4OO3A

Crystal structure of a putative oxidoreductase (parmer_00841) from parabacteroides merdae atcc 43184 at 2.23 a resolution
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
439
structure length
439
Chain Sequence
b'EGFTGAPGEVKLITLDPGHFHAALVQKVSYPQVSKDVYVYAPTGFDVDEHLKRIQGFNTRAENPTAWNEIVYTGDDYLEKMLAEKKGNVMIQAGNNGKKTEYIKKTLEAGINVLSDKPMAINSQSFKLLEECFAIAKQKNIMLYDIMTERNEITTMLQRELSTIPAVYGEQLKGSPEEPAIVKESVHHLFKLVDNKPLTRPVWYLDVNQQGEGIVDVTTHLVDLVQWEAFPDQIIDYRKDIELIDANRWTTSISPEEFKQVTGTDAYPDFLKKDVENDTLKVYCNGDIVYKIKGVTAKVSVIWNYTFPKGGGDTHFSVMKGSKADLVIRQGKEQNYQPELFVEAVKGVDLAAYEKDLTASMEKVSAEYPGVALNKVGDGVWQVEIPAKYRVGHEAHFGQVTEHFLDYLKEGKLPDWEVPNMLAKYYTTTSALDMAKAKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
molecule tags Oxidoreductase
source organism Parabacteroides merdae
publication title Crystal structure of a hypothetical protein (PARMER_00841) from Parabacteroides merdae ATCC 43184 at 2.23 A resolution
rcsb
total genus 148
structure length 439
sequence length 439
ec nomenclature
pdb deposition date 2014-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF16490 Oxidoreduct_C Putative oxidoreductase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4oo3A01
4MKZA 1ZK2A 2I5PO 4OQZA 3DBRB 2PV7A 3F5QA 5A4DA 5GMOA 4CJXA 1A4UA 2PR2A 3IP3A 3CH6A 3PYLA 4J7XA 3CEAA 3IMFA 3PIDA 5GZ1A 3IC5A 8LDHA 1I30A 3WGIA 4C7JA 4J16A 5ADHA 1ZKMA 1VC2A 4RDIA 3JQCA 2I66A 4HV4A 3AY3A 3HHPA 3KYDB 2ZTMA 5CG2A 4K6FA 3GG2A 4MINA 1PGOA 1VJ1A 3DO5A 4NDNE 1JKJA 5T67A 1BVUA 1A71A 3H6KA 1H94A 5JC8A 3PWZA 4N5MA 4IUYA 3C1AA 3LDHA 5FWNA 5JPIA 1PX0A 3ZWOA 4YJGB 1VJTA 3KV3O 4GSLA 5H81A 5KIAA 3PZBA 4EBFA 1O89A 3ONDA 1EE9A 4IMPA 2PH5A 4KOAA 3S1LA 5TNXA 4RQTA 3Q9NA 4E30A 4UUMA 2PWZA 3I9LA 4UEOA 4BGUA 1LQUA 4R5HA 3PHLA 1R4MA 4Z3DA 2YW9A 3AI2A 4TRNA 3QIVA 3OJEA 1I5RA 3RQSA 5F1OA 2RBEA 3U4IA 4I5FA 2EV9A 3H3JA 1XLTA 4ZA2A 4WLOA 1Z7BA 1JQBA 2VT2A 3EVTA 1SOVA 4PLGA 5TQVA 4BQRA 1O94A 4HFNA 3AUAA 5GZ3A 1I3LA 2HMVA 4GVXA 4I08A 4N54A 3E03A 5CDUA 1R37A 3PLNA 3LK7A 1MA0A 1XEAA 1LTHR 2NLOA 4JBGA 3RUDA 1I2BA 4YQZA 5DOVA 4HNHA 3WQRA 1NQ5A 1M67A 2ZJ1A 1B3BA 1YS4A 5DZSA 3A4VA 3OJFA 2C2XA 4CQLB 4BIIA 2Q99A 3KBOA 5JCXA 2AE1A 3GAFA 3WLEA 2G82A 1T24A 3V1TC 2GZ3A 1ZBQA 1ML3A 1E0DA 3EYWA 3FR7A 3PJGA 4WLEA 3EDMA 1J49A 1HYGA 4RVDA 1P1RA 1QYDA 4FJ0A 1C1DB 4XB2A 3STHA 1HSZA 2P91A 3GLQA 2VWQA 2NU9A 1D8AA 3P2OA 4XDZA 3RFVA 2WJPA 3Q9UA 1M76A 1YBVA 1I3MA 5TS3A 4J2HA 1LBEA 3AOEA 4ND2A 4EGFA 2DKNA 2BGMA 2AG5A 4PFJA 3UAGA 4R9SA 3A06A 5GY7A 3GVXA 4UEKA 4P8RA 3TFQA 4LRSB 3ZHBA 4B8WA 3GH3A 4LCJA 4MPDA 2C54A 5BNTA 4RGBA 2EHDA 4XZ3A 2HRZA 3MJSA 2GR9A 1ADFA 1Z82A 1QSGA 3CE6A 1FDTA 3ZU3A 1YJ8A 4FOSA 2R00A 1GV1A 4CUJA 4E3ZA 2QW8A 4MVJG 2NADA 4D41A 2ZTLA 4G65A 4GL4A 4ALJA 4XRGA 1U2GA 3RUFA 4RVHA 2CVZA 5IN5A 3NV9A 1IOLA 2DTXA 2WD7B 3KYCA 4W4TA 1MXFA 4UVGA 1DIRA 2Y05A 2YV2A 3MTGA 2FR0A 1J5PA 2P5UA 4XYBA 4F45A 3L6OO 4DPKA 1OC2A 3GZ4A 1LC0A 2DM6A 4MVJE 3ORFA 4GBJA 5HWSA 2IZ1A 2C5EA 4HFJA 1JAXA 2C7GA 4PZCA 2I3GA 1VM6A 3ETGA 4NNJA 2IXAA 1PIWA 4FR5A 3FNFA 3AOEC 5IZ4A 3ON5A 1OZAA 5EN4A 3LQFA 3I4FA 3DZFA 4WNCA 1PQUA 1ZSNA 4LN1A 4A10A 5FFFA 3RI3A 4M49A 4U5QA 1LU9A 2FWMX 2O3JA 2Q3EA 4RVSA 3GZNB 4I5EA 1VPDA 1DAPA 4CM7A 1DSSG 3RUAA 3V2HA 3C85A 3O9ZA 3OF2A 1SBYA 2J6IA 1A27A 1D3AA 1GPDG 2AE2A 2EKQA 3QVSA 3WOHA 5JYDA 1SB9A 4RCVA 5FI5A 4NBRA 3WYBA 1HTBA 1EFKA 4HP8A 1E7SA 1O8CA 2Y1DA 1RJWA 3IDSA 1X1EA 4BO5A 2NM0A 2X7HA 1V3TA 2C07A 3F1KA 4ZQGA 2HK7A 3VZPA 2QYTA 3OECA 4WJZA 3GC6A 3S55A 2JKVA 2YDXA 3QVTA 1PGJA 3IS3A 4XX0A 4HWKA 1DB3A 2CUKA 1ZO8A 2WTBA 2E37A 5CDGA 2ZYGA 4MVJI 3KB6A 1M75A 1LEHA 4L4SA 2R00C 5EJ2A 1RM3A 3DAGA 2H5LA 4DUPA 3CMCO 2NVBA 2DPGA 3JQEA 2B83A 4UVIA 2VYND 3GNTA 1XCBA 1RYEA 5DBFA 1UDAA 5COAA 4BL5A 3D3WB 4OHUA 1B14A 2OO5A 4OYRA 3S2GA 1DIGA 2JHGA 2YHUA 1HDXA 3LYLA 5JBIA 1U2DA 3NEPX 1EUDA 3F9IA 3RIHA 3S2FA 1MB4A 1HLPA 5CEFA 4IPTA 1K89A 3OIGA 1JTVA 3L9XA 3K5PA 4NK5A 3WXBA 4H7PA 4KUEA 3WGHA 4U0JA 4D46A 1E7WA 2F00A 3AFMA 4A7PA 4GMGA 2NTNA 4LISA 4NQZA 2FHSA 4BOYA 3N58A 3ZWXA 5TIIA 5G0VA 4BB6A 4GMFA 1PJBA 4ZRMA 4E6PA 1AE1A 1GQYA 1GV0A 3W4IA 4AJHA 3HUDA 2AEFA 4CM5A 4M87A 3NT4A 2VHVA 4UVHA 5CHEA 4Z9XA 3RAJA 3MWEB 4M8SA 1I2CA 5G4KA 2GN6A 3QJ5A 2PZMA 5KOIA 4Z0HO 2JD0A 5G0UA 3ZWVA 3GG9A 1Q7CA 5BSGA 1ID1A 9LDTA 5CPFA 2GERA 5CDTA 4CV1A 5L4NA 5G2OA 1V9LA 4UUNA 1NFQA 2WSBA 2J5RA 2NV6A 4CMEA 2JCYA 3WWZA 1LLCA 3KHUA 3OH8A 5TF4A 4ALMA 1NPYA 3U5TA 2NU8A 3GN1A 2C2YA 1E5LA 4L75A 2DBVO 4LSWA 3AU8A 2VCYA 4I5GA 4ND3A 4RF2A 4PG5A 3I1JA 5KVSA 4N5LA 3VH4A 3ZWMA 3KTDA 4CLXA 3AY7A 4R4JA 2D2IA 4YAKA 2VOJA 4M89A 3C8MA 2AG8A 1J4AA 1J6UA 3GY0A 3P2YA 3PIIA 1UJMA 1EBUA 1QKIA 1EBFA 1P9LA 2HSDA 2GNAA 3NT5A 3KM0A 4WCFA 3GN2A 4MIOA 4AJ1A 4W82A 2XPCA 4OO3A 5G4KB 3T4XA 5A02A 1YBMA 1ENOA 1I3NA 3KZVA 4J91A 3W1VA 4CQMD 4DWVA 4R01A 1OFGA 4YAJA 4BMNA 4FS3A 2DTDA 2R6JA 4YT8A 1A7AA 2OBYA 1X0VA 5A5EA 4WOKA 1BRMA 3RJ5A 3FHLA 5KJFA 4Q3CA 3HADA 1E7MA 3DBHB 4ONEA 1MP0A 4Z9YA 3VKVA 3WLFA 3WMXA 4XQ9A 4GAEA 1E77A 5BNIA 1LSUA 4BNUA 5AXCA 1EFLA 1DBVO 3VPXA 3H7AA 3VPFA 2AHRA 3I23A 4Y67A 5MGBA 1BWSA 2BD0A 3ZN2A 4HFMA 1QRRA 1Z6ZA 2GUGA 3X2FA 3EUWA 