4OOIA

Reduced hlyu from vibrio cholerae n16961
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
95
structure length
95
Chain Sequence
LQEMEKNSAKAVVLLKAMANERRLQILCMLLDNELSVGELSSRLELSQSALSQHLAWLRRDGLVNTRKEAQTVFYTLSSTEVKAMIELLHRLYCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator HlyU
publication title Crystal structure of HlyU, the hemolysin gene transcription activator, from Vibrio cholerae N16961 and functional implications
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Dna binding protein
total genus 31
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ooiA00
2KIFA 4HBLA 3M7GA 1W5SA 4HX4A 4WX9A 4ZYEA 2F5FA 1PP7U 3RTRA 3DF8A 3HRUA 2Z3YA 4KMFA 3I64A 2ZXJA 2FA5A 1TQPA 3F72A 2DK5A 1P4WA 2CWEA 2CSOA 2F2EA 4EM0B 4L5IA 1J75A 2VOPA 3E6DA 3KFWX 3E6MA 2ZO4A 3DPLC 4L0YB 4YIFA 3SZTA 2E7WA 3GW2A 2FF4A 2OBPA 3GFLA 3KP3A 1XGOA 2A6HF 3FMRA 4FT8A 3V8KA 1KU7A 1ODDA 2JT1A 2L4AA 3ZPLA 3DFGA 3QPTA 1I27A 2Q0OA 4LG0A 2A61A 5HDNA 1Z7UA 2DO7A 3WTUC 5E17F 2XVCA 4OOIA 5H20A 4PGHA 4HLXA 3E6CC 2A68F 2VBYA 5FFZA 5H6QA 3KLNA 1D3YA 3I0TA 4GCVA 1DUXC 3R60A 2MBFA 3KCCA 2QENA 4G6QA 2OZUA 5TJJA 5L3FA 1YS6A 2GQQA 5KVRA 2RV8A 1IXCA 5CVUA 4MTDA 2ZNYA 1R1TA 2UZKA 2PJPA 4UV9A 4HLYA 2Q2EA 1I5ZA 1TQIA 2DFIA 3GFIA 5L3GA 4FHTA 2GXBA 2LF7A 4ENNA 5ILUA 3EYIA 3GYHX 3I58A 3WU0A 1P92A 3FXRA 1J5YA 5E20A 4R8HA 1XB4A 2XGXA 5JVTA 2FNAA 3FXUA 3HYIA 5DEQA 1QQIA 4RB1A 2QBYB 1OR7A 3V4GA 3VOEA 1R1VA 3MZYA 5D5XB 4QWQA 1DPUA 1J2XA 1FZPB 3TOAA 1R1UA 2D1VA 2LDUA 5J8CA 3IKVA 3CUOA 1HW2A 1D8JA 4UHTA 3TGNA 2V1XA 2LF8A 4B8XA 5E18F 3BPXA 1UB9A 4HW0A 4LMYA 3FHZA 4MEYF 3FMSA 3QU6A 4EJVA 2M30A 1RUNA 3SHFA 4RB2C 3ZN0A 2CQKA 3GX4X 1PDNC 5DCFA 2G7UA 4BQAA 3I59B 4HF0A 3TO7A 3HUGA 2XAGA 4XLNF 3CLOA 4P5OA 2EFWA 4XSXF 2STTA 1SD4A 3DEUA 1YS7A 1G3SA 5BPIA 3T8TA 5L3CA 2F5EA 3Q9SA 3BDDA 4G9YA 1P4XA 1X3UA 3WTZA 1USTA 3BOQA 5BQTA 1W7PB 2O8XA 1LNWA 5D4SA 5ED4A 2O61A 4HX8A 3M8FA 2NS0A 4GO1A 1Y0UA 2HS5A 5L3BA 4RGUA 1H0MA 1EH7A 3KLOA 1BN5A 2P7CB 3BWGA 3WU1B 4M6YA 1ZRFA 2JSCA 4OMYA 2RDPA 3F8CA 1CGPA 2QUFA 2EK5A 1R00A 2EV5A 2UXXA 1HKTA 2DQRA 1T2KA 2EWNA 3KP2A 1SFXA 1LEBA 2DPDA 2Q8KA 1QBJA 2A07F 3GO5A 1GHCA 3FX3A 2STWA 4IRGA 2IA0A 1YTYA 1IRFA 3GLXA 4N9HA 3ZMTA 3VFZA 2QQBA 2KJBA 2YX7A 2CW0F 2VT3A 1EV7A 2W85A 4L9VA 4A0XA 1XMAA 3GUDA 5CVJA 1LQ1A 2OZ6A 4Q4ZF 4ON0A 5HLGA 3GF2A 2BE5F 5ICFA 4I02A 2IJLA 3L00A 2L01A 1RNLA 5JHUA 3KP7A 4HX7A 2D2WA 1QZYA 3AAFA 2HKXA 1JHFA 3E5QA 4D0PA 2XHKA 5TRDA 3CUQB 1WI9A 3ZN1A 4I7HA 4CO8A 2YU3A 2DLLA 3WTXC 3J81Z 2IA1A 4M6XA 3GFJA 2VC1A 1XD7A 2H94A 1W5TA 4EV0A 2DW4A 2EFQA 1Z9CA 1XSXA 2TDXA 3ULQB 2DBBA 5CYVA 1IXRC 3K69A 3WTVC 2G9WA 3RI4A 1XCBA 4LK0F 2ISYA 4ZZLA 2UWMA 3KEOA 1HSJA 2V9VA 4LJZF 4EM1A 5LHHA 3WTTC 2XASA 3FM5A 2R7FA 3OOPA 3C3WA 4KFCA 2IVMA 2VONA 2IW5A 2XUBA 5DYMA 5E1ZB 3EUHA 5LEKA 5LHGA 3MQ0A 3WGGA 1O3QA 3GWZA 4I98B 2VBXA 4XBFA 1ZG5A 4PCQA 3R61A 1KYWA 2P5LC 2IP2A 1FNNA 5BOXA 1I1SA 4ZYGA 3WE3A 5F6FA 1AWCA 1OPCA 3LAPA 4KT5C 4IHSA 3U1DA 3P9IA 1SFEA 4I2OA 1NHAA 4WXCA 1U5TA 2QYOA 2FRHA 3RIRA 1DP7P 3F8BA 2GZWA 2HFHA 