2GO3 A;  1ZXM A;  4JI1 E;  5C0X F;  4B3S I;  1Y60 A;  4N3O A;  1HNX I;  1H74 A;  1R6L A;  2Q2E B;  4DV4 E;  4DV0 E;  4WUC A;  2CG9 A;  2O1V A;  4JI8 I;  4DR3 E;  1VIS A;  3PYG A;  2UUA E;  4DR2 I;  5DRO A;  4UTG A;  4KHP I;  4PRV A;  2E5L I;  4DR7 I;  3CDI A;  4JI3 I;  4DUZ E;  2OI2 A;  2IOP A;  4BA2 B;  1DAR A;  1R6M A;  3P3E A;  4JV5 E;  5BR8 E;  4NXM I;  5DNL A;  4DR4 I;  4YHH I;  4ISA A;  4BA2 A;  4OO1 D;  1PKP A;  4JI6 I;  1XNQ I;  4LFB E;  5IWA E;  4X65 E;  4X66 E;  1PVG A;  2IER A;  3WU4 A;  4B3M I;  5K36 B;  3CDJ A;  2WW4 A;  1MG7 A;  4DUY I;  4DV2 I;  2Z5C B;  4DV3 E; 
#chains in the Genus database with same CATH homology
 1E3P A;  3GME A;  4IFD C;  2NN6 B;  1UDQ A;  2C37 B;  2BA0 G;  5C0X A;  2PO0 B;  2JEA A;  1E3H A;  1UDO A;  2PNZ B;  1OYP A;  3L7Z A;  2C38 B;  4IFD B;  2PO0 A;  2JEA B;  5JEA D;  2PNZ A;  5C0X D;  2BA1 G;  2BR2 A;  5K36 A;  2BA1 D;  2JE6 A;  2BR2 B;  2PO2 B;  5K36 C;  5JEA E;  3M7N D;  2JE6 B;  2PO2 A;  3M7N G;  5JEA F;  2NN6 C;  3M85 D;  5C0X B;  4AIM A;  4OO1 E;  3M85 G;  2JEB A;  3L7Z B;  2C38 A;  4OO1 F;  5C0X C;  3B4T A;  4IFD E;  5JEA C;  4AID A;  4IFD F;  4BA1 A;  5JEA B;  2NN6 E;  2PO1 B;  2C39 B;  1UDS A;  2C39 A;  2PO1 A;  2NN6 F;  3GLL A;  4AM3 A;  5C0X E;  2BA0 D;  4OO1 B;  1OYS A;  2C37 A;  5C0X F;  1R6L A;  2WP8 A;  4NBQ A;  5K36 E;  3H1C A;  2NN6 D;  4BA1 B;  5K36 F;  5JEA A;  3CDI A;  2WNR A;  4IFD D;  3HKM A;  4BA2 B;  1R6M A;  3U1K A;  2JEB B;  2WNR B;  1OYR A;  3DD6 A;  4OO1 A;  3KRN A;  4BA2 A;  4OO1 D;  1UDN A;  4IFD A;  5K36 B;  2WP8 B;  3CDJ A;  3GCM A;  5K36 D;  4OO1 C;  2NN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...