4OO3A

Crystal structure of a putative oxidoreductase (parmer_00841) from parabacteroides merdae atcc 43184 at 2.23 a resolution
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
439
structure length
439
Chain Sequence
EGFTGAPGEVKLITLDPGHFHAALVQKVSYPQVSKDVYVYAPTGFDVDEHLKRIQGFNTRAENPTAWNEIVYTGDDYLEKMLAEKKGNVMIQAGNNGKKTEYIKKTLEAGINVLSDKPMAINSQSFKLLEECFAIAKQKNIMLYDIMTERNEITTMLQRELSTIPAVYGEQLKGSPEEPAIVKESVHHLFKLVDNKPLTRPVWYLDVNQQGEGIVDVTTHLVDLVQWEAFPDQIIDYRKDIELIDANRWTTSISPEEFKQVTGTDAYPDFLKKDVENDTLKVYCNGDIVYKIKGVTAKVSVIWNYTFPKGGGDTHFSVMKGSKADLVIRQGKEQNYQPELFVEAVKGVDLAAYEKDLTASMEKVSAEYPGVALNKVGDGVWQVEIPAKYRVGHEAHFGQVTEHFLDYLKEGKLPDWEVPNMLAKYYTTTSALDMAKAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (PARMER_00841) from Parabacteroides merdae ATCC 43184 at 2.23 A resolution
rcsb
source organism Parabacteroides merdae
total genus 148
structure length 439
sequence length 439
ec nomenclature
pdb deposition date 2014-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF16490 Oxidoreduct_C Putative oxidoreductase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4oo3A01
3DHNA 4FN4A 4LCEA 3I6IA 4Q3NA 1GQQA 1I2ZA 3UF0A 1NYTA 2GZ2A 4LMPA 2HK7A 2NSDA 1FJHA 1GL3A 1D1TA 1X1TA 1XGKA 2G17A 5IDXA 5IZCC 1P0FA 1YWGO 2I9PA 1FK8A 2CD9A 1HETA 4M89A 3GRPA 3FWNA 5JAZA 3U3XA 4F45A 3RJ9A 3E03A 4GMGA 5G0WA 3ZWVA 4CV3A 3AI3A 3AI2A 1XSEA 1KEUA 1V6AA 3TJRA 1PL8A 3U5TA 4ZRNA 3WTCA 1Y81A 3LT1A 4YEDA 3RD5A 4NU6A 1QYDA 1Z73A 4NNJA 2Q49A 5CFZA 1T24A 3OETA 3HDHA 1RWBA 1BVUA 1WPQA 4OQZA 4QXMA 2C54A 4QECA 3JQGB 3RBVA 2AE1A 3ZV4A 4BNVA 1JN0A 5JMPA 4ZQGA 4FGSA 1LEHA 2HJSA 4IMRA 4RQUA 5A02A 2CF5A 4A2CA 1H6BA 3UHAA 1WDKA 4LVCA 4B3IA 3BTOA 1F17A 2VYND 1DC5A 3CKYA 3GN2A 3QV1A 1ISIA 5I9MA 3IMFA 1B2LA 3E5MA 4IY1A 5G2OA 3Q9NA 1MG0A 1K0UA 4RZIA 4A10A 1KERA 3IP1A 3WICA 1NQAO 2CF6A 2IYOA 2R00C 3C7AA 5DCUA 1DEHA 2Y1GA 2EP7A 3DZFA 1GZ3A 2C7GA 4Q3EA 5IXYA 1CRWG 2VQ3A 4IDCA 3BMOA 3H9JA 4XEHA 2E6UX 2WEKA 4AJJA 1U28A 2AQHA 3OIFA 4BQRA 3VPHA 3FSRA 3JQFC 3I52A 4JJIA 3TFOA 3ZZNA 1DRWA 4N54A 3QY9A 4WCFB 5MDHA 5TF4A 3O9ZA 3ETDA 3GG9A 4LW8A 3E82A 4B4VA 3KSDO 5JBIA 2EHDA 3EVTA 4FJ2A 3LQFA 4HV4A 3AY7A 4CLRA 1LDBA 3INTA 4LRSB 1U7TA 1GAEO 3H2ZA 3ASVA 4RF3A 3TPCA 2GN8A 2A35A 3DXFA 2Y0EA 3RU9A 3ZV5A 4E2ZA 1XA0A 1H94A 1DFGA 4BQPA 2EP5A 4J3FA 3V1YA 3AM4A 3L77A 3MJTA 4Y6SA 3DDNA 4B8WA 4E5MA 1IL0A 5CDTA 1BTOA 1R16A 3GVHA 1M6HA 2HMTA 3ZW8A 4B4OA 5F1KA 4D3DA 4R5HA 4RO0A 2I65A 4J7XA 4NBTA 1M66A 2BLLA 3H6KA 4YDRA 3HUDA 5ENVA 4Z9XA 3GDFA 4EJ0A 2HJRA 3ZU4A 2PZMA 1RM5A 5DCWA 5ADHA 1SNYA 5H83A 4DA9A 1EE2A 1SZJG 4RPLA 1EE9A 5A1TA 1XDWA 4LMRA 3LDHA 1J5PA 1I2BA 1K6XA 1W4ZA 1YRLA 2Q2WA 2VTDA 2ZB8A 3JD2A 4NK5A 4R1NA 4HFRA 4JN6B 4BO0A 1PZEA 5G0SA 1RM3A 3AY6A 4E6PA 2JD1A 4YRDA 1NWHA 1KEPA 3JQ7A 2AA3A 4YAJA 1XQ6A 2E37A 3GUCA 1E77A 3PFFA 1ENYA 2XPCA 2FR8A 4BO9A 3ADOA 1GCOA 4I1IA 1T2EA 1PJ3A 4AL4A 4PG8A 2UAGA 4RDHA 1C0PA 2I99A 2X4GA 3QVWA 3WGZA 4YVFA 1DJQA 1PGPA 2UV8A 5HTOA 3OJLA 2W2LA 1P1KA 3P5SA 4HP8A 3JQ8B 4ONEA 2CDCA 4RVGA 5GY7A 4FFNA 3WFIA 4ESOA 2W90A 3KLMX 1PL6A 4N18A 2FRDA 2ZTVA 5A3VA 4RPKA 3E5RA 1SCUA 5JCXA 2PWZA 5TNXA 4OXNA 4WLFA 3OF2A 4RV9A 3DZBA 2GF2A 4GWGA 1B8UA 3I9LA 4Z0TA 4PLYA 4B4UA 4UUPA 2YW9A 1EVJA 4DMLA 3FNFA 4QFDA 1UR5A 3TOXA 4JBIA 3G0OA 1WMBA 4JLWA 3V8BA 1Z75A 2GCGA 4TRMA 3UXYA 3PTZA 2GUGA 2NVBA 3OP4A 4KUHA 1WZEA 3LT0A 1ENOA 4CMAA 3KRTA 4ZQFA 1D8AA 3JQGA 1HDCA 1ZK1A 4NIMA 1K89A 1NHWA 1YVEI 3TZHA 2RBEA 4I9UA 4EGFA 4B7XA 3BMNB 3EZLA 3MJCA 5L4NA 2C07A 1Y9EA 1F8FA 2B4TO 3C7CB 4A27A 3DBVO 3KHUA 5A03A 3V2UA 5KJ6A 4CLEA 3FR8A 3PYMA 5AOVA 4RPGA 4NFSA 1H6AA 2O3QA 2B5VA 4UVDA 3W4JA 1K5HA 2NVUB 1R37A 2I76A 4YB8A 3H9UA 2O48X 3F4BA 4DBZA 1LRLA 2EKQA 2J3HA 3AM3A 4W7HA 1HE4A 1YO6A 3E1KA 5FI5A 4AJEA 3W4KA 2X9NA 2WSBA 2RHRA 3GF4A 4WLNA 4IQ8A 4BGVA 3ZWNA 3UKOA 3AWDA 4Z3KA 4IJKA 3WMXA 1E7RA 4J4BA 4A7PA 2WD8A 4K6FA 3DL2A 4ZD6A 3H9QA 1SB9A 1U2DA 3PWKA 4OXKA 1V3UA 1Y8RB 4NPCA 3C85A 5JSFA 3JD3A 3ZH2A 3HDQA 2X22A 2WE8A 3OJFA 5CP8A 2OUIA 2PTGA 1F0YA 4ND3A 1GU7A 1YXMA 3AW9A 3IJPA 4IMPA 4BKUA 4EEXA 2Y1CA 2X6TA 1T1RA 3C24A 1TI7A 4ZA2A 2A9FA 4UEOA 5G0VA 5IDYA 4HWKA 1Q7CA 3KVOA 4ZJUA 2J6IA 3DEYX 1FDTA 1YL5A 2O50A 4BMNA 1UAYA 3PXXA 4KWIA 4YBZA 4YXFA 2VWQA 1NQTA 2ZQZA 5DBGA 1N7GA 3IOYA 5T6BA 4YAGA 1LQTA 2C0CA 1E7WA 4DTIA 2Z1NA 1BXKA 1BVRA 1IPEA 1NFRA 4KDEA 4CM8B 4HFNA 1Z7EA 4BO2A 1UXIA 3PJDA 1AN9A 2VRBA 4XQ9A 3T4EA 3DOJA 3R6DA 2HQ1A 4INAA 4DBVO 1B16A 3O03A 3W8DA 5CHEA 1NNUA 1HRDA 4TZKA 4FJ0A 4FJ1A 5IF3A 2ET6A 2ZK7A 4WLUA 2OFPA 1ONOA 3DQPA 3VTZA 4A73A 1A71A 2OO5A 1EEHA 2BGKA 3SLKA 3C3XA 3VOSA 1TT5B 4TKMA 3QRWA 3R3SA 5AQ1A 3SC6A 1KVUA 3HQ4O 4IDAA 4KUEA 5KJFA 3GPIA 2HK8A 3PHLA 4C7JA 1QMGA 3MJEA 3DZHA 5KVVA 1MFZA 1YJQA 4YT4A 1ZK3A 2VNAA 4M54A 1SOWA 2FZEA 3EW7A 1PTJA 4Z3DA 1P1HA 3ZWCA 5ICSA 1P1FA 6ADHA 3JQ8A 2X0IA 2VYNA 2QW8A 1VLLA 1VJ0A 4YT5A 4BO8A 1B7GO 1SMKA 1ADGA 5JFOA 2YQ4A 3DFUA 4IGFA 4E13A 1C1XB 4YPOA 4RLHA 3TFQA 4EI2A 2Q45A 2D5CA 3Q3CA 3LF2A 1C0KA 3BIOA 4DQUA 1NVMB 2J5QA 4MINA 3ABIA 1E5QA 1YBVA 2DUUA 5DOZA 5LC1A 6LDHA 4OO3A 1ZJZA 5HRUA 1L7EA 1ZSNA 3EK2A 3EZYA 5F5NA 3X2FA 1DC4A 4R41A 