4OO3A

Crystal structure of a putative oxidoreductase (parmer_00841) from parabacteroides merdae atcc 43184 at 2.23 a resolution
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
439
structure length
439
Chain Sequence
EGFTGAPGEVKLITLDPGHFHAALVQKVSYPQVSKDVYVYAPTGFDVDEHLKRIQGFNTRAENPTAWNEIVYTGDDYLEKMLAEKKGNVMIQAGNNGKKTEYIKKTLEAGINVLSDKPMAINSQSFKLLEECFAIAKQKNIMLYDIMTERNEITTMLQRELSTIPAVYGEQLKGSPEEPAIVKESVHHLFKLVDNKPLTRPVWYLDVNQQGEGIVDVTTHLVDLVQWEAFPDQIIDYRKDIELIDANRWTTSISPEEFKQVTGTDAYPDFLKKDVENDTLKVYCNGDIVYKIKGVTAKVSVIWNYTFPKGGGDTHFSVMKGSKADLVIRQGKEQNYQPELFVEAVKGVDLAAYEKDLTASMEKVSAEYPGVALNKVGDGVWQVEIPAKYRVGHEAHFGQVTEHFLDYLKEGKLPDWEVPNMLAKYYTTTSALDMAKAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (PARMER_00841) from Parabacteroides merdae ATCC 43184 at 2.23 A resolution
rcsb
source organism Parabacteroides merdae
molecule tags Oxidoreductase
total genus 148
structure length 439
sequence length 439
ec nomenclature
pdb deposition date 2014-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF16490 Oxidoreduct_C Putative oxidoreductase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4oo3A01
4J16A 1NQAO 1XU7A 4CQMD 4DTIA 3JD3A 4W7IA 3I4FA 3GN1A 5ITWA 4D7AA 4R16A 4GPD1 5TGDA 3AY3A 2C54A 4GBJA 4IDFA 2J3KA 3ROPA 2VHXA 4WCFC 1DIHA 3M2PA 4GKVA 2GNAA 3N7UA 4E2WA 2VHVA 3LC7O 3CMCO 1L7EA 3F1LA 4LMRA 1E5QA 2B69A 4DVJA 4BGVA 5K6AC 3RJ5A 4JBIA 4IY1A 4IMPA 5K9ZA 4BO2A 4NJMB 3R3JA 5KVSA 1M75A 2HK7A 1XG5A 3MJTA 1TI7A 1EFKA 4UUMA 5A04A 1E7YA 1PZEA 1GDHA 1KVSA 3K96A 4K26A 3PWSA 3RU9A 2WYUA 4PLFA 4BNHA 4U8GA 5F1KA 3WGTA 3NUGA 2BH9A 4EUHA 2AMFA 2JCXA 1NNUA 5FYDA 3PDUA 3VH2A 4YB8A 2X1HA 4FC7A 4BO0A 1PQPA 4BIIA 3E9QA 1JA9A 3IUPA 1B26A 4LCJA 1WP4A 4H3VA 3D7LA 1DXYA 2VOJA 4P8RA 3WMWA 5IXYA 3GAFA 4XYBA 2POQX 4UVGA 4RPJA 4BO6A 3ZV4A 4YR9A 3CH6A 4GWKA 2NSDA 3KXDA 4R01A 3CXRA 3ZWXA 4BO1A 1RYEA 2GCGA 4U6QA 3LC1O 2QRKA 4P22A 4KQWA 1KOLA 3L4BA 3ZWYA 3ASVA 3I9OA 4U0KA 1BWSA 3TDKA 4XIYA 4MVJM 4R1SA 3U4HA 3DHNA 5JSFA 3WGQA 2OZPA 3EC7A 3WYCA 3WGZA 3A28A 2BI8A 1K0UA 1GZ3A 5TS3A 1EDZA 5KJ6A 2Z95A 4E5MA 1ZKMA 1UP4A 2EP7A 3OEYA 4Z3DA 3ZU4A 4NDNE 3NX4A 2Q46A 3FRJA 3IL2A 1YKFA 1JDJA 4RPLA 2QX7A 4E0BA 5JCXA 4BUCA 4U5QA 5DULA 2D5CA 3ADOA 2GN6A 4XQEA 3RFTA 5CDUA 2HDHA 1ISHA 3NKLA 5AYVA 1K6IA 1JVBA 1LLQA 2Q1WA 3V2GA 2Y1EA 4TZKA 2WSBA 3MJSA 4LRSB 2EKPA 1D1TA 1N1GA 3JTMA 4BVAA 3WMXA 2X5JO 4OO3A 4ALMA 1HDYA 4A2CA 1D7OA 4P4LA 2VOEA 1E1NA 2GZ3A 2VHYA 1PL8A 4WK6A 3WGOA 2CSUA 2JFGA 3UHAA 2YW9A 2ZTLA 2O23A 3PYXA 1LJ8A 1ZJZA 1VJ0A 4HP8A 4YAJA 3DFZA 3ZDFA 4IQ8A 1YL6A 3BYZA 3I9MA 1ZNQO 1KY4A 4E2ZA 3PIIA 2CMDA 3DAGA 4PLCA 1A71A 1YDWA 4R5HA 2NTVA 4NI5A 3OQBA 1DEHA 1QYXA 1B15A 3KYDB 1EVJA 3ZI0A 4DMMA 3H9QA 3H3FA 3GUCA 4CL3A 5JAIA 1GYPA 1T2FA 3Q11A 3ROKA 3IS3A 5L95A 4TRNA 5TX7A 4LMPA 4R9SA 4IS3A 4BKUA 1ADFA 1GQ2A 1E6WA 1VKOA 3M1LA 4J90A 3VKUA 4F3YA 1U2DA 1NFQA 4B7UA 1EDOA 1Q0QA 2PD4A 3Q6IA 4MKRA 4IPTA 4D3SA 1DJNA 1Q2XA 1GUZA 3DOJA 3H65A 2X4GA 1PGOA 1UP6A 1ENPA 1ZCJA 5A3VA 2FZWA 2EEZA 3GVHA 4FB5A 5KIAA 3I5MA 3DMTA 1HLDA 1PQUA 1OMOA 3D64A 4IS2A 5A3JA 3CPSA 3HJAA 2YDYA 2WE7A 1N9GB 5MGBA 1SEPA 4YJFA 3S55A 3WGIA 1RM3A 4HFMA 4BNIA 4OXYA 1T1RA 3GZ4A 2IDZA 4QT0A 1QLJA 1YJ8A 3NTOA 1X1TA 4C7KA 3JQAB 1E3LA 3IC5A 1B3BA 3PK0A 4CV0A 4L73A 4IBOA 4EUEA 1EUZA 4O63O 5KJ1A 3O38A 4XQCA 1WAMA 4DIFA 2ZTMA 3L0DA 1FDTA 5CHEA 1OC2A 4Y9DA 1GCOA 4DPKA 1VSVA 5TC4A 2DBQA 2PD6A 5B12A 4XQGA 2RHCA 2Y1GA 3CE6A 3P2YA 1R4MA 3FTNA 5IFLA 3KEQA 5BT9A 4IXTA 1DDOA 3RIHA 4MP8A 1L1FA 3FSRA 1JWAB 2W2KB 3RROA 5G0VA 3GFBA 1Z6ZA 4EJ6A 2FMUA 2JFFA 2OL4A 4DBZA 4N18A 1LC3A 1QYDA 4YJHB 3GG9A 4CODB 4Q3DA 4YAGA 3IIEA 4NJMA 1W73A 3DAFA 2AW5A 3INGA 4BMNA 3CMMA 1G1AA 3KEOA 3VZRA 3W1VA 3ITDA 1IHXA 1EZ4A 1O0SA 4JLWA 4Z9YA 5JLAA 2PZKA 1Y8QB 2GF2A 2RH4A 4J4TA 3D0OA 5BNTA 3B1JA 4XJTA 1K6JA 3AUTA 4RLSA 4AJLA 4CLHA 1UR5A 3C8MA 4G2NA 3ZWPA 1R0KA 1ZUD1 4W9NA 5I9NA 3ETDA 1N5DA 1K89A 1LRKA 2OMEA 1Y5RA 3JV7A 4FQ8A 3SJUA 2X22A 3DZIA 4B3JA 3BMQB 1T4BA 2X23A 3FD8A 4PCVA 3IKTA 3E1KA 1B8UA 1V0JA 2EIHA 3I1JA 4YTEA 2YFQA 3UN1A 4B4VA 4BNGA 1OBFO 1W0CA 5I7SA 1GPJA 1HDXA 3GEMA 1NTOA 1C1DA 6LDHA 1KEPA 3DC2A 1R12A 1I36A 4WUVA 1B16A 2CDAA 3H8VA 3BHMA 1HE2A 3GEDA 3E9NA 4IJWA 1D1SA 1DRVA 4N7RA 3DZHA 2Q1SA 4CQLA 4UEOA 2DAPA 3PI7A 5JC1A 4JK3A 3TRIA 3B20A 3PGXA 4XYMA 1YVEI 2Q1TA 2J3JA 1HL3A 3PZBA 3RUEA 1J0XO 4B3IA 2AXQA 2O3TA 3CIFA 2I3GA 2G0TA 2OFPA 2FY8A 3UOGA 3IDSA 2P68A 3PJGA 4HV4A 1U3UA 1T1SA 3AK4A 1JKFA 3DZKA 4DYVA 4Q39A 1B8PA 3GDOA 3FCOA 4NG5A 4BNYA 3GFGA 2E4AA 1M6WA 5AXAA 2YQ5A 2DTEA 3A14A 2H1SA 4CR7A 2H63A 3ICCA 3ONFA 3H3JA 4PLTA 1HSZA 3I83A 4RVHA 3WTCA 4EEZA 5HRUA 4IUYA 4XGNA 1M6HA 3ZNQA 5HM8A 4GGOA 5H82A 2BKAA 2NU8A 4AVYA 5A03A 1MA0A 2EV9A 3GDGA 2PD3A 1PJ4A 3K9QO 3PHJA 5THQA 1DHRA 1FK8A 1IHYA 1PJ2A 1M66A 3AY6A 3OM9A 1XELA 2Q50A 4PLGA 1SCUA 3WOHA 4AJ4A 4DIBA 1KY5A 3MJVA 3WWZA 1R0SA 1H2BA 4L0QA 1VLLA 4WCFA 2Z5LA 4Y6SA 3U5TA 5DNAA 4NHEA 5I8WA 4TSKA 2GRAA 1TT7A 2VWQA 4CMHA 4PG4A 2PZJA 5FFFA 5A9SB 1G6KA 1IE3A 1ZVMA 1HDRA 2PK3A 3F46A 3O03A 4BKRA 3L4BC 2TMGA 1EQUA 4CUJA 4RF2A 1E3EA 2Q3EA 5CG1A 2A35A 2Y67A 4DGSA 4PG5A 1DIRA 4AJPA 