3ZHXA 4B3IA 4J1QA 1MXHA 5JDIC 3ABIA 3JQDA 3N74A 5I7VA 4RZHA 1BW9A 2YZ7A 3DMTC 5DCYA 1C3VA 2DBQA 3NAQA 3RBZA 5K0ZA 3JYLA 5HS6A 3HNPA 7ADHA 5IAAA 1UH5A 3NGXA 2GCGA 3L77A 1NM5A 1R0KA 1AN9A 3BMNA 1C0PA 4MKXA 2IXBA 1QR6A 1YKFA 1TLTA 2VHWA 1EUCA 3KLMX 3OMLA 3ROKA 1H6AA 4DBVO 2HMWA 1GCUA 2P2SA 1LDYA 4LSMA 3ROMA 4DIOA 5A5FA 5BSEA 1NBOA 3D4PA 1NAHA 3DWFA 5GZ6A 4ALLA 4TQGA 2RCYA 4WGGA 1AUPA 3VH2A 4J1NA 1CETA 3ST7A 3CKYA 1HE4A 3WIEA 4YBZA 3MZ0A 3CINA 5IDXA 1R4NB 3I4CA 3IJRA 3R6DA 5ILOA 1BW9B 1AXEA 4CM1A 2E49A 1E6UA 5JMPA 4E21A 3QY9A 5ICMA 1E3SA 2JD2A 3NTQA 4FQ8A 1X1TA 3U49A 4NFSA 4DQVA 2VYVA 3KYDA 3SLGA 2VZ8A 2WEKA 3DZHA 3L4BA 5F1KA 2ZYAA 3ITKA 4FN4A 4DYVA 4MVJH 5KVQA 4MOWA 4B4VA 5I9NA 1DRWA 1PGQA 2C7VA 4FIZA 4WEOA 4AG3A 1PJ4A 1B7GO 4B7CA 3RUCA 1UZMA 1ZH8A 5JE8A 3EAGA 3GVIA 2VUSA 3ANLA 3U4DA 4D44A 2VRCA 1PWZA 1CDOA 1UR5A 2HKIA 4GQAA 4DGSA 2YYYA 1QYCA 3AWDA 5KJ6A 3PTZA 1R4NA 2VYNA 3H2SA 1GEGA 1P77A 3UICA 3C7DB 2Q2VA 1KYQA 3C3XA 3Q3CA 1XG5A 3TRIA 1CEQA 5KTKA 2X0NA 1HWYA 2PH3A 3GOHA 3QV1A 1JKFA 5JDIA 2UYYA 2JCVA 2AEJA 2H63A 3PFFA 1IPEA 1JW9B 3G0OA 2D5AA 3WSVA 5EQFA 3JQFC 3OFSA 4CM6A 2JHFA 4D42A 4PLFA 2PGDA 1MUUA 3RC1A 2EP5A 3JQ7B 2YQ4A 4UREA 4HX5A 2Y0EA 4FFPA 2YV1A 2PD6A 4TZTA 1V35A 1QG6A 3WFJA 3GFGA 3AK4A 3K73O 1LDNA 4EI2A 2EJWA 2IYOA 2X23A 4KWIA 1M66A 1Y8QA 2X5KO 2ZCUA 3NKLA 1U5CA 5ITWA 3L4BC 1VE9A 4GGOA 1QLHA 4XYEA 3BHIA 1E92A 1T1RA 1WMAA 1HRDA 2EEZA 3DDNA 4JX8A 3ZU4A 4FBGA 3M2TA 1GYRA 2B69A 4EJ6A 2QIOA 1U28A 3G3EA 1Q0LA 2C59A 2V6GA 5CAEA 3MJEA 4BUCA 3IP1A 3TOZA 3PQEA 1Q0QA 2I9PA 5I8ZA 1WDLA 3D5TA 1S7CA 1H9BA 1PTJA 4KUGA 4J6FA 2AW5A 3TDKA 1BXKA 4DPMA 2HMTA 4BHTA 1Y81A 4NU5A 3GEGA 1RM4A 5F3RA 4CM8B 5IZCC 4BNJA 1LC3A 2AQIA 1WDMA 2PZJA 3E9MA 4HBGA 1T26A 3WMWA 2QZ9A 3RKUA 4CL8A 4BKOA 4YACA 3ONEA 2ZIZA 3B1KA 4S1VA 1WZEA 1BGVA 1WP4A 2WM3A 3MOGA 4CLRB 1DIBA 5DBGA 5IF3A 3L07A 3LC2O 3L4SO 3H5NA 1MFPA 3IIEA 4L0QA 1QYWA 1G0NA 2NVWA 3DB2A 3ROQA 3JQBA 1QLJA 2UUPA 4JGBA 4XJSA 5T8KA 3A9WA 4K26A 1U3WA 1CIVA 3H9GA 3ZCXA 1HDCA 2D59A 2PY6A 4J4TA 2YV3A 5KKAA 3DHEA 4C7KA 1X7HA 5TT0A 4A26A 4YPOA 3LT2A 1EZ4A 5I9MA 3LT4A 1TT7A 4OOEA 1O6ZA 1XSEA 3H9QA 4BGEA 3QWBA 5EINA 1I24A 3VDRA 4EUEA 2P9GA 5BQFA 2Y93A 2EXXA 3WGQA 2YJZA 3FSRA 4O5OA 5B1YA 1E3JA 2XOXA 4MP6A 4WLNA 1VKOA 1D1SA 1XYGA 4L8VA 1L1FA 1P74A 4BO3A 4FPXA 1SAYA 1NASA 1PJ2A 2WMDA 1P3DA 4AJ2A 3JYQA 1GZ4A 3HDYA 3GA0A 2PZLA 4NBTA 4BV8A 5G0WA 1HE2A 2CZCA 1I10A 1ZK4A 4RPHA 3K31A 1R4MB 2D0IA 1BXGA 3I6IA 2NVUA 3WR5A 1I01A 2O50A 2VQ3A 4P4LA 4BMVA 1GFSA 4TKLA 4NJMA 3BTSA 1OOEA 4R68A 4L9RA 1P33A 3DOOA 2WYVA 4IM7A 1UAGA 3B6ZA 4BO7A 4CV0A 2A92A 4QFDA 2NU6A 4I9UA 4Y9DA 4R9RA 4Q39A 4A5OA 4GX2A 3IUSA 4FGWA 1O9BA 4HKTA 1PZGA 4ZQHA 3E5RA 3PPIA 4H3VA 1BSVA 4GX5A 4EJMA 1Z73A 5L53A 2Q4BA 3ZI0A 1NX6A 5IDYA 4ND5A 3WGYA 2HJRA 1NVGA 2WYWA 4KUHA 1IHYA 1C0KA 4J2OA 2PD3A 1T2CA 1Z45A 1D1TA 1E1KA 3GRPA 4WUVA 1E3IA 3NRCA 4WASA 3BYZA 2EKPA 4PCVA 2I99A 1YRLA 3FBTA 1ZMOA 1HYHA 1IUKA 1GAEO 3PK0A 3ANNA 1FDVA 3AW9A 4ZD6A 4AL4A 3BTVA 2BMAA 2QRLA 2O2YA 2BI8A 4IQ0A 3AJRA 1XDWA 3JD3A 1BDBA 2VNAA 4PG7A 3HDHA 4YEDA 4EEZA 5B4VA 1PU2A 4O6VA 3DTYA 4P4NA 3AY6A 1PL6A 4H15A 1LLUA 3ZW8A 3TNLA 3LC1O 1YB5A 2OBNA 4IQGA 1P1KA 1XELA 3PHJA 2YQ5A 3OIDA 1K3TA 2QHXA 5JDCA 4O59O 4OQYA 2E48A 4PN3A 1VJ0A 1DC5A 2DPHA 2E82A 2EP7A 2DUWA 4XCVA 2OL4A 1NHGA 2FSSA 4GVLA 4II2A 3SC4A 3KYCB 3LF2A 1SO8A 4JBHA 2P9EA 3WGTA 2IE0A 2BGLA 4GSKA 1UXIA 4A73A 5HS4A 1VL8A 4XB1A 3BMOB 4FFLA 4IXWA 4R51A 4ILKA 3HWRA 4RLHA 4E5NA 4WOJA 3OEWA 4XDYA 2NTJA 3KOUA 4J1TA 3PZRA 1GL3A 4RL6A 5L4SA 3SVTA 1DC6A 1T1SA 3FPLA 1C0LA 1DJNA 3EZLA 4J4BA 1TVEA 5F5LA 1TA4A 3I3OA 3RWBA 2YY7A 2NVUB 3DZIA 4ZRNA 4YAIA 2TMDA 2B35A 4AJJA 4OXKA 1YVEI 1NR1A 1K6IA 1E6WA 2WD8A 1KETA 2FP4A 2W4QA 3N7UA 3GZNA 4IDBA 1CERA 3X2EA 4OJNA 3I9MA 4DYDA 4K1LA 1UZNA 4MIEA 1SZJG 3GVCA 4HADA 1F14A 1PJQA 4EJ0A 2ET6A 1YQXA 2QYSA 1YL7A 3JCZA 1OBFO 4IDFA 2FPGA 3PHHA 3ZWBA 4YJHA 1YL6A 4OXYA 4R54A 2DU8A 3ETEA 4FGSA 1EUZA 4ZU3A 3A14A 5JMWA 3GPIA 3ICPA 4IINA 4ND4A 5EL0A 4X54A 4OSPA 4RPJA 1Q2XA 4AFNA 3PWKA 4YRAA 4B7XA 1U3UA 1ZK3A 4YAEA 2J8ZA 1LUAA 4PG4A 1R12A 4ZVVA 3GVHA 4GKVA 4OOFA 2IEDA 4UAGA 2H6EA 4UVDA 3JQAD 3GK3A 4ZQBA 4TSKA 3LT1A 1U4SA 3KETA 4D3DA 3FPCA 4RVUA 4ZICA 3JQAB 1ISJA 2NUAA 2FPIA 3MCVA 4IIUA 4CM3A 5J23A 1LXCA 2UUOA 1XGKA 4FOOA 5HM8A 3QVXA 3G1TA 2BKAA 3RBXA 2RHRA 1ULUA 3H2ZA 4NFYA 2GYYA 3HSKA 1H6BA 1GZ6A 3ZWNA 5T6BA 1GZ3A 3H65A 4UEJA 3PI7A 3VH3A 2D1YA 4EUHA 3BIOA 3VDQA 3DXFA 5F21A 3TZQA 3DZKA 3WBBA 2XF8A 5C7LO 1SPXA 4L4RA 3T7EA 2VNSA 2HDHA 3LZ6A 2W90A 3OJOA 1B8PA 3BMOA 5EIOA 3EW7A 3HN7A 4IMRA 3H8VA 1EK6A 3VPGA 1WZIA 3JQ9A 1PGNA 3TF5A 4W6ZA 4AJ4A 5JS6A 3B1JA 1SEPA 1X7GA 1C14A 3QVOA 1DXYA 2X6TA 4YVFA 1CQIA 4B4OA 2X0IA 1PS0A 3OICA 1B0AA 2DVMA 2PGLA 1B16A 3UH1A 1NWHA 3E1KA 3QWAA 4WK6A 3RUIA 3WJ7A 4RORA 2F1KA 4XYMA 5KJEA 3NT2A 3ASVA 3S2IA 3JQFA 3G17A 4CMCA 4GX1A 3PYMA 3QSGA 2O23A 4FCCA 5I8WA 3BMNB 4DTIA 1O0SA 5JCJD 4XIJA 5THKA 1HKUA 4L73A 3BMQB 2VYVD 2DUUA 4Q3EA 3ASUA 2FOIA 1H2HA 5L51A 1E7QA 2FRDA 2BI7A 1K0UA 3TN7A 1E1MA 2HRBA 1BTOA 2D3TA 2DTEA 3LF1A 4E5YA 1DEHA 1BG6A 2B4TO 4FSHA 2G5CA 4NZ9A 4XWYA 1UUFA 4D0SA 1YQDA 5CDSA 