2JPBA 2AS5F 3I4PA 1SD6A 5CJ9A 1JE8A 2BYVE 3P9KA 1YIOA 2EA2A 5K1YA 4MEXF 3NRVA 3RJPA 4P9FA 3QOPA 3BROA 1XMKA 5HDKA 5AIQA 2XROA 4G8XA 1QO0D 5HDGA 3EDPA 3HRTA 1O3TA 1STZA 4CICA 4UNOA 2LKPA 3ERED 5AIPA 2OA4A 3F22A 1IF1A 3H3ZA 3QP6A 5HOOA 1WQ2A 2DT5A 4KIBA 4WK8F 1USSA 1BI0A 3V8LA 1IRGA 2IPQX 4ENJA 4EVIA 1D8KA 1WRJA 4LB5A 1MKMA 2YPRA 4DQ2A 3E5UA 2K4JA 2XKPA 1O3SA 5DCMA 3VEPA 2NNYA 1QZZA 4ETSA 1QGPA 3DKWA 4N9IA 3RKXA 4PZJA 4QLCU 4I09A 1IAWA 3Q9VA 2XAQA 4WCGA 1IN7A 4L9TA 3RYRA 1P2FA 1MDMB 4EQQA 1WSUA 2VE8A 1TQMA 3FWEA 1IN6A 2P6TA 2H6CA 3GXOA 3S2WA 4M9XA 4L5JA 1R5GA 1YQAA 2JPCA 4O5VA 3LA2A 1SAXA 3DP7A 4AWXB 2MD5A 2R7DA 3QU3A 2EA4A 4B09A 2DQLA 4NQWA 4IF4A 4YFXF 2P5VA 1T0FA 2W24A 1BIAA 4K2EA 5DDGA 1S8NA 1S7AA 4EJWA 1FBUA 3QP5A 1PUEE 2DPUA 2MLKA 3EYYA 3RYPA 3B02A 2FEZA 3TDZC 1K78A 2HTJA 2DK8A 2KIMA 1FLIA 2BBYA 4FX4A 3TO9A 3I54A 1O57A 3SXYA 2RC4A 2HWVA 3WTSC 2ZBKA 1T38A 2EFPA 2W57A 3LSTA 3SZPA 2IT0A 2KJCA 2HR3A 1J0RA 2K86A 1BI1A 3MCZA 1XDSA 1BC8C 1S29A 3ML6A 1ZRDA 1B6AA 2QWWA 3R0AA 2ETHA 5D5UB 4UVCA 3C7JA 3RDIA 1IUYA 2Y0MA 2BGCA 2OQRA 4CHUA 1TBXA 3JAMZ 3F21A 2VC0A 3WTWC 1YW8A 3EQLF 4EGYA 5ILSA 2EJRA 1RIOH 1SMTA 3V7SA 4CGZA 4HQEA 1REPC 1LEAA 1DDNA 2L54A 1HW5A 3ZMUA 3M8EA 1XGSA 2D1HA 4U0VA 5LRSA 2F5DA 1W4MA 1KU3A 3CTAA 1KQ9A 5CVIA 4UV8A 5LRRA 2KIUA 4WWCA 2VODA 1XGNA 4JQFA 2HOEA 1HBXG 2BEOA 5FGMA 3IKTA 1L3LA 3K1MA 2ACJA 5DD4A 4MQVA 1FX7A 3P9CA 3BJAA 1TW2A 2D45A 2JZYA 1B4AA 3DPTA 2NAZA 3F8FA 3LA3A 1BI2A 4IPAA 4YIIA 2HQRA 1QNTA 5E8IA 4JBAA 4A6DA 5KK1A 4H0EA 4ZH4F 1JXSA 2A5YB 4KUMA 2CFXA 5CVRA 3O3KA 3IRRA 3HHGA 4Q47A 1J59A 2QQ9A 5HS9A 1BJAA 3T8RA 5CVVA 2GXGA 1KA8A 3T1BA 1ZN2A 2EB7A 2X0LA 4OIOF 1IN4A 5LBQA 2XIGA 1LDKB 1OMIA 5D8KB 3WGIA 4HV5A 1KGSA 4OINF 4MHGA 2EFNA 1FY7A 1FP2A 4LLGF 1IXSB 4M72A 3F6OA 2GWRA 3I71A 2XKOA 4Y17A 1ZLKA 5HVQC 5H6RA 3F8MA 5LGTA 5HLHA 4U88A 4JK1X 5E1WA 4YFKF 2HEOA 1T39A 1UHMA 3HSEA 3OV8A 4HYEA 4Q5SF 2O03A 3ZMVA 1EH6A 4CXFA 2M45A 1OYYA 2YSRA 5K5OA 2P6SA 4PGGA 3WGHA 5LLQA 2K4BA 4TV7A 1J9IA 4GYIA 2XAHA 1ZLJA 3HOTA 5L3EA 3T5XA 4N0BA 5FB2A 2B0LA 3P7NA 4IRHA 3ZQ7A 2YX4A 3HSFA 4A0YA 5EEGA 2VN2A 2QBYA 4A2UA 3JSOA 3MAJA 2KRFA 3ECOA 3I5UA 4R1HA 2COMA 3LWFA 4ZYHA 3E6BA 2Y75A 4U0WA 3JTHA 3ZMDA 4FX0A 1FBSA 4RGXA 3H3UA 4PDKA 3BZ6A 3NQOA 3F8NA 2PBIA 5HLIA 1ONVA 3F3XA 5BS6A 3FZVA 5F1RA 1MZBA 1U5TB 4Z2YA 2HGCA 2H09A 4UXNA 3VB2A 3J80K 4OIRF 3N4MA 4G6DA 1K7AA 4IHTA 4BHBA 3ROUA 1FSHA 2HQNA 2OAZA 5D6EA 1O3RA 4XSZF 4A5NA 4LLNA 3JSPA 4O3MA 3MZHA 3TKYA 1HKSA 2F5CA 2OD5A 3L7WA 4L0ZB 4HAMA 5JR3A 2ZMEA 3QRFF 1W7PA 4KDPA 1HW1A 1YG2A 3TOBA 2JTVA 5BMZA 1FSEA 2OQGA 1U6GA 5FFXA 4HOBA 4EM2A 1GXPA 1ZYRF 3D5LA 1UFMA 4KN4X 1DPRA 1FWZA 4Y15A 3TQNA 3IWFA 4U0YA 2PI0A 4LB6B 5ICCA 5D5VB 1Q1HA 5LGNA 1MD0A 4M9ZA 2RKHA 6PAXA 3DQVC 1F4KA 2EFOA 2VBWA 3LFKA 3R4KA 4ENMA 2P8TA 1TW3A 1ZHFA 1OYWA 3JW4A 1Z6TA 3LQQA 2ZNZA 3GZ6A 2W25A 4LFUA 4UVBA 1R5HA 1SD7A 4IXAA 3D0SA 4HF2A 1Z91A 4LK1F 4P55A 1XGMA 2ZFWA 1Z1DA 4NHJA 3L9FA 3BJ6A 2L4MA 1VTNC 1P6RA 2O6GE 2OU2A 2GAUA 1R23A 2H27A 2M1BA 2M87A 4DNCA 2H6BA 2MC3A 2ESHA 4ESFA 2HYFA 