3QIVA 1YQXA 4CLOB 4I5DA 5EESA 4WASA 1WMAA 2YV1A 3JQBC 4Y67A 3V5NA 3ETEA 4BV9A 5A4DA 1ZO8A 1Q0QA 4FFPA 1UXGA 4B3JA 3GC6A 4BMVA 3AOEC 1DRVA 2D3TA 5JW6A 1YH3A 3SJUA 1I30A 1IHYA 3DMYA 1F06A 2J3IA 2Q4EA 2OL4A 5CDSA 3AK4A 1H2HA 1MC4A 3E18A 1BRMA 3DO5A 4DIOA 3BMNA 4L74A 1M76A 5L4LA 3OA0A 1IB6A 5U1PA 3JQCA 3BHJA 1R4NB 2QZ9A 4NK4A 2CNBA 3IJRA 5JDIC 4JGBA 4P8RA 2CVZA 3JD4A 3I4FA 3OFSA 5JDCC 2PKQP 1DC6A 1WAMA 1H6DA 3U4DA 3E9NA 4GX1A 1R0KA 3KLPX 3R3JA 5B4TA 4JJGA 1QV6A 4I5FA 1M6WA 3KTDA 4PLZA 2NVUA 3WWZA 2YJZA 4NMHA 5J23A 3PZRA 4G65A 1XIVA 3VTFA 3EHEA 1QYVA 1HYGA 1PJTA 4ND2A 3OH8A 1ID1A 2GN9A 3BHMA 4D0RA 1MXHA 4K26A 3ZWXA 2VUUA 2IODA 3GGOA 1Z6ZA 1EBFA 4DLBA 1DRUA 1IOLA 4BO5A 1PGNA 4EDFA 4XGIA 4F6CA 1A4IA 3LLVA 4MJLA 3B6ZA 1DFHA 1Y8RA 1KIFA 3BXXA 3IKTA 1GCUA 2DU8A 4M8SA 3TZKA 4GBJA 1UZMA 3MTJA 4L76A 4B4WA 3JYPA 1PJSA 4IZHA 4QQRA 1SPXA 1P0CA 4W99A 4KOAA 2DTXA 3WGGA 3UCEA 4ZGWA 4FQ8A 4BGEA 1MB4A 4ILKA 3DHEA 4BB6A 3U49A 3I9MA 3WR5A 3DTTA 4PVDA 1ZEJA 4CUZA 1IZ0A 5L9AA 3COSA 3FI9A 1QR6A 3OQBA 1U5AA 2C20A 3VDRA 5KVQA 1WNTA 1PIWA 2ILTA 3Q0EA 3KM0A 4CM8A 1HKUA 1CYDA 3I5MA 3MEQA 3Q2IA 5A5EA 1CJCA 1WXDA 3A28A 3OM9A 3V2HA 2SCUA 3DONA 4CM9D 4MP3A 5JCJD 2Q1SA 4AJIA 1NR1A 1QORA 3P2YA 4N7RA 1DO8A 4F6LA 4AG3A 4HADA 1UAGA 5L53A 4L8VA 1XWFA 3PP8A 3FRJA 3UVEA 1TT5A 2WYVA 3LZ6A 4Q3BA 4IIVA 3K96A 3ON5A 4RDIA 1IULA 1RJWA 4UVEA 3K92A 2ZYDA 2ZIZA 4J1NA 3GDOA 3P19A 4YQZA 5I7FA 2PD6A 3ORFA 3WNQA 5KKCA 3RROA 1NPDA 1VSUA 2AQ8A 3MJ4A 2FY8A 4HY3A 4JJFA 3RWBA 4CUJA 3EDMA 4MVJI 2P2SA 1VM6A 1LLDA 3AUUA 1VE9A 3E48A 4RL6A 2OP1A 3WSVA 3LU1A 4W82A 4U0KA 1C1XA 3M2PA 4QT0A 3JQDA 4R9RA 3WX0A 4XQGA 4A0SA 4J1SA 2VWPA 1TB4A 1B0AA 4KTTE 1JDJA 4XQEA 3S8MA 1ULSA 5IJZA 4GX5A 1T1SA 3VVBA 2ZJ0A 3DHYA 1V3TA 1OOEA 3ZV6A 5JYDA 1EFLA 2ZTUA 1GYQA 4EJ6A 4CLOA 3PLNA 2EW2A 4CMBA 4J0EA 2DBQA 3I9OA 2XXBA 3LSYA 2C59A 5EIOA 4R5MA 4AJ4A 4XDZA 5C7LO 4JQCA 3NT4A 1CF2O 1LI4A 4OAQA 1PQWA 5TS3A 3CXRA 3D5QA 2DM6A 5DBFA 1WW8A 3EAGA 4E12A 4BNJA 2VT3A 1BWSA 3OIDA 1GTMA 3RVDA 1E1KA 1R4NA 4TRNA 3C1AA 4U6SA 4YYZA 4XYGA 3HB5X 2HSDA 1P74A 5KJEA 4DPLA 4WNCA 4MKXA 5BSGA 1DAOA 1O94A 1H9AA 4G5HA 3RBZA 1LRJA 4AJ1A 4DREA 1LX6A 2AEMA 1I3NA 3A06A 1ONNA 2P5YA 2F00A 3FPCA 3TL2A 4YCAA 1U1IA 4DWVA 3JQAD 3TWOA 4IDBA 3DOOA 3GVCA 2WDZA 1Y6JA 4ALKA 4JXKA 3G1TA 5DP1A 5EQFA 3VAZA 5KVSA 4AJOA 3JYOA 4F3YA 5KIAA 1I3KA 5EMHA 4ZU3A 4EUEA 2D5AA 3QA9A 4ROSA 4YJGB 3ITDA 1LSOA 1QRRA 2CVOA 1GDHA 2V6GA 2NQ8A 4NZ9A 3WBBA 3IIEA 1A5ZA 1JW9B 2ZB4A 1YQGA 3DWFA 5U9CA 1B26A 4AJKA 1QG6A 3UAGA 3OMLA 4KTVE 1DFIA 3TL3A 5C7OO 2QG4A 5LDHA 4E31A 4MVJH 1J6UA 5JYEA 3FN4A 1ZW1A 4U6QA 1DHTA 5TLSA 4FDAA 3OEWA 3WQQA 2PZKA 1PGQA 4HNHA 3WFJA 3OEYA 2H6EA 3LVFO 1BDBA 4DMMA 1Z45A 3KXDA 4E0BA 1NAHA 2GRAA 4G81A 4PLWA 3W4IA 1B3BA 4PVCA 2IE0A 1U8XX 4R16A 1KVSA 5AVOA 1LUAA 2DUWA 2DFDA 1QSGA 4K9DA 4LISA 4DC1A 2UUPA 3TOZA 1DIRA 4CMEA 3IC5A 1LLUA 3GAZA 3R1IA 2POQX 3Q9UA 1HL3A 2QRKA 1N8KA 4PRKA 4L73A 2HMWA 2VUSA 3G1UA 3UH1A 5KJ1A 4IJUA 2OBYA 1JTVA 4Z0HO 1C0IA 4NFHA 4YT8A 3PRJA 5G4KB 3DBRB 3GNSA 4R4JA 1LRKA 1B15A 3PWSA 5AXDA 4BVAA 1HDYA 1HXHA 3NX4A 2GERA 1Y5RA 1LC0A 1UZNA 2IRWA 3M1AA 5G0TA 4BNTA 4IDEA 2O3TA 3S55A 2DKNA 4LRTB 4WJZA 5DT9A 2FMUA 5TT1A 4P22A 5L7YA 2FR0A 3PYLA 5AXAA 1EK5A 4LSWA 2P9GA 3D3EA 4OJNA 3AFNA 4NQZA 2PV7A 3WYBA 2QIOA 3RAJA 2IXBA 5T67A 1R4MB 2YFQA 4HUJA 5KNLA 4BNYA 1TEHA 3S2GA 1IZ9A 2FSVA 3IQDB 4MVJM 3OJOA 2ZYGA 2X58A 3ICCA 2QX7A 3PK0A 1OBFO 5GMOA 1B8VA 1G0NA 1OC4A 3A1NA 4PFJA 1GYRA 4M49A 3D3WB 1ZH8A 3H7AA 1GZ4A 4X54A 4NJMB 4XYLA 2AE2A 3EMKA 4J7CA 4JP3A 4MPDA 1Y1PA 4LSMA 1MFPA 1HLDA 1N92A 3AUTA 1U5CA 3KUXA 4FFMA 4GLLA 3JQAB 3WGYA 4FW8A 1GUFA 4TROA 2YYYA 4FCCA 1F14A 3H5RA 3FNGA 3K8ZA 4BMSA 3QWBA 2JCVA 1ZK4A 2JHGA 4MKZA 3RFXA 3L07A 5ES3A 1WP4A 2Y05A 1JWBB 1LJ8A 4BIIA 1ENPA 4FFLA 4YR9A 3R0IA 2E82A 3DAGA 3AFMA 3RU7A 3VZQA 4A26A 1Z74A 4RF5A 1I24A 3WJAA 4B7UA 3IS3A 5I8ZA 2UUOA 4DYVA 1ZBQA 1G6KA 3FF4A 4R54A 1WVGA 4CR6A 3NDRA 2P4QA 3AY3A 4J6FA 1NFFA 4PZCA 3HHPA 1PS9A 3RFTA 1DSSG 3HNPA 5BNFA 1IY8A 2D1YA 1QP8A 3ZW9A 2GASA 4FOSA 3WGQA 3WSWA 1PWZA 4H3VA 4MIYA 4YRAA 2PK3A 2JFHA 4PG6A 5EPOA 1BDMA 3RUDA 1Y8QB 4XB2A 2BKAA 3NRCA 3GNTA 1K3TA 2JAHA 5JCJA 4CM9A 2WM3A 1DHRA 2YUTA 3PLRA 4M1QA 1X13A 3GZ4A 3T4XA 4IM7A 4ALMA 2FR1A 4YJGA 3QVOA 4XRRA 3ROKA 4BKRA 3QVTA 5TQVA 1U3TA 3ZWYA 1IHXA 4FFRA 7ADHA 1FDVA 1JWAB 4L0QA 5CPFA 1D1SA 2JKVA 3BMCB 1HT0A 4D43A 2FPGA 3RUFA 4S3MA 1Z82A 3WLFA 3TF5A 1HF3A 4O59O 3WYEA 4OXYA 2NTNA 5ITVA 1U8FO 3H2SA 2EKPA 8ADHA 1A7AA 1VKOA 1GUZA 4ZQEA 2GO1A 3KSUA 4G2NA 1PJ2A 1JKFA 3E8XA 1EMDA 2P9EA 1UUFA 1CQJA 3L9XA 1OZAA 4LGVA 5B4UA 4MOWA 1I5RA 2IZ1A 1FDSA 1HDXA 2OHXA 1V9LA 2RH8A 3ONDA 2ZB7A 4XWYA 3INGA 2CFCA 3I3OA 2VWGA 4UVIA 2EJWA 3PJGA 4BS9A 1T2AA 1ZNQO 4XGNA 3KEOA 4KZPA 5G4KA 4QO7A 3DBRA 3ADPA 2IDZA 2BI7A 1AXEA 2EGHA 2Y1OA 3FTNA 1GY8A 3L6DA 1NASA 1TA4A 3F46A 5H82A 1I3MA 3HDJA 5G0UA 5A3JA 2H9IA 1IPFA 2AQIA 1UXHA 4PLHA 1ZUD1 2PA3A 3O38A 2Y93A 3RC1A 3VZRA 2VCYA 5BSEA 4CR8A 5JAQA 1W6UA 2IZZA 4Q3AA 4JX8A 1DJNA 1YB4A 1DIBA 3JD0A 1LA2A 4NJOA 1YE3A 2AG8A 3GFBA 2EW8A 3IL2A 4MVJD 4J1QA 4D79A 1JKJA 1QYCA 1L1FA 3PPIA 4KDFA 3LK7A 1R4MA 1VRWA 