3NTOA 2D8AA 4IQ8A 2X4GA 5EERA 3UOGA 2O7SA 2QRJA 4QT0A 5TSDA 1QMGA 4BNKA 1OC4A 1GQQA 2DQ4A 3NDJA 3HDJA 4U8GA 4B7UA 4HXYA 2X22A 1DFHA 1KC3A 1YE3A 1EVJA 1PEDA 3DOJA 5F5NA 4XYLA 3WQSB 1ISHA 3RUHA 1DFIA 4NK4A 5BNFA 3L6DA 3D4OA 2FPPA 3U4CA 1LSOA 4D0RA 5JY1A 3JD0A 3RC2A 4JBIA 1YH3A 4CMIA 1WAMA 1XWFA 3MOIA 3E5MA 2Q2QA 2W2LD 2VTDA 1BHSA 3WNVA 5ER6A 1EVZA 3BMCB 4IJUA 5A3VA 3RROA 3V2UA 4WLUA 4XGKA 2NWQA 1YL5A 3FI9A 2Q49A 1IYZA 5L7YA 3W4JA 3M6IA 2EG9A 3NTRA 4YJDA 5AXDA 4KDEA 1MV8A 5JO9A 3UF0A 1MX3A 3I9OA 3IUPA 2X9NA 3OJLA 1ADGA 1T2FA 2O3TA 2TMGA 1H5QA 1EVIA 3JQGA 3PQFA 1GQ2A 3HDQA 1FDUA 4HUJA 2VT3A 3Q11A 1PJLA 4J1SA 4ALNA 2PKQO 3ZNQA 5U1PA 4RF5A 4BNYA 4DPLA 3U62A 3QE3A 3WYCA 4CMHA 1VLLA 4BNXA 1ZK1A 1JAYA 1ZXLA 1JDJA 4LK3A 1Y1PA 3EK2A 4LMPA 4QUKA 4BNWA 1UP6A 3D64A 1GD1O 3UGKA 5BSHA 1ONNA 1SNYA 4J90A 1KEUA 3T4EA 3WNQA 5ENVA 3WB9A 4GGPA 1GR0A 3RJ9A 3H4VA 1E3WB 4IGEA 3QRWA 5DP1A 4GPD1 3O38A 1PQWA 2D4AA 5FF9A 5IG2A 3CIFA 4L74A 3WQQA 4PG8A 1FDSA 3JV7A 1SMKA 3E6AA 5B12A 3WBFA 3IAHA 2B5WA 3VZRA 3ZV5A 4CODB 4D43A 1I2ZA 4ND1A 2AQ8A 2QZZA 3KSDO 5KWEA 1R0SA 3PGJA 1Y6JA 4B79A 1CJCA 5F1PA 3IKTA 2NTVA 4CUKA 4IDGA 3UFXA 3AOGA 4WPGA 4FFRA 3TZ6A 1K2WA 3DMYA 3W8FA 4R1TA 3KSZO 4E2YA 4LVUA 1Z74A 3JQ6A 5IDWA 4Z6KA 2ILTA 3UVEA 1TB4A 1HEUA 4BNVA 3CSDA 3D1LA 1KIFA 1E7YA 1G6KA 5JAQA 3FNEA 1QORA 4PRLA 2EF1A 3OQ6A 4QXMA 4ZJUA 3WFIA 2VRCD 3UUWA 4BGVA 2Y1OA 4BB5A 4OKNA 2O2SA 4J9VA 4MP8A 2BFPA 4MKRA 3WSWA 1UXGA 1IE3A 1EE2A 1BVRA 2GLXA 2X9GA 3NJ4A 4CM4A 3JD2A 4CMIB 2PNFA 1H0KA 2W8ZA 4CR7A 3ZZNA 1PJSA 4XQGA 3BMCA 2CF5A 9LDBA 3H3FA 4XA8A 1I36A 1YJQA 1I8TA 4G5HA 3RFTA 1MLDA 1LI4A 4GLOA 3FWZA 4R41A 2YDYA 1XU7A 2Y99A 3UN1A 3OP4A 5TT1A 1PR3A 4CR8A 2O7QA 4BMSA 4D7AA 5THQA 6ADHA 2H1SA 1XA0A 3AUTA 4NFHA 1Q7GA 1W4ZA 4PLPA 4BO0A 1KVRA 5IFLA 3RSHA 2YHIB 4FD3A 4FC6A 4HFRA 3ZV3A 4RV9A 4ZGWA 1E3LA 1PZEA 4J3FA 4RO0A 5A3JA 1U9JA 2DC1A 4PIVA 1KOLA 5L45A 3EC7A 1U3TA 1JVBA 1PWXA 4HNGA 1ISIA 2WE8A 4NBUA 4Y98A 1HDGO 2QG4A 2ZATA 3RU9A 4E4YA 1E1LA 2GN9A 3OJ0A 1KVSA 2R2GA 3EVNA 3FN4A 4DC0A 1DPGA 4ZHSA 1UXHA 2NU7A 4U7WA 1KEVA 3L0DA 2OZPA 5JC1A 1BXGB 5T57A 1XR3A 3I6QA 2Y67A 3GDFA 3BTOA 2DFDA 4MO2A 1D7OA 4BS9A 4CPDA 3PYXA 4GI2A 5IDQA 2NQTA 4PLCA 3D4NA 2LDBA 5A04A 3JTMA 1YBAA 3NJ8A 1PR9A 3INRA 1ZK0A 4TVOA 2X0RA 5B4UA 2W2KB 1GUYA 3VTFA 4FFMA 4NBWA 4YA6A 3CPSA 2VUTA 2ZTUA 1YONA 4O1MA 4DRYA 1I33A 2OXIA 3PGXA 3F3SA 3HQ4O 1Z7EA 3PXXA 2OP0A 4NJOA 1LSSA 3RC9A 1DIAA 2FR1A 3EGOA 3NDRA 3L9WA 1QXSA 5AOVA 5I7SA 2I3AA 1QYXA 1UP4A 3K2BA 3B1FA 3ZU5A 4BNHA 4QFCA 3Q1LA 1ADBA 3C1TA 3E8XA 2DBZA 4BNNA 4OIMA 3HZZA 5JYEA 1B8VA 3S8MA 5L7TA 2X5OA 3A1NA 4CQMA 3H9JA 5ICSA 3ICCA 1HLDA 1TT5A 3MJTA 4JXKA 5JO0A 1HSOA 1U3VA 4DA9A 3GEDA 3FNHA 4NIMA 4DC1A 2Z5LA 3WYEA 3CMMA 4FJ1A 1PZFA 1ZUD1 5HTOA 3VVCA 4AJNA 2FSVA 1K6JA 5MDHA 4PG6A 3ZV6A 2HJSA 1QP8A 3PDJA 4YRBA 5AXBA 2B36A 5AVOA 1RPNA 1DHTA 1KS9A 5KJCA 4QECA 1IZ9A 2BRUA 4CV2A 5JAZA 3NYWA 5G4LA 4MVJM 3GEMA 1E5QA 4P22A 3D7LA 4R1SA 2X5JO 4ITUA 3KEQA 4QTZA 3IJPA 1EEHA 2G1UA 2O3RA 1ZJYA 4CMEC 1ISMA 4M86A 1A9ZA 1B15A 4ZN6A 4UULA 1CRWG 1YB4A 1SC6A 1ONPA 3TPCA 4DREA 4YQYA 1W73A 5DULA 4KWHA 4Z9FA 5H83A 4Q3NA 5B37A 3G79A 1X7DA 2LDXA 3LT0A 2JCXA 4JQCA 1F0YA 1B26A 1DRVA 3O26A 5CPBA 1GADO 4P4GA 5TX7A 3WGOA 3LU1A 5JCJA 2I6TA 2Z95A 4F6CA 3GMDA 4XGIA 5CDYA 1CF2O 4AJKA 2Y0CA 3F5SA 4BQPA 1BDMA 2EKLA 3QQPA 3C7CB 3O03A 2HCTA 1Y5MA 3SBOA 1Y7TA 4OKIA 1EVYA 1U8FO 1HZJA 4TMFA 2OORA 3H9EO 3MJ4A 3W6UA 2OOSA 2Y1FA 1DDOA 2E4AA 3GNQA 4Q9NA 1OAAA 2AXQA 2GPTA 3E9QA 1HDRA 3D5QA 7MDHA 4TRJA 5C3MA 1N9GB 4DBZA 3HN2A 3PWSA 1MFZA 3PFWO 1V6AA 3ADPA 5C7OO 1F17A 3K96A 3PQDA 1R16A 4WE3A 4P38A 4CQLA 3SLKA 2B4QA 4JP3A 4ID9A 3B70A 2RH4A 1U5AA 4RPLA 3DONA 5A1TA 2QRKA 4J7CA 2XXJA 2YFQA 2V6MA 1SCUA 4XGNA 4TROA 1CWUA 4CM9A 1TI7A 5DOZA 5DDIP 1FDWA 4TWRA 3JSAA 1PSDA 1A4IA 4XRRA 1F06A 1DAOA 1GEEA 2CF6A 4KQWA 2B5VA 1ONOA 3GGOA 3OA2A 3VKUA 2B4RO 2OMEA 4KTVE 1WMBA 3HB4X 3OEYA 3ZWWA 1YGYA 2A94A 2PKQP 3INTA 3BXXA 3JQAA 1EQ2A 1E6EA 1PJ3A 4B4WA 1RYDA 1Y8RB 3F4BA 4DXHA 1EQUA 5JXWA 1NPDA 4KQXA 3HG7A 3FCOA 2C82A 3VZSA 1KERA 5JAIA 4IS3A 2PFGA 2FZEA 1T4BA 2YUTA 2GDZA 4RLSA 1P1FA 5ER9A 4AJIA 5IXSA 3VZQA 1K6XA 3RVDA 1H93A 1WNTA 1C1XA 2GF2A 1NVTA 2RIRA 2PLAA 1S6YA 5JDCC 4YAGA 4NPCA 3I83A 3TZHA 3SC6A 4M1QA 4YT2A 1V8BA 4IDDA 4OGWA 3D3WA 1LDMA 5BR7A 4FDAA 3W8EA 1Y8RA 5DN9A 3QWHA 4WLFA 3KRTA 5BT9A 4NMHA 3SXPA 2CDAA 2VHZA 3QW2A 3CXRA 3MJVA 4BNZA 4RPGA 5T8KC 1UXKA 3NGLA 5I7EA 1KBZA 4NBVA 1JKIA 2DBRA 4Z0PA 2EW2A 1EMDA 4PVCA 3GGGA 3R3SA 1N92A 2JFGA 2A9FA 4E5PA 1HDZA 5HBRA 1HF3A 3GPDG 3BMQA 3TWOA 3U0BA 4XD2A 4CR6A 2C29D 5BSFA 1ENYA 1NP3A 2C20A 1N8KA 2VRBA 1N9GA 3AM5A 4DLLA 1NFFA 2CD9A 3M2PA 3WS7A 4EYEA 2Q4EA 2C0CA 5L7WA 1ZIDA 1W6UA 3DFUA 5HA5A 2IZ0A 1YOVA 5JY6A 1N7HA 2O4UX 3OIFA 4U6QA 1T2EA 5L40A 2ZB4A 1H9AA 4B3JA 5ENDA 2OP1A 2EERA 3R1IA 2FR8A 5EMHA 3KUXA 1N2SA 3K9QO 2PK3A 4R5MA 4PGFA 4RPKA 4QSMA 4ALKA 1WXDA 2J3IA 3FTPA 4GWKA 1DRUA 1ZCJA 4EZBA 1UDCA 1VL0A 1X15A 1UAYA 2E6UX 1VSVA 1KVUA 3KLPX 2NNLD 3T7CA 1Y5RA 4BKUA 4MIYA 5DBIA 3O8QB 3ZHZA 1QV6A 5IXYA 1X14A 3UW3A 4YJHB 2EIHA 5U9CA 2QQ5A 4Y6SA 4WLVA 5TRTA 4B3HA 1BXZA 4JJFA 2OUIA 3TJRA 