4RB3C 3KZYA 4BNCA 4KICA 4XRFA 1ZREA 2M5WA 3NEUA 4OIQF 4RAZA 3J81K 5D6FA 4LG0B 2EV0A 2XRNA 1U2WA 4S04A 3CUQA 2A6EF 1U8RA 1LDJA 3CUQC 5JFRA 5FD5A 1B1BA 1IN5A 5HS8A 2A3SA 4F7ZA 3WODF 3MFKA 4KN7X 3ABTA 2DTRA 1YYVA 5D8LB 1BOAA 4LLLA 1OYIA 1SMYF 5DV5A 1ZH5A 2VE9A 1JGSA 3KP4A 3K2ZA 1R58A 1GXQA 4KYWA 4EJOA 4MQ9F 3VODA 2W84A 1BM9A 4IVNA 2J5OA 4ZZDA 3PQKA 2MA3A 3REOA 4KNYA 4G7HF 5L3DA 3CJNA 1R36A 3HOSA 1G4DA 4LGWA 1A04A 2PEXA 2HKOA 5J8FA 4AVPA 1QPMA 4OIPF 1ZRCA 2L3DA 2O0YA 2PG4A 2GA2A 5FLXK 4AIKA 3ZMSA 4HDVA 3HSRA 1FP1D 1HSTA 5LGUA 1KYZA 3JTGA 5AONA 4CDGA 5E8GA 1WKMA 1G3TA 1ZG3A 3CDHA 4EJUA 4EGZA 1R22A 4HF1A 1MJBA 4I0BA 2BV6A 3DXJF 4GXOA 3IWZA 2V79A 5JI6A 3ISPA 4L18B 1FYKA 3K1PA 4MTEA 4L9JA 3K1NA 3CO7C 2EV6A 4R79A 1V3FA 2PN6A 2ADUA 3G3ZA 4U7BA 1BI3A 4AIJA 2A69F 1XSVA 4NB5A 1CF7A 1E2XA 4O6JA 4ENKA 4G7ZF 1RUOA 3CO6C 3M9AA 1WWXA 3KZZA 1ON2A 1FPQA 1TLHB 5CLSA 3MWMA 5K5QA 2P7VB 5DUIA 3KP5A 5IT9K 1ZGAA 1IW7F 2NNNA 5A2QK 1I6XA 4MGRA 2XAFA 1K6OA 1U78A 2FNPA 2E7XA 2O3FA 3FM3A 3IHUA 2HTSA 3ZP5A 1FYMA 3HTUA 1MJAA 4Q48A 5HS7A 2FBIA 1PP8F 2ESNA 3WTYC 2ZKZA 1RZ4A 1C0WA 2DI3A 5E1XA 3L09A 3FF5A 4E70A 5D4RA 2RN7A 3KETA 1O7FA 1YW9A 3BJOA 2X4HA 4ASNA 2K02A 2FBHA 2G7HA 1FYLA 1XCVA 2IRFG 2P4WA 4RB0A 4BH9A 3ZMZA 3W6JB 4M74A 2AXLA 5DD8A 2FOKA 4A6EA 4A0ZA 3QAHA 3TO6A 1HQCA 2PMHA 4U7DA 2RVCA 1B9NA 2CG4A 1KQ8A 2J5PA 1ZG1A 2YR2A 3KEQA 2LNBA 3BY6A 2E1NA 1UHWA 1R7JA 3O2PE 4RGRA 2V6CA 1MDMA 1SD5A 3BP8A 3IRQA 2Z99A 2K27A 1Z05A 4BHPA 4LD5A 4HQMA 5D5WB 1B9MA 1IN8A 1XSDA 3O6BB 3SFZA 3F23A 2WV0A 4GYGA 3QPHA 2Y48A 3WE2A 1P4AA 3RKYA 3B73A 4WXDA 2VXZA 4ZYDA 2PQ8A 2V1DA 5FO5A 5J6XA 4ESJA 1XN7A 1JHHA 5K5RA 2KKOA 3IC7A 2ZJ2A 3LA7A 4KIFA 1G3WA 2QZ8A 3N97A 3E5XA 4WXHA 5FD6A 3W6KB 3KE2A 1H9TA 2XAJA 3BPVA 1UCRA 5ILVA 4HV6A 3J80Z 1F5TA 3SQNA 3JAMK 2ZMEB 2FBKA 1Z6RA 2WWYA 1KU2A 2V1UA 3TDUC 2WC2A 4I0AA 5ERIA 2K7LA 2HZTA 4L9NA 3Q5FA 1G6NA 2QVOA 3EETA 4AIHA 2XV4S 4HA8A 2RQPA 2Z33A 4HDUA 5LHIA 3F6VA 1F9NA 2JRTA 3C1DA 3U9GA 3IL2A 3I53A 3C18A 2C6YA 3RKWA 1LVAA 4OU0A 1U3EM 2VOOA 5ICEA 1BBYA 1ZARA 1G3YA 1D5VA 2FMYA 1S7OA 3ECHA 3MEXA 1TTYA 1AOYA 3GFMA 4M71A 3T0YA 3ABUA 2NYXA 3E97A 5IT3A 4EMSA 2FXAA 2GIVA 4P9UA 1V4RA 2WTEA 4BHCA 4BYYA 2MH2A 4RGSA 4BXUA 4CZZA 1YO5C 3M1EA 2DAOA 3I59A 1ON1A 3PFIA 5LEJA 2FU4A 5F64A 1B59A 1FOKA 1ZAOA 3GZ5A 2FSWA 4M73A 4EJTA 2QLZA 3RPQA 4KA4A 4ESBA 1O7LA 3COAC 1K79A 2PMUA 4RS8A 2GA1A 1YW7A 2RGVA 4P96A 1T6SA 4BAYA 1XDUA 3PQJA 3DV8A 4IJAA 3V7CA 2E1CA 4GGGA 1TNSA 4A5MA 1KU9A 4OMZA 1BIBA 2CO5A 3HIFA 2M8EA 3R0JA 1IZ1A 4WF2A 4I01A 2FE3A 4YG2F 2NRAC 4HZFA 4AD9A 2QQAA 1H9GA 2LSOA 1YFHA 4G7OF 2QM3A 2ELHA 3K9TA 3LAJA 4IRIA 1OKRA 4S05A 5DCMB 2DU9A 1T98A 4G94A 2VT2A 2P5KA 3L2CA 1FT9A 2CYYA 4UVAA 2VBZA 1ZGJA 3U2RA 2FQ3A 4M9SA 1TNTA 1I1GA 1FBQA 1S3JA 1HKQA 2UXNA 3RPUA 1LDDA 3FXQA 5FLXZ 4KMUX 1LJ9A 1MGTA 2Z5UA 1L0OC 2L02A 3K0LA 1CF7B 3H92A 4KIGA 3E3VA 3WG9A 3V8JA 5DUKA 2R3SA 5ICGA 1HXDA 3KP6A 1U5TC 1SFUA 3HHHA 3ELKA 2ISZA 4XLPF 1RI7A 3GEZA 1LB2A 3HTSB 1J7KA 1KQ0A 4YFNF 1YLFA 1W7PD 1E17A 2CGPA 2MH9A 1K78B 5EEHA 1F1ZA 1BC7C 2PLYA 2RNJA 3GVAA 5IT9Z 3LQRA 3J7AO 3R6SA 5A2QZ 4RAYA 1GVJA 2HYGD 4UUVA 3HRMA 1EH8A 3V7RA 5BPDA 1FC3A 1ULYA 2PFBA 2ZCWA 4A12A 3G73A 1MJ9A 1S6LA 3HRSA 4Y13A 2FMLA 3FMQA 4MNUA 2MLGA 2HDCA 4CYDA 2IA2A 2Z9OA