3VC7A 4TQGA 3ZI0A 2VZ9A 4URFA 2OOSA 2DFVA 3K5PA 3PEFA 2C29D 2JAPA 4OSPA 1ORRA 4RF4A 4GPD1 5FFFA 2VZ8A 2C5AA 1OC2A 2NNLD 3D3WA 4NJMA 2OBNA 2VZ0A 4RORA 2D59A 4J4TA 4Q39A 4JBGA 1YONA 2Q1TA 3F1KA 1T2FA 4FGWA 2EF1A 4BNXA 5CDYA 4HFMA 4CMGA 2Q1WA 3JQAA 3U62A 3GHYA 2NTJA 5ILGA 1E7MA 4IJWA 4CM4B 4RJTA 4BGIA 2B69A 2JL1A 3CE6A 1DPGA 3FNEA 2W8ZA 3VKVA 5A9SB 1AE1A 1E0DA 1LSUA 2P9CA 3VVCA 1HDGO 3W8EA 1KEWA 3TZ6A 3WQRA 2JFFA 1M75A 4XJTA 4IGEA 4KMSA 2PZLA 3B70A 2BRUA 1N1GA 1EVZA 5COAA 2G5CA 5I8WA 5FEUA 5TT0A 3TZCA 4WCFA 1E3SA 3UN1A 1ENZA 4IZIA 4OKNA 3I83A 3I9KA 1JQBA 4DIFA 1DLIA 2C2YA 2O3SA 3PDUA 5EJ2A 4M86A 1GD1O 3GH3A 1P9LA 1JLLA 3TSCA 4E21A 4UUNA 4BNGA 1U4SA 1P33A 3NJ4A 3NTQA 1XKQA 1M2WA 2Z95A 4EUHA 4O63O 1E3IA 1IE3A 3PHGA 4IS3A 3T7EA 3D4PA 1X0XA 3JV7A 1Y8QA 2VHYA 3JSAA 2B36A 5F1OA 5H81A 2XXJA 3F9IA 4J9UE 3FTPA 3RFVA 3IP3A 4GL4A 1P31A 2BD0A 3NT2A 2IXAA 3AU9A 3QHAA 3VZSA 1ZFNA 5FI3A 4R3NA 2BFMA 4GLOA 4OGWA 4Z9FA 2FHSA 4IDFA 3JQ9A 4C7KA 3BMCA 5T57A 2HRBA 2XOXA 3D5TA 3GVPA 2GSDA 3LC1O 4WECA 4KWHA 2VHVA 5DCYA 1ZK2A 1MP0A 5CEFA 4DL9A 2CDAA 3L0DA 4I9HA 3WNVA 1YBMA 3W8FA 2FSSA 3JTMA 3AU8A 3EY4A 1YBAA 3H9GA 3K73O 3VH2A 3VHRA 3U4IA 4KQXA 3WS7A 5K6AA 4RQTA 3HZZA 2HU2A 3JD1A 3A14A 4IDGA 2NV6A 1XU9A 2GN6A 3AM5A 4YAEA 1E5LA 4UREA 3PHIA 1HDOA 4LVUA 1ZMTA 4E2YA 4ND5A 1H0KA 3MZ0A 1YL7A 1NP3A 3L4SO 1MG5A 4PCVA 1U3VA 5TC4A 1PGJA 1EZ4A 2A94A 1R12A 3SJ7A 4K28A 3PI7A 1YKFA 4BNWA 1KY5A 1Q0HA 3HWRA 5DDIP 3ZU2A 2UVDA 1IUKA 1GR0A 4D45A 2GZ3A 1DOHA 3RSHA 3P7MA 4IXTA 3EYWA 3WOHA 2P68A 1MLDA 2B35A 3AJRA 3VH4A 1MV8A 2W2KB 1V3VA 2J3JA 1MGOA 3DMTA 1E7SA 3DZKA 3KB6A 2WWRA 3U4CA 5JPIA 3VPFA 3DZJA 3QLJA 3M1LA 1MXFA 3SXPA 1BXZA 2BELA 3E6AA 4TRJA 3RIHA 1EVIA 4NBWA 4OIMA 8LDHA 3L6EA 4XR9A 1LDEA 1SC6A 4IDDA 2NVWA 1ZVMA 2ZKLA 3RUHA 5FWNA 2VRCD 2HMVA 5TSDA 4JNKA 4GKVA 3IUPA 4PLFA 4B3HA 3HN7A 3WWYA 4MO2A 5CEEA 4GSLA 4Y6PA 2I3GA 5T5QA 3DR3A 1SBYA 5CDGA 2YHIB 5L95A 1Y9AA 1YOVB 4ZN6A 4QUKA 2WD7B 1SEPA 1HDRA 1SO8A 2CY0A 5JO9A 3RUCA 5LDGA 3K30A 4XGKA 1B3RA 2EWMA 3VPXA 2ZATA 1D3AA 3QQPA 1PL7A 1D7OA 3H8VA 5JAMA 3N74A 1BMDA 1O8CA 1EVYA 4OKIA 1RM0A 4BO3A 5COBA 4CUKA 4KP7A 3FHLA 3BZUA 3NDJA 4DC0A 2Y1FA 1E1NA 2Q4BA 4GWKA 1UH5A 2OGUA 1CIVA 3PHHA 1P44A 4PLPA 5A06A 1YB5A 1Q2XA 4ND4A 3RC2A 3UGKA 4DPMA 3DBHB 3F3SA 2Q50A 1MA0A 4N5MA 1PZHA 4DQVA 4EZBA 5T8KA 2V7PA 4FPXA 5L40A 2X8LA 3QWAA 4BNKA 1NPTO 2C2XA 4BNZA 1XHLA 1YL6A 1ZXLA 1BW9B 2QYTA 2Y0CA 9LDBA 4E5YA 4CMEC 1AHHA 4O1MA 5F5LA 3ZGYA 4U8GA 5IXSA 3Q6IA 4YAKA 4GKBA 3H9EO 5BR7A 4GSKA 4ALLA 4B79A 3EVNA 3ANNA 3EUWA 4HNGA 1JU9A 1A7KA 4YTEA 1KVTA 3OICA 3V1TC 4AVYA 1U9JA 5LCXA 3ZNNA 1XU7A 2JCYA 2PH3A 4D46A 2YV3A 2C82A 3M6IA 3TDKA 3W6ZA 9LDTA 2X5JO 4IPTA 4NHEA 4OYRA 3NYWA 1U2GA 1K6JA 1GEGA 4MVJA 4E5KA 3GEGA 3CTMA 5ICMA 4R1UA 4UAGA 4FBGA 1QXSA 1DIAA 4HX5A 1LLQA 4GX2A 4JBHA 4DPKA 2HUNA 2RAFA 2BGLA 4R3WA 3V2GA 3OSUA 1ISHA 1DB3A 1I36A 1JAYA 3B20A 3NV9A 4J90A 4OQYA 5HS6A 3KBOA 4CV2A 1YGYA 2WE7A 4CLHA 3QSGA 1PSDA 3JQ6A 2XAAA 1HYEA 2DPHA 1O0SA 1W73A 4MIOA 4ALNA 5KKAA 5DULA 4UVHA 3DC2A 1HTBA 1F8GA 3INRA 5IG2A 2VWHA 1P1RA 2NQTA 4BKPA 4J91A 5K0ZA 1W0CA 4FS3A 1SB8A 2WYUA 5DF1A 5EN4A 5B1YA 1ZEMA 2W2KA 4BNNA 3VH1A 3OJ0A 3OBBA 4RPHA 3HJAA 1WDMA 3FBGA 1AHIA 1S7CA 3ZWBA 1KVQA 1O95A 3D7LA 4DRYA 1X14A 1ADFA 3TNLA 1AGNA 1LC3A 1PQUA 2O4CA 3DBLB 3L4BA 1GQ2A 1R0SA 1FDWA 2RH4A 1YQDA 2PGDA 1LDMA 2P4HX 2G82A 2BMAA 4TZTA 4N5NA 4GI2A 3WIEA 3U0BA 4WUVA 4AFNA 3T7CA 1N9GB 4CODB 3OJEA 1LDGA 1XCBA 2DPGA 4W9NA 2YHIA 2I5PO 3HDYA 2PKRA 3PQDA 3I9NA 4J2OA 4AJHA 3A4VA 2Q2VA 3HG7A 4I8XA 3NUGA 1PS8A 2Q46A 4GH5A 1VC2A 4P4GA 2WD7A 4PLVA 3UW3A 4BNFA 1A9ZA 1NXQA 3S1LA 2BFOA 4IINA 3K31A 4GGOA 1I0ZA 2E48A 4LCJA 3FCOA 1E6UA 1KS9A 2CZCA 2VHZA 2RCYA 1PU2A 5HWSA 4P38A 3UFXA 3UOGA 1PJQA 1UDAA 2ZB3A 1SAYA 2Y68A 5THKA 3BA1A 3GT0A 4ID9A 4DIBA 4XZ3A 2CUKA 2X5KO 2OP0A 2A4KA 1NQOA 4R68A 4RZHA 3ZHYA 1J49A 4D0SA 4MVJE 1DXYA 1JVSA 3ZWPA 3AOEA 1EFKA 2C7VA 5ER6A 3NGXA 1LU9A 1PR3A 3PIDA 3L9WA 4WPGA 4OOEA 5A04A 2X9GA 4OL9A 4J49A 1GV1A 1O6ZA 4BNMA 1H9BA 2HCTA 4HBGA 3DBHA 4CQMD 3WG9A 5EQDA 3PWZA 3ST7A 1ZJYA 3GDGA 4E5PA 4CLRB 1XG5A 4OSOA 1ZSYA 4A03A 3FPLA 3VPSA 3MTGA 3FWZA 1KC3A 1O5IA 2CSUA 1PEDA 3ULKA 4XRGA 3ENNA 1HEUA 4HFJA 5DBIA 5BQFA 1HSZA 1EQ2A 1A72A 4OOFA 2Y1EA 1RPNA 2FPIA 4QEDA 4PLCA 3X2EA 2TMDA 4TWRA 3GMDA 5EINA 1FXSA 1QLJA 3Q11A 4H15A 1NR7A 3RI3A 4WNIA 1NHGA 1SEVA 5JY6A 1BXGB 2DLDA 2Z1MA 4GGPA 3MOGA 1P1JA 1ONPA 2FN7A 1H5QA 2OXIA 3GY0A 3VKUA 1P77A 1NAIA 3RC9A 3SC4A 4CV1A 5JC1A 4EUFA 1K2WA 4EW6A 2NWQA 3FNHA 4J4HA 4U0JA 2EEZA 2O4UX 3P2OA 4XIYA 4ALJA 5KVCA 1FMCA 1FF9A 4CPDA 3GOHA 4D41A 4XYMA 5DOVA 2HMUA 3MWDB 2LDBA 4CM1A 4NI5A 5A9RA 1RM4A 3NJ8A 2AHRA 1EUDA 3WGTA 4NG5A 5JY1A 4NR0A 1I33A 3GMSA 1NQ5A 2QRJA 2B83A 4BO1A 1J4AA 3S2EA 5L7TA 5G4LA 4YJDA 1E92A 1E1LA 4I9NA 4XQCA 5B12A 1VL6A 4WGGA 3V1UA 4FOOA 1LNQA 3ZWMA 4E5NA 4MIEA 3CMCO 3H65A 1GV0A 1HE5A 3UCXA 1GADO 1YDEA 2EKLA 5KCZA 1PZFA 4XKJA 3D1LA 5L4SA 4FB5A 5MGBA 2D0IA 3MJSA 5GZ3A 5I7SA 2B4QA 2X1HA 4Z9YA 3DBLA 1QYXA 2HAEA 5CG2A 3ROMA 3ICPA 3WLEA 3ZNPA 4UUMA 2PZJA 3LF1A 4GQAA 3CMMA 4DYDA 2AQKA 4C4OA 4NBUA 4JIGA 1UJMA 2QHXA 3BAZA 4WCFC 