2LDBA 3Q3CA 2WD7B 1JAXA 3M6IA 4A27A 5A5EA 1MB4A 1Y8RB 1DO8A 1BXZA 1NP3A 3NAQA 3QRWA 1UP7A 2HQ1A 3DZBA 3EHEA 3C1TA 1PTJA 3UUWA 4CLRA 4J1TA 1LSUA 5IG2A 1EQ2A 1IY8A 4E12A 3ZU2A 2HRBA 1EVIA 1KEVA 4KDFA 3ETEA 4DIOA 1IZ0A 5A02A 2EERA 2O2YA 3ONEA 1VL0A 4D79A 4JQCA 4IQGA 1LXCA 3DAPA 3DBLA 1BRMA 1HLPA 5AXCA 2YY7A 5TQVA 4TRMA 1Y1PA 3C3XA 3MJCA 1NWHA 1UJMA 1X7GA 4ZQGA 1N2SA 1UXJA 1ZEJA 5ICSA 3QVTA 5JDCC 3JQ7A 2GZ1A 2P4QA 4FGSA 4LISA 1QLHA 1O6ZA 5FEUA 3GNQA 4CM4B 3C1OA 1EFLA 1HZZA 3E9MA 3JQAA 1EUDA 1C0KA 3FI9A 4KDEA 4AJ2A 1DBVO 5JYEA 1VE9A 5CPBA 1LDMA 3GA0A 4R68A 2JD2A 3RSHA 3H9UA 1HE5A 1I2BA 3ANMA 2VZ9A 4PFJA 3MOGA 2ZATA 4QFCA 3RU7A 3F47A 4NU5A 4O6VA 4Z9XA 1DIAA 5L7WA 5EINA 4XKJA 4A0SA 1NR7A 1X7DA 4P4GA 3H9EO 1P77A 4TVBA 1NASA 4CM4A 5JDIC 4UUPA 3VZSA 3EDMA 5DOVA 3LLVA 3PGJA 3W8EA 4C4OA 1R0LA 4NR0A 3DBHB 1DOHA 3GZNB 3SVTA 1U4OA 3O9ZA 4F46A 2Q2VA 4MVJA 4PLHA 4L4XA 4XGIA 2W2KA 5CFZA 2FR0A 2O3RA 4B4UA 1P1FA 1HYHA 1I32A 1UXGA 4R4JA 5JFOA 2Q4EA 5IXSA 3RC9A 1NPYA 2UUPA 3KLMX 4R1TA 4W99A 1C0IA 1QV6A 4AJ1A 3RUCA 1LSJA 4PLYA 5B4VA 3M1AA 3O8QB 1FDUA 3OIFA 2CNBA 4NFYA 3MTGA 4NK4A 2AA3A 3Q1LA 4BNTA 4OSPA 2DTDA 1ZK1A 3WNVA 4S3MA 1PEDA 1VJ1A 1E3WB 2CFCA 5TF4A 3HHPA 3JQGB 5TT0A 4RORA 4TRRA 1E7MA 4N5MA 4FOOA 4MP6A 4DUPA 4E5KA 3TZQA 1BHSA 5L40A 5TNXA 5I7FA 1QKIA 3PRJA 3QP9A 5DT9A 4PZCA 3AUAA 2BD0A 2CVZA 4IXWA 3COSA 3OIGA 2EJWA 3Q2IA 1YS4A 1I01A 3UCEA 3BMQA 3GC6A 3E48A 5DDIP 4YAKA 1DRWA 2CY0A 4O5OA 1P1KA 3I4CA 5F1OA 4D44A 3ZWVA 4GL4A 3TWOA 5EJ2A 2HUNA 4TRJA 1DC5A 4NH4A 4W4TA 4LVUA 3N58A 4OQYA 1YQXA 3U62A 5MDHA 4EYEA 4XX0A 4CMBA 4NBUA 1I2ZA 4CM1A 5ICMA 5IZ4A 1O5IA 4GKBA 3V1UA 1U5CA 3GT0A 4M89A 4RZHA 4ITUA 3H9JA 1I5RA 4GWGA 3EK2A 1BDMA 2P9CA 3P19A 3G49A 3H5NA 4I9NA 1K5HA 1NVMB 4PZEA 4ID9A 3OJEA 4CLDA 3DTTA 5T64A 2P5YA 3AUSA 1NX6A 1TXGA 2JL1A 2IXAA 4BV9A 3PWKA 1ENYA 1LTHR 1WNTA 1ZMTA 2QRJA 3LYLA 5T67A 3ANLA 4ZGWA 3JQBA 4R3WA 4JP3A 3K30A 5TJHA 2J6IA 1ZZEA 4J43A 4BKQA 4WLEA 4BO5A 1YOVA 1NM5A 3LVFO 5U1PA 1BW9B 2CVQA 1H6AA 4J9VA 5L3ZA 3WIDA 4AICA 4QSMA 3WG9A 2DBVO 1VSUA 3ETGA 5G4KB 3GEGA 2R6JA 5JAQA 4A03A 2HJRA 3LZ6A 4ROSA 2CF6A 2O4UX 2GR9A 1QG6A 1YB1A 2XAAA 1LSSA 2IEBA 3I9LA 4MKZA 2OGUA 4UULA 1GCUA 1NQOA 1PJBA 2P5UA 3KO8A 2BGKA 3K73O 3GVPA 3QVOA 4KMSA 3S2EA 4YQZA 1CWUA 4ZU3A 3I9JA 1CIVA 1A4UA 2VT2A 3VTFA 2AE2A 1YB4A 3HZZA 3T4XA 4HUJA 1O8CA 8ADHA 4CPDA 2I3AA 3RUHA 4ZN6A 1U1IA 3PPIA 4II2A 3A06A 4YACA 2FP4A 3KVOA 5A9SA 3HNPA 2G82A 2C7GA 4B3HA 4YQYA 3I9KA 4DLBA 2OBNA 1LRJA 1C14A 4ZICA 3B70A 2C20A 1ULSA 3ANNA 3IMFA 3GHHA 1RKXA 2QHXA 2PZMA 4QUKA 1MFPA 3AY7A 3SXPA 4DQUA 2B5WA 3GUYA 4ZJUA 1U5AA 4JJGA 1KC1A 3QVXA 3ZWAA 4OHUA 1JQBA 1P44A 5L7YA 3NGXA 5I9MA 4H15A 4AJEA 5BSFA 1LDYA 2FZEA 2DUWA 3UCXA 4D46A 4L76A 5A06A 2OP0A 1HXHA 1T24A 2OBYA 3NJ8A 2CZCA 1YQGA 3GVIA 4U0JA 1PGQA 1ZJYA 1DHTA 2V7PA 3LT0A 4ND1A 4PRKA 1XA0A 3MWDB 2JJYA 1ZXLA 1DFIA 1GQQA 3WTBA 2A9FA 2X8LA 3F6YA 1SB8A 1B14A 4GH5A 1UXIA 5L45A 5F1PA 3ZWNA 2VRBA 4ALLA 5ILOA 2YV1A 1LLCA 3BTOA 1PWXA 1KIFA 3GNSA 4Z0TA 3HN2A 1I24A 4KZPA 4E32A 2WE8A 5LCXA 5ITVA 1VRWA 4HY3A 1YBAA 4R1NA 4M49A 4YT5A 3UGKA 4BQRA 5IAAA 1NQ5A 2B5VA 4L4SA 4NMHA 3WS7A 2PLAA 4ALKA 4YAIA 3W6UA 2EGHA 3JQ8B 3PLNA 2NVUB 2Q4BA 2O2SA 4NK5A 3ONDA 4GVLA 4INAA 1UXHA 2V6GA 3QVSA 1ADGA 1D3AA 1E77A 2NVBA 1MV8A 3RI3A 4WPGA 4Q3EA 3EY4A 4RQTA 1DC4A 4WLUA 2NU9A 4DLAA 4BO3A 1KERA 4B8ZA 4MVJG 3S2IA 5KVCA 3GZNA 3NT5A 1B7GO 3LQFA 1KVTA 1YDEA 5IDXA 3LSYA 2WTBA 3WWYA 2XXJA 3SC6A 4CJXA 3GDFA 5LDHA 1J5PA 2PY6A 4EJMA 2BRUA 3OQ6A 4HXYA 2P91A 3UKOA 3VKVA 1ISIA 4K6FA 1V3UA 3E5RA 4EW6A 1I3LA 1EK5A 1H5QA 3SC4A 5JW6A 4IMRA 1HEUA 1LQTA 1SMKA 1A9YA 3UVEA 3P2OA 2GYYA 4J49A 2HMSA 3GNTA 1Z82A 3D3WA 5CG2A 1X0VA 2Y0EA 4RLHA 1E3SA 2Y66A 2R2GA 1VC2A 4DBVO 1GFSA 1UZLA 1Y81A 2YV2A 1Q0LA 3BTVA 2O3JA 3GOHA 3ZWOA 3G1TA 3KZVA 4K6CA 1PWZA 3QSGA 5G0UA 4YCAA 1ISFA 2Q99A 4OOFA 1WDKA 3ENNA 3EZLA 4AJIA 5FF9A 4XJSA 2HO5A 2YHIA 4ND5A 1H93A 4OQZA 1Z75A 1PS8A 4JP2A 4J7CA 1BSVA 2GN8A 3I52A 1R66A 4YDRA 4I9HA 4BNNA 4PLZA 1ZFNA 2PZLA 4BNMA 4WEQA 1NHGA 2EW8A 2NNLD 3MOIA 5I8ZA 3H7AA 3WBFA 3WSWA 4GSLA 3LF2A 2X5OA 3D4NA 2FPPA 2OOSA 2OO5A 1VKNA 4FJ0A 2IYPA 2B4TO 3JCZA 3DZGA 1BXGA 2NU6A 1V3VA 4XWYA 1PR3A 2I5PO 3H5RA 3NGLA 4NJOA 5JDCA 5JE8A 3TF5A 4FSHA 4B4OA 1M2WA 3L77A 2HMWA 3QA9A 2X5KO 3ABIA 1ZIDA 4N54A 4J2OA 4QX6A 3BMOA 4Y8VA 5G4KA 3TNLA 4YJGA 1GZ6A 1LNQA 2FSVA 1HETA 4MVJP 3AI3A 1GYQA 4C7JA 3T7CA 4PN3A 2C2XA 1NFFA 2X9NA 1B0AA 1O9BA 1XSEA 4DYDA 1GV1A 1FXSA 4Z0HO 1LA2A 3NEPX 3GGOA 5IJZA 1HYGA 4JCOA 5JDIA 4AJHA 1Z7BA 2JHFA 2W8ZA 2ZB7A 3O26A 3PP8A 5A1TA 4I5EA 1F17A 1HDOA 3MZ0A 2HK8A 4NU6A 4A73A 1GUFA 2NTJA 4J4HA 1PGNA 1LC0A 1JAYA 1SEVA 1ZSYA 3I3OA 1NBOA 3WQQA 2ZK7A 4WOJA 2DPGA 4TQGA 1GQYA 1X13A 3DO5A 4J9UE 3AW9A 5ADHA 3JQAD 2IEDA 4R3NA 3AM4A 1XQ1A 3G0OA 4TZTA 1T2DA 1P33A 3GLQA 5F5NA 5F21A 5KNLA 1I0ZA 1KETA 4TKLA 4LVCA 4UEKA 5DP2A 3ZZNA 4QO7A 1DPGA 2ZTVA 4R41A 2BF7A 2Y93A 2NTNA 2PGDA 4MPDA 3OSUA 5EQFA 4KUGA 4QECA 3MEQA 1Z74A 5F3RA 3F4LA 3GF4A 3VDQA 4H16A 4MVJD 3BMCA 3HSKA 4KWIA 3JQBC 4BQPA 3RUAA 3RFVA 4ZQHA 5EIOA 4RVGA 3VAZA 3ZWWA 1M76A 1F06A 2BGLA 4RGBA 1QSGA 1FF9A 1ADCA 3WIEA 2I6TA 4R5MA 