1SB8A 4DQUA 1NVMB 4A0SA 3INGA 2CFCA 4YJFB 3V1UA 4K9DA 4XEHA 5JLAA 4R1NA 3GRKA 3O4RA 4LVCA 4RF4A 4EITA 1W0CA 4Y6RA 4MP3A 2CVQA 3JD4A 2AA3A 3QA9A 4GKBA 1KC1A 1MG0A 2ZTVA 4ALIA 2IYPA 4YXFA 4JJGA 2P4QA 3ADOA 4JNKA 4OSOA 3DC2A 4O63O 2QX7A 3IL2A 4D79A 3JQGB 3RD5A 3PVZA 2WYUA 4C4OA 2FMUA 1A7KA 4BNIA 1VSUA 3AU9A 4DMLA 2CVOA 2IODA 3WGGA 1VKNA 4A2CA 5FEUA 4PZDA 5LCXA 4FJ2A 4XQEA 4CLOA 4XIYA 3I52A 1NPTO 3CZMA 1AHHA 1KVTA 3CUKA 3AFNA 5L4LA 5KKCA 1WDKA 3MJCA 4BO2A 2GASA 3MWDB 4JP2A 1ULSA 1ZVMA 3WICA 1M2WA 2Y68A 1LJ8A 2OGUA 3DTTA 5A9SB 2YHIA 3K8ZA 1YQGA 1Y9AA 2VZ0A 3GQVA 3Q0EA 1ZFNA 1TEHA 3V8BA 4IBOA 1JN0A 2RH8A 3HB5X 3GT0A 4MVJD 2JFFA 4YJGA 2PZKA 3AUSA 3RU7A 2WWRA 4PLTA 3JQ9C 2ZQYA 4ZQEA 4CLDA 3QHAA 1WW8A 4CLHA 2CDBA 2EWMA 2PKRA 5JNLA 5K9ZA 2Y1GA 1ZZEA 1LRLA 2B37A 2ZJ0A 1Z75A 4LW8A 1Y8QB 1ZW1A 2FZWA 4BVAA 4DMMA 2BFOA 2PA3A 4YB8A 4R1UA 4E0BA 1WWKA 4IDAA 3ULKA 4CLEA 1YB1A 3AM3A 4A27A 1MC5A 3RKRA 1XKQA 2GN8A 4TKMA 3DAFA 3JYPA 1U1IA 3ZNOA 4CV3A 1ZSVA 5IZCA 4F3YA 1T4DA 4CM9D 5LC1A 2Q45A 5A9RA 3OM9A 4EUFA 3PRJA 3Q2IA 3GFBA 1HDYA 1XU9A 2GSDA 2Z1NA 3GHHA 3TSCA 4LMRA 3GUYA 4RF3A 2VUUA 5TJ9A 1ISGA 1F8FA 3K6JA 1AHIA 5KNLA 4HY3A 1FXSA 1E7RA 1GY8A 4K28A 1P1IA 2JL1A 3FRJA 4BKQA 2C5AA 1NXQA 2VWHA 3DQPA 4BNMA 1NQTA 4IJKA 5DCUA 2BELA 4E2WA 3M1AA 1T25A 2EGHA 4D45A 3ZWYA 1NYTA 4U6SA 3COSA 4CLRA 1GCOA 3ZWPA 4LCEA 1E1NA 1UP7A 1V0JA 2V7PA 4QX6A 1AXGA 2EW8A 2NACA 1YO6A 4H16A 4QQRA 2BLLA 4WECA 2BH9A 3DBLB 3ANMA 3PJEA 4MVJP 2AMFA 2EGGA 1DFGA 4II3A 4URFA 1JWAB 1QV7A 2BF7A 4JK3A 2ZB7A 4NH4A 5AYVA 1LDBA 4AJLA 3JQBC 4TRMA 3LC7O 2HK9A 4IDEA 5DCWA 3TZKA 1HYEA 3F4LA 4D3SA 4WEQA 4Y8VA 2O3UA 1U7TA 3DFZA 4WCDA 2P68A 2BFMA 3DMTA 4CL3A 3QWFA 3HE3A 3RASA 2O4CA 3G49A 4XQCA 4CMJA 4GH5A 1GTMA 1WLYA 5DP2A 2W2KA 1D4FA 3DBLA 3L6EA 4IIVA 3U4HA 1GUZA 4I1IA 2NSDA 3DBRA 4D3FA 4WKGA 3VVBA 1O95A 2GGSA 1B2LA 1DOHA 4FW8A 4PVDA 3SJ7A 1A72A 5A9TA 2J3JA 3BAZA 5T5QA 4IS2A 4Q3BA 5EPOA 8ADHA 2FN7A 1HE5A 3E18A 1E3EA 1KY4A 5U4QA 5JSFA 2CY0A 4KTTE 3SEFA 4E5MA 2DLDA 4DQXA 1ORRA 2V6FA 5I7FA 1C1DA 3WIDA 3QVWA 3S2EA 1XQ1A 3RBVA 4CMGA 1RM5A 1IHXA 4W9NC 4IJVA 1GU7A 5JW6A 1TT5B 4BKPA 4JJIA 2SCUA 5K6AA 3IKVA 3FR8A 4DL9A 1VRWA 1WVGA 2BHLA 3JD1A 3P5SA 4FFOA 3E82A 3ENNA 3IQDB 4TZKA 3GDGA 4CMBA 3FBGA 3MEQA 4ZQFA 1M6WA 4DVJA 2CMDA 3I9NA 2HMSA 1NR7A 2W98A 3V5NA 1N5DA 2P4HX 2GZ2A 1DLJA 2Q1SA 1ZXBA 1ISFA 1T2AA 4Z3KA 1J0XO 1YDEA 1JLLA 3F47A 5I9LA 1O5IA 3PJFA 3A28A 1SOWA 3BTUA 1GYPA 4B4UA 4BO9A 2X0JA 4YRDA 4J0FA 4MDHA 1R66A 4XKJA 3RCBA 4DLAA 4EDFA 3FNGA 2RAFA 1M6HA 2WD7A 1ENZA 3WJAA 4YYZA 4R69A 2NQ8A 1YXMA 3DAPA 3JYOA 4M54A 5DF1A 1P1JA 1MG5A 3VAZA 3VPHA 2PGJA 3NDIA 1U4OA 1FJHA 2OHXA 4YT5A 3MTJA 3TFOA 3Q6IA 3FD8A 4AJEA 1B3RA 2DFVA 3Q2KA 4CM8A 1RKXA 3WX0A 2ZQZA 4EEXA 4PZEA 3U09A 1TXGA 1P44A 1G1AA 4FB5A 3G1UA 5L3ZA 1DJQA 2OFPA 2ZYDA 1MC4A 1L7DA 1AGNA 1R0LA 3I9JA 3QWIA 3QLJA 4W7IA 3LSYA 4JN6B 2HMUA 2Y66A 4FFNA 3B20A 3V2GA 1LRJA 2A35A 4ESOA 6LDHA 5G0TA 5L9AA 2Q1WA 3CTMA 4NHEA 1NWCA 2V6BA 4BNFA 2X86A 2Z1MA 1W8DA 2WDZA 4BNLA 1FF9A 1CYDA 1EDZA 3WDSA 1N7GA 1VI2A 4DIFA 1EK5A 3U3XA 5T64A 2P9CA 3UHAA 3JYNA 4O0LA 4IZHA 1U7HA 3OSUA 1OI7A 2VN8A 2XXBA 4WNIA 4KP7A 2BGKA 1XQ6A 3E48A 4XR4A 2I76A 1I3KA 2AQHA 5K6AC 3DEYX 2X1HA 1G0OA 2HO5A 1R15A 1K5HA 4IDCA 2J3KA 1BMDA 1MGOA 2Q50A 4RDHA 4NG5A 3DHYA 1A5ZA 1ARZA 3BA1A 2CSUA 5A05A 5TGDA 1LNQA 1YDWA 4OL9A 4PRKA 3UKOA 3GVPA 3VH1A 3DBVO 4WCFC 1DC4A 1R6DA 5COQA 5EESA 2A4KA 1IY8A 3ONFA 4IY1A 3ZNPA 3LVFO 2GN4A 5HRUA 1P1HA 2O48X 4BO6A 4I8XA 2B0JA 1ENPA 3PHGA 2HLPA 2V65A 4GWGA 2ZB8A 5TC4A 4YR9A 4Q3AA 1LSJA 4BO8A 2VWPA 2X8LA 3F1LA 1HL3A 2YFHA 2O3SA 4BGIA 2UDPA 3H9UA 3SJUA 5L95A 5CEEA 5G0SA 1A9YA 1KY5A 5TJHA 1LLDA 1RWBA 1FK8A 2O3QA 1PS9A 3EZYA 3GAZA 3LLSA 4XR9A 2UAGA 4NJMB 2IEBA 3WGZA 4N18A 4CQMB 4PLWA 2UV8A 3AM4A 3GHYA 4KZPA 3OQ1A 5C37A 2Y1EA 4J49A 5DNAA 4OAQA 5TLSA 1C0IA 4XJTA 4RVGA 1X13A 4UVEA 4Y6PA 3GR6A 1KEWA 2AQKA 4E5KA 3ZV4A 1ZEMA 3LLVA 1IULA 1N1GA 2HUNA 5CEJA 1EDOA 4BO4A 5IN4A 4E12A 1T2DA 5IJZA 4AJOA 3ROPA 2PTGA 3FWNA 3C1OA 1P0CA 1DHRA 1F8GA 1VL6A 2JD1A 1ZJZA 1ZNQO 3C24A 3PP8A 5FYDA 3V1YA 3DR3A 3NX4A 5ILGA 4DLBA 4KDFA 4W7HA 1H6DA 3ZHYA 1F12A 1KEPA 4NU6A 4OMUA 3HFSA 3K30A 4F46A 2D5CA 2J3HA 4G81A 4S3MA 1HZZA 5LDHA 1DLIA 4J9UE 3EY4A 3OBBA 3KXDA 1U8XX 4WCFB 4BV9A 3TQHA 1YWGO 4RQUA 4RVFA 4IGFA 1LA2A 2VTEA 2W2LA 3KO8A 5JAMA 1B8UA 4JIGA 5KVVA 5CFZA 4CLOB 2VOEA 4N7RA 3D0OA 5C7IO 3QP9A 3DBHA 5CP8A 4OH1A 3DZBA 1Q0HA 3BHJA 3K2EA 4E31A 2WE7A 2VWGA 2IZZA 3ZU2A 5B4TA 1HXHA 3TOXA 4MVJF 5ITVA 3FF4A 4Q3DA 1OMOA 2CDCA 2Q1UA 2CNBA 4JROA 3ZWAA 3GF4A 2GRAA 2POQX 5KVCA 5LDGA 1ZSYA 4AJPA 2X58A 1H2BA 3O8QA 1ADCA 1PZHA 3PHIA 4OM8A 3TL3A 3ZW9A 1NQOA 4KMSA 1GDHA 3PLRA 4JCOA 1NQAO 3GUCA 4K6CA 3H5AA 4TRRA 1IZ0A 4E33A 2GZ1A 5EQDA 4EW6A 1L7EA 3AI3A 3GMSA 4E2XA 4PLVA 2VHYA 1GYQA 3EHEA 3EMKA 4YT4A 3M1LA 4L76A 1Y9EA 2Y0DA 4R16A 4AICA 3UCFA 2ZKLA 3FTNA 3I5MA 4W99A 1E3WA 1ZEJA 3KVOA 2EJVA 3NUGA 1KVQA 3UCXA 4IXTA 4BO1A 3SX2A 3BZUA 3R0IA 5DT9A 4XYGA 4QO8A 4FC7A 3P7MA 1LX6A 1Q1NA 4LRTB 1UDBA 1P45A 1ZMTA 4QO7A 1P31A 1NTOA 5FI3A 4UUOA 3RUEA 1FMCA 1NNUA 4LGVA 4TVBA 1N1EA 1I0ZA 3F6YA 3UCEA 3JQ8A 3TL2A 2JFHA 4BKRA 