chains in the Genus database with same CATH superfamily
2LD5A 2DA3A 2KIFA 4HBLA 1MBHA 3M7GA 1W5SA 4HX4A 4WX9A 2O5RA 4ZYEA 2BW3A 2F5FA 5CQGA 2DN0A 1OCRH 1PP7U 3RTRA 5BNGA 3DF8A 2JMWA 3HRUA 3KYCB 2Z3YA 3D5SC 4AUXA 3I64A 1S5LC 4KMFA 1Y6IA 2ZXJA 1X4PA 4XRMA 2FA5A 1FTZA 1TQPA 2CFOA 4PFOA 3F72A 2DK5A 1P4WA 3RPUD 2EIMH 2CWEA 1VQPI 2CSOA 5EZHA 1LFPA 2F2EA 4EM0B 4L5IA 2VLAA 2JUCA 1FEXA 1J75A 2VOPA 3E6DA 3KFWX 1WH5A 3E6MA 4DBRA 1TC3C 2IS4A 2ZO4A 2M0CA 1SAUA 3DPLC 3JRHA 4L0YB 4YIFA 3SZTA 2UV1A 2E7WA 2X1DA 2FF4A 2OBPA 3GFLA 3GW2A 3KP3A 4BUPA 1XGOA 2A6HF 3C2HA 3FMRA 4FT8A 3V8KA 1PYVA 2XRLA 3PUBA 4IQJA 5F27A 4F52A 2JRMA 1ETKA 4D5CA 1KU7A 1ODDA 2JT1A 2L4AA 4UUSA 3CMAI 3ZPLA 3DFGA 4FISA 2KT0A 2LMDA 5M5WJ 3QPTA 1WGXA 3DLLF 1TWCJ 3QYEA 1I27A 3J7ZI 2Q0OA 4LG0A 1ETYA 2A61A 1MMGA 3CCSI 5HDNA 1Z7UA 2H8RA 2DO7A 3ZQGA 1V55H 2TCTA 3WTUC 2M3AA 5E17F 2WA0A 2XVCA 1ZELA 4OOIA 4XLHA 5H20A 4GFBA 2LKXA 4PGHA 2V7FA 2QCOA 4HLXA 3E6CC 2A68F 2E35A 5KAIC 3DLAA 3CLQA 1HDDC 2VBYA 5FFZA 5H6QA 3KLNA 1D3YA 3F0CA 2KZGA 4CYCA 1KONA 1U9OA 3I0TA 4GCVA 1AU7A 3AKZA 1DU0A 3AG3H 2JJ7A 1DUXC 3R60A 2MBFA 4QPQA 3KCCA 1X1CA 2QENA 2K3FA 2E2HJ 3MKLA 4G6QA 3EUAA 5EF6A 2OZUA 1PVEA 2EZKA 5TJJA 2R7VA 4BXFA 3CMEI 2XC7A 3M4OJ 2CH0A 5L3FA 1VQ5I 1NTCA 3CCRI 1YS6A 2LG4A 3JRBA 4BS9A 2GQQA 5EYRA 2VKDA 2OCCH 5KVRA 2CW8A 1FIAA 1YX3A 2RV8A 1IXCA 3H5AA 5CVUA 2FX0A 4MTDA 3HB9A 5CKTA 2ZNYA 4C9YA 4BY7J 1R1TA 2UZKA 1UZCA 2PJPA 2HOAA 4UV9A 4HLYA 2L7KA 3HDDA 2WY7Q 4XLEA 5F0CA 2LBFB 5C44J 3HOZJ 2Q2EA 4BDYA 4IOAF 1I5ZA 1TQIA 2DFIA 2HQAA 3GFIA 4JX6A 2CRGA 4A3GJ 5L3GA 3VSLA 5JLWA 4FHTA 2F48A 1WJBA 2GXBA 2LF7A 5F1JA 4ENNA 3BQYA 1AHDP 5ILUA 3EYIA 3J7YJ 3GYHX 2EPFA 3I58A 1P92A 3FXRA 3WU0A 3CCEI 4PUSA 1J5YA 5E20A 2E71A 2HDWA 4R8HA 1XB4A 1K61A 2XGXA 2QKLB 5JVTA 2KFDA 2FNAA 3FXUA 3HYIA 5DEQA 1QQIA 2DA1A 4RB1A 4XIDA 2O7OA 4AM3A 4YELA 1PUFB 9ANTA 3D1NI 2QBYB 1OR7A 3V4GA 3VOEA 1VQ7I 3TP0A 1R1VA 3ZR8X 3MZYA 1OR7C 5D5XB 2X1CA 3BR5A 4QWQA 3VYUB 1DPUA 1J2XA 3QPLA 1FZPB 3OL3A 1R1UA 3TOAA 2D1VA 2LDUA 5J8CA 3IKVA 1IUFA 3CUOA 3HEFA 1ACIA 1HW2A 2FD5A 1YHQI 1D8JA 4UHTA 3TGNA 1U9NA 1VQNI 2V1XA 2LF8A 2M4GA 5FROA 4B8XA 5E18F 3BPXA 1N78A 4M3FA 1HOMA 1UB9A 1X2NA 4HW0A 4LMYA 2N8GA 3FHZA 2QSHX 3BG3A 1QA6A 4MEYF 1A6QA 3FMSA 3CCVI 3LSIA 3QU6A 4EJVA 2M30A 1RUNA 3SHFA 4RB2C 3ZN0A 4BJ6C 2CQKA 2X48A 3GX4X 1PDNC 2OJED 5DCFA 2HPIA 2G7UA 4BQAA 4CCMA 2BVLA 3I59B 4MFEA 4HF0A 3TO7A 3OMYA 3HUGA 3C2BA 2XAGA 4XLNF 1IG7A 4JX4A 3CLOA 1APLC 2HOSA 4ZDLA 3BLYA 3PSFA 4P5OA 3RSNA 3ZGKA 2DA4A 2EFWA 2HPMA 4XSXF 3OIPA 2STTA 1SD4A 4B3XA 3DEUA 3K70C 1DGRM 1YS7A 1G3SA 5BPIA 3T8TA 2EIKH 5IYDJ 5L3CA 2F5EA 1S72I 3A0HC 3Q9SA 3FK7A 3LSPA 2LRDA 4KJZA 3BDDA 1RC9A 2X85A 4G9YA 5IPAA 1P4XA 1J09A 1B72B 1X3UA 2M34A 3WTZA 1E3OC 3IH3A 2KPMA 5M5XJ 1USTA 2DA2A 3BOQA 4ANJA 5EGOB 1WI3A 5J40A 5BQTA 1W7PB 2O8XA 1LNWA 2AHQA 5D4SA 2ZJRF 5ED4A 