4J1QA 2WM3A 1P3DA 1I8TA 3GPDG 1BTOA 3DQPA 3Q2KA 4BO9A 2AQKA 2FPIA 5KKAA 1X15A 3OA0A 3JD4A 3U4CA 2CVOA 4P38A 3VVBA 4AJJA 3R3SA 4LGVA 2WYVA 4M8SA 1JKIA 8LDHA 4UVEA 4BKPA 5G0WA 2D59A 2PA3A 1PGPA 4FFLA 1DLIA 4NBWA 3VH3A 4OL9A 1I30A 3PTZA 1KEWA 1E1LA 4RO0A 3TSCA 4AJOA 4CMIB 5C3MA 4YPOA 4XR9A 3ZN2A 3D5TA 1BG6A 2AHRA 2HMUA 2O3SA 2VTEA 3OETA 3BMNB 2ZB4A 3JQ8A 1K3TA 3EUWA 4CM8B 1NR1A 3STHA 2BELA 4MVJE 3ZHXA 3C7DB 2D2IA 1JW9B 2OP1A 1J6UA 3NDJA 1GD1O 4DC1A 3JQCA 3KRTA 1XHLA 4GVXA 4YBZA 1W8DA 4RVFA 5F5LA 2ZTUA 3IP1A 1UH5A 2G5CA 5KJCA 1ISGA 1YWGO 1SOWA 2FR8A 2WDZA 3G17A 2PGLA 4RL6A 4AFNA 3ZWCA 5DP1A 3WR5A 3INTA 3VPXA 4O59O 3GAZA 3WBBA 4ZA2A 3ZCXA 4GX1A 3EMKA 4I5FA 2GN4A 5CEJA 1T25A 4J1NA 1MXHA 1YBVA 1ZMOA 3RBXA 4DLLA 2IZZA 5AOVA 1PSDA 1IPEA 4IQ0A 3LU1A 4XDZA 3S1LA 1C1XB 3TFOA 5CDYA 5FWNA 3ROMA 2VCYA 3JQEA 4MIEA 2C7VA 4BB5A 3HE3A 2RAFA 2E6UX 5BSEA 4XRGA 4DREA 2A4KA 1PJTA 5A4DA 3VHRA 5JAMA 2G17A 1ZBQA 4RPGA 5JPIA 4ZD6A 3K2EA 1MC5A 4XR4A 1QV7A 3ZH2A 3CTMA 5ES3A 9LDBA 5GZ6A 3MCVA 1RYDA 4W82A 5G4LA 5L7TA 2YDXA 3ZU3A 1F8FA 4HFRA 3RUIA 1Q7BA 2VUTA 5T5QA 2PKQP 3QWFA 2O3QA 4J91A 3D4PA 1XEAA 2GDZA 1R4NB 3E18A 2H5LA 2J5QA 5BSHA 2AG8A 5TLSA 2VUSA 3JYOA 4CL8A 1ISMA 5TIIA 4CV1A 1K6XA 2FSSA 3F1KA 4FN4A 1LI4A 3CUKA 1WZEA 4GX0A 3OP4A 4WASA 1WLYA 2RBEA 1PL6A 1PZHA 3TL3A 4XYLA 1SC6A 4ALIA 4K28A 2IYOA 3QJ5A 4Z0PA 2ZCVA 3ICPA 3CSDA 2O3UA 4A5OA 3LC2O 2ZJ0A 3R1IA 2VYNA 1U2GA 1OI7A 2JCYA 5I7EA 1O95A 1NXQA 2C29D 3CINA 5DOZA 1VL8A 1C0LA 4ALNA 1S7CA 4PG7A 4BB6A 1KBZA 3EAGA 1I3NA 3KHUA 4WNCA 4ALJA 3HADA 4Z9FA 3IAHA 1UDAA 1VI2A 4IZHA 3JQFC 3PJDA 4ZQEA 4ESOA 4L4RA 2XPCA 4UUNA 5ER6A 1U7TA 4CMCA 5DBIA 3HB5X 4CMJA 1JTVA 3QWAA 2B36A 4JBGA 4JNKA 1IULA 3WFJA 4OSOA 1GZ4A 3KYDA 1RPNA 2A94A 2DVMA 3L9WA 2PR2A 3QE3A 3WQSB 4BKOA 1HT0A 3EVNA 3DONA 4DA9A 3ZHBA 2BI7A 5H83A 2XOXA 3TZKA 4YT8A 4JROA 4N5LA 4D42A 4GAEA 3PQDA 3KYBA 4ND4A 4R1UA 4XCVA 1CJCA 1F8GA 3DBRB 4YRAA 3PFFA 2J3HA 2Y1DA 4CR8A 9LDTA 2BFPA 3H2ZA 4JBHA 3WGGA 2GUGA 5CDSA 2HMVA 3D4OA 3RUFA 1HKUA 1P0FA 2YUTA 4CLEA 2Q45A 3HG7A 1PJSA 3KSDO 3W4JA 3Q9UA 1U8XX 4BHTA 1DFGA 2OHXA 5L9AA 1ZO8A 4DPLA 4ND3A 2BHLA 4CLOB 4E5YA 4H7PA 1CETA 4OGWA 4QO8A 3X2FA 4D43A 1N9GA 3KYCB 5EPOA 3WQRA 3JYLA 1OFGA 2NADA 5KCZA 1Q1NA 2EG9A 4GMFA 4WJZA 1YQDA 3EZYA 3VC7A 2XXBA 4OAQA 3ITKA 3BZUA 2ZYGA 1ARZA 3DWFA 5FI3A 2UAGA 1CRWG 1MFZA 4DL9A 1F14A 1TT5B 3C85A 1D4FA 4PGFA 3LF1A 2AQIA 2VN8A 4L74A 2BGMA 3GK3A 5J23A 2J5RA 5JCJA 5C7OO 2X6TA 6ADHA 1IOLA 1WDLA 2NUAA 4IDCA 1B2LA 3L6EA 4WLFA 3LLSA 2CDBA 1PGJA 3WLFA 5KWEA 4PVCA 4G65A 3ZV6A 2EKQA 1U28A 1U7HA 2Y0DA 4DQXA 4G81A 4I5DA 5HWSA 1H6CA 2X0NA 2V6MA 3UCFA 4Z3KA 5JXWA 3B6ZA 4DC0A 1T2AA 3RAJA 3AU9A 4JGBA 1BVRA 4WCDA 3D5QA 1FMCA 1GAEO 2AEJA 3FNGA 4Q3AA 4YJHA 4YT2A 4GLOA 2DBRA 5FI5A 1V6AA 4BNKA 5L4LA 5KOIA 2JD1A 3R6DA 4FIZA 4ZQFA 3RVDA 2B83A 3U0BA 3GVCA 1MGOA 3U4DA 4IIVA 3FNHA 4NNJA 3OIDA 1Y8QA 1A7AA 1B8VA 2Y68A 2Y1OA 2C5AA 3B1KA 4FC6A 5GMOA 2CDCA 4M55A 4Y67A 2BFMA 2VRCA 1ZK4A 1XDWA 1FDWA 2DQ4A 5CP8A 2AQHA 1PQWA 1OC4A 3GGGA 3I9NA 5AXDA 1GTMA 2HU2A 4UVHA 3TZCA 1HDGO 3G79A 3JQ6A 3MJ4A 5DBFA 2PKQO 3IJPA 4TKMA 1C1XA 2OORA 4XD2A 1EMDA 3LK7A 4B7XA 5L4NA 4YRBA 3FN4A 2QQ5A 2AE1A 4M1QA 4YJDA 2PNFA 4XA8A 2HSDA 5G2OA 4FGWA 2FN7A 4CM7A 3QV1A 1ULUA 4E30A 2W4QA 3ZU5A 3FWZA 3KB6A 1LBEA 2B0JA 4QQRA 3PQFA 4TVOA 3RQSA 3F4BA 4R69A 1AE1A 3UAGA 1OZAA 4IDBA 2NQ8A 4EJ0A 4BNWA 1HSOA 1EE2A 1HE4A 2GO1A 5B4UA 3FR7A 3WGYA 3WFIA 5HTOA 1E7RA 1E7QA 1YGYA 3WYBA 2F00A 4CMKA 3E82A 4UREA 4CM6A 3AM3A 3JD2A 1GADO 4UEJA 2NM0A 3AOEC 4I8XA 3ZNOA 2FHSA 5C7IO 2X9VA 1NVTA 3AFNA 1AXGA 4JIGA 4L9RA 5EQDA 4D41A 4FFRA 3TL2A 1JN0A 2O48X 3WJAA 1LX6A 3TJRA 2ZYDA 4J4BA 4BMVA 4AJKA 3V5NA 1V3TA 2I67A 1YB5A 2Y0CA 4HFJA 4XB2A 2CD9A 2LDXA 3RC7A 2C2YA 4FW8A 4J3FA 4TROA 3I6QA 5JS6A 1JVSA 4KQXA 3NTRA 5DCWA 4E5NA 5KVQA 3KV3O 2ZYAA 1DIGA 3H5AA 4NPCA 3PHLA 2GPTA 3BAZA 1HDZA 2ZKLA 3G3EA 3KOUA 3NT4A 2HK9A 4BNZA 4CMEA 3RKUA 4WECA 1PJCA 2EW2A 3DR3A 1U3TA 3AUUA 1O94A 1DB3A 2PH3A 3PWZA 3BIOA 4IM7A 1UDBA 4R54A 3WXBA 1TEHA 2QYTA 4BNFA 2W2LA 2WWRA 2WJPA 4OOEA 1R15A 2RIRA 3IQDB 5EN4A 1PIWA 3PJEA 2X7HA 1IZ9A 2F1KA 4J6FA 4HBGA 4FBGA 3RCBA 1F0YA 3EGOA 2BMAA 1TVEA 3SEFA 2D8AA 1LQUA 3TZ6A 1E1KA 2UYYA 3JYQA 3E03A 3SLGA 1JU9A 2P9GA 3H6KA 1WVGA 4OYRA 1UAYA 2WD8A 3KSZO 4E2YA 2WD7A 1EVYA 3ZV3A 3UXYA 3ZW8A 2IODA 4HFNA 1E5LA 1Y8RA 3FR8A 4Q3NA 3NDIA 3PEFA 4E5PA 4B4WA 4HADA 1IUKA 3F5QA 1QP8A 4GX2A 5HA5A 1E3IA 1GEEA 1NVGA 3CKYA 2Y99A 4WNIA 4CM3A 1QMGA 1FDSA 2NVWA 3B1FA 2GLXA 3I6IA 3ASUA 4CUKA 4O1MA 1X0XA 1YRLA 4U6SA 1DAPA 1ZSVA 3H9GA 4CLOA 3O4RA 3DDNA 2HRZA 4UAGA 2Y1CA 4F6LA 2QRLA 1Q0HA 1WZIA 4KUEA 2W98A 1YH3A 4JJFA 3KM0A 3PDJA 5GY7A 1BVUA 2DLDA 4WEOA 3V8BA 4YJFB 3MWEB 4XQ9A 1WW8A 3JQ9A 1NQTA 5CEFA 3C1AA 1J49A 4J1SA 1A27A 4WKGA 5BNFA 4LSWA 5LDGA 2NQTA 1SB9A 1RJWA 4CM9A 5JC8A 3GRPA 3LDHA 2Z1MA 4IJUA 3PHGA 4NBTA 2EJVA 3ZW9A 2GASA 4B79A 2E48A 5EESA 4EDFA 2ZB3A 4ND2A 1P74A 1M67A 3HQ4O 1IYZA 1MUUA 2DM6A 2YHUA 1UUFA 5HBRA 1QR6A 4GSKA 2VYVA 3LT1A 4RPKA 4Q3CA 1LLDA 1QYCA 1WMAA 3NRCA 4QXMA 1XU9A 2DFVA 5IDQA 1N7HA 5THKA 1R4MB 3X2EA 1XWFA 3DBHA 4OXKA 1QRRA 4XRRA 4P4NA 5DCYA 3QWHA 1SOVA 