2AEMA 2G76A 2I67A 1PJCA 5ES3A 2Q46A 4PLZA 2G0TA 1QYVA 5KCZA 1DIHA 3VOSA 3RFXA 1PJTA 2HK8A 5AQ1A 2UVDA 4J4HA 1HDOA 1DO8A 2GO1A 3GGPA 5A9SA 4B8ZA 1SEVA 1C1XB 3KYBA 4G2NA 3ENKA 1IPFA 4INAA 1Q7BA 1IB6A 3OHSX 4N5NA 2JAPA 3WTBA 2PD4A 2DAPA 3DHNA 3U9LA 2FY8A 1PL7A 1DC3A 1V3UA 2IRWA 3ZH2A 4ROSA 4CMKA 2VHXA 4R3NA 3I9KA 1HE3A 1JA9A 3F46A 2P5YA 2HQ1A 4YJFA 3AUUA 4YCAA 2X9VA 3ZWCA 1PQPA 3OA0A 4RZIA 4R3WA 3WWYA 1XHLA 4U0KA 5A03A 4I5DA 1CQJA 1GUFA 2GD1O 1XIVA 3GDOA 4J0EA 1LDEA 1JVSA 3W8DA 4NR0A 4QEDA 4RJTA 5CG1A 3HFGA 1V3VA 1JWBB 3JQ7A 4BNTA 1HT0A 4NI5A 4J43A 5C5IA 1H6CA 2I65A 3CZRA 3IOYA 4E2ZA 3AI1A 4UUPA 1PS8A 3C7AA 3W6ZA 1YOVB 2HU2A 1UZLA 3ZGYA 1NHWA 4IZIA 1LLQA 3TZCA 3P19A 4YWJA 2HAEA 4CUZA 2Y1CA 3R3JA 3DL2A 1NAIA 4W9NA 1PL8A 4F6LA 3PDUA 1RM0A 3GNSA 2Q2WA 3OETA 1P0FA 1UXJA 2ZB3A 5JFOA 1LQTA 3OQBA 3WTCA 4A03A 4I9NA 3H5RA 3K92A 1LDGA 3VHRA 1PGPA 3DZJA 3ZNNA 2J5KA 3HJAA 1GPJA 3KSUA 3VTZA 5H82A 3UXYA 1IL0A 4JLWA 2JJYA 1X0XA 4GX0A 4YDRA 3W4KA 1WPQA 2G17A 2BFAA 2RHCA 3KEOA 4PLHA 4MJLA 3VC7A 4CM4B 4AVYA 4DIBA 5AXAA 2XAAA 2ZK7A 4CMAA 1LRKA 2VZ9A 4E32A 4L4XA 4OXNA 4IJWA 2H9IA 1NFRA 3JQ8B 3DOCA 5KJ1A 3DZGA 2Q1TA 4BNGA 3E9NA 2ZCVA 3PEFA 1HETA 2JAHA 4GLLA 2DT5A 1JU9A 3ETDA 3BHMA 1I32A 3RC7A 4J7UA 5COBA 2J5QA 5A06A 3D3EA 4I9HA 3ZDFA 3VPSA 2IDZA 4Z0TA 3PJDA 4MVJA 3ITDA 4YTEA 3WG9A 4PLYA 4E13A 4M55A
chains in the Genus database with same CATH superfamily
1FU7A 1NV8A 4MKZA 1ZK2A 2I5PO 2R11A 3DULA 3F5QA 4PQFA 5CLFA 5A4DA 2YWBA 5GMOA 3WIBA 3IEIA 4OKSA 3W34A 2GJ9A 2J1LA 2OFFA 1NF2A 4M9QA 3CH6A 1XROA 3PPVA 3ANYB 4MUJA 1YS9A 3I2YX 5F51A 3ZWDA 16PKA 3LUCA 3JY6A 4Q7JB 4ABTA 4P5PA 3GJ0A 4PIPA 1Q14A 1ZKMA 2VQSA 3WKDA 1AH2A 3KDSE 2IT1A 4BZWA 4Z4HA 1E1QD 1JEQA 1TO6A 3DKRA 3MT8A 1L1EA 3WDMA 5CG2A 3MUEA 3PXUA 4H1HA 3GG2A 3PSHA 2XT9A 3WL3A 1PGOA 1IK6A 1YB6A 3HRKA 1KJQA 4NYMQ 3CTPA 2Q2NA 2O5CA 2J4CA 3H6KA 2YJ6A 1H94A 1YFKA 1A97A 1ABFA 4EVQA 4NV1A 4IUYA 2B8EA 3C1AA 4OXXA 3TDNA 5BR4A 5KX5B 1PX2A 1PX0A 1KP3A 1CQWA 3VUFA 1IZZA 1V6SA 2PL9A 1RLTA 1O89A 2I03A 1TW3A 3ONDA 4Y30A 2QUJA 2PH5A 4KOAA 4KIWA 3W5DA 4Q3KA 2WVGA 1R9MA 1V95A 3I9LA 4Q7EA 1RLMA 4FYKA 3PGKA 1XVUA 1ULZA 1ND5A 1YZLA 3RQSA 4AT1A 2RBEA 4I5FA 3SR0A 3VX4A 3IUQA 3T1HB 2F8TA 4ZA2A 2VG8A 4RH3A 1JQBA 3HBJA 3LP6A 1CUZA 5F2KA 3UO8B 3UUEA 4A6EA 5CA1B 3MVEA 1O94A 3TK1A 1YVRA 4RD4A 2C9MA 3TW6A 2HMVA 3EF0A 3O1LA 3E03A 5DKFA 4TV8B 3FYUB 2XWPA 3JAMA 1LTHR 2NLOA 3Q8WA 4XGQA 5LOVF 4YQZA 5DOVA 4HNHA 3WQRA 4P32A 2ZJ1A 4G4SO 4JZYA 4NULA 5DTIA 3W5JA 1T8SA 1JFVA 3AR7A 5FCDA 3WZLA 2QRGA 3GP5A 4OXRA 3BGSA 4QUBA 1K5GA 4KVGA 1CZUA 3M3HA 2DERA 3FHOA 2VEDA 3AIKA 3W9SA 5JCXA 5KTNA 3WLEA 5LU8A 1UAAA 3HYTA 4GXNA 1IUPA 3GA7A 3MUFA 3V1TC 1ML3A 2AD1A 3FR7A 3PJGA 4B7AA 2PSFA 4JBWA 3I62A 4HUQB 2BTQA 3FFAA 1QYDA 4FJ0A 4Q34A 2NZYA 3F97A 3KK0A 4XB2A 3STHA 4ZCLA 1F2UB 4X20B 3X0DA 5CXUA 1D8AA 3P2OA 4E51A 3DO6A 3Q9UA 2PPVA 3VU9B 1L6RA 1G66A 1OLSA 3LW8A 1RJ9B 3A7EA 3KKLA 1NW8A 4TV8A 4ENVA 3QFRA 1LBEA 3AOEA 1NBAA 3G5AA 5E9JA 4H1TA 2BGMA 5F1YA 3WVNA 5IYZF 3LVBA 4PINA 5HQ3A 1HH4A 2PJZA 4LRSB 4LYJA 4B8WA 4LCJA 4MPDA 4UJ3A 3RS8A 3T3HA 5BNTA 4RVCA 3D8NA 2HRZA 5DV9A 4UE2A 4LRWA 4BFLA 1L5QA 4DR7B 1Q50A 2H2WA 2GFIA 1EDBA 1YJ8A 3MMNA 1WUJS 4ZYVA 3BA6A 2ZU6A 4CFZA 2LKCA 1XN1A 5DGXA 3Q3GE 2WW8A 1GV1A 1WUIS 2QW8A 1SIBE 4AMUA 2ZUFA 2AFIE 2UZ0A 3KZKA 4G65A 3R74A 5AKHA 3KKNA 1WLSA 2VRNA 4YBRA 5JALA 3D8HA 3VPDA 1XB2A 2WD7B 1TO1E 1ZY2A 3H87A 2QUHA 1B43A 1U7XA 3HCFA 2Y05A 1RVV1 3ZD6A 2FR0A 1SG0A 3FDZB 4XYBA 4K81B 4F45A 4P3OA 2L19A 1YKSA 1P61B 1OC2A 4QOHA 3LWBA 4EB6B 1KJZA 3H2HA 4JOQA 4UARA 1VKZA 4GBJA 3SNKA 5HWSA 3TM5A 1YDGA 1ZL0A 2HLHA 4K5QA 4MCAA 5FTWA 5IAKA 3L4JA 1Q11A 2C7GA 3C8HA 3HUEA 4AB1A 1GRRA 1PT5A 1ZDMA 1MQ8B 2I3GA 4ZDIA 1OI4A 3TAUA 2LWIA 3NH9A 4TMWA 3BRCA 3U44B 4LRXA 1XRNA 5FOQA 5EN4A 3MCWA 4QSHA 2MHCA 2P41A 3EGIA 3MLEA 4WNCA 5FFFA 3HSYA 4JB8A 4M49A 3U4MA 4AW9A 4JGIA 4Q18A 5E38A 4ZVQA 5K8VA 4RL4A 4ZEWA 1EE1A 1DKMA 2QR3A 1Q95A 4WK0B 3WQBA 4Y1FA 2WG1A 3O9ZA 1GGMA 1OYYA 3FZEA 4AULA 3N8GA 1PG2A 1I4TD 3BXEA 1A27A 3AHCA 2AWOA 2I6QA 2J6HA 1RPAA 2NZUG 2EKQA 3GI1A 1P62B 2OG1A 1GSIA 4RCVA 4CCYB 2Z0MA 5FI5A 3KJFA 4M7PA 4ZQIA 4HP8A 2XCLA 1K7YA 1OZHA 1QH8B 2G1JA 3V8NA 1O8CA 3RSSA 1X1EA 1SUCA 4GI7A 2X7HA 1V3TA 1SKYE 4G1BA 5B2FA 3F1KA 3V7WA 1ZN9A 4YJ2A 3C3DA 1MBZA 3L6CA 4ITRC 5DGHA 1XQWA 1UJ6A 2FMHA 3VZPA 4V0SA 1AMUA 4WJZA 1QRUA 2RGBA 2PUTA 4EF4A 4EHJA 1PD0A 2JKVA 2YDXA 4FUTA 2G70A 4O2BF 5E6RB 3N2GB 1PGJA 3GZTB 3AEKA 1T91A 1DB3A 1JZSA 2AH5A 1NXWA 2OZKA 2WTBA 3DV9A 4YWHA 2WHYA 4L51A 2ZE7A 2JLBA 3Q7TA 3A6DA 4PNPA 1RKVA 3IEXA 2R00C 2WSSD 4E3WA 1TTHA 2AVNA 1RM3A 4ZVMA 1EVQA 2H5LA 1PWHA 1WCWA 1Y3BE 4EYGA 3WKCA 5BV1A 2KWIA 3CSUA 2DPGA 4FQ5A 2IHYA 2XSZA 2B83A 3M6FA 3OE7A 3VZBA 4CKBA 1ZUNB 3GNTA 1XCBA 2H31A 3L8ZA 4W6QA 3U9SA 1YKGA 3ZLJA 2BEJA 2HWXA 3RRXA 3T5TA 4UTRA 3Q3HA 4P82A 4AMBA 1R10A 4XE5A 2Z30A 2JHGA 1T6XA 1HDXA 4EKGA 2RHJA 4XFJA 4I50B 1JZTA 4XPIA 1ZMRA 1EUDA 3RIHA 5B6IA 3S2FA 2N46A 2D1SA 4PQRA 3NHUA 5A71A 4EEKA 1K89A 2QD3A 1L4LA 3KT0A 2XYVA 1QVWA 2Z4SA 1SG9A 1NN1A 3ZPXA 3G68A 3UBTA 5FI1B 4B9AA 2R1UA 1G8HA 2GB4A 4A7PA 2F00A 2X2OA 1IY9A 1QU3A 1CUGA 5HKKA 5F12A 