1R5ID 2O61A 4HX8A 1N75A 2R5YA 3M8FA 2NS0A 5GPAA 2LTPA 1R4MB 4GO1A 3ZCOA 1Y0UA 2HS5A 5L3BA 4RGUA 1H0MA 3H5RA 1EH7A 3KLOA 1BN5A 2Y30A 2P7CB 3BWGA 5HODA 3WU1B 4M6YA 1ZRFA 2ME0A 2JSCA 3H0DA 4OMYA 4XNFA 2RDPA 3JR9A 4FETA 3F8CA 1CGPA 1OLTA 2QUFA 4XLAA 2EK5A 1G59A 3VYRB 1XPXA 1R00A 1IV6A 2ZFUA 2XPVA 2EV5A 3BTIA 3FKIJ 2GM4A 3NWTA 1JUMA 2UXXA 1HKTA 1MBGA 3PNYA 3OYJA 2DQRA 1T2KA 2EWNA 3KP2A 4U87A 1SFXA 2OC6A 3RZDJ 4E7SA 4RDUA 4BBSJ 1LEBA 2DPDA 2Q8KA 1QBJA 3KIOA 3GO5A 2A07F 3SYTA 1GHCA 3FX3A 2STWA 4IRGA 1OCOH 2IA0A 1YTYA 4X6AJ 1IRFA 2R7OA 3GLXA 4N9HA 3ZMTA 2KL4A 3VFZA 2QQBA 2KJBA 2YX7A 2CW0F 3FXMA 2VT3A 4MFDA 1D1CA 1EV7A 2W85A 5HLTA 4L9VA 2NS7A 1V5GA 4A0XA 4B1RA 4IQ4A 1XMAA 3GUDA 4UB8C 5CVJA 3HOYJ 1LQ1A 1B8IA 2KZVA 2OZ6A 4Q4ZF 5IY5H 3OSFA 3BT9A 3CP8A 4ON0A 3GF2A 4F55A 5HLGA 2BE5F 2L2OA 5ICFA 2R7SA 3CF5F 4I02A 2IJLA 3EUKL 3L00A 2L01A 4YRVA 3GTLJ 1RNLA 2IGKA 5JHUA 3CCMI 1OCZH 4IOCF 3TEDA 1BR2A 3KP7A 4HX7A 2D2WA 3G4SI 1QZYA 3AAFA 1HA8A 4NUBA 5J1YA 2K9QA 2EBIA 2HKXA 3KYDB 1JHFA 1JI8A 3E5QA 1R6RA 4D0PA 1K83J 2XHKA 4XKWA 4BU2A 2IGNA 3OS0A 5TRDA 1Y8QB 3K4KA 2WB1A 3SZGA 3CUQB 1WI9A 3ZN1A 4CZCA 5E79C 2X9DA 3AG1H 2HOTA 4I7HA 2EQRA 4CO8A 2YU3A 3Q3SA 1MNDA 3OL4A 1ENHA 1P9QC 1NK3P 2XGDA 4HNUA 4Y52J 1V54H 2DLLA 2Y9ZA 3WTXC 3J81Z 3HPHA 4CSWA 2IA1A 2VXDA 4M6XA 3GFJA 3OY9A 2L9RA 2VC1A 1XD7A 2YUSA 3O8GA 2BY0A 2H94A 3U21A 1T8IA 1W5TA 4EV0A 2DW4A 1X58A 4RBOA 2EFQA 2O9LA 2A05A 1Z9CA 3LSJA 1XSXA 2KLOA 2TDXA 2V4JC 5EJCA 3PSIA 1IRZA 3ULQB 3D5RC 2ZMEC 1WJEA 2DBBA 2VQCA 5CYVA 4BEHA 1IXRC 3K69A 3WTVC 2DOFA 2G9WA 3RI4A 1XCBA 4DYCA 4LK0F 3L2QA 3E1SA 2ISYA 1LUJB 2XF6A 4OWRB 3RQ4A 4ZZLA 2UWMA 3KEOA 1HSJA 2R5ZB 2CQQA 5B1BH 2DMUA 2V9VA 3GBGA 2L7ZA 3HPGA 2ZXIA 2LREA 1VQ8I 3C2GA 2PX9A 4NBQA 4LJZF 4EM1A 3HGYA 2EIJH 3L1PA 5LHHA 1FOXA 2WB1N 1UJ8A 5M3MJ 3WTTC 2XASA 3FM5A 5FLVA 2Y0SN 4B44A 2R7FA 3OOPA 2E60A 3C3WA 3BG5A 4KFCA 2IVMA 4BXXJ 2VONA 4Y33A 2IW5A 2XUBA 3NARA 5DYMA 3EUHA 5E1ZB 4CA0A 5LEKA 5LHGA 3EUHC 3CESA 3MQ0A 3WGGA 4BE0A 1O3QA 3GWZA 4I98B 2VBXA 3HXLA 2HNHA 4XBFA 4DZPA 1ZG5A 4PCQA 2CQNA 3K4BA 3R61A 1KYWA 2R7QA 1WJ5A 3HJEA 3MMYB 3PIOF 2BW3B 2IP2A 2P5LC 1D5YA 4XORA 3K2AA 1FNNA 3HC7A 2M2EA 5BOXA 1SFOJ 2LC2A 1TT5B 3CC2I 1I1SA 4XONA 3W6VA 4ZYGA 5FLMJ 3WE3A 2G0EA 5F6FA 1AWCA 3FK6A 4J00A 1OPCA 3LAPA 1EKEA 4KT5C 3ZQQA 3OYFA 4YEJA 4IHSA 2X51A 3U1DA 3I3LA 3BR0A 3P9IA 1SFEA 4I2OA 5FKOA 1NHAA 2GOMA 1D1BA 3NWSA 4WXCA 1U5TA 2QYOA 3M3YJ 2FRHA 3RIRA 4CUGA 1DP7P 1WJAA 2VKEA 3F8BA 2GZWA 2HFHA 2K40A 1Y8RB 2JPBA 2AS5F 3BZCA 3I4PA 4V19K 3S3OA 1UG2A 1SD6A 5CJ9A 5EDNA 1JE8A 2BYVE 3P9KA 4UUSB 2LR8A 1YIOA 3CP2A 3OYBA 1VQ4I 2X6YA 1JGGA 2EA2A 3I4MJ 2MD0A 3W2VA 1LPQA 4L5EA 4ZC3A 3BZKA 5GAEJ 4FTHA 5K1YA 2AXTC 1RR8C 4MEXF 3NRVA 4XK4A 1CQTA 2Y9YA 3RJPA 3A03A 4P9FA 3QOPA 2IEKA 3BROA 3CDLA 1XMKA 5HDKA 5AIQA 2CV2A 2XROA 5GAHJ 4G8XA 3ZXSA 1QO0D 2E1MC 1Y39A 3FXOA 5HDGA 3EDPA 3HRTA 1O3TA 4XICA 1STZA 3CC4I 1WJCA 4CICA 1ZK8A 4UNOA 4CYCB 2FUG2 4EATA 1T08B 2JA2A 2LKPA 1RETA 1Y1VJ 3ERED 4KISA 5AIPA 2OA4A 3F22A 3MN2A 1IF1A 1YJWI 3DCFA 3H3ZA 3QP6A 2KRCA 5HOOA 