3DB2A 2PTGA 1JLLA 1JKJA 1XIVA 4HNGA 1KVUA 3TZHA 1KVQA 3OICA 3AWDA 4I5GA 2HCTA 4JX8A 1NFRA 3GR6A 1X1EA 3OEWA 3O8QA 3RC2A 3VOSA 2I9PA 3V1TC 2VQ3A 4RVSA 4I1IA 4JXKA 4JN6B 4FS3A 3JQFA 4EI2A 2Q49A 4CQMB 1PJLA 4RZIA 5BSGA 1E3WA 4WOKA 5U4QA 3JQGA 4URFA 5COBA 3OFSA 2VYND 3ST7A 3RBZA 1J4AA 4K9DA 2IE0A 2W90A 5IN5A 3GRKA 3N74A 2GSDA 4IJVA 4TMFA 3GMDA 3L6DA 4MP3A 4BOYA 3MJEA 4EITA 2I99A 3DHYA 2C5EA 3BA1A 4LSMA 3NV9A 1EEHA 1N1EA 3LT2A 3RASA 4NQZA 3VH4A 1A72A 4IGEA 4BMSA 1DRUA 4FFMA 3C7CB 3GY0A 1ZK0A 3RC1A 1I3KA 1E7WA 2HLPA 1XKQA 4MO2A 1YL5A 4KTTE 3KBOA 1C1DB 3S2GA 1I3MA 2JAPA 3RFXA 3OJOA 4D45A 3FTPA 3GH3A 4AG3A 1P1IA 3OJ0A 3M2TA 4JJIA 2D1YA 4PVDA 3VZPA 5ENVA 4CQLB 3DEYX 5ILGA 3T4EA 4CV3A 3WX0A 2QYSA 3ULKA 4BS9A 3PHHA 5ENDA 4M54A 4IZIA 2IRWA 3VPGA 1YBMA 1V35A 3FHLA 5AXBA 1XQ6A 1PZGA 1EK6A 2C07A 3S2FA 3PFWO 4DMLA 1LLUA 1BW9A 1I33A 1WWKA 3ZHYA 3NTQA 3WB9A 5H81A 2PKRA 2Y1FA 1MX3A 2WMDA 4XB1A 3UH1A 5GZ1A 2Q2QA 4IJKA 5JO0A 3H4VA 3K8ZA 1GPDG 3PIDA 3OQ1A 4ZRMA 4B7CA 4RV9A 1DC6A 4E4YA 4RQUA 1GV0A 2GZ2A 5CEEA 4PIVA 1CDOA 2EGGA 1IPFA 5A5FA 3UFXA 2GD1O 1R16A 1ENOA 2D0IA 2ZQZA 1YO6A 1BMDA 3L9XA 5JYDA 2AEFA 4MKXA 2WEKA 7MDHA 2O4CA 5IDYA 4EBFA 2IZ0A 5CAEA 3PYLA 4WCFB 1LDEA 2FWMX 4RVUA 1QYWA 3P5SA 3VPFA 3OMLA 4IDDA 5JY1A 3F9IA 3FNEA 1U8FO 4XZ3A 2QG4A 3ZV5A 3WGHA 3ZGYA 4FJ1A 3RBVA 4BNVA 4E21A 1YONA 2D3TA 2P2SA 3ZHZA 3HUDA 1DSSG 3MTJA 3GN2A 1CF2O 4J7XA 2VWHA 3IP3A 1MLDA 3L07A 1ZEMA 4Z6KA 1I2CA 5JCJD 3TOXA 2VNSA 5BR7A 3UF0A 2UV8A 4GGPA 3OECA 1VL6A 2NWQA 2X58A 4IIUA 1ISJA 4J7UA 1PR9A 1E92A 5IZCC 4J0EA 1ENZA 1YXMA 3PHIA 4FJ2A 2C59A 4MVJF 3VPHA 3QQPA 4CLRB 4YT4A 4DQVA 5G0TA 3PVZA 4J2HA 3DBVO 3PQEA 4LK3A 2EF1A 3HFSA 1EE9A 3R0IA 2G1UA 4NZ9A 3NYWA 1D8AA 1KVRA 1NPDA 2E82A 4RVDA 1G0OA 3NJ4A 2BFAA 4DWVA 4J0FA 2X9GA 5A9RA 2SCUA 3A1NA 3DTYA 3TOZA 1IL0A 3JSAA 3VVCA 4CMGA 1Y6JA 1K2WA 3KLPX 2AQ8A 1T4DA 2Q2WA 3DBLB 3OJFA 1EBUA 1Y7TA 4FFOA 5KVVA 2QZ9A 1PJQA 1X7HA 1Y9EA 3PXXA 2FOIA 4II3A 2VRCD 2JCVA 2NV6A 3K6JA 3AI1A 4RF4A 4BGUA 1LRLA 3QVWA 4CMEC 1T26A 4OM8A 4XIJA 2ZJ1A 1PJ3A 3BXXA 5JMPA 3C7AA 3E5MA 3ROQA 3JQ7B 4G5HA 5I9LA 3DHEA 2O50A 2E37A 1ZK3A 4RF3A 2HAEA 4KUHA 1RM5A 1EBFA 2NVUA 1ML3A 4PRLA 2UVDA 5HS6A 2I76A 2NU7A 2PFGA 3FBTA 5T8KA 3WYEA 1E6UA 2JFHA 2QZZA 3AOEA 3U49A 5U9CA 4Y6RA 3H2SA 2DUUA 1S6YA 1TB4A 1YL7A 1UXKA 2C0CA 2ILTA 2I65A 3VH1A 1DFHA 1H0KA 2ZCUA 3OA2A 4D3FA 1AUPA 2C82A 2P9EA 5TT1A 1T2EA 2IZ1A 2RHRA 5TJ9A 3HN7A 4LN1A 3BTSA 3JYPA 1ZH8A 3RUDA 4PG8A 1W6UA 1EVZA 1VJTA 4UVDA 4A10A 1E7SA 1HTBA 1E3JA 3IKVA 2TMDA 5B37A 2FRDA 1LDNA 1XCBA 4HNHA 4MVJI 2R00C 4CUZA 4XGKA 1BGVA 3CEAA 4FFNA 1XLTA 3GG2A 4RDHA 2Q1UA 4XYGA 1SBYA 4IDAA 1Z45A 1SAYA 2PV7A 3ZWMA 4DRYA 2OXIA 3ON5A 2HKIA 2YZ7A 1RWBA 2J3IA 3LT4A 3FNFA 2V6BA 1MXFA 1PS9A 2V65A 2DPHA 3QIVA 4BNJA 4FOSA 4KP7A 3JD1A 4CQMA 3K31A 4FCCA 3TN7A 3RKRA 4OJNA 3ENKA 7ADHA 3DMYA 1C0PA 1X14A 2FPGA 4CV2A 1XGKA 2H9IA 3C24A 3VZQA 1NAHA 3JQ9C 1NHWA 4FR5A 1UDCA 1A9ZA 5T57A 2ZIZA 1CERA 3TFQA 3HDJA 2B37A 3AU8A 2CUKA 4AJNA 1ID1A 1GY8A 1EUCA 3WNQA 3EVTA 2GN9A 4RF5A 1AGNA 3HFGA 1A5ZA 2VTDA 4CLXA 3ZWBA 3D1LA 1N92A 2W2LD 4PG6A 4XEHA 4E2XA 4D0SA 2EKLA 1LU9A 2AG5A 3FPCA 5JY6A 3U09A 5JAZA 3AOGA 3U3XA 1V8BA 2EXXA 4RPHA 5DF1A 5EMHA 1OOEA 1ZXBA 4OXNA 4XDYA 4LCEA 3OHSX 2XF8A 4E31A 1FJHA 3PZRA 4WLOA 5C7LO 1WPQA 4ILKA 4I08A 5BQFA 2FR1A 4M87A 4O0LA 2O7QA 4OH1A 1DJQA 1SNYA 3OH8A 3S8MA 2PGJA 4OIMA 1AN9A 4EGFA 1RM0A 2IXBA 4YWJA 2PH5A 1DAOA 1U3WA 1HZJA 2EP5A 1LEHA 1UAGA 4FPXA 5KJFA 1YOVB 1GL3A 4W7HA 4BV8A 4FDAA 1H6DA 4FFPA 3QY9A 1ONOA 1U9JA 5KTKA 1CQJA 1ADBA 4E6PA 3IUSA 4MVJH 2BFOA 5EL0A 5CPFA 3EW7A 4OKIA 2VHWA 1IB6A 1KEUA 1Q7CA 2J5KA 3GMSA 4I9UA 3VTZA 1R6DA 5BNIA 2YV3A 4NFHA 2VWPA 1HF3A 1XYGA 3NDRA 3WDSA 4EEXA 2J8ZA 1BXKA 2D4AA 3DZJA 1ZW1A 3W6ZA 1I10A 1P1HA 2O7SA 2DU8A 1B3RA 1Y5MA 2H6EA 2Z1NA 4ZHSA 3E8XA 3A9WA 5JMWA 5DN9A 1SO8A 1TA4A 1ZSNA 3U4IA 1NAIA 1O89A 1PX0A 4CM9D 2DT5A 3SX2A 5AQ1A 5CDGA 5K6AA 1GYRA 1VM6A 2P4HX 1KYQA 1PL7A 3PYMA 1LDGA 2VUUA 4QFDA 3SJ7A 1MC4A 3EYWA 2A92A 1SZJG 1KS9A 3W8FA 1NWCA 2YFHA 2VYVD 3KUXA 4EUFA 4CM5A 2I66A 1HE3A 4Y98A 1RM4A 1WMBA 1HRDA 3WSVA 1LDBA 3DOCA 1CYDA 2ZB8A 4HWKA 4ZRNA 1YE3A 2VWGA 2X0RA 4MJLA 4D3DA 4PLVA 1QXSA 2G76A 4Y6PA 3QWIA 5K0ZA 4BO7A 2EWMA 5EERA 5I7VA 5JO9A 4BO8A 1R37A 1HYEA 1ONNA 3HWRA 1AXEA 4R9RA 2GERA 1P31A 3JD0A 4A7PA 5IN4A 3F5SA 3UW3A 3F3SA 1PZFA 3CZRA 1QYVA 2YQ4A 2JHGA 3WJ7A 4GQAA 3QWBA 2HMTA 3RWBA 4ZQBA 4A26A 4CMIA 1YJQA 1JWBB 1QORA 4AL4A 4F6CA 4N5NA 4K1LA 1AHIA 4DXHA 3OJLA 2JD0A 3BMNA 3KSUA 3W4IA 4CM8A 5TRTA 2VHZA 4IDGA 4NFSA 4MDHA 2UUOA 3FPLA 1PU2A 1WDMA 4YRDA 3K5PA 5L51A 3GGPA 2X0JA 1T2CA 3L4SO 2WYWA 3ZNPA 5AVOA 1U3VA 3INRA 4UVIA 2GGSA 3GPIA 4BGEA 4E3ZA 5ER9A 2JAHA 1CQIA 3PLRA 3RD5A 1L7DA 1GU7A 1PS0A 4B8WA 5KKCA 3WLEA 2RH8A 5B4TA 1DLJA 3VDRA 4L8VA 3U9LA 1WXDA 1KC3A 4OMUA 4BGIA 4W6ZA 4ZVVA 2X0IA 4KWHA 4MOWA 4WE3A 1H9AA 5C37A 4IGFA 4Q3BA 4CR6A 2B4QA 2YJZA 4UUOA 3ORFA 5C5IA 4M86A 1ORRA 3ADPA 1P1JA 3DZFA 5DBGA 3DMTC 1ZK2A 3DOOA 3D3WB 2EHDA 4OKNA 4MIOA 4CMAA 3GQVA 4DPMA 2YYYA 4NBRA 4MIYA 4EZBA 1DC3A 3TQHA 4BO4A 1P9LA 1TLTA 3G1UA 3T7EA 1W4ZA 1DIBA 4PZDA 2B4RO 2DBZA 4F45A 1E1MA 3PJFA 4QEDA 