3HFGA 5A05A 3PVZA 1N9GA 3W1VA 2F1KA 2VYVD 3I4CA 2HLPA 4R9SA 3ZNOA 3ZWWA 4BB5A 4CQMB 1I3LA 3D4OA 3TZQA 4NU5A 1YS4A 5TJHA 4DQXA 4IQ0A 4XB1A 5JS6A 1ZK0A 2YV2A 4D44A 1C14A 1TLTA 4F46A 5JC8A 1ZZEA 1S6YA 2AXQA 2B37A 4JK3A 1KBZA 1HDZA 1Y5MA 3N7UA 1HSOA 1PJCA 2TMGA 4MDHA 4W4TA 4W6ZA 3CINA 4CM5A 2E49A 5TX7A 3RJ5A 4MKRA 3BTUA 3D64A 3PYXA 3HFSA 1PX0A 2WTBA 4B7CA 1ZKMA 4YWJA 2AW5A 2X86A 3ZN2A 2OORA 2X9VA 4E2XA 1JKIA 2X0JA 3BTVA 3QVXA 3SLGA 2JFGA 3PQEA 1D4FA 3DTYA 3O26A 5L3ZA 4TVBA 3GLQA 3JQ9C 2V65A 5C3MA 1NPYA 1GUYA 4OM8A 3WTBA 3HSKA 1LDYA 4CMHA 2EJVA 4II3A 4BNIA 2BH9A 2Y0DA 4BO4A 2VHWA 4OMUA 4CMKA 5GZ1A 3MOIA 2GR9A 3B1FA 3NEPX 3UCFA 1I32A 5JMWA 2E4AA 1KEVA 4LN1A 4XCVA 2CDBA 3SEFA 3E9MA 1Q7BA 1E1MA 3WGIA 3GA0A 5JNLA 5DZSA 4L9RA 1CEQA 3PZBA 2GLXA 3VH3A 1N7HA 1YJ8A 1OI7A 1V0JA 3OQ6A 4Y6RA 2GGSA 5K6AC 5HS4A 3O8QB 4J1TA 1ZSVA 1BGVA 1EBUA 3PGXA 3UICA 1ADBA 1M67A 2WYWA 1PJ4A 1NVTA 1RKXA 2QZZA 2EXXA 1N1EA 3KSZO 1MC5A 1R15A 3GHHA 5TIIA 1AUPA 1ADCA 5I9LA 4RVFA 3Q1LA 2D2IA 2FOIA 4K1LA 4YRBA 2HK9A 3NDIA 4GVXA 2BFPA 4XJSA 1OMOA 1BXGA 1X7HA 5JXWA 3K2BA 2D8AA 4NH4A 5F1PA 3FR7A 2P91A 3AOGA 1GFSA 3CIFA 4UEKA 4A5OA 3FD8A 2J3KA 1DLJA 1NWCA 2X7HA 4PZDA 1U3UA 2Y99A 3GG2A 3BYZA 3QWFA 4WOJA 1H2BA 1UXJA 2BFAA 1UDBA 3OQ1A 1ZIDA 3DMTC 2I67A 3GFGA 2HRZA 2WJPA 4RGBA 5B37A 3A9WA 2PGLA 4Q3DA 3KYCB 4ZRMA 4YAIA 5IFLA 2NM0A 5DP2A 3E9QA 2LDXA 5IZ4A 4WKGA 4UULA 2IYPA 1G0OA 1UP6A 5COQA 2V6MA 1KY4A 3ANMA 1O89A 4M87A 3WIDA 3G49A 3LC2O 4CM7A 1T26A 3H3JA 4YJFB 1W8DA 4H16A 2R6JA 4Q3CA 1T2DA 5CDUA 1P3DA 1YDWA 3RKUA 1CETA 1V35A 4PZEA 3CH6A 3GGGA 4PRLA 4E33A 2O23A 1DBVO 4IS2A 5I7EA 1T4BA 2DQ4A 3I1JA 4J7UA 2VOJA 1VL8A 1U7HA 3C1TA 5ENDA 4XYBA 4E4YA 3BTSA 4RVUA 4FD3A 1R66A 4NFYA 4CM3A 5AXCA 3WXBA 4ZQHA 4CL3A 3D4NA 1PGOA 5IZCA 1ISJA 2OZPA 5C5IA 1UP4A 3F5QA 2UYYA 4CR7A 4U5QA 4Z6KA 2PNFA 2GDZA 1LBEA 4BUCA 3SVTA 4QFCA 1PZGA 2QQ5A 2NU9A 5KWEA 5KTKA 2PY6A 4JP2A 3CZMA 3GGPA 1E3EA 1DAPA 2H5LA 4CQMA 4CLDA 1X0VA 3H5AA 4E3ZA 1NTOA 1CDOA 1UDCA 4TKLA 2WMDA 2JD0A 4FSHA 1L7DA 5T8KC 2NUAA 4Y8VA 4YJHB 5DNAA 1I01A 2O3UA 1T2CA 4D3SA 1EDOA 4XD2A 2QRLA 5IDWA 4ZHSA 3DZIA 3F6YA 2O3RA 4WLOA 1KYQA 3QE3A 2RIRA 1DC3A 4KUGA 1Q1NA 4KQWA 3IUSA 3KEQA 4WLVA 3KETA 1MUUA 2GD1O 4WE3A 2H1SA 2G0TA 2FPPA 1LTHR 4AJ2A 5BSFA 4XYEA 1QV7A 4PLTA 2R00A 4CV0A 4MVJF 3GVIA 3ZCXA 4PG5A 4IBOA 3F5SA 1NX6A 1E3WB 4M55A 5T64A 1C0LA 1VKNA 4R1TA 4WEOA 5CAEA 3DAPA 4BNUA 4DLLA 5HM8A 4YA6A 3ZU3A 4BHTA 2Q99A 3JQFA 3NTOA 5HA5A 3GZNB 2VNSA 4L4SA 2ZQYA 3RCBA 2ZTMA 4CMIB 4BKQA 4OHUA 4MVJG 3KYDB 5AXBA 4I5EA 2GZ1A 3F1LA 2DTEA 2UDPA 3FBTA 4UVGA 4EYEA 1X7GA 3ZHXA 3O8QA 5A5FA 3ZHBA 2A92A 2IEBA 2IEDA 2BI8A 2VHXA 3CUKA 3KZVA 3K9QO 3F4LA 4O0LA 3B1JA 2YHUA 2NADA 3PHJA 4N5LA 4E2WA 3LT2A 3UUWA 3ANLA 1QLHA 2FWMX 3QWHA 4R1SA 1JVBA 5GZ6A 1ISGA 4R01A 4R69A 1GZ6A 1ARZA 4QO8A 4CMCA 2X5OA 1TXGA 4U7WA 1X7DA 3WB9A 3JQEA 5L51A 4PG4A 4CQLB 2X0RA 4GMFA 1UZLA 1E3JA 3ETGA 1EK6A 1I8TA 3H5NA 1VPDA 1BG6A 1E7QA 3QWIA 4HXYA 2DT5A 5IN4A 3Q2KA 2Q2QA 3GUYA 5CPBA 5I9NA 5KJCA 4UEJA 4CMJA 3KYCA 1U4OA 3GPDG 1HE2A 1NFQA 1XELA 2NLOA 1BSVA 2QYSA 1EDZA 2PR2A 1LSSA 2EIHA 5TRTA 4OH1A 3L4BC 4RLSA 1CERA 3RC7A 2AMFA 2JHFA 2VYVA 2GNAA 5ITWA 3ZHZA 4S1VA 4XR4A 5BNIA 1VJ1A 1QYWA 4YJFA 4ITUA 1ML3A 3S2FA 3IKVA 1ISFA 4W9NC 2BF7A 3OIGA 1K6IA 5CEJA 3SX2A 1EUCA 3N58A 3G79A 2NU7A 4TRRA 1V8BA 3KOUA 4BV8A 4Y9DA 4EEZA 2O7QA 3L6OO 2AEJA 3TN7A 3U09A 3NT5A 4FC6A 1NM5A 3PIIA 4PLGA 1OFGA 1XLTA 2PD3A 3GEMA 4YACA 2GPTA 3RUIA 3HE3A 5BSHA 3NGLA 1BHSA 4O6VA 3WBFA 4RVDA 1SOVA 3RKRA 4CM4A 2Z5LA 1HWYA 3ZV3A 4XDYA 2NACA 2YY7A 4K6CA 3ZDFA 2PKQO 1CQIA 4QX6A 1EQUA 2YDYA 5THQA 3ROPA 5A9SA 2B5WA 3IAHA 2X0NA 5FF9A 3QVSA 2V6BA 1VL0A 4PN3A 1A9YA 2VOEA 2HKIA 4QSMA 3DFZA 5ER9A 1XEAA 1QKIA 1E6WA 4P4NA 4MP6A 4EITA 2YDXA 1G1AA 3H4VA 4I08A 4YJHA 3O4RA 1C1DB 1O9BA 1F12A 3I9JA 4L4RA 3WYCA 4GAEA 2NU8A 4GX0A 3ZNQA 5JAIA 1HYHA 2JD2A 2W4QA 4AICA 2Q3EA 4J0FA 2HDHA 3TRIA 3EC7A 5EERA 1A27A 3SBOA 1KC1A 4II2A 2XF8A 5U4QA 4DVJA 5FYDA 4BNLA 3PFWO 4RCVA 3QW2A 3ZWAA 4RF2A 1J0XO 3C1OA 1WZIA 5IAAA 3HB4X 2NTVA 4O5OA 3NTRA 1DIHA 1E3WA 4B8ZA 1UXKA 5C7IO 3GRKA 2EG9A 1C3VA 1Q7GA 1P45A 5BT9A 4IUYA 3GZNA 2G1UA 1NVGA 3ROQA 1B8PA 4CMIA 5K9ZA 5B4VA 5DN9A 3MJVA 4JROA 4RVSA 2RHCA 2EV9A 3KYDA 4TMFA 4YT2A 4P4LA 3RUAA 2R2GA 2O7SA 4DGSA 3C8MA 3CZRA 3LLSA 1DIGA 2CMDA 2I3AA 3DB2A 2IZ0A 1I10A 1X1EA 2I6TA 4XX0A 3G17A 2DBRA 4Q9NA 2ZTLA 2W98A 2Y1DA 5ILOA 3DOCA 1RYEA 2EERA 2HMSA 1LXCA 3BMQB 3JCZA 2YZ7A 1LQUA 4EJMA 1I2CA 3WMWA 1PWXA 2C5EA 2DC1A 2JCXA 1IYZA 1H6CA 4J2HA 3QP9A 3KV3O 3PQFA 4I5GA 4TVOA 4ZICA 3EGOA 3GK3A 4IJVA 4MVJP 2FZWA 3K2EA 3JYQA 4LK3A 1GQYA 4ND1A 1AXGA 2DVMA 3HN2A 4AJNA 4CQLA 4J43A 1E7YA 1GYPA 5HBRA 7MDHA 3GR6A 2YQ5A 4RVHA 1X15A 1PJBA 1XQ1A 2Y67A 4Y98A 2D4AA 1H93A 2PH5A 1LDNA 2B0JA 4BNHA 4DXHA 1U3WA 1JAXA 1E3LA 1UP7A 1Z7BA 5F21A 4AJLA 4WOKA 1XR3A 2I66A 1KVRA 3WJ7A 1T25A 5F3RA 4DUPA 1ZMOA 3F47A 2NU6A 4HKTA 1ULUA 4BO6A 2J5KA 3OHSX 4BL5A 4J9VA 1PR9A 2FP4A 4J16A 4L4XA 3VPGA 1OAAA 2OMEA 1N5DA 1B14A 1DDOA 1LSJA 4FFOA 5TGDA 1HLPA 1PS0A 4TSKA 1JA9A 1ZXBA 4IIUA 3CPSA 1Q0LA 2CVQA 5AYVA 2GN4A 4QTZA 1GPJA 3DZGA 4ALIA 2BHLA 3GAFA 1HZZA 