5EEAA 4XN3A 3H36A 2MW8A 1WQ2A 2DT5A 5C3EJ 1ETXA 3OYEA 4KIBA 4WK8F 3DU6A 1USSA 2PJRA 1BI0A 3OIQA 3QWLA 2ZJQF 1R4NB 3V8LA 1YRNB 3GLLA 1IRGA 2IPQX 4ENJA 4EVIA 1D8KA 1S9HA 1WRJA 2WV1A 3CC7I 1YE9A 1N25A 1GT0C 3LSKA 4LB5A 1MKMA 1HF0A 2YPRA 1V5EA 3HL2A 4C3IJ 3E5UA 2K4JA 2XKPA 1MBJA 4N4OB 4PJMA 4DQ2A 3S2HJ 1RRJA 2EZIA 1O3SA 5DCMA 5E3LA 1VQKI 4DBQA 1HDPA 4E7KA 3VEPA 3I55I 3QOEA 2JQ7A 2NNYA 4A3DJ 1QZZA 1P7IA 4ETSA 1QGPA 1AKHA 3DKWA 4N9IA 3RKXA 1GV5A 4PZJA 4QLCU 4I09A 3GTKJ 1IAWA 3UR3C 3Q9VA 4XR6A 3HOXJ 2E19A 3QODA 2XAQA 4WCGA 1IN7A 2DOAA 3Q0VA 4HSTA 3JRGA 5JLXA 1HCRA 1FTTA 1X1AA 4L9TA 3W2WA 4XKBA 3RYRA 1P2FA 1MDMB 4EQQA 1TWHJ 2BHZA 2VE8A 1TQMA 3FWEA 1IN6A 2P6TA 2H6CA 5KHDA 1WSUA 3IV5A 3GXOA 3IH2A 2LFBA 3S2WA 3OYKA 4M9XA 2RREA 3OYAA 4L5JA 2KRHA 1QVUA 4FE7A 4DYQA 1R5GA 3A0BC 3S1NJ 1YQAA 3DPUA 3UNGC 2JPCA 4FE4A 4FQGA 4O5VA 3LNQA 3LA2A 4V2GA 3OWTA 1SAXA 3QYFA 3DP7A 2DMNA 4AWXB 4EEFG 1VQOI 2MD5A 2R7DA 3QU3A 2EA4A 4B09A 2DQLA 2JWTA 5IYBJ 3JRIA 4NQWA 3CCQI 4IF4A 4YFXF 2P5VA 1T0FA 2W24A 2VI6A 4M3GA 1BIAA 1T0FC 4K2EA 5DDGA 4PFPA 1S8NA 1UAAA 2JA7J 1IRXA 1S7AA 1IC8A 4EJWA 1FBUA 3QP5A 1PUEE 4PSXA 4ZJZA 2DPUA 4XM3A 2E2JJ 2NVQJ 2M8GX 2MLKA 3EYYA 3RYPA 2DDBA 3HUGB 3B02A 5J1UA 2FEZA 4RM2A 3TDZC 1IDZA 1K78A 2HTJA 1YIJI 5EZGA 1BR4A 2DK8A 2WBMA 1RESA 2KIMA 1FLIA 2HQ5A 1ETQA 3BR6A 5F0HA 2BBYA 3FXJA 5GTIC 1VQ9I 4FX4A 3TO9A 2QQ8A 2E1OA 3S17J 3I54A 1O57A 3SXYA 2RC4A 2VB6A 2HWVA 3WTSC 1SFKA 2ZBKA 5B5EC 1T38A 4E6KG 1SVMA 2EFPA 4BE2A 2W57A 3LSTA 3SZPA 2IT0A 1A5JA 1GDTA 2KJCA 3LL7A 2HR3A 1J0RA 2K86A 1BI1A 3MCZA 2OTLI 2FOWA 1O4XA 2W48A 1XDSA 1D1AA 1S29A 3CJRB 1BC8C 3ML6A 3JRCA 2M7AA 1ZRDA 1B6AA 2QWWA 2VQHA 2DYRH 3R0AA 3PUFA 2ETHA 2LKSA 2NVXJ 5D5UB 4UVCA 3C7JA 3IAS2 3RDIA 4B4CA 1IUYA 2Y0MA 2BGCA 2E5ZA 2OQRA 4CHUA 1TBXA 2ID6A 3AL0C 3S1MJ 3JAMZ 3F21A 2VC0A 3WTWC 3ABLH 1YW8A 2HVQA 2NXNB 3EQLF 4EGYA 3M8JA 3SDGA 5ILSA 3CMMA 2EJRA 1RIOH 1SMTA 3V7SA 4CGZA 2NVTJ 2DMQA 4HQEA 1REPC 3M07A 3SDBA 1MW7A 1LEAA 3FHNA 3LSRA 1DDNA 2L54A 3S8PA 1OCPA 1EA3A 1HW5A 3ZMUA 2GXAA 3OS1A 2DFEA 3M8EA 1A36A 1XGSA 2D1HA 4U0VA 5LRSA 5LD2C 2CUEA 2F5DA 2K5CA 3BTLA 1W4MA 4D7NA 1KU3A 3CTAA 1VI0A 1KQ9A 5CVIA 1MMSA 4UV8A 1ETVA 5K7HA 1I50J 1UELB 5LRRA 2KIUA 3PO2J 4WWCA 2VODA 4RM3A 1XGNA 3CCYA 2JA6J 4JQFA 2QSGX 2HOEA 2L0KA 4BE1A 3G2BA 2V6EA 1HBXG 1D0XA 5F08A 2NVUB 1W5CC 2BEOA 3AG2H 5FGMA 3IKTA 3K1MA 1L3LA 1IV8A 2ACJA 5DD4A 2R0QC 4MQVA 1FX7A 3RQIA 1QPIA 4UUTA 2HU9A 3P9CA 3BJAA 1TW2A 2D45A 5FRMA 4JOMA 2JZYA 1B4AA 2HZDA 3RKQA 3DPTA 4DW6A 4DYRA 2QEXI 2NAZA 3F8FA 4XKCA 4IHWA 3LA3A 2H8WA 1BI2A 4IPAA 4YIIA 3HOUJ 2NVYJ 2HQRA 5M5YJ 1QNTA 2KDOA 4IL6C 5E8IA 4JBAA 4A6DA 5KK1A 2MSYA 3DU5A 4H0EA 4ZH4F 2VUMJ 1JXSA 2A5YB 4KUMA 2CFXA 3HGGA 5CVRA 3O3KA 2CS3A 3IRRA 4IZZA 2NOGA 2P81A 3HHGA 1DQUA 4Q47A 1J59A 2QQ9A 5E3NA 2WY8Q 5HS9A 1BJAA 3DEWA 5TISC 3DTEA 3T8RA 1VQMI 1F43A 5CVVA 2QF7A 2GXGA 1KA8A 2B7EA 2MFZA 2QA4I 3ASOH 3T1BA 1ZN2A 2EB7A 5J3LA 2E5NA 2XB0X 3LSMA 2R7WA 3ZQLA 4W97A 2X0LA 2Y2ZA 4OIOF 5J4VA 1VFCA 1I39A 1IN4A 5LBQA 2E36A 2LY9A 2XIGA 3WU2C 4FCYA 4I6ZA 1LDKB 1OMIA 