1H9BA 3RJ9A 4D0RA 5L4SA 5LC1A 1P0CA 1MG0A 5JBIA 2YHIB 1NYTA 4GMGA 3HDQA 5IZCA 3DL2A 1GUYA 1C3VA 3HB4X 1R4NA 5T8KC 3GHYA 3WICA 4IDEA 4WLVA 2V6FA 1H6BA 4YA6A 1Z73A 4YVFA 3IOYA 3QHAA 2QW8A 3TPCA 4BL5A 3OBBA 1E6EA 5HS4A 5COQA 2VZ0A 4HKTA 4BNXA 3QLJA 4E13A 2UDPA 1OAAA 4E33A 2JKVA 5JNLA 4PLPA 2X86A 2DFDA 4NBVA 1FDVA 2Y05A 3AFMA 2PWZA 1BXGB 3SLKA 2DC1A 3P7MA 3ZNNA 1MG5A 2ZQYA 1H2HA 1P1RA 2DTXA 4KOAA 5IDWA 1Z7EA 3BMOB 3I23A 4YJGB 3FBGA 3W4KA 1AHHA 3K2BA 2NACA 2OUIA 3OF2A 3K92A 1SPXA 2NLOA 3UICA 1Q7GA 3Q0EA 4U7WA 1E0DA 1V9LA 5A05A 5L53A 1N7GA 5KJEA 5TSDA 2DKNA 4MINA 4W9NC 4LRTB 4RCVA 4RJTA 5DCUA 5COAA 4FD3A 3GVXA 3V2HA 3BHJA 5G0SA 4YXFA 2D5AA 3AM5A 3IJRA 4GLLA 4WGGA 2VT3A 3AJRA 3HDYA 3HDHA 4HX5A 3FF4A 3L6OO 3A4VA 4PLWA 4QTZA 1XR3A 3DXFA 4WLNA 1LSOA 3DBRA 2VZ8A 4YYZA 4BNUA 5CDTA 2ET6A 4R51A 2R00A 3BTUA 3FWNA 5B1YA 3KTDA 1A4IA 1UZNA 3V2UA 1A7KA 1NPTO 4L75A 3BHIA 1HDCA 3D3EA 3CZMA 1P45A 4KTVE 3VPSA 1F12A 2QIOA 1U4SA 3QW2A 4YAEA 1HWYA 3W8DA 3Q9NA 4X54A 5IF3A 2B35A 4GX5A 4IINA 5T6BA 3NT2A 3KETA 4BNLA 3DFUA 1N8KA 5A9TA 1BDBA 4LW8A 3BMCB 3AI2A 3JQDA 1GR0A 2RCYA 2VNAA 2HJSA 3KYCA 4YEDA 1MP0A 1UZMA 4Q9NA 4TWRA 3JYNA 1LUAA 2CF5A 3V1YA 2BLLA 4NIMA 1ONPA 1VPDA 1Y9AA 1CEQA 2AEMA 1GEGA 5GZ3A 4ONEA 4GI2A 4XYEA 1H94A 3E6AA 4RDIA 5DZSA 2E49A 1G0NA 3SBOA 4S1VA 1TT5A
chains in the Genus database with same CATH superfamily
3UJBA 3EZGA 5K0TA 4F3TA 5BOVA 4RFSB 5EKTA 4PO9A 3MINA 4R7ZA 5AKEA 1YI0A 4JR1A 1HYQA 3BJZA 1QS0B 1SN7A 4D7AA 1CY7A 4GPD1 2WB4A 1ZM3A 4H1UA 5TGDA 2BKVA 4PQEA 1G20B 5DPMA 2C54A 2IYAA 4GBJA 5LLSA 1CD5A 2VHXA 4U7GA 2PVSA 4F5DA 5LYJF 4LF4B 3IEKA 1Q0TA 3M2PA 4Y7DA 2AC7A 1OBOA 4E2WA 2W4IA 3CMCO 4LBZA 1JEDA 1A1SA 1BJRE 1E5QA 4LMRA 3ZXYA 2B69A 3L8EA 1R4ZA 4DVJA 5K6AC 4X65B 2PJUA 3EJ6A 3P0IA 4JBIA 4EVQA 1QF9A 3MGBA 3HLTA 1OZFA 2PRJA 4HVAA 4LYJA 2QORA 1GQRA 2D0OB 4BATA 2YYSA 1T3TA 1U2RA 2ZYVX 3R3JA 3H75A 1D4AA 1XG5A 3MJTA 4GPAA 1A9QA 1V96A 3TW6A 1K27A 4IXMA 4UUMA 1PUXA 1E7YA 4JODA 4AWBA 3VM6A 1K7EB 5CX4A 2FQXA 4V24A 4Z7OB 3PWSA 4BNHA 4HEA6 3PC8C 2BH9A 3EC2A 2IUSA 3RB8A 4ARSA 1FUUA 4L3WA 4Y1RB 3LUKA 4EUHA 2JCXA 4MUMA 1BEZA 1KDTA 2P9QA 4Z2AA 2HWXA 2I7TA 1UFKA 1JHVA 5FOSA 4PZPA 2ZI3A 5KI6A 3KEGA 1XAHA 4NBLA 2OZLB 3F73A 1PQPA 2EU8A 4LWOA 2I6XA 5KHLB 3IUPA 1C7IA 1B26A 2ZRFA 5DBHX 2CNDA 2D2FA 4UTZA 1PJ8A 4TMWA 5CB6A 4WY8A 2I7VA 3GFQA 5IXYA 2NSLA 4XYBA 4YO8A 5FFMA 3V8PA 1JS1X 1PW7A 4MGKR 2NX2A 1ZD5A 1RZVA 2YW2A 3ZV4A 3J7AC 3ZWXA 2NSDA 3FUXA 4QELA 4XVCA 3LA8A 1K08A 1WUTA 2R7AA 4KQWA 4P22A 2YFKA 3U2QA 4NQRA 3TPFA 4ZCQA 3L4BA 1UPUA 1SUFA 1R4AA 5LYJB 2A7XA 3A3PA 4U0KA 2QVGA 1ODLA 2QK4A 3K0SA 4QWMA 5JSFA 1A50B 1SBIA 2BFDA 1PJAA 3IIJA 2ZRIA 3RDPA 1SXJD 1HZZC 2JA2A 5LQJA 1ZCFA 2Z95A 3FOZA 4B0OA 3P94A 2PUEA 1IOVA 2AH5A 4LOKA 4BLOA 2I6GA 1YVDA 4AMGA 3KBBA 2QE6A 5TB5A 1HPLA 2DE0X 2HC9A 4BFZA 4E0BA 4Z2YA 2YWRA 3OURA 1KO5A 1RRKA 4E1BA 2RGDA 3PXUA 2ZZNA 3SMVA 1KZ9A 4F8EA 3ADOA 1R9NA 3RFTA 3K6SA 1K5PA 5KSYA 4N49A 5D5PA 2KLBA 4Y6QA 2GF0A 2PGIA 4PO8A 4YQEA 1K6IA 2Q1WA 5JI3E 3WHPA 1OASA 4M7WA 5JNWA 1O0BA 3MJSA 1MV5A 2BTQB 2EKPA 4PXAA 1D1TA 2WT8A 3RGGA 4ALMA 2DYKA 3Q3EA 5AHWA 2IP2A 5GJVC 1NURA 1L5SA 3GLRA 4B48A 5GM1A 3PFGA 1E1NA 1SK8A 2VHYA 3WGOA 3CJTA 2JFGA 3R44A 5CTAA 5EVCA 5GQSA 1M7GA 3RVBA 3SZGA 3HCBA 1JQJC 2DUMA 2O23A 5CXXA 5ALNA 3KB2A 1W581 3CX7A 3PYXA 3ZDFA 4IQ8A 3BYZA 3I9MA 4GMDA 4RAOA 4D6YA 3TMYA 3PIIA 3DAGA 4LJ4A 3UO8B 3HFJA 3IDFA 4IMJB 4MUAA 1S2OA 3FCAA 3FPGA 2O8NA 2VXOA 1QHIA 2L19A 1DEHA 3EIQA 1QYXA 4MAAA 3WRWA 3ZI0A 3V4VB 1LZLA 4RHTA 4DMMA 5ILQA 5HJ5A 5IABA 3H9QA 3R4VA 2AK2A 2GXUA 2O0HA 2H31A 1L5KA 1JG7A 1KQPA 3GUCA 2Z2YA 1ZBDA 4X8HA 2GYVA 2ZITA 2O5CA 3BB4A 5EI5A 5F77A 4B3SB 2W8BA 1R6AA 2FW1A 4LMPA 3QE9Y 3DVLA 3AWIA 4KCGA 1VKOA 1KEKA 1NBMD 4N4AA 5AVVA 1Z17A 1ZAYA 1U2DA 1E4YA 4B7UA 1ZD3A 3HRKA 3DOEA 4Q7MB 4ZOCA 3Q6IA 4IPTA 4GYWA 3PLAE 1RQGA 2QENA 3C3PA 1O96A 2X14A 2HWKA 3NO4A 3P71T 2W2QA 5F51A 1FX0A 1ZCJA 4JYZA 1Q12A 2UXBB 3I5MA 4V1CB 2VTBA 4N7BA 3O31A 2QD1A 1HLDA 2X7JA 4L4UA 2AFHB 3DS8A 3HPQA 4IS2A 4QGAA 4WK4B 3HJAA 2NW6A 2WE7A 1SEPA 4LE2A 4WNAA 2J46A 3H1BA 4O1IA 1DARA 1Y1QA 4JEUA 4RHXA 3S55A 5D6NA 1DELA 4E1VA 2C77A 3WGIA 4HFMA 3ZVMA 2E4VA 4NU0A 4P4SB 3ZQUA 3ONVA 2QTMA 1D9ZA 3H7IA 1UK9A 1V9CA 1QLJA 2B2CA 2V98A 1UMDA 3L02A 4ND8A 5CYFA 3NTOA 1X1TA 2WZBA 3FSJX 4C7KA 3IC5A 5CVJA 5JMTA 2OHJA 1B3BA 3GD7A 1V16B 3CUYA 4I8DA 3MT9A 4JVSB 2PEYA 3O38A 1ZJ5A 4DIFA 1JU4A 1M2HA 1OT5A 5BV1A 4WINA 2BUBA 5D00A 2R60A 4N65A 4KGZA 4QARA 4L5JA 1FU8A 1GCOA 1ICEA 5TC4A 1MQ9A 2YZGA 5K8LA 2BEJA 2ZIXA 3AJEA 3RAFC 3ONWA 1ILWA 2X8JB 5JWRA 1R6XA 3FTNA 2ID4A 4E7OA 1IBKB 3FOCA 4LYFA 1G8MA 2K87A 4MP8A 3PNLA 1UMBB 2QZSA 4DMHA 1H05A 1JWAB 1KK3A 2FKNA 2VDLB 2ZI4A 5G0VA 3RROA 3S29A 5B3JA 4DBLE 3K9BA 2R6GA 4P1ZA 1RLUA 1PK8A 3DYBA 4KJXA 3VDMA 1OCEA 5C8VA 5J47A 1QYDA 2BP7A 2G25A 2QL7A 4CODB 2CCKA 2YOHA 3V97A 2AW5A 2ZUWA 3INGA 3OLYA 1GAXA 1G1AA 3OPQA 4YRQA 4YRNA 4ETIA 2GKOA 1NXVA 1BU5A 5E7IA 3MAJA 3ZHTA 3ZVKA 1O0SA 4H17A 4JLWA 4B84A 1GP2A 1XTJA 4UDOA 1Y8QB 5AHOA 1NV8A 4C2AA 1QAOA 4COKA 4F8YA 3ZWVA 2MOKA 2BM0A 5BNTA 2QUJA 2Z6QA 4MAFA 4OSEA 1UBNA 3A9UA 4LXGA 4YRPA 4LY9A 5DGIA 