4E32A 3JYLA 1XYGA 3OECA 3C7DB 1VJTA 4IXWA 2JJYA 2W2LD 3KYBA 4ZQBA 4D42A 1A4UA 3PJFA 2Y66A 3ONFA 1HZJA 4MP8A 1YOVA 4CLXA 5L7WA 2VT2A 4PG7A 2YFHA 1YB1A 4NBVA 2GYYA 4BKOA 4D7AA 3LYLA 2O2YA 4AJPA 4IQGA 3VZPA 3WGHA 4Z0PA 4L75A 3WDSA 4BOYA 2ZJ1A 3ITKA 1FDUA 4DLAA 3ZU5A 3DAFA 2ZCUA 4GVLA 4NDNE 4BGUA 4EBFA 2AG5A 3BMOB 3JQBA 5KOIA 4PGFA 4XIJA 1R0LA 4R51A 3B1KA 4RPJA 1T4DA 4WEQA 4WK6A 2AEFA 2X23A 3MCVA 5I7VA 2PLAA 3KO8A 1WLYA 1C1DA 1R6DA 4FR5A 5TJ9A 2PGJA 3GN1A 1WDLA 5C37A 3H3FA 1VSVA 3RASA 3STHA 3RBXA 2J8ZA 2Q1UA 2DAPA 3GVXA 1Y7TA 3AUAA 3MWEB 2DBVO 3M2TA 1TVEA 3QJ5A 3ZWOA 4CM6A 3BHIA 1RYDA 4YQYA 2O3JA 3VDQA 5JDIA 3PGJA 3JYNA 4NBRA 1N2SA 3NKLA 1KOLA 5JDCA 1MX3A 3I6QA 4ZVVA 3PJEA 3AI1A 3WGOA 4JCOA 4CJXA 4FIZA 3RUEA 2G76A 3WQSB 3D0OA 2VTEA 1EUZA 4E30A 3GNQA 4XA8A 3W6UA 1BW9A 4H7PA 3GEDA 4WLEA 2EGGA 2H63A 1PJLA 2V6FA 2VN8A 3G3EA 1E6EA 3HADA 4W7IA 3TQHA 1KETA 4D3FA 5JO0A 2B4RO 2ZCVA 3OA2A 4CL8A 1PQPA 3ASUA 3IDSA 2PD4A 3RQSA 3CSDA 5EL0A 3ONEA 3AUSA 3LC7O 4WCDA 1WWKA 1LLCA 1HE3A 5A9TA 2DTDA 5CG1A 4UUOA 3U4HA 2O2SA 1CWUA 5JE8A 1NBOA 2P5UA 5L45A 4BO7A 3BMQA 2BGMA 2PFGA 1GPDG 4PIVA 1ISMA 3PDJA 2J5RA 2DBZA 5IDQA 3K6JA 5JLAA 3U9LA 4FC7A 3I23A 5IN5A 3JQ7B 1GEEA 2VRCA 2VUTA 5BNTA 1P1IA 3LT4A 1ZCJA 2HO5A 3ENKA 2ZYAA 3CEAA 3NAQA 1VI2A 1TT7A 3GQVA 3S2IA
chains in the Genus database with same CATH superfamily
3AERB 1MAWA 1IXZA 2GBPA 2VTVA 5DT2A 4CDNA 2E7ZA 4E4RA 1IHDA 1I4OA 2IP1A 1VLQA 3ROEA 2PA0A 4OHFA 2XYHA 3WLIA 2R1TA 1T3LA 2G07A 1TUGA 3KB8A 3TVYA 3TLZA 5CNIA 3KYJB 4EJSC 3OE5A 2QM0A 4MQBA 5DYWA 1W88B 1QBKC 2EFGA 2QE7A 3GD5A 5KYYA 1YCGA 2I9PA 3HCOA 1FK8A 3JVDA 4LJ6A 5CLQA 1E2JA 4R98A 3GFTA 5EZ6B 1FEZA 4MGIR 1GITA 1DRJA 4JYAB 5G0WA 1X92A 3ZWVA 1IHOA 3AI3A 2HNBA 4OLFA 3C39A 3ISJA 4OBWA 3Q1KA 4KQMA 3JQPA 3WTCA 3LT1A 1GA4A 1T8UA 1QYDA 3O4HA 3CW9A 2D5LA 1KJZA 2WR8A 4P4SB 2V0CA 4NNJA 1K8QA 2H9AA 2Q49A 3I01A 5CFZA 3OETA 1Q6YA 2WC1A 3ZJ4A 1BVUA 1XT6A 4DSOA 4N47A 2C54A 4UM7A 4BNVA 5HMMA 5HDBB 1V1MB 1ONBA 4M21A 3H18A 1JN0A 1TU0A 3P27A 1JLMA 2JLBA 4FGSA 5CMLA 1DX4A 4JEMA 1KSHA 4ZQGA 3ZTWA 2VC2B 3TD6A 1WDKA 1ZESA 3DPUA 5FOSA 2QN2A 3VXKA 1GGJA 4LVCA 4DR5B 2BZGA 2GHIA 3ODGA 3OKPA 3R74A 1L4YA 1R8SA 1RYMA 2OAGA 2VYND 1E8DA 2WIGA 3GN2A 4JQZA 5BQ5A 4JV5B 3K8QA 4P9NA 1E2LA 4GBED 1L4NA 3MCZA 4B44A 1B2LA 3KJQA 1KK3A 2AG6A 5B1IA 3Q9NA 5KYNA 1PR2A 1Q77A 4GMXA 1QF6A 1U8UA 3C7AA 2IYOA 1YNSA 4JJ8A 1GNSA 4RZ2A 5DCUA 5J5AA 4PSKA 3DZFA 2XLBA 3H17A 1PFWA 5HZHA 1X1AA 3W7VA 2GM3A 3W78A 2XBUA 4EZIA 4XEHA 1TZMA 1E4OA 1U28A 3CUYA 1I3OA 2ORIA 2XV1A 3N2LA 3UGTA 3VPHA 4BQRA 3JQFC 2H85A 1OH8A 2XVXA 3P2MA 2VYCA 2GBFA 4Y2RA 5CCDA 2JI6A 4DIUA 3DQQA 4ZVNA 4RTMA 4C4RA 2XODA 3QY9A 4WCFB 5THXA 2D1TA 4PQYA 3ETDA 1M1NB 3ME5A 2Z8YA 4LW8A 4H7JA 2I6XA 4B4VA 1KBQA 2WVGA 2P8JA 1ZH4A 4Q18A 4NU8X 4CF6A 3EVTA 2H2IA 2I0FA 3EVAA 1GKIA 3HJHA 2RK6A 3RNOA 2YKGA 2BFEB 3WI7A 3B12A 3AY7A 1P2VA 2ZIEA 4LRSB 1GAEO 2CBGA 2PKEA 1OLSA 4KLNA 1UADA 2J3EA 1JHDA 3DXFA 3RRYA 1MRSA 3SBDA 3WK8A 1SK8A 1PK7A 3AESB 1Y4DE 3BAFA 4E2ZA 4G9BA 1IDN1 1V16B 1H94A 4F6RB 4UMDA 5ISMA 1YTUA 4P0TA 4J3FA 3VDXA 2HZ7A 1WX1A 3AM4A 3V1YA 4P86A 1T1EA 2KE5A 3LRXA 3NHZA 4LHYA 1RXSA 3RYHA 5BV1A 5FX2A 4R6WA 3C97A 5IAKA 1U2TA 2HMTA 2Z3ZA 3ZW8A 4B4OA 4JI8B 4MUMA 4R5HA 2XUHA 1NUPA 2BLLA 1Z56C 3HUDA 5ENVA 3U5ZB 3G7NA 1CR4A 2QTTA 2HJRA 4DC9A 2PZMA 3ZE1B 2VJPA 3SKYA 3H8SA 1QGUA 5H83A 4JC4A 1EE9A 4MUNA 5A1TA 1CDEA 3HA3A 5KSPA 1CV2A 5JR3A 4DLTA 5LP6C 1TIPA 3PC3A 5ALPA 1J5PA 4KE9A 3K0EA 3HO6A 4NK5A 4R1NA 3BB4A 2R1ZA 1I7LA 2BHNA 2ZUBA 3NWEA 2UVPB 4HFRA 1JIXA 3N2KA 1XNQB 4ETMA 4NBLA 4WA8A 2HPZA 4ZCMA 2DOKA 3RTEA 3UUFA 3ZXUB 2OCKA 1XKLA 3UC5A 2XCLA 1I13A 1KEPA 4MYCA 3JQ7A 4YAJA 1L4HA 1UKYA 1ZOIA 3CVJA 1JWLA 1E4EA 4GXNA 4ZVUA 1II8B 2HBYA 1XKTA 4IF4A 5AO9A 1WY5A 1XCPA 4PG8A 2I99A 5DGHA 1ZGCA 3DT8A 4YVFA 5A5DA 4HH3C 2BFDB 2FX2A 3A6HA 3CV3A 2UV8A 4QPJC 1V7PC 3OJLA 5HEKA 3WK9A 3EIFA 4D3ZA 2W2LA 1PQ4A 1D0SA 5EWMB 3VUEA 3B13B 4HP8A 1T2VA 4ONEA 5FAKA 1ZUWA 2I6FA 3DUFA 3OCZA 2Z30A 3U19A 4C14A 1GU0A 1TX4B 5CFOA 4U39A 4YAOA 3K8YA 2BZ0A 4PCUA 4RFSB 4TMKA 5CX1A 4UHDA 1ZYUA 4FQ7A 5FOUA 5E4JA 3U7FB 1Y6GA 1G5TA 3NTXA 4CIAA 1Z6AA 3UH0A 3ICVA 1LGYA 1SCUA 4C5CA 4EARA 2MR6A 1JIUA 3K0KA 4OXNA 4P0PB 2YVUA 3AHHA 4WLFA 4RV9A 2FCAA 2JZNA 2VLIA 4IG9A 2GF2A 4GWGA 1MC8A 1B8UA 4N40A 4DBLE 2P2CA 2RFLA 4Z0TA 4B4UA 3DE5X 2NO4A 4IUCS 1MD9A 1SVWA 2GZMA 3EGIA 3HYSA 3L0IB 4I3FA 4QFDA 1QWSA 4WXHA 4ZYZA 3TOXA 4EVSA 4Q4AB 5JS7A 2ZE6A 1WMBA 5JQGF 2QMQA 1RC1A 3V8BA 1L5OA 2VK2A 3HY4A 4JIMA 2QR2A 4FDUA 4LXIA 2WWHA 5SICE 4DQKA 3OZWA 1E66A 4KUHA 1MB2A 1WZEA 4PC7A 4X93A 1CF4A 1ENOA 4CMAA 4ETIA 3KRTA 1KKLA 4UTOA 1JFTA 1NDQA 1ZZGA 2AW3A 3AW8A 1H42A 3N8GA 4XTRA 2B1IA 4FEAA 2F3UA 2GJ9A 4NOJA 3BMNB 1ULTA 1AD2A 1J8QA 5YASA 1DG9A 3HJUA 5L4NA 2OCIA 2O8DA 3KE8A 2CL7X 2AYXA 4G0ZA 3C7CB 5CFMA 3IMKA 2VQFB 3V2UA 2WM9B 3IVXA 1UXOA 1DAGA 3MTDA 5KJ6A 1NP7A 3OPMA 4BZPA 4B71A 4FD2A 2O2EA 3KPYA 1W94A 2BSXA 3LWNA 4NFSA 4ENWA 2O3QA 5DX1A 3C3JA 4UVDA 2JFQA 2VPIA 3QHPA 5IEBA 4B34A 3LY7A 5J5CA 1X19A 1AQJA 2XCSB 1OYWA 2XWJI 3DEZA 4HSEA 2IYSA 4JI7B 3BXFA 3PR2B 1F2UA 2J3HA 1O95D 2PBRA 3IBSA 3E9EA 3O47A 4P34A 