5D8KB 3K10A 4B3AA 3WGIA 3OYGA 4HV5A 1KGSA 4OINF 4MHGA 1U0JA 3DBLB 3M1CA 2EFNA 1FY7A 1FP2A 4LLGF 1IXSB 3QQAA 4M72A 1YJNI 2MG4A 3F6OA 5K7ZA 2DTZA 2GWRA 4BY1J 3I71A 2XKOA 3IAM2 4A3KJ 4Y17A 3OYNA 4HRIA 1ZLKA 4DZJA 4DJAA 2IXSA 5HVQC 5H6RA 3F8MA 2OF7A 5LGTA 3ABKH 5HLHA 3FBNB 4U88A 1F36A 2HYJA 4JK1X 5E1WA 4YFKF 1OJLA 2HEOA 1T39A 3S1RJ 1UHMA 3HSEA 2FQ4A 4PJNA 2HDDA 5FKMA 3OV8A 4I76A 4HYEA 4Q5SF 2O03A 2X6XA 4B47A 1XC5A 3ZMVA 1EH6A 4CXFA 3S15J 4CCOA 2M45A 1OYYA 1X1PA 5GP9A 2YSRA 5K5OA 2P6SA 3G1MA 4PGGA 5CQEA 3VPRA 3WGHA 1JT6A 5LLQA 2H1KA 2A6TA 2K4BA 3CZ6A 4TV7A 1J9IA 5JHFA 3BR1A 4BBRJ 4GYIA 3PM1A 2XAHA 1ZLJA 4MLOA 2KIQA 3HOTA 5IP7J 1BR1A 5L3EA 2DT6A 4DGWB 4DOZA 3T5XA 4E4HA 4N0BA 4XMYA 4BDZA 2EZLA 5FB2A 2B0LA 3P7NA 4IRHA 3ZQ7A 1W36C 2YX4A 3HSFA 4A0YA 2ZJPF 5EEGA 3KYLA 2VN2A 2QBYA 4A2UA 4CCJA 3JSOA 3MAJA 1ZKGA 2KRFA 3ECOA 3I5UA 4R1HA 2COMA 4IKFA 3LWFA 2DJNA 3A02A 4ZYHA 3E6BA 2Y75A 3K4NA 4U0WA 3JTHA 4Y3OA 3ZMDA 4FX0A 1FBSA 4RGXA 2ID3A 3H3UA 1OCCH 4A93J 2CUZA 4PDKA 2VKHA 3DEEA 3BZ6A 3NQOA 3ZRGA 1FOYA 2X6OA 3F8NA 2PBIA 3FBIB 5HLIA 2XPUA 4XQFA 1ONVA 3L2RA 3ZQFA 3F3XA 5BS6A 2VJIA 1YJ9I 3FZVA 2IGMA 3K6GA 5F1RA 1MZBA 5IOZA 1U5TB 3KX2A 1P7JA 4Z2YA 2XGEA 4A3FJ 4D7MA 2HGCA 3K70D 5H2FC 2H09A 4UXNA 2VKVA 3VB2A 2PMZA 3J80K 2Y0SA 4OIRF 3N4MA 2IS1A 2E34A 2BZTA 2JVGA 4G6DA 2Z16A 1K7AA 2ZXHA 1VQLI 3HKZA 4IHTA 2L5QA 4BHBA 3ROUA 2BY3A 1FSHA 1X3ZB 2HQNA 2OAZA 4HNTA 5D6EA 1O3RA 2HXIA 2M4KA 4XSZF 4A5NA 5FRNA 2Z1DA 4IHYA 1MMDA 4LLNA 2ZSHB 2COBA 3HBLA 4B43A 3JSPA 4O3MA 3MZHA 4CCLA 3TKYA 1HKSA 2LH9A 2AO9A 2F5CA 2OD5A 3L7WA 1WCMJ 4L0ZB 4HAMA 1Z7LA 3VDXA 2DDAA 2L7FP 5JR3A 2IAIA 2ZMEA 3QRFF 4NNJA 1W7PA 4KDPA 1HW1A 1YG2A 3TOBA 2CV1A 2JTVA 5BMZA 1FSEA 1DGWY 4ITVA 1RKTA 4LOCA 2OQGA 2Q1ZB 1U6GA 5FFXA 2ZB9A 4HOBA 4EM2A 2K9LA 1GXPA 1ZYRF 2IBDA 3D5LA 4LIUA 1H8AC 1DU6A 1E3PA 1UFMA 4KN4X 1DPRA 1FWZA 1OQYA 4Y15A 2VASA 3TQNA 3IWFA 4ZDPA 4U0YA 2PI0A 4A3JJ 1JJ8C 2JSPA 1X19A 4RLFA 4LB6B 1JKOC 3ONQA 2LOOA 1EJ9A 5ICCA 5D5VB 2CV0A 1Q1HA 3OS2A 3H5NA 5LGNA 1MD0A 3CCUI 3CJTB 5IOYA 2HVRA 3U1KA 1DP3A 5FKNA 3IP4B 3CJQB 4M9ZA 2PMZN 2F6CA 4NC7A 3BG7A 2R7TA 2RKHA 5DTDA 2DCEA 6PAXA 3DQVC 3A01A 4C30A 1F4KA 2ELKA 2PJRB 2EFOA 2VBWA 3LFKA 3HKZN 3R4KA 3H9JA 2R4GA 4ENMA 3GCMA 2P8TA 2QKMB 2CQXA 3HOVJ 1TW3A 1ZHFA 3OR1C 1OYWA 1RR7A 3H35A 3MZ8A 3JW4A 1Z6TA 1E3HA 2ZNZA 3LQQA 3GZ6A 1FMVA 2W25A 4LFUA 4UVBA 3TBIA 1R5HA 1SD7A 4IXAA 3D0SA 1IJWC 1TZLA 2LVSA 4HF2A 4ZYAA 1PJRA 1Z91A 5FKLA 4LK1F 4P55A 1XGMA 1FOWA 2ZFWA 1Z1DA 4NHJA 1Z3YA 2DODA 3L9FA 3BJ6A 1WZ2A 2L4MA 2VJ5A 1VTNC 4E7JA 1P6RA 2O6GE 1UMQA 1XTAA 2OU2A 2HVSA 2GAUA 1A6IA 1R23A 1V5FA 4BQNA 2H27A 2M1BA 2M87A 1R9TJ 4G6TB 4DNCA 3G1LA 1TT0A 2A5WA 4XL9A 1BL0A 3CD6I 3GTOJ 3S3MA 2H6BA 2MC3A 2ESHA 4D5FA 2L7MP 1Y56A 4IO9F 4ESFA 4M6VA 2W7NA 2HYFA 3CF2A 4RB3C 3KZYA 3OYLA 4BNCA 4KICA 4XRFA 1ZREA 3ESWB 3NAUA 3E0JB 2RNGA 2M5WA 2NS8A 3FXLA 4HEA2 3NEUA 4OIQF 4RAZA 1Z21A 4F93B 1BW6A 3J81K 4GRIA 4NC6A 1QU3A 5D6FA 3CMYA 4LG0B 1MH3A 2O8KA 2OCEA 2XRNA 2EV0A 1U2WA 2TRTA 3B6CA 4S04A 1ETOA 2A6EF 3CUQA 1U8RA 1LDJA 4RLQA 3CUQC 5JFRA 