4Z0NA 4G2NA 3ZWPA 2C92A 3MRXA 3S6JA 1ZUD1 4KR2A 3OX2A 1T6ZA 3WLJA 3OZFA 3PDIA 4KEAA 5K3EA 3L8HA 4WZ6A 3SJUA 2X22A 4X9XA 2LIPA 4JA2A 4US0R 1H0SA 1T4BA 5C4IA 3IT3A 5HQ3A 1FP4B 4O4LA 4KW7A 2HLHA 1RMTA 2FG5A 1V1MB 5J59A 1X87A 1NI5A 3ZS8A 3E1KA 2EIHA 3I1JA 4B4VA 5HKBA 2YFQA 3KKKA 4KKVA 4LVNA 3OOYA 5TQ2A 3A4TA 4E3WA 1JSXA 1TNDA 4QQNA 3SYNA 1G3RA 1C1DA 1SHZA 1XDZA 2QGZA 2FB9A 1W4LA 3DC2A 1R12A 1PFGA 2GCIA 2X77A 3SDBA 3H8VA 6AT1A 2P35A 2Q3LA 3BHMA 2G5PA 1HE2A 4HLUC 1RAEA 5F3DA 1L5GB 4BLVA 2C61A 2GDJA 3OOWA 1D1SA 1NJ1A 1DRVA 1GPWB 4LPKA 1N34B 3AVTA 2CNWD 4V2IA 3H1FA 3IULA 4CQLA 4Z54A 3TLAA 2OESA 2WKSA 1IHDA 5JC1A 3SVLA 2WWXA 4D8YA 3EXIB 4QRHA 3B20A 4QREA 1GXSA 4XYMA 3WLSA 2Q1TA 5KTMA 3LWDA 4HNAA 3NHKA 1RCFA 2EKZA 2YXDA 1HL3A 3CRNA 4IOMA 4N3BA 5HIKA 3LCCA 1R64A 3PQ7A 3H0CA 1J00A 1VG9B 3BFVA 2X0KA 3NIFB 3ELYA 3SX0A 4UBLA 1RLTA 2IF2A 2OHOA 3IDSA 5DM1A 4DAEA 5A3RA 1U31A 3TI9A 3AK4A 4J29A 1C41A 3SSNA 5KBYA 2G9VA 3FIJA 2IYYA 3AJAA 3GDOA 4FHFA 4JBWA 1XZMA 3PGVA 4QXAA 1ZRSA 1ZW6A 2ODAA 3ICCA 4O4HF 3H3JA 1SVIA 2NAFA 1HSZA 3P9YA 3WTCA 2WIGA 3GT4A 1E0KA 1JTEA 4JVMA 1SKQA 3LVQE 3OKFA 3GLGB 1CRPA 4KGXA 1QK5A 1XRPA 3M4NA 5H82A 4YMHA 5CB4A 3T3DA 3EMVA 3K9QO 2BRUC 4MV3A 4UHCA 5THQA 4JMPA 2AJTA 1N57A 1DHRA 2OVBA 4RS4A 3QPBA 5LUBA 4CI0B 2YXLA 2CZQA 2CZGA 1XELA 5AI9A 3RTEA 2X3UA 1QJCA 2VF2A 5FAKA 1SXJA 5BO5A 3MJVA 3V32A 2WWWA 1L8XA 2YRFA 4L0QA 4B3FX 3AF5A 3P9PA 3TLBA 1UOEA 2BF4A 2NUPB 5I3ZA 3CLRD 3U5TA 4V3CA 2JFQA 4M9QA 5C1IA 3ZDXB 1TT7A 2VWQA 4RSGA 4BAZA 1Z5OA 3ZX5A 5BQ3A 2WIAA 5ETJA 2Q07A 3WNDA 1CW2B 3RNOA 4HPXB 1DQSA 1TUBB 3F46A 3MS7A 1TM1E 3OI7A 4WGFA 4YRCA 3EODA 2GBLA 4G9GA 4DVGA 3GWZA 3NBXX 1QG4A 5B58T 4CUJA 3PL5A 1T0BA 4PY2A 4EIWA 3OTHA 2F8TA 1U0EA 2O1EA 3CLHA 4MGEA 2WIKA 5E8RA 5DSZA 1ZISA 1CUAA 3HABA 3DE3X 2HSWA 3W3ZB 1ZI9A 4JYAB 1GT6A 4YJ2F 4S1OA 5C4MA 3I1FA 4UU0A 2V4MA 3M6IA 3W2HA 5EEHA 2QIPA 2FSHA 1VB3A 1K8ZB 2ZKIA 1BXZA 3B48A 5BR1A 1UP7A 1HV8A 3KAJA 5DASA 3C1TA 2CHGA 2QS9A 1KE2A 3TI7A 4B3DA 4J1TA 4MHSA 5MFPA 4MCJA 4TLMB 1LSUA 3AESB 2BYTA 3VNSA 4CEIA 1XVTA 3D8TA 4O4HB 2OHGA 1HO3A 1AV6A 2WZQA 2VDJA 4NCIA 1RTKA 4GXNA 1VSBA 1KEVA 4KDFA 3LIPA 1AGPA 3ETEA 3QA3E 4MV4A 3HA2A 4C3UA 2HA3A 3GRCA 1VL0A 2CHFA 2ZSIA 3DM9B 3CXUA 2BIFA 4ON9A 3FYTA 4JQCA 3G2PA 1LXCA 3KEMA 4IQGA 3DBLA 4P5EA 5TR9A 3VSDA 3WY9A 1HLPA 5AXCA 2WVAA 3THYA 1Y1PA 3HWX1 1NWHA 3VQTA 1N2SA 4HR7A 3RS8A 2JLWA 3CW8X 2C83A 4Y9TA 2VPZA 5K8VA 3P26A 2WWFA 2AC2A 1MBZA 2HCRA 2LR0A 1KP9A 3LX5A 4FGSA 4DG9A 4EZIA 1O6ZA 3LDGA 4RHEA 3EF3A 5FEUA 4B2PA 1AXRA 3C1OA 1NBMA 4M1SA 2FSVC 4JLMA 3E9MA 1QWSA 3HXTA 3JQAA 1RRFA 4HAUA 1C0KA 4KO2S 5CFPA 1DBVO 3CWQA 2XQVA 2ZRQA 2F3QA 4AUNA 4EW1A 5J1SB 3THXB 3GA0A 2O9JA 3BQNB 2JD2A 1P1CA 1X42A 3JYHA 4EG6A 1Y6FA 4S2EA 4PFJA 4J76A 1WSAA 1AKMA 2H17A 4QFCA 1V11B 4NU5A 1S2LA 1W5AA 3CLSC 3H17A 3I01M 4XKJA 4YLGA 4A0SA 1G8PA 3SHFA 4ZI3A 5JJIA 4P4GA 1NW6A 1P77A 1NASA 5JDIC 4UUPA 3VZSA 4HVCA 5DOVA 1R0LA 2D54A 2DCMA 2REXB 1PKEA 3DBHB 3N28A 4TTQA 2RGAA 3GZNB 1OAOA 4EF5A 3N5KA 4OUKX 3ZE0B 2Q2VA 4MVJA 4L4XA 2I54A 2UZ1A 3EIHA 3OLQA 3NETA 4PYLA 4B4UA 5K0GA 2PUHA 3LW7A 1NPYA 3QPWA 4QYTA 1YZNA 4TYYA 1CE8A 1C0IA 1QV6A 3A6KA 4LGMA 5ALSA 3R7BA 1LSJA 2O0JA 3A6LA 1T1GA 1LPBB 3CLUD 3RUCA 3V9PA 3ZEIA 2QKYA 1WQ4A 2BGJA 1FDUA 2XRFA 4IJMA 1HH4A 1MRSA 2L0XA 3OT4A 3TPZA 4MRSA 4NFYA 8AT1A 4J0GA 3B1YA 5JQWA 4W5QA 9ATCA 3OIYA 1BWPA 2DTDA 4N9WA 4LJ9A 1NU6A 2FQWA 2NZXA 4S3MA 1E3WB 1E9CA 2O20A 4HEA1 4L02A 5TF4A 3NGMA 4PSUA 4UD6A 3TIFA 4AF6A 4B46A 4PIMA 1LPOA 3VKFA 1E7MA 3WRVA 1BA3A 2FEOA 2JI7A 2XUKA 4MP6A 1RQRA 1T13A 3NM5A 4MQ4A 5TNXA 2ODNA 1QKIA 5B1HA 1C4KA 1G59A 4PZCA 1AA9A 3L2OB 3QUBA 1SKMA 1LK5A 2CVZA 3C15C 2C2BA 2J87A 3OIGA 1KWKA 1I01A 3UCEA 1C9NA 2O6HA 4ZT2A 1DBWA 4RTQA 4O5OA 3I4CA 4D44A 3VR0A 2EFGA 2R66A 2QP4A 3IUEA 1CC1S 3N58A 2ZQ5A 3RTCA 1G5QA 1NF2A 1YR6A 3PF8A 2NIPA 3N39C 3WRXA 3MMZA 1SBHA 1I2ZA 4CM1A 1JIXA 1KYYA 1O5IA 1PQYA 2JGLA 2JASA 2W58A 3IE0A 4TMYA 1FFSA 5BPHA 4HQRA 1JNXX 3RK4A 4EKEA 4ZV4A 4AUEA 3EK2A 3A27A 4P7FA 1BDMA 3H5NA 3AMVA 5FNVA 1HRKA 2R44A 5J4VA 3THWA 3QXJA 4LJRA 4QYMA 3OJEA 4CLDA 3DTTA 3LPDA 1PL0A 1TW3A 3AUXA 3CKMA 1NX6A 1VCMA 4YFVA 5HE9A 3G88A 4O4JA 4UNPA 3MWLA 1XHEA 2QN8A 2NZUG 3IBYA 4P86A 5EG5A 3LYLA 1Z12A 4M1ZA 2H8KA 3P32A 4ZGWA 3UGTA 1GHTA 2NSYA 2W2NA 2IW3A 2WJVA 4JP3A 5TJHA 1WW2A 2BBSA 3K6KA 1ZUIA 2Q3BA 1D5CA 1U6IA 1N5IA 1Z3CA 1P9WA 3MQ4A 4HN4B 2C4KA 5JVDF 2ZRHA 2HPZA 1US8A 1YASA 3DAYA 4J9VA 5L3ZA 4AICA 1Z0JA 4BQFA 3G2NA 1SCAA 3ETGA 2CDRA 4MGZR 1UMKA 2O0MA 5DJ5A 3VKHA 2AYXA 3BF7A 1ZIOA 2I1WA 2V1UA 1RWNA 1RBMA 1TIKA 1IXSB 3I9LA 2WJJA 3DVAB 2QL6A 4LZAA 1VDMA 4KQHA 2P3OA 1PJBA 3ICVA 5AOCA 5BWOA 2C95A 4JJZA 3GVPA 3QVOA 3T7RA 3S2EA 3HMKA 5C8DA 5KTSA 1E2KA 1CIVA 2IIQA 3VHXB 1A4UA 4Y9UA 2AE2A 4D0GA 1WCWA 3HZZA 4EPRA 3T4XA 4HUJA 3UJPA 4MR7B 3C5WP 4M8NE 3TNDA 4B4KA 5AUPB 8ADHA 2Q9AA 3IQEA 2AXPA 421PA 3RUHA 3FVQA 4ZN6A 3D6MA 4Z4EA 1G1MA 3FG9A 4BTVA 3NHUA 5BOSA 4QPCA 3VZDA 4RZUA 3O3OB 2XWBF 3EVGA 1CUJA 2NUTB 4R3UC 3VPAA 5A9SA 5CD9A 1YDHA 1SRQA 3KKOA 4V0ME 3WAGA 3KUDA 2OBNA 1EP2B 4C7BA 3L43A 5JMOA 4XX1A 2JIZD 2CK3D 3OC0A 1G41A 3A1WA 4CG0A 4Z7QB 2PUAA 3V1NA 