5JJBA 1CF4A 2PJDA 2G80A 5JH7A 2OO5C 2ACVA 4TTSA 2FUCA 4KFSA 1PJBA 1M10A 3N87A 4E6PA 1AE1A 2OV4A 2YZGA 1GQYA 2JFUA 3GV0A 4ZT7A 1ZWKA 3HUDA 3VMMA 3W4IA 4UMDA 2VHVA 2DSNA 2MSLA 3L8HA 3MWEB 5DYYA 4DILA 4CNQA 5IC4A 3QLUC 3UB2A 1R3UA 1KQFA 2GN6A 1WB9A 5HPYB 3SXJA 3C1UA 1SXQA 1GN9A 3DNMA 4POOA 3GG9A 1Q7CA 3GJ5A 3KHTA 5BSGA 1ID1A 4NX2A 3WWOA 3H0EA 3E2MA 1COWD 3MW8A 5CPFA 2ATEA 9LDTA 5H16A 4HPWA 3SX0A 3IT0A 4CV1A 3F90A 4AY5A 1Y6FA 1WOYA 1V9LA 1KK1A 3PQ2A 3ZC3A 4WSOA 4CMEA 5LP6F 2PUHA 3KQMA 3ZVMA 1ZGHA 2B1RA 1Y48E 1CP3A 3ZDAA 3DW3X 1G20E 1TVMA 2W6OA 2VYCA 1C3OA 1E5LA 2C2YA 3M49A 4HF7A 4L75A 4LSWA 3AU8A 4Q9IA 4GKJB 2VCYA 4FHGA 4RF2A 1J1ZA 3OZVA 4B4DA 4DDTA 3FOAA 2BDTA 2WJVA 1CD5A 4EJSA 2CT8A 4NBNA 3ZWMA 1J9EA 2XCSB 3QX3A 5C8YB 3CT4A 2PGIA 6PFKA 1NUPA 1YS6A 1J4AA 3C8MA 3P2YA 4MIKA 2LZ0A 1W1IA 3NT5A 1EBUA 4MVYA 3PITA 3VO9A 3KM0A 1F4PA 3IQGX 2LCFA 1XVLA 4MQFA 4OO3A 4PHFA 1RE1A 1Z0UA 2GK7A 1YE5A 2JPDA 4Z8XA 4CQMD 2CMKA 3QVUA 4R01A 1F7VA 4DC9A 1KMMA 2XZPA 4QYIB 5C8DA 1N9KA 1K68A 2FN8A 3ESAA 3MRXA 4FS3A 2DTDA 2R6JA 4L72A 1TM7E 1U65A 4DGQA 3KOOA 4M9ZA 2OBYA 4KR6A 2BFEB 4Y2YA 2REOA 4KW7A 4LXHA 4B34A 3MWLA 3GLVA 4E7PA 3FHLA 4BV3A 3IURA 4Q3CA 3DBHB 3U7QB 4BWFB 3U1TA 4FWTA 4Z9YA 3DVAB 3EEOA 4XQ9A 4TLBA 4LOAA 1A7UA 5K3OA 3RTCA 4C01A 3QE0A 5FLKA 1XPOA 2RG7A 4B32A 1XPRA 1M0TA 2GMWA 3VPXA 1CIJA 1VIMA 1DDIA 1JQLB 3KXIA 3H1BA 2PMKA 1BWSA 1CR2A 1L7BA 3FZNA 3QW4B 3RHTA 3ZN2A 4HFMA 4V24A 3E0QA 4B31A 2G4VA 4N6NA 5EXDA 4OG2A 5FBKA 1KA9H 3X2FA 3WQHA 3ZHXA 2IH2A 3DE5X 4B3IA 4ERXA 2DE0X 3BD6A 1MXHA 2WHQA 3HXKA 2ZR7A 4U2BA 1B73A 4RIGA 4Z7QB 1EZ1A 3I01A 2Z6AA 2NSLA 3JQDA 3RWMB 5TQ0A 5I7VA 5FBZA 4KPYA 1L4FA 4MQ5A 1U0HC 1U2GC 4RZHA 4URHA 1OFTA 5KOJA 1A5SB 3DMTC 3PNPA 1W4LA 2YWFA 3NAQA 3UJ8A 4PFKA 2Q27A 3JYLA 3KDAA 2C96A 1Y1SA 2PL3A 5HS6A 3ROTA 1UH5A 1YJ5A 3NGXA 1NM5A 5LYJA 1BVYF 3IPXA 4AKSA 3AZQA 2IXTA 4PIMA 1M2EA 2HSGA 3U19A 1RXSA 1QOPB 1V48A 4ENQA 4MKXA 2W71A 1BCRB 1IY2A 1E2HA 2L2QA 1Y5IA 1FB5A 3QOXA 4AECA 4RLFA 4TUYF 3BXGA 3A1TA 1H6AA 2HEIA 3I3SR 2GI4A 4BN4A 4KIJA 1XOIA 1NAHA 1VJGA 5FUBA 3DPSA 1D2AA 1JIIA 2BMVA 3BBPA 5JZBA 5K4HA 2XWQA 4FEYA 4BB0A 4FI3C 4QHSA 3ST7A 3ZD7A 1KZ6A 3CKYA 4KXQA 4Z1OA 3STWA 4ILEA 5KEIA 2OZLB 3IRVA 1MJNA 3MZ0A 1W0KD 2OO7A 3I4CA 3IJRA 4DRZA 5J9FA 4CEIB 5BWBA 1M8FA 3RSQA 4GSYA 1AXEA 4I1RA 1XXHE 1G42A 4E21A 5EIBC 3QY9A 3T5DA 3WHPA 1DC8A 4IDHA 1KEZA 4DQVA 2VYVA 2J9RA 3VISA 3KYDA 2FLWA 1XRRA 2QROA 1PNVA 2NYVA 2WEKA 1QYIA 1J23A 1Q91A 2ZYAA 1EGVB 3AJAA 4N6OA 4MVJH 5KVQA 3CW2A 1TTQB 5JVDF 4MOWA 4C9BA 2EW1A 1BCRA 1YJAA 2FPUA 2QVBA 2OKGA 3O4IA 3QLVC 1W96A 4B4VA 5BUZA 1DRWA 1QRSA 3DUFB 5EHQA 2J59A 4R8RA 4HR7A 3OF3A 5CIWA 2NO0A 3RUCA 2QN9A 1ZH8A 2QI9C 2XW6A 4KBFA 4EG7A 2QRMA 4N9QA 5BYAA 2ZAMA 2VUSA 1T3TA 2QJWA 5EPEA 1WDWB 4LJKA 1CDOA 1BN7A 4JC4A 4JITA 4TLLB 1FRZA 3R7LA 3KCNA 1KOFA 3AWDA 5KJ6A 1KSHA 2IVZA 3V42A 1R4NA 4BFTA 3AB3A 4EF6A 1KBQA 4RY8A 4C7MA 4QOFA 3IULA 1TUEA 3H2JA 3MWDA 5SY6A 5IF9A 2V03A 3C7DB 1R8SA 3C3XA 1Q74A 3USES 1HNXB 2J0QA 3Q3CA 3MTQA 3B60A 1FYXA 1MZVA 1HWYA 1ZOLA 3GOHA 3QV1A 1JKFA 1Q0TA 1G20A 1SRRA 2JCVA 2H63A 5JDIA 2OWDA 3G0OA 1O77A 3PDCA 2F3SA 2JHFA 4PLFA 3OX2A 3JSXA 2R7MA 1QE5A 5JRDS 1X19A 2EP5A 3JQ7B 4JWKA 2YCLA 2YQ4A 1HTTA 2C42A 3HABA 2H00A 3M6VA 4AZ0A 2C94A 1EP3B 1W0JD 2AJCA 1VFPA 4FFPA 2YV1A 3M3DA 1G16A 6AT1A 3WV5A 1X1RA 5K8CA 1QG6A 2XEXA 4IMIB 2X0EA 3GFGA 2QBYA 1KEKA 4X7PA 1HNWB 1LDNA 2EJWA 2JJ1D 2X23A 4JELA 4KWIA 1M66A 2X5KO 3EF3A 2D6FA 4NH0A 3STXA 3UQZA 3AC0A 1QLHA 1Z4IA 2WOJA 3BHIA 1T1RA 1I6WA 2EEZA 2PKEA 3M5DA 1XZPA 3ZU4A 1PUIA 1QX3A 1P1CA 3LSTA 4O1IA 4ZVRA 3RT1A 5FUWA 3H11B 3X2SA 2BWJA 4MULA 1BQ3A 1F2UA 1YQTA 4X20A 3NOQA 3AHEA 5CAEA 2V6JA 4JYPA 2FMIA 2XKJE 3IP1A 2GZHA 3EGCA 3QXHA 1YZFA 2GKOA 2I9PA 3U3RA 2D1RA 3W04A 1S7CA 2FPPB 1H9BA 1G21B 2H8GA 1HTWA 1R3DA 2XTMA 4KUGA 4R1OA 2AW5A 1VFNA 1BFDA 1N2ZA 1BXKA 1W2WB 2BCJQ 4P7KA 4C7BA 3TOCA 1ZJ4A 4C1BA 1Y81A 4Z9AA 4WN3A 2OG2A 3ZS9A 1TJ5A 4OFBA 5IZCC 2KMLA 5E7QA 3I30X 1WDMA 2FH5B 4S1TA 3B6IA 1V43A 2J31A 3OEED 2AC4A 5JG7A 3WMWA 4JXXA 4PAMA 3RKUA 5CFOA 3HXLA 2CMFA 4E08A 2QLNA 5JCPA 1PFQA 2HHHB 2QUBA 4GOOD 5BSTA 1BDHA 4GP6A 1BGVA 3T3OA 2YX1A 4JEIA 3HBNA 1L4EA 1MZPA 1DIBA 1SZPA 3WGNA 1RQNA 2EOAA 3G82C 3L07A 3CVUA 3LC2O 4RW0A 6YASA 2FTKE 4YMSA 5ALSA 2DWQA 4DSAA 4JB2A 3FNQA 3SS9X 4EHFA 2NVWA 3BGDA 2P67A 3K0BA 3ROQA 1RZVA 2BUAA 4JHLA 4DOMA 2WPNA 1U2QA 1AXRA 3D02A 2UUPA 4JGBA 4XJSA 2PZ8A 4FBMA 4NBSA 1U3WA 2WVAA 5T8KA 4TTJA 5T41A 5CLJA 4NABA 1EDEA 2QT9A 1T5SA 1W2HA 1XZ8A 1YU6A 2GK6A 1HPLA 3AERA 3GJXC 3OT1A 3IP7A 4X8MA 2CDRA 5EXPA 4N39A 5CLLA 5HTKA 3NFRA 2OQVA 5KYUB 5KKAA 3GJRA 2XA9A 3GJQA 4GM0A 1FP2A 1GJRA 1X7HA 3GLUA 4F86A 1CEXA 1N2GA 4A26A 3WLTA 4EG5A 1JEAA 4O4JF 2WG2A 5I9MA 1U2RA 2CFRA 2Y1KA 5CYGA 1FVOA 1PEYA 2HL6A 5BSKA 3E53A 2C7OA 4EABA 1XSEA 3AR4A 3EOZA 1TJPB 1ZUHA 2HIMA 3H9QA 5CJ2A 5BSUA 2FWAA 1BFUA 1I24A 3H6GA 3SM9A 4BGEA 5ITZB 5HNKA 3CIOA 3STUA 3PD7A 1JHXA 4Y0NA 1JQ5A 4J0DA 2J87A 3WGQA 4ZJZA 3FSRA 4I3FA 6REQB 4MP6A 3PA8A 4G63A 2A78A 1VKOA 4L8VA 5EFZA 2ZZKA 1BU5A 3HZHA 3ZE7A 4ZZ0A 3ZIAD 5FL7A 1AKTA 4BO3A 1Z3CA 4FPXA 4XVQA 1NASA 4DJJA 1V5FA 1UKAA 3EAQA 5F5XA 