5FI5A 4BVFA 3L8HA 1QPZA 3W4KA 1PNOA 2H1OA 2JGJA 4ZAVA 1BWPA 2X1VA 4TWIA 4X65B 4IJKA 2FSUA 1PI3A 3BL8A 1TD1A 4HF7A 4FUQA 2XMZA 2FKNA 3L8EA 2VPZA 3K4QA 5C4GB 4A7PA 4B3GA 3GPLA 3K9NA 4NOMA 3WIOA 1RLUA 2IE8A 1SQ5A 4GXQA 4S1PA 1Y8RB 2ZZNA 3PC8A 4M1YA 4QBTA 3TLMA 4Z4FA 3NMUF 2IU4A 4AIIA 2FGKA 3WLHA 3OJFA 5CP8A 3AWIA 3HSYA 3F3KA 3GEHA 3ESXA 1J23A 4LXXA 2PUJA 2XUQA 2VDNB 4ND3A 4NONA 4EEXA 1EJ2A 3C24A 1TI7A 3DB1A 3BXPA 1BEUB 5I4KA 4DJJA 2RGUA 5EQJB 1Q7CA 3M6AA 4GNKA 1FVOA 1NKVA 2QMHA 4EF4A 1KEKA 4Z53A 3DEYX 5KSYA 1FDTA 1SUFA 1YL5A 2O50A 4PHHA 3PXXA 4QBIA 1YR1A 1D2RA 2CLLB 2VWQA 4NCNA 1GPMA 2HA3A 3BICA 2PYZA 3FY4A 3LUCA 2UZ1B 2WKWA 2B3TA 2E9SA 1UBTS 1R5OA 2C0CA 3PUYA 1E7WA 4GYYA 3QPDA 4DTIA 2EQBA 3FVQA 3TKAA 3P9CA 1BXKA 1IPEA 1NFRA 1VPLA 4D6XA 3QVKA 4IO0A 2OXTA 1TK9A 2ZKIA 5TQJA 1ADJA 1P2SA 2UXBB 3PJDA 4F3TA 5A4IS 2VXCA 3R6DA 4RL4A 4EY6A 2HQ1A 2A86A 4YRTA 4DBVO 1A76A 1OXTA 3U3JA 2XA1A 4AKHA 1NATA 4FJ0A 5ALOA 4O2AB 2FQ1A 4WLUA 3DQPA 1ONOA 2FPRA 2OO5A 3L05A 1EXVA 4AKSA 3QRWA 3R3SA 1UPUA 2OTCA 3AYZB 3GWGA 5DSTA 1KVUA 2XQVA 3AF1A 5KJFA 3ZD6A 4IVNA 1TUIA 1B93A 4LJ5A 3KZCA 1QIFA 3A6JA 4MVWA 3DJFA 1QMGA 1HNXB 1IBSA 1YI8A 1YJQA 2ZS9A 1A1SA 2GAAA 4NEGA 3QPBA 1P6QA 4M54A 1R6AA 2FZEA 3SZ3A 4N3AA 2PXAA 2PGNA 1PTJA 3KR2A 3WLJA 2XTMA 4G1FA 1P1HA 1YIDA 1FUIA 1RHKA 4KPFC 1QIKA 1EFRD 3UB3A 1WPXA 3C7KA 4JELA 1HZZC 2XGJA 1E1RD 1ILEA 3L43A 4BO8A 4HXGA 4KXVA 5H70A 1J8YF 1L3CA 1TZJA 3HRIA 3A1VA 3I1IA 4FYIA 4E13A 2VDOB 1GXSB 2J59A 2P9JA 3CG4A 1DKUA 5DHAA 2PGXA 3FH0A 4YXWA 2Q45A 5DJ5A 3CYFA 3I5XA 3H4MA 3ZBUA 2VDJA 3VYVA 1JFFB 1E1DA 1NVMB 1XA3A 1J2JA 2J5QA 1YBVA 2YWDA 4V0KA 1ZJZA 1U9YA 2Q5EA 4EJ2A 1U0TA 1L7EA 3EK2A 2DQZA 4K88A 3X2FA 1OT3A 4YPVA 4R41A 3QIVA 4A0HA 2OHGA 4Z1MA 1PFQA 3HUUA 5EESA 3HJCA 1WMAA 4IRUB 4M53A 3V5NA 3FPGA 2R7NA 5AW5A 1ZO8A 1Q0QA 3KLNA 3P71T 1SD5A 1XF1A 4RJ2A 2QD4A 3C5WP 3QUTA 5JJBA 4LF5B 5F3DA 3F7NA 4DDHA 4A8PA 4BFYA 1B74A 1DRVA 2D3TA 1QAQA 5JW6A 1OB2A 1GA6A 3MUEA 1I30A 3ICWA 2Q4EA 5ALKA 4U9IS 3CXUA 5J47A 3BG5A 3G5MA 1QHGA 3MCWA 4HUQA 1DNPA 4WZ6A 4B17A 4XCQA 3ZCQA 5LQJA 5CB4F 1BRMA 1XWIA 2MSWA 3DO5A 2O8EB 1NRXA 4L74A 5AK3A 3OA0A 4O4LF 3KWJA 1Z4QA 1H5UA 1A88A 4EPYA 3SOZA 4QUJA 3JQCA 4GOOD 3ZI7A 3IJRA 1TJPB 4NY1A 2A5FA 4FMDB 1SZCA 2PKQP 2AMYA 3U4DA 2Q8PA 3R3JA 4UFOA 1CVIA 2XGOA 1GA1A 2B94A 4CIYA 1N3IA 3KTDA 3ZTYA 1SXJD 4BFVA 4QA9A 2V7TA 4MPTA 4Q02A 3ONWA 4JDUA 4TS3A 5HYVA 1WABA 4NF2A 2PPVA 3L1HA 1RP7A 3SDZA 4J03A 1OY1A 1CIJA 4GE0A 4U5XA 5EIBD 2W6OA 3STTA 3VTFA 4EI8A 3EHEA 2H4WA 1H05A 1QYVA 4I19A 5I4BA 2DWUA 4PGGA 4JY7A 1BU8A 1AURA 3A36A 2C57A 4TSFA 1P9RA 2V3WA 1YOBA 4K26A 3MBIA 4C0LA 3ML1A 1CUJA 1FP4A 1DRUA 1EXMA 2DCMA 1HRKA 3M4ZA 5EE5B 1KIFA 5LXTB 4X66B 3IKTA 4LI0A 5JAOA 1GCUA 1G8HA 2DU8A 1UQRA 1UZMA 3E1SA 4YHHB 2QLTA 4EYKA 2A5LA 5CXUA 3I6BA 4XGRA 3B52X 4QQRA 2XKJE 4E5KA 5D5HA 2DHDA 3FIJA 3RVJA 1IAVA 2QTMA 1S01A 1OAOA 1V1RA 1XTBA 3PDIB 5JSYA 4DMHA 4ZGWA 1DAMA 2CNLA 1MB4A 3CUEF 3PSAA 3U49A 1MIHA 1T36B 3DLIA 5AJHA 2JG3A 3LRPA 2Q0HA 4GYKA 4Z9BA 3ZVLA 4F12A 4XIIA 1M5UA 2BHSA 3OQBA 4X90A 5DTIA 4B74A 3TOVA 1O96A 5KVQA 1PIWA 4BE4A 3OZSA 1M0SA 3WRWA 1MO2A 2JI7A 3A6FA 4TWBA 4BX8A 4DJEC 4HUTA 3J81k 2C77A 1H8ED 4RAQA 4CT4B 4X1IB 121PA 3G5AA 4AZ3A 2WD9A 3ZE8A 4BUZA 1CYDA 3EXHB 4UU7A 3Q87B 3EH1A 4M9CA 5A5EA 1JUDA 1KZ4A 3OM9A 3SPXA 4OBBA 5LZ5A 3WK5A 1TJ5A 1OV4A 1QH1B 3DDHA 3DONA 4WX2B 1U5BA 1E58A 1RJFA 2ZTHA 4MP3A 3TQTA 1NR1A 4GRDA 4WY2A 4DQDA 5K5EA 5KPDA 4F6LA 3TR6A 5EQTA 4Y1RB 4HADA 4AG3A 5BV8A 2O5EA 2OK8A 1I51A 3GQVA 5L53A 2J9YB 4RELA 1V26A 2FG5A 3NNNA 3N8IA 4ER7A 4A36A 1U6KA 5HF9A 2C58A 1DCMA 1DKQA 4URZR 4G9EA 2IV3A 2Z3WA 3K96A 2FMXA 1IH8A 3AF3A 3NIWA 3QVLA 3W6NA 3IELA 4G3XA 4C3VA 3DXXA 3KJGA 2DUNA 3K92A 4AZTA 5C3UA 3EIXA 1OWPA 1U7DA 5FJJA 3PDHA 1JQ5A 4YQZA 1SUDA 1JE0A 3QVGA 1T35A 2AD1A 1V4NA 2F17A 3KHTA 3RROA 1NPDA 4YCJA 1MHTA 1JGTA 1QHSA 2C95A 2ORWA 3I42A 1YDMA 4K6OA 4AQYB 1T4GA 2FY8A 4YIKA 2VHCA 4HY3A 4FFSA 2EYUA 1XUOA 1NJ6A 2GPAA 3WQBA 4M9UA 3VKGA 1VM6A 2PS3A 3AUUA 1IN6A 2I6QA 4C0JA 1N6KA 4MULA 3K1AB 2H5JA 5EHNA 5K7SA 2YC2C 3AR3A 3DEFA 1KFJB 3L7OA 7REQB 3M2PA 2EKBA 5H9WA 4HN9A 1KSGA 3RB8A 3JQDA 3WX0A 4LF7B 2R4QA 2JGNA 3JATB 4M0CA 4ZHQA 1SXJB 4Z7QB 4PEVA 5E1BA 2P78A 3OOJA 4KTTE 5DSZA 1BJRE 3VX3A 3VVBA 3RAGA 2OKGA 2ZJ0A 2JJQA 2AFRA 1EVEA 3DHYA 4GEKA 4IXDA 5E6SA 5CM8B 5HUJA 2WTUA 4JGGA 3D3JA 3HC7A 3GLIB 4EJ6A 1YRAA 1GAXA 5FWYA 2DBQA 5K8JB 3BWDD 2J3DA 2C59A 3H84A 3HCPA 5FLKA 2PSHA 4R5MA 1R6TA 3UMCA 4XDZA 1KNXA 3B5IA 4N1AA 3HKBB 2OVBA 4H7HA 2IBTA 1H4SA 1OYYA 1U3CA 2VG8A 2AOTA 4DBLC 2C2WA 4OAQA 2RKOA 3UG7A 3WIVA 1ULZA 1YIOA 5CVUA 4Q21A 2HX1A 1U1GA 2DM6A 2VP0A 1PT6A 1RRFA 1VG9B 2WI8A 1UWVA 3D5QA 3L40A 3CX4A 3IE2A 5DGDA 4K0KB 2CCJA 1ZU5A 3OIDA 6NULA 1CYEA 4IH1A 2MWMA 4TRNA 3C1AA 1I4WA 1PT7A 1RTKA 4U6SA 1JDPA 1KI1A 1WA5A 2IUUA 3SCZA 4YYZA 4XYGA 1SXQA 4D3YA 3QU2A 5C1DA 3I6YA 1QHHB 3KJFA 3SVZA 1H8HA 3LUKA 3WKEA 4B6SA 1SKYB 3W05A 1DAOA 1SC1A 3EGDA 5FNVB 4NH0A 1O94A 1N7JA 4H7FA 4L2IA 4RIHA 1CR0A 1JYEA 3ACDA 4C6TA 1EHCA 4YUAA 3L8CA 1LX6A 1RBZA 2AEMA 3QFSA 2R7LA 3DBIA 2JVIA 3ONVA 3UGQA 3TTYA 4K03A 3CSSA 4HD8A 1H2YA 1U1IA 1YE5A 