3B70A 3K72B 4MUKA 4JU8A 4DB2A 1N1DA 2DWOA 3ANNA 1IONA 1K9SA 3EEYA 3GHHA 1SELA 3IMFA 1RKXA 3MERA 4FWBA 1WSWA 2O0LA 2PZMA 1VPEA 3DTVD 1C8BA 3HU2A 1X7YA 3HKEA 3QI2A 3SXPA 3GUYA 4LF7B 1KC1A 2KE5A 3I8SA 3A6DA 3QVXA 4GOND 4P33A 1PNTA 3PUKA 3ZWAA 1YFZA 1NTRA 3NGXA 5L7YA 4PPGA 2EFYA 5I9MA 3VPBA 4FWIB 1F4VA 3FWHA 5IPFA 1HT1E 5JVDB 1LDYA 2FZEA 5A06A 4LK2A 1KO8A 5SY4A 1W36C 5FQNA 3NNDA 1XEWY 2PUWA 4H3KB 5CTJA 4CW7A 4B3GA 2OBYA 3NJ8A 3O4HA 4RDCA 3TSZA 1YQGA 1L5MA 1JIUA 4ZCLA 2O1WA 3FWKA 3BCUA 3FAZA 1DHTA 1DUSA 4F86A 3D6FA 5T41A 3TINA 1CQXA 1SUCA 1XA0A 3IQZA 2J4DA 3MWDB 1ZXLA 1SBNE 1M1YB 5J2UF 3F6YA 2M6LA 3SKYA 1PEYA 1B14A 3N0WA 1U2GC 1GPMA 1UXIA 3KOYA 5CIWA 2B82A 5F1PA 3VO8A 4EA7A 1P5RA 2P79A 3OZRA 1KDVA 2YV1A 3R7SA 1E1RD 1PWXA 4RXUA 3GNSA 2XB9A 2XHZA 4PN7A 1J06A 1GTL1 1I24A 2DOKA 3NU1A 1N8SA 3BUSA 4I55F 4KZPA 3RSSA 4HY3A 4R1NA 1KL7A 4YT5A 4DMFA 5HJEA 3KOWA 3AERB 4L4SA 3GEBA 1V47A 2PZFA 4PZLA 2O8DA 3EIFA 2GN2A 1M33A 3BM5A 2Z08A 2OCBA 1NF9A 3PLNA 3HR7A 3E8MA 3T9FA 1KU0A 1CBUA 2ZAIA 1I7NA 1K7FB 2WF5A 2XA9A 2X42A 1O57A 1R9JA 3LVRE 1JQDA 4FGZA 4W1PA 5BUSA 1NMSA 2A9KA 2V6GA 1P7CA 2P6PA 3HVUA 4AWAA 1ADGA 4MWBA 2R7LA 2HN9A 1FP2A 3OX1A 3EY4A 5BWBA 3O0DA 4WLUA 3C98A 4DLAA 5FUVA 1W29A 2BBTA 2V5UA 1K6EA 1YBHA 3L3BA 1T2NA 3BD8A 4FW9A 2JJ8A 1YT5A 2CE7A 3ABQB 3KFXA 4R40A 4KFSA 2YN4A 4MVJG 3IP7A 5KVCA 2BONA 1UBOS 3FSGD 2QRZA 1R0CA 1WG8A 1E5TA 1YQEA 3NT5A 3OIWA 3KXKA 3WLAA 4L50A 2EW1A 4HTFB 4BE9A 3UK0A 4BAGA 2D2EA 3HZHA 1FVOA 4IRXA 1KVTA 4B17A 1YDEA 4RADA 5IDXA 5SV2A 2XXJA 3D8SA 3D6AA 1R6UA 2ES4A 2GMWA 3GDFA 3KUCA 4EJMA 3ZJUA 4BC1A 3RRZA 3BGWA 4ZEMA 3OZTA 4FQ7A 4DIEA 4JL8A 3TD6A 5JISA 4Z3OA 1RU3A 2VPXA 1AKTA 3ILHA 2Q21A 4K6FA 5FA6A 1NGSA 1I3LA 4KMOA 2R6HA 4EW6A 5CFMA 3PR2B 1SQ5A 1TK2A 3KZOA 4NPAA 4EL0A 4M46A 2IHNA 5JW6A 4JBLA 4MNTA 2R5WA 4JYCA 4IG4A 3WYNA 1AV7A 3VOBA 5JFGA 3A1SA 1LQTA 2CUNA 2K4MA 1IN5A 2BWJA 3UVEA 2D1SA 4AZSA 2Y1LA 2P7HA 4I6JA 1V7QA 2WSSD 3B36A 5EP4A 3C3YA 3MAGA 1P2UA 2Y0EA 4EO9A 2VF5X 3RS2A 1FJGB 4I55B 1TQHA 3E2PA 4NE9A 4RLHA 4JHXA 4KQCA 5IBQA 5TVGA 3AHDA 3X1YA 1VC2A 3WISA 1HFJA 1S89A 1UZLA 4FCTA 1MT3A 3A70A 3OLXA 3VOAA 2ZI5A 1NBIA 1KXJA 1ISPA 1M6YA 2O3JA 5AJWA 3ZWOA 4EI7A 4K9MA 2HA2A 1AZLA 1KP2A 1I51A 2C0QA 5JHHB 1UDRA 2B2XA 3H83A 4YCAA 3FA2A 1ISFA 4MI1A 2HWUA 5JAHA 2J4CA 2HM7A 4AJIA 1GN9A 1GM5A 4AXXA 2HO5A 5AW1A 9ABPA 1O5TA 1H93A 1Z2OX 3QYJA 3GEHA 4YBRA 1PVOA 1S9DA 1U2EA 1BSVA 2X3YA 4ZAWA 1TVMA 2I4NA 2GN8A 3WIUA 4BNNA 4I9HA 4DW8A 2GNOA 3AF1A 1ZFNA 1JSCA 2PZLA 3MMNA 4LZPA 5JASA 4Z4QA 1MRNA 4R6WA 4NMXB 4ZVMA 1M2OB 2O7NA 5IX8A 1NYLA 3NBYC 2GXAA 2Q5QA 1G7RA 5I8ZA 3L0CA 2WTXA 3H7AA 2Q7OE 4ZTUB 1D6MA 2YBEA 2O2EA 3S2SA 3LP5A 1P5HA 1ZCZA 3X3HA 5CLHA 2M6SA 4V0OA 2HBQA 2PVPA 3BDIA 4GM4A 4GSLA 2YTZA 1VKNA 5DK6A 4XARA 3JCZA 4X7PA 4ZYLA 3CVXA 3DZGA 3F98A 5DX1A 4JGGA 3GLFB 2NU6A 4RIGA 5K4GA 3JS5A 2I5PO 3H5RA 4NJOA 4D3ZA 5JDCA 3TF5A 1Y4UA 3B3FA 4P83A 1WUIS 3RSZA 3ABIA 3IEVA 2I4IA 2MR6A 4L6IA 4J2OA 4R2KA 4KYTA 1TFUA 1Y6QA 5G4KA 3TNLA 2ZROA 2J0VA 1H5NA 2QM7A 1GZ6A 1LNQA 1WHSA 3C3WA 4YJGA 3UK7A 3R6TA 4GPZA 4D3XA 4YCLA 1RQ7A 2XTJA 3IURA 2CHEA 1KYWA 4X62B 2QJOA 3O83A 4DR5B 4RMIA 5IHPA 3EAFA 1XMXA 2BHNA 4WXHA 3NDPA 5LA6F 3PCRB 3HVJA 5B1EA 1PNQA 3KT0A 1AG9A 2OCAA 3NEPX 3R5SA 2W70A 4EJSC 3T95A 3O90A 1IDN1 3PP8A 3N0RA 5CFQA 1T9BA 4I5EA 1EP3B 2CXUA 4J3JA 5K1ZA 2NTJA 4A73A 4D2IA 1BOFA 4PLWA 4LC1A 1Q5PA 1IZZA 2VP3A 3AV3A 1ZL0A 1GQYA 1SZPA 3A2MA 3DO5A 2FWBA 3NIBA 1KZ6A 3ZKAA 4GGMX 1DBQA 1L4EA 3CZAA 3G0OA 1M0WA 3RJZA 3IT1A 5AVQA 4DABA 1DCFA 1P33A 1B6RA 1Z28A 2Z3WA 3B1VA 5MFZA 3ZLJA 2WM9B 2QTNA 2W6JA 4EUNA 2ZWVA 3KKNA 2VA9A 1I0ZA 2YX1A 2FGJA 1KETA 3NFYA 3SBDA 1W35A 2IX3A 5SZHB 2NZ8A 1CRLA 1YR7A 3KOXA 4QO7A 4BLSA 3KDSE 4QUGA 5ALMA 2VLIA 2Q6VA 2RFLA 4NPHA 3GJ5A 2Z98A 4LYDA 1L7AA 5F3RA 3WC4A 1J33A 3BMCA 3HSKA 4KWIA 2RBKA 5ED4A 2B99A 2OZEA 1V26A 2WOOA 4JSRA 4PGAA 5NULA 3RFVA 5BYKA 1Y8ZA 4W5JA 1A5AB 1E9DA 3BA6A 1G291 3N8IA 1F06A 1LB1B 1NM5C 1V48A 1XTSA 1M1NB 3DEZA 4J0JA 3HDGA 4FHEA 1QSGA 2C4NA 3GW8A 4POAA 3LLUA 3WDLA 2I6TA 3WLRA 3AX6A 4A9AA 2AEEA 2VHJA 4R5MA 1N6NA 5FOUA 4GU5A 4YRKA 5C52B 4BEJA 3MGCA 5J5VA 3DQPA 3HB1A 3KR1A 4C4RA 3FZYA 3JD4A 4KGVA 4R8RA 3T61A 3U4CA 4EECA 4ZMRA 3USZA 2F64A 2QZJA 2H06A 2WSYB 4KQ9A 4QM6A 2CK3A 3R3SA 3CX8A 2WYVA 4M8SA 3L40A 1J97A 2WD9A 1YJBA 3JTEA 2J3LA 4UVEA 3R7NA 5JYBA 2QV7A 2R87A 3OEED 4K9QA 1QE5A 4FNMA 3PTZA 4K2HA 2DRIA 3DH0A 1ZH6A 2A9OA 3TSCA 1JLSA 1TA0A 2RJOA 4XUGB 3ZH9B 1K7YA 1BG6A 4AXBA 1LS1A 5T4FA 4BTEA 2AI1A 5CDHA 1XJCA 3JQ8A 4U6NA 4OX9Y 3PT5A 2FE4A 5FULA 5A2QA 2NQ2C 5CFNA 4G23A 4RNDB 3P0EA 5HVNA 6NULA 2FV8A 1G3QA 1XMIA 4RVOA 2XE8A 1JW9B 4KQIA 2IE8A 3RIXA 1J6UA 1ZUNB 3ZYCA 3WGVA 1EG7A 1OX6A 2X6QA 3JQCA 1ZPDA 3KRTA 3HL0A 5ELLA 1QQBA 1UPTA 3EVEA 1HDIA 1RWVA 1BXRA 2JIDA 2OGZA 4YCMA 3EHDA 2ZTUA 4IIJF 3LJKA 3P9CA 1YWGO 4LZLA 4WKBA 3BZBA 2WTUA 3GLHB 1FP6A 1SOWA 1MEEA 3BJRA 3QE0A 2ACEA 3W0LB 3YASA 4RL6A 5ADWA 1NZDA 4RTMA 1ETUA 2GJ4A 3ESCA 3WR5A 3INTA 3MNFA 4RIFA 1E1RA 3QG5A 5CCDA 1BE8A 3WBBA 4ZA2A 3PTAA 1UINA 5LP6F 3FCCA 2SBTA 1T25A 3R23A 1EX7A 4WDQA 4M9RA 4DLLA 1HFKA 1VA5A 1UC9A 2P8JA 2IZZA 4KOEC 1Z63A 5HUQA 