4CCYA 1TKCA 3TQFA 4FS8A 5H8WA 1GA4A 3H1AA 3ACBA 2HTEA 2JJ2D 2QMOA 1HE2A 3ZTTA 4ENTA 5F2NA 2JVKA 3QBVA 3AJ8A 5TV2A 2GFHA 1KAEA 2C78A 3EXHA 1AUOA 4FCVA 5DBOA 1FL9A 2FN3A 1AK2A 4Y2VA 3G7UA 3I6IA 5LA6B 2QA5A 3ZEIA 4EGAA 4Z7OB 3R3XA 4P4LA 1V7PC 4PPGA 4RUKA 5KOYA 3DDOA 5CT9A 1FS4A 5B1HA 1V11B 2ZBQA 4F0JA 3W5CA 4IIBA 2A0FA 1NXOA 3DOUA 1FFBA 2H1FA 2VAVA 1H05A 3B6ZA 4QFDA 5CGZA 3WISA 5HVNA 2NU6A 1KRHA 3B6EA 4Q39A 4A5OA 4GRIA 4GX2A 3IUSA 2HGSA 4CKEA 4EHDA 4EKIA 1QQTA 3UIEA 1JR3E 4GEKA 1EIWA 1PZGA 4MA5A 2P75A 4P84A 1TKRA 1BSVA 4GX5A 3DUWA 1Z73A 2B4YA 4H3VA 3DJYA 5E8RA 3BL6A 3R7BA 4JUAA 1NX6A 4NAUA 1JHRA 1FFDA 3ZOZA 4EPWA 4KUHA 1QDUA 3MS2A 4TZ0A 1T2CA 4KDRA 1M34A 1Z45A 3SSOA 1RPTA 4BQEA 4N0QA 3C3JA 5AK3A 5J1TB 4WUVA 2A9QA 4ZP1A 2OB2A 2YV4A 4J76A 1UFRA 2Q21A 4YHBA 4QAJA 4WASA 4QPCA 4QLOA 2JVJA 3BWVA 3RIMA 3TFWA 1LY1A 2BEKA 2IS2A 1FJ2A 2WJZB 1IJEA 1GAEO 3EXEA 3ANNA 1EZZA 3AW9A 3D59A 2A5GA 4PYMA 4ZD6A 3BTVA 5IAGA 2VXYA 1RR6A 4OATA 4I0WB 4G0WA 4L8LA 3OU7A 4YRQA 1IN7A 4YK7A 4B35A 5I7WA 3H9CA 1AM4D 2GHTA 1GKKA 4HDSA 3V9AA 4WBNB 3AJRA 4K05A 1B8OA 4DYHA 3O2NA 3DLCA 2HA6A 4FHZA 1JBKA 1N0VC 3OFNA 1MH1A 4URZR 5FOVA 3REOA 2BHTA 1D1PA 4JP1A 4IW3B 3RW9A 1P72A 1HX7A 4D9JA 1B8NA 1TQ8A 3HDHA 4EEZA 1E4OA 1GU1A 1QP4A 2PA0A 3KQTA 5TMBA 4BMXA 2C58A 2MIIA 2FW0A 1TMOA 4IQGA 2OBNA 3TNLA 2IX3A 1XELA 3DXZA 2COEA 1IWPB 2YQ5A 3HHEA 5D3MA 2E48A 2BZ0A 2NUPA 4LZWA 2UYHA 5C8ZA 2G67A 1L5HB 3BBLA 1I1QB 1O1YA 2OL4A 1XJ0A 2B7CA 4KXLA 3ADCA 1ZN2A 4Y2GA 4PM4A 2RONA 2YMMA 3KYCB 4RKEA 1G2OA 4JBHA 1QTNA 1QHYA 5EWMB 3EEQA 4M21A 2NU8B 4B2YA 4A73A 4F2WA 1CBUA 1QWSA 4RK4A 3SZMA 3VBCA 5HS4A 1PSWA 3NNSA 4XB1A 4FFLA 3D6HA 5KNBA 1SC9A 4NYIQ 2SKCA 1OZ0A 1QIGA 2G1KA 2R4UA 1JI0A 3WAJA 1Z5PA 4JZKA 2OPHA 5HIKA 5IT9A 1FMFA 2XCQA 4YMTA 3HRIA 3IR6A 2O8EB 2AOTA 2NSHA 3L7NA 3R7WA 1GL3A 4M37A 1MN6A 4RL6A 4RXMA 1XEWX 3CEHA 4QDOA 1CX9B 1JLLB 1NXPA 1T1SA 1JHQA 1FU4A 2V7EA 3FPLA 4HEA1 4MR8B 3EZLA 2OBLA 3L92A 3WDKA 1UQUA 1KPGA 4J4BA 4Y2JA 1EKXA 1ONBA 1U2TA 4C3ZA 5BUQA 1RMYA 3PR1A 4ZRNA 1U2ZA 2WYHA 1M8JA 4AJJA 4G0QA 4INPA 1YVEI 3TPFA 1FW8A 4GUDA 1K6IA 4WNYA 3BE8A 1FS5A 3A6ZA 4PYKA 1DTWA 3NAGA 1V8ZA 2WK1A 2P2CA 3UJ3X 4RZ3A 1AZWA 1TECE 1WM1A 2Q3BA 3EZNA 1RMQA 3I42A 4OLHA 4OP3A 1ELOA 4K1LA 5HFJA 4MCHA 3OTIA 1DKPA 3GVCA 3ND6A 3CN7A 2VJKA 5FJIA 3R8CA 3QSYA 2VJPA 1GGFA 1YL7A 2REXB 3DAYA 3HVUA 2ZJ2A 3G8YA 3GFVA 3P9CA 5IT0A 5ALWA 2PDAA 1YZHA 2EYUA 4FHFA 1QHGA 1KL7A 1TJ4A 4ADSG 1FSSA 3FDIA 4JQOA 1GQFA 1CUVA 4R8VA 1J8YF 1Z4QA 4EP1A 5K20A 1GPWB 4IINA 4ND4A 1GKUB 4IVRA 4R98A 1JIKA 3OZWA 4X62B 1X7ZB 1V1JA 1BMTA 4LDAA 4RPJA 5DGCA 1Q2XA 1A2OA 1V47A 4BMOB 1OLUB 2J0UB 4ZOQI 1ZK3A 3H8SA 2VTBA 2J8ZA 2X3FA 5CNMA 5BN5B 4BXOA 1FLNA 2P8JA 2C4VA 1P0MA 2JVIA 2IEDA 4GKVA 2H6EA 2VJAA 5IEBA 1DG3A 2GH1A 2NVOA 4LOLA 3GK3A 2QP4A 3O2SB 1EFRD 4TSKA 2ZRFA 3KJZA 4KNVA 2PMEA 4NAHA 3AG5A 5EJIA 1GFIA 1U4SA 3KETA 4D3DA 3EUFA 2VKTA 4RVUA 3MGGA 3OZFA 3L93A 1IIBA 5IBRA 1BS9A 1DVRA 1F2VA 1PW7A 4KH0A 4CM3A 4E1VA 4D96A 4KGDA 5IBQA 3T3PB 5HM8A 1ZOOA 2EX1A 3QVXA 4LNAA 2BKAA 3IDOA 1ULUA 2Q5FA 1NBIA 1ODCA 3H2ZA 4TSRA 1PT6A 4KOEC 2H29A 4NFYA 1J2JA 1QZTA 4NDZA 2I0FA 3CF0A 3ZWNA 3M4NA 1GZ3A 2AZ4A 2CBZA 1NNSA 4C6HA 1OLUA 1UOPA 4JHXA 5B3JA 4LF8B 2AMLA 2F4NA 4B3SB 3O4JA 4QPZA 2PAFA 3Q40A 3WBBA 2XF8A 3GX1A 3X44A 2XZDA 4GOMD 1RKQA 2Y1LA 2VSXA 4L4RA 5CFRA 2HDHA 5HZGA 2PU5A 1TYCA 3NRBA 3AHHA 3N7AA 5EIOA 4CCWA 4GO1A 1WZIA 1WKBA 3JQ9A 3HP1A 4AJ4A 5DBEX 4YFYA 2ZRCA 5CFNA 3B1JA 1RFGE 5LM3A 2PUDA 1DXYA 2WAAA 1JR2A 1S02A 3MWEA 4OJQA 3RIEA 1H1LB 2I55A 2C5LA 3B3GA 4M1EA 3LHKA 5J43A 3OCCA 5HE9A 1YR2A 4DMFA 3LXMA 4X6LA 1B0AA 1MB0A 1Z13A 4GR4A 5F76A 3FTQA 4B2LA 2AN3A 3W6PA 4BEBA 4JBXA 4MJXA 4ND6A 4WK6A 4M53A 3ETHA 1I1HA 1LBIA 1JGTA 3OEHA 4RORA 1L5LA 3WJ7A 1HGXA 4ODIA 4FMBB 3S2IA 1YQWA 2W2QA 3DXYA 3I9V1 4PZLA 4V0RA 3AYXB 3T7KA 2J9GA 4CMCA 3I61A 4I6GA 2GM9A 1OWPA 1PHPA 1SK8A 1TM5E 2CHUA 1INLA 3IBTA 4KK3A 1RHRA 5CD9A 3L06A 2OGTA 5I8WA 3ZZ1A 3NLLA 2DR2A 3QMMA 2CJYA 1GNSA 3EF1A 4I1PA 1EUCB 2FLKA 4ZOLF 3NHJA 2J5BA 1JHDA 3CY6A 2ENWA 3LVRE 3NJRA 4JLVA 5AUQA 3V4LA 5L51A 3CKKA 1T36B 1E1MA 5IARA 1BTOA 5BVGA 1YIDA 2DTEA 2QK4A 3IILA 1BG6A 3K0AA 3CWZA 1SCDA 3FPHA 3K4QA 1OWLA 2INGX 4FSHA 2C2WA 3C4QA 5ECGC 3TR0A 3V4ZA 3V8MA 3NTLA 1UUFA 4RA6B 4O25A 1KDVA 3C0KA 3D7RA 3FFBA 2D8AA 3F8WA 5EKSA 1OT5A 4UNRA 5DLYA 4PANA 4QT0A 2QG6A 2IUEA 1E20A 3BE6A 4BNKA 3I5AA 3EARA 4B7UA 5CCDA 4U8GA 1VRCA 2CLDX 1SHTX 1YE3A 3JRWA 1ADJA 3ES9A 3OKAA 3QKSB 3TCNA 1TVKA 3H2YA 2WA2A 3DOJA 3EXG1 4EMSA 3QYPA 4EGJA 5KNBH 2SECE 2VBGA 2YMQA 4DUGD 5LR6A 3E8SA 1Z5OA 3KQSA 3RUHA 2HI0A 4NEGA 4NK4A 3D4OA 3QU7A 2F6RA 5DSXA 1D7AA 2QT1A 2XYQA 3DLAA 1WAMA 1XWFA 5JV5A 3MOIA 1JPJA 3RVKA 2P9QA 3TR6A 3WNVA 3LDFA 2LIPA 4JYBA 4AQ7A 3ZGVA 4WLUA 4BLUA 4XGKA 4JR1A 4TMXA 5U4XA 3WLKX 4C0HA 7REQB 2D06A 1SUDA 4YP9A 4YJ2F 3I2KA 5KOJB 3FI9A 1N9ZA 1IYZA 2EQAA 2IHTA 2Q49A 1ZUIA 2NUTB 2OC9A 2R3SA 4MW9A 3QG1A 3SZRA 4DV1B 5B6PA 2G0AA 4HRXA 3G5LA 3JYHA 2AD5A 2DKFA 2QN1A 5D01A 4MWGA 2HCBA 1MX3A 1TM3E 2ZIFA 3E84A 3IUPA 2I8AA 4MS1B 1DG1G 1IONA 1GQRA 1EVIA 2G40A 121PA 1CUIA 3M4YA 3MC1A 1GKYA 2RGDA 1FDUA 1YDFA 1KNQA 4HUJA 5JXIA 1TJYA 