3GDHA 2CDRA 2FFAA 1V7QA 3JQAD 4EB6A 2QWXA 4IDBA 3ZH9B 3BJIC 4XVRA 5IKEA 2WDZA 4AAYA 3O93A 2BUCA 5EQFA 5KVSA 3JYOA 1G9XA 1TMKA 3CEMA 3L49A 5EMHA 3QA9A 4ROSA 4YJGB 2W2OA 3A1UA 4Z7OB 4D97A 1KFCB 1GDHA 3OLVA 2P2GA 2Q7DA 5LU8A 4NZ9A 3WBBA 4H27A 3L7DA 2ZB4A 3I76A 3JRNA 3FHOA 1I0IA 1QG6A 4JH0A 1VGVA 4KTVE 3LUAA 3E05A 5C7OO 3FSEA 2GK3A 4E31A 5JYEA 1J6UA 3R4VA 1X42A 1U0OC 3FN4A 4QNMA 2CL0X 5FP0A 3SF0A 4OQPA 5IP5A 2FKAA 1Y4UA 3WQQA 1CEYA 1PGQA 1Y1KE 3WY9A 2COEA 5I5EA 5JQWA 1GZVA 1YBFA 4UUQA 4HN4B 1JMYA 1NAHA 2P1DA 1W76A 2V7QD 4KRGA 2IGTA 2R6ZA 4R3UC 4PVCA 5TS2A 4DDWA 1CQJB 1GCGA 1DKOA 4KNWA 1KVSA 4PY2A 3K0FA 2WZQA 2UYGA 1QSGA 5JVDB 5E6UB 1CY6A 1DIRA 1GZUA 3GQBB 2NN3C 5E4YA 1SUIA 1K2VN 4D92A 4PRKA 1FNMA 3SC3A 3U7HB 2I2DA 2Y71A 2FRDC 2OBYA 1G9SA 1OXUA 4BXOA 5K0FA 2YZMA 1JV2B 4HDRB 3PRJA 4AKTA 4X3OA 2OZVA 3FG9A 3DBRB 5HIIA 3RW9A 3L3BA 4BVAA 2WWFA 2ID4A 3NAMA 4FYPA 4MWTA 4RY0A 1V45E 2QU7A 3H13A 3L4KA 3D59A 4NS4A 1EINA 2DE0X 3M1AA 2ECQA 3RLIA 5L3QB 4DR3B 3RT7A 1S8OA 4DEVA 5I9IA 3AHIA 3THWB 4P22A 3PYLA 2O1EA 1FB5A 1I80A 1P8JA 2IEYA 2V0NA 3AIIA 3GB9A 3KQVA 3M9LA 3D3EA 3OJCA 5D1HA 3FDZA 4NQZA 2IHKA 3IAS1 3WYBA 1HH4A 2JJ1D 3OZAA 1ATZA 5T67A 1TAGA 1EZZA 4BNYA 1EFCA 1TEHA 4PX9A 1FFBA 2EAUA 4HATA 2OGWA 1JG1A 4NECA 2A1TR 3WAJA 2ISSD 4UHEA 4MS1B 1G291 1FFWA 1G60A 1XK6A 4YMUA 1V96A 2ZYGA 3OJOA 2X58A 5GMOA 1KAGA 2PMKA 3T9EA 1E2HA 3UV6A 4CMHA 1UJ2A 1YZTA 4UPVA 1MJGA 1D4OA 4IQFA 4Q48A 5JYBA 3CNBA 4PHFA 2AH5A 5TV2A 1X7XA 2PMFA 1MAAA 4X54A 4RPIA 1IZ7A 4PAQA 5EPEA 4I46A 3MQFA 1GLVA 2FLWA 3M4YA 4HEA6 4JP3A 3BXEA 4LSMA 4MPDA 3QI2A 5FIUA 5K01A 3ND8A 4L15A 4NX2A 1MFPA 3GT4A 3LA8A 4Y0NA 4IEIA 1IN7A 2ONKA 1HOXA 2AYZA 2FCRA 2GRJA 3DAYA 4FFMA 4KAFA 3JQAB 1Y63A 5C31A 1BE1A 2EBHX 3R41A 3K8ZA 3W7BA 1T5IA 2B8WA 2EOAA 2WOJA 1LKZA 1JR3D 4ZOQI 1YZKA 2YWRA 2GN1A 2HTFA 1YQQA 2OYRA 3VNRA 3CRMA 4Q7JB 3RFXA 2G67A 2FGJA 4BIIA 1LV7A 4FFLA 4YR9A 1K7CA 2ZVQX 3R0IA 2E82A 2YZNA 1NN5A 2XRFA 2XCUA 1Z3IX 4RCZA 4UUPA 1WXGA 3WJAA 1QWOA 1XDGA 4X60A 5I8ZA 2YR0A 3HBJA 1T10A 3N8KA 4FI3C 1NVKA 4MICA 1G6KA 1NUAA 3FF4A 3RS9A 5BV0A 1ULAA 5K8CA 3B6JA 1PW5A 3RLFA 1GSHA 1NYQA 1M8PA 3C6BA 4LE2A 1YU6A 2WFLB 4V03A 1GPYA 3U6BA 1UWKA 3HNPA 5HHTA 5KTSA 1IY8A 1BXRA 1AUXA 1QP8A 2GASA 3WGQA 3WSWA 4J76A 3R3VA 4JB8A 4Y2XA 4Y9RA 4YRAA 3K4PA 4I66A 3IDFA 4B6EA 1SIOA 2BUAA 4E2FA 4ZDIA 1R4ZA 4GUDA 1Y8QB 1BS9A 2HOQA 1B4DA 4R2XA 4XB2A 3WZMA 3CE9A 1N6NA 4A23A 5JCJA 3ANYB 3PLRA 4H1WA 1ODTC 3PENA 3CNEA 1Y6QA 3ZLJA 2H1CA 2CE2X 4KQFA 2CYBA 3CF0A 4ALMA 4XRRA 2H07A 1NJSA 1O5OA 3GU3A 4LYHA 3V4PB 4C21A 4CIDA 1QM5A 1U3TA 2ADOA 3I2GA 3HB7A 4JD5A 4PNHA 1JWAB 2ABWA 3EA0A 2EG5A 3VYRB 1MDFA 3D6HA 3OOYA 4DA7A 4LPSA 1NVDA 2DPYA 5HQJA 1U8AA 4D43A 2FPGA 4EHBA 3RUFA 2RK3A 3PJRA 3QG1A 4HJXA 1GNRA 1A82A 1NVVR 1WF6A 3TF5A 3L6CA 2DCUA 4LZPA 1XAIA 3C3YA 1N0VC 2Q3BA 2XDQA 3B2EA 3IQFA 4UATA 1U8FO 4YP6A 1ZI6A 5A7FA 4RK7A 4DZRA 3H2SA 3FKJA 3OQJA 4JYCA 4RD2A 5AHWA 8ADHA 1VKOA 1BMFA 3KQPA 2PX6A 1L6IA 2HMAA 5HQ3B 2XUDA 4C7MA 2G3YA 1PJ2A 2MHCA 4G2NA 1SXJE 3AFHA 1W25A 4UMVA 2Q27A 3L9XA 3U2QA 5B4UA 1A8IA 5I7WA 4QLBA 1BVHA 2IZ1A 1FDSA 2OHXA 2RH8A 4J3JA 4A1FA 4F4FA 3FWKA 3S8EA 3ER9A 2ODWA 3CR8A 2BEVA 2P79A 3INGA 5AH0A 2ZM5A 4AF6A 2VAVA 1MB9A 1XTZA 1ZMBA 2PSFA 3E84A 2FK8A 3DTVD 4UVIA 2AN1A 4DSUA 3GLIE 4BS9A 1ZNQO 3OZXA 2G63A 3ND7A 2GHQA 2GEUA 1DBSA 1KE1A 3WRXA 4WT7A 5AW0A 5BT8A 5HKAA 4S0ZA 1RSZA 4GZ5A 4HB0A 1JLRA 1U7ZA 3KEOA 4QO7A 2WP0A 4MQ5A 3EY9A 3G59A 4JSTA 1P2FA 2VVTA 1NASA 3F46A 3WV4A 3BRQA 1GSIA 1S0UA 2I4LA 3CZAA 2YXPX 3SY8A 2Z2XA 2H9IA 3CO0S 2ONYA 3PQ8A 2Q4RA 4HDAA 3RC1A 2Y93A 3VZRA 3P4YA 4QOIA 3HKEB 2CYCA 5B1HA 3O8CA 1W6UA 1EK1A 2IA5A 2IZZA 4JX8A 4MPJA 4Q3AA 1YB4A 1DIBA 4JLDA 4BUJA 1L7VC 1YE3A 2AG8A 3VVLA 2OAP1 2ZRKA 3Q88A 1QNLA 4IH9A 1SKYE 3ZCPA 3PPIA 1GU1A 3ZCTA 2R7MA 1ES9A 1OPRA 1CRLA 4NNOA 5FULA 3KEFA 4RENA 1V47A 2P9YA 4YONB 2X7JA 3GJZA 4TQGA 1UFOA 5DYNA 5AOCA 2JH9A 4URFA 2OOSA 4X7PA 1M2VA 2DFVA 1T9GR 2C29D 2QL6A 3ETJA 2O2XA 4LZWA 1JXMA 3VM6A 1ORRA 3EPPA 3CRW1 4GPD1 1LCIA 2C5AA 3D3WA 4QXOA 2JEZA 1ODFA 3KX2A 2PZBA 4JB2A 4V3BA 1J9EA 1MNAA 1W93A 3H5OA 2QSYA 1Z29A 3AR5A 4JLAA 4YP7A 3UJPA 2IKQA 4ENUA 1YONA 3M7IA 3OUTA 4UM8B 5F1YA 3GLFB 5GM2A 4MLDA 4OATA 1UMKA 2ZI6A 4M1ZA 4XD7D 4FNGA 5CDYA 3HEBA 1EHIA 4CMGA 1FSSA 1UJCA 4AG6A 2NTJA 3QENA 2PNJA 5JIBA 2JLUA 1CUUA 1AUOA 1BEZA 1E7MA 1UBSB 4IJWA 3AKDA 4RJTA 4YR7A 4YQFA 3UB4A 3OC6A 5JJCA 4J8PA 1I1HA 3UHJA 3VX4A 4BY9E 1S2OA 4H17A 3U1VA 1DPGA 5B58T 3FVVA 4ZVSA 2CFRA 1CQIB 2J07A 4PHCA 5K0EA 1WXEA 1KOGA 1LSUA 3KFLA 5TQ0B 1OH7A 1HDGO 3W8EA 2QTZA 3E61A 3S68A 1W87A 1Z4OA 3AVUA 5AVUA 1M75A 4IHKA 3H5VA 4LJLA 3FGOA 4MQ4A 5JSHA 2BRUA 3ETLA 1JHQA 5I5GA 1EVZA 2NZ8A 5COAA 1MORA 1O87A 1J0AA 4JI1B 1JDNA 3Q3IA 4C3UA 5TT0A 4MYDA 4PNZA 5EJ9A 1I0LA 2X8JA 3FKSD 3IDOA 4IZIA 4WCFA 4AP5A 3AL0C 4L8WB 5ICGA 4LNHA 3ETHA 5ECDA 2QAIA 2WABA 3HCNA 4BQEA 1Y37A 1DLIA 2O3SA 2ZJYA 1C50A 3LBHA 3V1LA 4BEWA 4B09A 2PSDA 4WAUA 1KE2A 4EY7A 4G07A 2VK8A 4M86A 2GBLA 1CVLA 3OEED 4I3HA 2C2ZA 5KTMA 3QOFA 4KNVA 4XPIA 1P9LA 1UZUA 3V8NA 3LVBA 2VQDA 3CF4G 2BJHA 2R6R1 4JQOA 3TSCA 3PTAA 1U4SA 3NTQA 4RKQA 3O9VA 4UNSA 5I7HA 