4BZXA 4PONA 4H1WA 2IYUA 3RVMA 4ACAA 3IA7A 3LA6A 2GBFA 5CDYA 3ZDZB 2VCYA 1TF7A 1RHUA 2R84A 5GOTA 3HE3A 3FOAA 2FPOA 1TMOA 4NWIA 4G26A 1SXGA 4RPIA 1KKMA 1O0CA 3ZIDA 2GAAA 1OWPA 5A4DA 3CVYA 4C4TA 1E69A 3PCXA 2UUBB 1LK0A 3N2ZB 3KZXA 4KI0A 1ZBQA 4LTDA 4RPGA 4E08A 1NVXQ 1KOGA 3MTAA 2WSLA 4HEQA 3RSOA 3EDOA 2H92A 1BEUB 4OGGA 5GZ6A 3D7RA 1JALA 2C5GA 1FMTA 2C3YA 2YDXA 4OYLA 3RS5A 1EU1A 4HQ0A 4A1FA 2VUTA 3IV6A 3EQZA 3HPRA 2CGEA 2X8AA 5T5QA 2R3SA 1TO6A 3FYUA 1OJ7A 1XEAA 1CUDA 3PL1A 1BKYA 2IDJA 1N5MA 2J5QA 1W0JA 2B1IA 1A9PA 2HNKA 4CL8A 1ISMA 3OCYA 3UUEA 1B1CA 3HYLA 3L7JA 4IIJB 2J9YB 4R0MA 1D6JA 1K6XA 4YCDA 5DLQC 3E3LA 3CUKA 2PMDA 4UNNA 4DLYA 1VGVA 3C5VA 2RBEA 2XOEA 4FT4A 1WKCA 4P35A 3WDKA 5L3SB 4DRZA 2WTMA 1PWHA 2IYOA 4S0XA 3UFBA 3VVLA 3RRYA 4A8HA 3ICPA 1EINA 1RHJA 3IDAA 1NN0A 5WRFA 2I2DA 3K70C 5CJ2A 3IQHX 1OFUX 4Q4HA 1UAAA 4PX3A 4ZREA 3WLIA 2C29D 4IIBA 4U4AA 5IKMA 4BEBA 5DLDA 1S7CA 1YCDA 3GRVA 3ZG6A 4BB6A 4ZYWA 4JKYA 2A0FA 3FOWA 2WUFA 4GDFA 4BFXA 1LVUA 1A8HA 3HH8A 2JI9A 3KHUA 3MTQA 3HADA 1U0TA 5DYTA 3IAHA 1KKUA 3VGJA 4I36A 4PRYA 5DU2A 1TQ4A 3F5DA 1QTNA 4C0HA 3JQFC 2E7ZA 2I2CA 4B47A 3BRSA 5K3SA 4XVUA 3FMOB 3F67A 3KOZA 4JY7A 2C9CA 4L4RA 5DTQA 3V4LA 2JF0A 2PX8A 4CMCA 3OE4A 2WYIA 2X13A 2IGBA 4PYKA 2PSSA 4ZVNA 4JBGA 3QWAA 2MMGA 2PMFA 4JNKA 4LJYA 4OFXA 4E5UA 3WFJA 3UB2A 2PHZA 1E79A 2QRUA 2WT9A 3X1KA 2A94A 2GQ0A 4H18A 4F2PA 1QC5A 2QMZA 2PR2A 3LNTA 1KFKB 3DONA 3U7GA 1SOMA 1T4GA 1K3FA 2XIJA 2HJWA 3D2CA 2BI7A 4GICA 1XTRA 2VXCA 3FFTA 3G68A 3Q7EA 4HXGA 4HLDA 4YT8A 1KH1A 1MAWA 5GGYA 4GAEA 3IHLA 4D26A 5JANA 2QL5A 1F8GA 2VC2B 2I2FA 3T3EA 3GGJA 1XZHA 3DL4A 4JIMA 1A97A 2FEWB 2J3HA 2Y1DA 4QUJA 4TL9A 5AQEA 2C2MA 2LCIA 3L79A 3D4OA 3RUFA 1EK0A 1GNTA 3BD9A 2OGSA 2YUTA 4UUQA 4CLEA 1U6JA 3R40A 1NF3A 1XP8A 4IFBA 1I4EB 4KXLA 1U8XX 1XQXA 2JIMA 3C8UA 1GKUB 5SYAA 3DV0A 2H3EA 1Z4NA 4JC5A 1ZO8A 3UJNA 3SFZA 3I6BA 1ECBA 4ND3A 1VI5A 2BHLA 4JZYA 4F1JA 4DR4B 1YRHA 1E2JA 4H7PA 4L51A 5FPTA 5AUNB 1ULAA 2F3UA 3GYGA 2QLBA 4IZOA 5K2MA 3X2FA 2X5XA 5ELXA 1DTWA 4CDNA 3TM4A 2QLMA 4B6FA 3SQLA 3JRXA 3KYCB 5BRAA 2YXPX 4Q4DA 2QSUA 3QFHA 1G5TA 4ZT6A 4WJZA 5FA5A 1YQDA 3VC7A 3TBHA 3ANSA 1S3IA 4I1PA 2KPOA 1XJWA 4OAQA 1AKRA 3THRA 2OUKA 3DWFA 3NHJA 5FI3A 4I50A 4C3VA 1MIOB 3RRXA 1NI4B 5CFLA 4ARIA 4OMCA 4C4YA 1RYBA 2QNIA 4NYJR 4R0NA 2AQIA 2ZJYA 2VN8A 2XCOA 3EY9A 3MINB 3Q6NA 2IXTA 4JWKA 1J9EA 5FBLB 5J23A 3AJDA 3WBJA 4LBVA 4KR7A 4GIBA 4U7HA 1RWXA 5C7OO 2HEIA 4QBHA 2J7PA 1IOLA 4IDCA 2NUAA 3IOEA 5HIJA 1B2LA 5H16A 3P2EA 2HY7A 3HCOA 3KKPA 3NIGB 3UA4A 3ZV6A 2B8NA 1EWQA 1HE1C 1U28A 2BZGA 2Y0DA 4MV8A 2J3EA 4DWWA 2IHBA 1UBLS 1WA5A 3QJYA 1H6CA 2V59A 3PRYA 4HG2A 4M21A 2X0NA 5CIQA 2P75A 2V6MA 3VKWA 3T8YA 4C5CA 1JQKA 1TF5A 2W71A 4BKMA 4G3XA 5K45A 1CJSA 2FUKA 4NAUA 1MH1A 4E2FA 3AU9A 2DLNA 4LXQA 1O7JA 4WCDA 1ABFA 3D5QA 3L7AA 5GTDA 2D7DA 4IMIB 4A0FA 1GAEO 4YH1A 2ZUEA 3ZHQA 1JMVA 1UBMS 1MO3A 2H5JA 3CPEA 2F3RA 3USES 2JD1A 3RVDA 4D9JA 2B83A 3LDUA 3SHWA 4I4LA 2H51A 3FNHA 1I1OA 3MTDA 4RVNA 3RJMA 3ZHCA 1C81A 1NXTA 1QPBA 2VDOB 2P77A 3A2NA 4BBZA 2C5AA 2WF9A 4K6OA 4W8GA 5FUQA 1Q91A 2CDCA 4Y67A 1G21A 1LCIA 2IA5A 3PE6A 1ZK4A 4Q3EA 4U9IS 1CSEE 1WUHS 4A2WA 3BVPA 4J07A 4QJ4A 5EKSA 4EG0A 3EXAA 4EG7A 3GGGA 5AXDA 1G98A 1GTMA 2HU2A 2JGJA 5CVEA 1P4GA 2EG5A 3BGIA 4PPNA 4R1OA 1V7PC 2JFYA 1VP3A 3UMFA 1O6CA 4KRXA 2OORA 4XD2A 1EMDA 1C3EA 4B7XA 3T3NA 4QE3A 1XTUA 3I5AA 3QU7A 2JAXA 3Q87B 1CUFA 4RGQA 4YRBA 2PLRA 5JCOC 3ZY3A 1LS6A 3AXTA 3EF0A 4R2XA 4YQFA 4XD7A 2VPWA 3GEPA 4EMTA 1SQFA 4LPSA 1N5LA 2B4YA 3H5OA 2P2DA 2Z2XA 3WZMA 1NLYA 4EM6A 5BVHA 1VMEA 2A5FA 3C3MA 4W8HA 5F76A 2NO4A 4LC9A 1H3FA 3ND8A 3OO0A 3PQFA 3HJFA 3IR6A 1LZKA 2WDPA 3F4BA 4R69A 1AQNA 1P91A 4P93A 2P9TA 3UAGA 5IYZA 1N33B 2BFDB 1VDZA 2NQ8A 3BFKA 1EE2A 5DHTA 5C8YA 2CMKA 1EAYA 2GO1A 3FDFA 2W6QA 2JEOA 3NVDA 4DYDA 4HVLA 2A4MA 1MJNA 2OBLA 4IKOA 4MYTA 3TIVA 3U7QA 1N2IA 1JZSA 2DFTA 3PFNA 5E7MA 3CCCA 3E82A 4NYMQ 4ZAVA 3AM3A 3JD2A 5IAGA 4MQUA 1KBQA 4CM6A 3NNNA 3QZUA 1XCLA 2DFPA 2FPXA 2X9VA 3CEPB 5DYIA 3AFNA 2QYHA 4KX3A 3DKPA 4WZZA 2VP2A 2O48X 3QVKA 1I1HA 4MA4A 1ZNWA 3TJRA 4D1YA 4G2TA 4RIEA 1P8AA 4TKVA 3V5NA 4YRGA 2I67A 2CFOA 3ESAA 4MJ3A 4XB2A 4B45A 3D1JA 2P41A 1CEXA 3L92A 1Z5GA 2GETA 2Z8XA 4HGRA 1JVSA 2HZ7A 3L6CA 4KQXA 4LXXA 2IPAB 1IEVA 2GVDC 2W2XA 4NE7A 5DCWA 3LGSA 1CQWA 4J2TA 4X66B 3TTWA 1SHTX 2PWBA 1HEYA 1HDZA 1YU6A 4MITA 3HYCA 2WNIA 4UTVA 2BM1A 2R7NA 3I2JA 4NVRA 5CT4A 2HK9A 4OHOA 4BNZA 1JFSA 1CPYA 1YA4A 4G36A 4WECA 1PJCA 2EW2A 4I66A 2FWNA 4KQMA 3RO7A 5EZ6B 3A4LA 3DLBA 1DB3A 3EXFA 5IJXA 2A1TS 4TXMA 3RHZA 2ZWMA 3R8XA 4ENSA 1H4SA 2PG3A 3I5YA 2L2QA 2ZAMA 2GM4A 2YZNA 1P3Y1 2ZT7A 3HEBA 4Q12A 4HNVA 4BNFA 4MKIA 5KB3A 3IP6A 2W2LA 3VU3A 1KFJB 4OOEA 2RAVA 1R15A 1SBTA 2IPOA 1BH2A 5EN4A 3UMSA 3HO8A 4HN2A 3WO0A 4B6OA 2W42A 1JR3A 1OREA 1QCDA 2ZAYA 3RCBA 1EJ0A 1N2ZA 1M2NA 4Y0AA 3FTDA 1F0YA 3HLYA 2BMAA 2CYCA 3IP9A 3UK2A 1LQUA 1J70A 2VS1A 2A8YA 3IAXA 2UYYA 5KDOA 3T41A 2O8BA 4KU4A 5H8WA 3W5CA 1XCMA 1JU9A 2P9GA 5DNYB 4A8JA 1Z26A 2PBFA 1NDUA 3CR3C 4DWJA 3ZV3A 4KN5A 4LHYA 2IODA 4NMWA 1D04A 1WMFA 1E5LA 1V1RB 3FR8A 4XJVA 2O52A 1PWYE 4H6PA 4E5PA 4P0QB 4YRTA 1TZBA 4RJ2A 1AZSC 2H16A