5F2OA 2SNIE 3GMTA 2E6KA 1VG8A 4BTVA 3IQWA 3ZNQA 3ZKAA 1W47A 3AVYA 3U62A 3QE3A 3WYCA 5I3ZA 1OKKD 4BNXA 4G0YA 1ZK1A 5I45A 2HDOA 1T8TA 1Y1PA 4LMPA 1OTXA 3DEIA 3JATB 4RY2A 3UMMA 3HKCA 3K1ZA 4MSUA 3IPCA 4OA5A 5CJPA 1GD1O 2OGSA 3R3ZA 3HJTA 1JH9A 1KEUA 4LGCA 5AJUA 3GEBA 4GGPA 3RJ9A 3QA3E 3FUVA 3H4VA 5H70A 3QRWA 4MYCA 5E1OA 3HKBB 3I0ZA 4IEIA 1SCKA 1FUIA 4GPD1 4KHPB 3V48A 2PPLA 3G0HA 1RJGA 1Z4LA 4FU0A 5D1NA 2I4RA 1Y1KE 4DSTA 4L74A 5LL6P 2FUNB 1CUSA 1Z28A 3E6AA 1ESMA 2IIVA 3DL4A 3W7VA 3H1TA 3KT6A 4CODB 5TGTA 2D0PB 4K6KA 4TTPA 2QL6A 4MARA 3NBZC 5F73A 3RVBA 1AHPA 2ZSKA 5GADl 2IH4A 2ZITA 3W8FA 4MWTA 2FSIA 2AYYA 2PUVA 3KR1A 4ZAWA 1J22A 1ZC3A 3AR9A 3KSZO 1NONA 1K8ZB 2C9CA 3DOIA 3QITA 1Z74A 4KAXA 3JQ6A 5IDWA 4RHTA 4HWGA 3ZW7A 2ILTA 2R6CA 4N12A 4KQJA 4TXHA 3UVEA 3L7OA 5DRYA 5IAOA 1G9SA 1UBOS 3LRPA 3CSDA 3NGMA 3NNNA 3ZHRA 2FDCA 1E7YA 1G6KA 3AY0A 5FBRB 3QIAA 1EUYA 3EZ9A 3W77A 1GILA 4JP5A 4GZ3A 4LC1A 3WFIA 3UA4A 2ZRMA 1JVNA 2Y1OA 4H3KB 4BCBA 3DEHA 3F67A 2O2SA 3OQHA 4J9VA 4AG5A 1Y3AA 2BFPA 4MKRA 3NIFB 3P0HA 1CJVC 1BVRA 4CM4A 5ERXA 4WHMA 2XVXA 4OBBA 5BQ3A 5JYCA 5M04A 4DV3B 1BJKA 2HBQA 1GIAA 4XQGA 5FD8A 3H3XA 1K7CA 1T9AA 3V1MA 9LDBA 1D5CA 1PG5A 2IHJA 1I8TA 4N3CA 1W85A 4Q00A 1LI4A 5TVGA 4F8JA 4GZ5A 3EYAA 3FWZA 4KVAA 4H7DA 2Y99A 1Z0JA 3TIXB 4D6XA 3TRFA 5TT1A 3U16A 4MGEA 4KJXA 2O7QA 2BFBA 2QGNA 4BMSA 4D7AA 1MD9A 3HB7A 4GMKA 4IEEA 4F2GA 2GZDA 6ADHA 3IXLA 4ECEA 5K0EA 4PLPA 2C4NA 3ESDA 5IFLA 3RSHA 1TK3A 3FXAA 1MC8A 4X7BA 3ZJ4A 4DA8A 4NZYA 1O97C 4ZGWA 2DLNA 3SS8A 3T9CA 5LZ9A 1PZEA 1NLMA 4RO0A 1BE1A 1U9JA 2ZRJA 4MUEA 1KOLA 2H0QA 4BX8A 4HNGA 2DWPA 2PUAA 4G0VA 2QG4A 1U5BB 4E4YA 2ANCA 1I1OA 5EA2A 4JLOA 1KVSA 4V03A 2QM0A 1L8QA 3K0CA 4QGHA 5BYJA 3OJCA 2R2GA 4URXR 5GIPE 2B1GA 1YT5A 2O0KA 1CUJA 2IPXA 3BSWA 5D84A 4RTNA 1J42A 1AURA 1KEVA 2Q4DA 3L0DA 1MKYA 1RAFA 2BEVB 3MLAA 1QK5A 3NP9A 2C88A 2KS6A 1OR8A 2I78A 2JBHA 2PSJA 4BLSA 3ERCA 4C5AA 2W5UA 4CPDA 1VHLA 3B3JA 3N8DA 4LJ8A 1ZCBA 1ZW6A 1PR4A 1ZI6A 3CKLA 3MBKA 4YCCA 1VCNA 5A04A 3PCRB 2IOFA 2V9CA 1J9ZA 1PD1A 3M7IA 2R7LA 4CTKA 2QTLA 1VL1A 3G88A 4XDHA 4TVOA 3SEAA 1KJIA 1P17A 2IP2A 1OYOA 3GUZA 1XZCA 4NBWA 5ETJA 3CZ5A 1KWKA 2P0YA 2WLSA 2VUTA 2ZTUA 4S2UA 4O1MA 1E1RD 1LZKA 1I33A 1BGXT 3BFVA 3CRVA 1E60A 3F3SA 2DT8A 3PXXA 4NJOA 2J3EA 1LSSA 3BULA 2JKYA 4JLUA 5ESRA 3R7WB 2FR1A 1TKBA 4F71A 3NDRA 2W2NA 3M9XA 4DRXA 2ZJ3A 3N0TA 5BMVB 2D7DA 4PSKA 2IF0A 5JSHA 1UP4A 4CKEB 2DHQA 9ABPA 3AUJB 2WIJA 2AI1A 4X6UA 3TNJA 2VH2A 3S81A 2VJOA 2HDNB 2O5RA 2DX7A 3UB4A 1QU2A 1ULTA 4X1OA 3AKZA 3CRW1 3L7CA 4OSEA 2IDMA 5JYEA 4FOLA 4H17A 3BJMA 1MRNA 2COUA 5IRCD 5EP4A 4EJFA 3U37A 4G1UC 2FSUA 4NVRA 3UHJA 3MJTA 4JXKA 4YCLA 5JO0A 1T3LA 1U3VA 4DA9A 3CVJA 3FNHA 3DEKA 1RQXA 1Z6XA 3E9DA 3TL6A 2BM8A 1YZVA 2RI6A 2Z5LA 1ORDA 3MHPA 3TUIC 5JWHA 4BYMA 2XT0A 4JT8A 4WUTA 3QGMA 2RHHA 1XU4A 4KGXA 1SCJA 2R5FA 3HBMA 1YA6A 1JH8A 1PNQA 2PLNA 1P6UA 3ABSB 3LPCA 2GS9A 2C97A 2RDMA 2YOFA 1QP8A 3UK1A 3ZV6A 3TIVA 4HQOA 1KS9A 4YALA 3ZY3A 5B53A 3DE1X 1JRLA 4CV2A 5J4LA 3COPA 1QGUA 4PPQA 3IE2A 4G8JA 3HGMA 1A5TA 2Q7DA 4N7JA 3AEQA 3D7LA 3EJ6A 3EVBA 4OUKX 4R1SA 4ZRDA 4ITUA 1MABB 1YZ3A 2J0UA 2J4FA 2LXNA 3IJPA 1RXVA 2M2IA 3LL4A 5DX8A 5CJJA 4D26A 5IPFA 1KSFX 2NN3C 2VPZA 3I2GA 4I81A 4MQMA 3GJ7A 1TU3A 2CV0A 4ZN6A 1YB4A 3W06A 3LX4A 4A2PA 4CW7A 2OB1A 4DREA 4YMLA 5IM4F 1W73A 1KJ9A 3OUTA 4KWHA 5H83A 1E62A 3DAOA 5E6UA 4Q3NA 4D8XA 1FX0A 3PUWA 3LT0A 4E5VA 3DCJA 1F0YA 4I46A 3HLKA 3DKVA 4W1SA 2AOUB 4P4SB 4HNVA 3E9ZA 4O33A 2Y6VA 5EWLA 1F1JA 1M9NA 4R9UC 2F90A 1E4EA 2I6TA 4F6CA 4XGIA 4WGFA 3H1FA 3WKEA 4V1CI 1PVVA 1IM2A 4M0MA 5JHHB 1WB4A 1U3CA 2H1IA 3F5SA 1K8QA 2D0OB 3IOMA 3M1IA 4RAOA 3UMJA 4BQPA 1HNZB 3PNMA 3C7CB 4UHBA 2HCTA 4P31A 1HC7A 5AVQA 4UUBA 2LCIA 1KJNA 4JS0A 1MABA 2RJ3A 3FUWA 4BZXA 2ARKA 4OKIA 3IA2A 5F98A 1QE0A 1OH8A 1F51E 1JNXX 1U0EA 3AVPA 3AZOA 4PGHA 4TMFA 2OORA 4WRRA 3B36A 3VR5D 5BSVA 1BDIA 2JIOA 1H0HA 2OOSA 3SKVA 1DDOA 1QTQA 1SCBA 2FQ1A 3NBAA 1B6SA 1OAAA 3PGA1 4YMHA 2GT1A 2JDID 3OZTA 3V2UA 621PA 2NYUA 4TTAA 1YCFA 2WG0A 4TT8A 7MDHA 1FX0B 3SLRA 3VU8A 4KO2S 2FSFA 2GPNA 3I5UA 4QL3A 1Q1GA 3PNLA 3IPAA 1VLQA 4HN4B 4CG1A 2V7QD 4BJHB 3ND8A 3PFWO 2IXGA 4M98A 3ZXSA 2YASA 5C7OO 5HCNA 5SZJA 2BT4A 2BSAA 4MRRA 3FFWA 1MGPA 1UMDA 2OECA 4QD3A 3R2JA 4ID9A 5FUXA 1T35A 4LZLA 3T7AA 3P4UA 3THWB 1Q84A 4D8UA 5A1TA 1NVUQ 7ABPA 3CNBA 3QELB 4Y6QA 1SCUA 2V6MA 3K2QA 4KVFA 4BLTA 5GINE 1OY1A 3GRUA 2JHPA 3NBYC 2IYXA 3D2LA 4LF4B 1NQXA 4JQSA 4DCPA 3L8GA 4OHWA 1GZVA 1CY6A 1OXUA 1PZMA 4IGIA 2PS1A 3L8YA 4DSUA 4G3XA 2VSOA 1A4IA 2DG2A 2ZI7A 3BXFA 1OX4B 1PDVA 4JLSA 3SE0A 3WKAA 1I6LA 1GEEA 4KQWA 4TV8F 1ONOA 2YVLA 3GGOA 2B4RO 3ZHVA 3NM5A 1SUAA 3QKTA 4DZTA 1BKDR 3HVIA 4M0CA 3ZWWA 3LD9A 2DY1A 3JQAA 3FKQA 1G55A 4HMPA 2I1LA 3BWBA 3C5HA 4HCJA 3KB1A 2W2VA 4HXGA 4GYYA 4V0OA 2ADMA 4HK4A 4C0KA 1EESA 2JIQA 1EQUA 4BB9A 3TTSA 5JXWA 1OPRA 2UYCA 5C1OA 6Q21A 4R0MA 4QFBA 1TF2A 5FWYB 3PC7A 2J41A 2WAXA 1JP7A 2WWTA 3ML1A 2C0QA 2QVCA 3DOEA 3FCOA 4KXXA 1GRNA 3HEBA 3OC6A 1KERA 4R2XA 2OENG 1EGMB 1Y4DE 2OZEA 5H0IA 5FA5A 2YUTA 3EISA 4A1OA 4RLSA 4KQGA 1P1FA 4RQAA 1SU8A 4OHMA 4DTCA 4IZ6A 1DEAA 3D6UA 1A76A 3ZY2A 3AQIA 3VZQA 3RVDA 2R0QC 3RYIB 1L4NA