2QP9X 5FA8A 4P4TA 3RIYA 3HKDA 3ZLBA 1WXWA 1TYCA 2GCEA 3D4PA 3T7EA 4CFSA 2VHYA 3QNWA 4EPWA 1U6IA 5F1OA 1M8FA 3AESA 1BX3A 1MO3A 3DTVB 3HRHA 3FTPA 4Q1FA 4O25A 4QVGA 4GO1A 1ZJWA 4D25A 3H05A 4GL4A 4PQFA 2HI0A 2J9GA 2ZULA 4KGXA 4BIMA 1ZUNB 3B6KA 4BBPA 2HF7A 5DBOA 2JKYA 2WZCA 2W11A 5FI3A 1MZVA 2DRIA 2JRLA 4R3NA 2C7OA 2X6RA 4GLOA 4O2RA 3H1FA 4OGWA 4C0HA 4Z9FA 1RJ9A 4D96A 2BFBA 3B3JA 2G83A 2XB8A 3JQ9A 4L5IA 2VH1A 3BMCA 1JEQB 2HRBA 3ESBA 3NR2A 3VNSA 4OHYA 4ITRC 3SAJA 1BHQ1 1RT9A 2JAWA 4GZ3A 4M99A 5SYNA 3T7DA 4ZJYA 1AA6A 4NZYA 3VKWA 2XKAA 2CUNA 3K6SA 1ZK2A 2ZSJA 2D2FA 4TLLB 2CDAA 3WNVA 2DP4E 5IYZA 5LIRA 3JTMA 3IPXA 2ERCA 4QM6A 4AN1A 3B9PA 3AU8A 5IH7A 1F1JA 4YAUA 3PCTA 5CX4A 2R66A 4DABA 5DGXA 2NAPA 5JSQA 5KB3A 4MEAA 4UTRA 1YJBA 1II9A 3K94A 4GOLD 2OV8A 3IFSA 2WJVA 4KQXA 1K7YA 3Q7TA 1OIXA 2HU2A 1YF3A 4R8MA 2WHQA 5FD8A 4ZHQF 4KPGA 4IDGA 4QUIA 3ZK7A 1N5IA 1XU9A 1RABA 2HR1A 4MR7A 2AD5A 5FI1B 5K3FB 4JJKA 3DE0X 4OXXA 1H0KA 5FT9A 1GO2A 1T2UA 1TYAE 1NP3A 4P5PA 3TBFA 1WHTB 3RRBA 3B3QA 3NWPA 2C2BA 1VJRA 4KFTA 4MTCA 3IV6A 4CEIA 4RXMA 1PGJA 1BN6A 1R12A 1ZH0A 2Q3MA 1W85B 1XCLA 5LZ4A 2H4FA 3WKBA 2D13A 3ZU2A 3DMRA 1BCRB 1E99A 1QGDA 3FFTA 3FOBA 3BE8A 4P7GA 3KAQA 1CB7A 1CFJA 4RETA 4MCIA 1ESNA 1E96A 3RSHA 4NESA 4UDYX 2GEDA 5CK4A 4B85A 1MV8A 1V3VA 1MGOA 3DMTA 1E7SA 2G4VA 4U2DA 3P26A 4QOSA 5E9AA 4W7SA 2C04A 3QLJA 2VXBA 1Z63A 3QPCA 4P3XA 3CNLA 1KJWA 3E6AA 4FBMA 4TRJA 1ZD5A 2SBTA 3RIHA 1H2ZA 2OCDA 4ZAYA 3I30X 2E4XA 1Z39A 1KQGA 2Y92A 8LDHA 1V6CA 1LDEA 3BK1A 3RC8A 1SUBA 3TCKA 4MARA 2ZWIA 4LWPA 1H65A 1SCDA 3RUHA 1QLWA 2ZU0C 3KQKA 2P69A 3ND9A 1F9AA 5TSDA 1KXZA 3UENA 3CVXA 4ZOEA 2B4KA 1HYQA 4PLFA 4BMYA 3N53A 4B3HA 2FRXA 4TQAA 3WWYA 5KSZA 4MO2A 2J32A 5IT0A 1WB9A 4PYKA 1YZHA 1EWQA 1ECLA 1T3ZA 3SSAA 5HK8A 3OQOA 4BCCA 4JL5A 3B5JA 3KVNA 4Z4QA 3UXMA 1JQEA 1QOQB 3MJDA 4GI5A 4EYQA 4PR0A 2WD7B 3LY5A 2AWOA 3T5BA 4EG4A 1E61A 2H08A 5HQTA 5FQOA 3QG5A 2Q7OE 5D85A 2FHPA 1H0RA 4XGKA 3MAGA 3N6VA 3MRTA 1X74A 3OFJA 1VGRA 2ZATA 3B1ZA 3C3PA 2WV9A 3TIFA 4G5QA 2NYVA 4IHJB 3WJ2A 1EFVB 1LFAA 3CLTD 1VCHA 3HVIA 3N74A 7ABPA 4LMAA 1QGAA 1Z12A 3TTVA 2DWCA 3E7PA 3NDPA 1Z4JA 4BRZA 5KSWB 1PVDA 3GX1A 3L8YA 1QK3A 3IUYA 3LM8A 4LNUB 3K53A 4Q24A 5DM2A 2PRJA 3C6QA 4AQ7A 2OSBA 4L5BA 2GEVA 3BZUA 4DC0A 4EKIA 2Y1FA 2ATIA 3DVAA 3V7WA 1RADA 2OGUA 4INPA 3M4NA 3G13A 4A1OA 5F9HA 1J21A 1OXKB 4PO1A 2DT8A 1H69A 1GGKA 4YRFA 3GJ5A 1C3XA 2ZUTA 1ZM4A 5A06A 3LY8A 4JWTA 1B6GA 1GARA 3K6RA 4JUAA 3UGKA 3PR1A 4MA5A 5HGJA 3WL3A 1P60A 4EZBA 1XTIA 2V7PA 1Z25A 5L40A 4HAWA 3F98A 1X38A 2EX0A 3E3AA 4JT8A 1NPTO 1CUGA 4LZZA 2C2XA 2CVPA 1N25A 2FRVA 1W49A 1XHLA 2AX3A 5ES4B 2B7BA 4FX5A 4OGKA 2GO7A 2J85A 2BFWA 5BN5A 1LI7A 2QYTA 3TH5A 4E5YA 3EXHC 2VDMB 4O1MA 4ZT2A 2PQ0A 4XWKA 1K98A 1MN6A 2LCIA 5ICCA 5IXSA 4YAKA 4M6WB 4L5CA 2HFKA 1IQUA 3EVNA 4FE3A 2JLAA 1JR3E 3EUWA 4KVFA 4PO9A 3UIEA 3ZDBA 1KORA 1FC0A 1JU9A 3OICA 3V1TC 3S0JA 5MF6A 3L6RA 3K6KA 4QJIA 4MI6A 3CH7A 1WDWB 1XZIA 4RA9A 1YHYA 2YV3A 5CLHA 1DBIA 2DGDA 3HHEA 3QJYA 4UNPA 1L5SA 1SCKA 2WZBA 5CFQA 4NHEA 4OYRA 2XUPA 4B3XA 3JAKA 2O0JA 1W2WB 1GEGA 1N9KA 1L8XA 3OCUA 2G5GX 2HNAA 3GEGA 4FDMA 4KO3S 2R8EA 5FBVB 3F6CA 2FP3A 1XDUA 2HA2A 3F3MA 4P3OA 1NBMD 1NVBA 5IT4A 4RTKA 3NDBB 5IS2A 1LLQA 4GX2A 4QBKA 3GLGA 2RAFA 2ZYIA 4R3WA 3WWEA 4Z5XA 1FPQA 3RSOA 3V2GA 2COUA 5AW4A 1DQNA 1LW7A 2HLNA 1NXWA 3L02A 3O8DA 4WY5A 1MQAA 5HS6A 3EZNA 1ZJ4A 1DXOA 4JLKA 4IWNA 4CV2A 2FSVC 4JU8A 5J2TB 3GLFE 4CLHA 1FP1D 3DZ8A 4Y7CA 3QX8A 3N6RA 3BDIA 2BZSA 4H3HB 1HYEA 4BN4A 4ALNA 2G8NA 4HAIA 4IFIA 4UVHA 4BX3A 1SXJC 2AVNA 2V7UA 1J22A 4DIEA 4U2CA 2RAPA 3GUHA 4DY6A 2VWHA 1QHIA 5BN3B 3QBDA 4ISBA 1Y1QA 4B84A 1WE2A 4V0SA 5EIBC 4MW1A 1GXSA 1KMIY 2QMOA 2WVJA 3AR7A 1TM2A 4X44A 3AUJB 4ZAXA 3RVMA 4D4IA 2W6MA 1DTSA 1SU8A 2BR4A 2JFNA 5DF1A 1Q57A 5B1YA 5C46F 4TXJA 4DAOA 3A32A 1Q0RA 1F2VA 1WDMA 1NRJB 3FBGA 1AHIA 1S7CA 2QT1A 3ZIAA 3H75A 1KO8A 2Q1YA 5E38A 1O95A 3D7LA 3MIZA 1ADFA 3ESYA 3L46A 4LY3A 2EFYA 3TNLA 4NULA 2QP4A 1CXZA 2PXXA 3TQSA 4II7A 1TFUA 3ZHTA 5KYGA 1I7PA 1U28C 3DBLB 1U9IA 3L4BA 5ALIA 4KW7A 1FDWA 1R50A 5CA0B 2P4HX 3SU8A 4N5NA 2IV7A 4F9EA 1N8NA 1YK0A 5BR1A 4JEIA 4LJAA 1LBQA 1N9GB 3AVPA 1XNRB 3OJEA 3GA7A 2ZBEA 3H1TA 4W9NA 2V7VA 1NXSA 2YHIA 1J90A 3OCXA 1L7NA 4J2OA 4LTDA 5AJVB 4AJHA 4E46A 5BQ3A 3TLYA 3NUGA 4P4GA 4GH5A 5DSXA 4BNFA 5L3SB 4AKIA 1A97A 2JHCA 1O2DA 5ITZB 1G8AA 3FCSB 4A6PA 3CWZA 1CPYA 2CZCA 4NV3A 3I32A 1MU0A 3RTGA 1S3IA 5LLTA 5HWSA 3UFXA 1O54A 3BGIA 3A9SA 1TKCA 1Z6PA 1SAYA 1QH8A 2Y68A 1LTQA 3GXBA 3LZCA 3N2GB 4I4TB 3LUJA 4D3XA 2BGTA 2HY7A 3BA1A 3VR5H 4ID9A 2CUKA 4ZAZA 5JV5A 1YV9A 2I34A 2MYUA 3QK7A 3CISA 2WU3A 5LL6P 4D0SA 1YQ9A 2E1PA 4L5YA 4QBHA 3H2BA 2H7CA 3ZWPA 4TSRA 2I3ZA 4QVKA 2FDCA 1E3MA 1PR3A 3L9WA 1FU4A 3RSSA 3IE0A 3CZ5A 2X9GA 3QM1A 4OL9A 4BMOB 3KQTA 5AR1A 1NVXQ 4BNMA 2CV0A 4GLJA 4CCAA 1WUIS 4HVCA 4MS4B 4TMTA 3GLRA 1PNVA 2QTFA 3WGJA 5BUCA 4DV0B 2ODEA 4G67A 4Q4JB 3RVPA 2R62A 5EQDA 3ST7A 4INZA 4JP5A 3IPAA 5CLIA 4DWWA 3UTCA 2FSHA 3C4VA 3IUJA 2SKEA 3CVUA 4BVEA 2VEDA 4BAZA 3T3EA 1ITZA 1KJYA 3MTGA 3PKZA 3A9UA 5MN4A 3Q7IA 1XRSB 2R4TA 4FLMA 1VLMA 1IQPA 1HEUA 1EFTA 2PUWA 4K46A 5DBIA 4X1YA 1RPZA 3ZD9A 4UTXA