3N05A 4UB6C 5FD5A 1B1BA 1IN5A 4Y4RA 5HS8A 2A3SA 5B1AH 1OFCX 3JREA 3G1OA 4F7ZA 5E3OA 1ITYA 1TWAJ 3Q0WA 3WODF 3MFKA 1MNEA 4KN7X 3S93A 3ABTA 4A3BJ 2DTRA 4ZTJA 1YYVA 5D8LB 1BOAA 4LLLA 1OYIA 4DIQA 1SMYF 2K85A 5DV5A 3Q0UA 1ZH5A 5IYCJ 2VE9A 1JGSA 3KP4A 4RA2A 1I3QJ 3K2ZA 1R58A 1GXQA 3QPSA 1VF9A 3DTIA 1OCTC 1MBEA 3DKYA 4KYWA 4EJOA 4MQ9F 3VODA 3L2WA 4KT6A 2ECBA 5DM7F 2X6WA 1ZR4A 2W84A 3P5JA 1BM9A 4IVNA 3JRAA 3H9GA 4M3DA 3GTGJ 1IO2A 3SEZA 1GV2A 2R7UA 2J5OA 4ZZDA 4AC0A 2DXIA 2CUJA 2F4OB 3PQKA 2DA6A 3W3CA 1VNDA 1W0TA 4X1EA 2MA3A 3REOA 4KNYA 5EG0A 4N4NB 4BJ5C 4G7HF 5L3DA 3CJNA 5GAGJ 2H1LA 2RAEA 1R36A 2R5ZA 3HOSA 1G4DA 4LGWA 1QVTA 4E7ZA 1WPKA 1A04A 2PEXA 3OYDA 1LE8A 2HKOA 3KEYA 5J8FA 1BA5A 4AVPA 1IGNA 1QPMA 3MVPA 4OIPF 1ZRCA 2L3DA 2O0YA 1R71A 1D0YA 2Q2EB 2PG4A 2GA2A 5FLXK 4AIKA 3ZMSA 4HDVA 2WAQA 1K4SA 3HSRA 1FP1D 1HSTA 5B66C 5LGUA 1KYZA 4HNVA 1YITI 3G6EI 1D0ZA 3JTGA 5AONA 1K6YA 4CDGA 5E8GA 2MC4A 1WKMA 1G3TA 1ZG3A 3CDHA 2XF5A 4EJUA 4F91B 4EGZA 3BQZA 1R22A 2DT7B 4HF1A 1MJBA 4C2TA 4FASD 4I0BA 2BV6A 3DXJF 4GXOA 3IWZA 2V79A 3CDIA 5JI6A 3ISPA 2KQRA 2MYSA 4L18B 1ETWA 1FYKA 1BJZA 3PL8A 1LFBA 1MSFC 3TW7A 3K1PA 3L2UA 2R7XA 4MTEA 1N77A 4Y7NJ 3GZNB 4L9JA 3K1NA 5GADJ 3CO7C 2EV6A 1QRYA 5KCMA 4R79A 1V3FA 2PN6A 2ADUA 2UUZA 3G3ZA 3X2QH 4U7BA 1MBFA 1BI3A 2A69F 4AIJA 1XSVA 4NB5A 2WADA 1W1WE 1CF7A 1E2XA 4O6JA 4CH7A 2JVHA 4ENKA 4G7ZF 3L2VA 2CU7A 1HC8A 1RUOA 3QYBA 3CO6C 2ECCA 3M9AA 1POGA 1WWXA 2LP0A 3KZZA 1ON2A 1FPQA 4A3EJ 3ERMA 2CMPA 1TLHB 3PNTA 5CLSA 3MWMA 5K5QA 2P7VB 1FIPA 5DUIA 3LSHA 1WH7A 3PNVA 3KP5A 5IT9K 2XDVA 1ZGAA 2CW7A 1IW7F 2XGCA 1JUPA 2NNNA 2BHYA 2IS2A 5A2QK 2WAQN 4P1WA 1QHHD 1I6XA 4MGRA 3BTJA 1SVLA 2GOXB 2OV7A 4JX5A 2XAFA 3K7AJ 4AIDA 2BOLA 3BR3A 1K6OA 4QPOA 4AVZA 2EH3A 3K4JA 1U78A 2FNPA 3I4NJ 4HG2A 4KITB 2CJJA 4UY8I 2E7XA 2O3FA 3FM3A 3IHUA 3OR2C 2HTSA 4HSRA 3CQZJ 3ZP5A 1FYMA 4Z6YA 3HTUA 3RCOA 1MH4A 4YIRX 1YI2I 1ORKA 1MJAA 4Q48A 3LSGA 5HS7A 1K4TA 4E7IA 3I9V2 2FBIA 2I5UA 1PP8F 2ESNA 5KNLA 1XMXA 1JT0A 3WTYC 1X1DA 2ZKZA 3VWBA 2OUMA 3DBRB 1RZ4A 2W00A 5F0FA 1C0WA 2DI3A 5E1XA 3L09A 3FF5A 4E70A 4A3MJ 1JKQC 5D4RA 2RN7A 3KETA 4QIWN 1JTXA 1O7FA 2R5YB 2V26A 2R93J 5HNHA 1YW9A 1WFXA 3BJOA 2X4HA 2QSFX 4V2FA 4ASNA 3LFUA 2GBYA 2K02A 4F92B 2FBHA 2G7HA 4BL0B 1FYLA 5TGTA 4A69C 1XCVA 5J4YA 2IRFG 3DBHB 1YRNA 2FJ1A 4II3A 2P4WA 4RB0A 2M0MA 2VPLA 3MKWB 1GUUA 4BH9A 4A3IJ 2F4IA 3ZMZA 3W6JB 4M74A 2AXLA 3FDYA 5DD8A 2FOKA 4A6EA 4A0ZA 3QAHA 1WJDA 4BACA 1ZQ3P 3TO6A 1HQCA 2PMHA 2KISA 4U7DA 2RVCA 1FMWA 1B9NA 3ZQHA 3ZOBA 2CG4A 1KQ8A 3A2KA 2J5PA 4BQQA 2IGOA 2YU9J 1ZG1A 2YR2A 3KEQA 2XAUA 2LNBA 3S14J 3BY6A 2E1NA 1UHWA 3HOWJ 1GVDA 1ERDA 1R7JA 3O2PE 4RGRA 5K7FA 2HXOA 2B63J 2IS6A 3OYMA 2V6CA 2I8DA 1MDMA 1SD5A 2ELJA 3BP8A 3IRQA 1Y1WJ 2EZHA 1G2HA 2Z99A 2K27A 2HI3A 2W82A 3PJRA 1Z05A 2YS9A 4BHPA 4LD5A 1B8IB 4HQMA 4C2MJ 5D5WB 1JTYA 1B9MA 1IN8A 4D9JA 1Q1VA 1IDYA 1YOVB 1A35A 3OYCA 3GMEA 4BJTA 1XSDA 3O6BB 3SFZA 2K3PA 4C2UA 2VL8A 2Z2SB 1R49A 2XSJC 3F23A 2WV0A 4GYGA 1HLVA 3QPHA 2Y48A 4LIVA 3WE2A 1P4AA 3RKYA 5GPCA 3B73A 3H0GJ 2VQGA 4WXDA 2CUFA 2VXZA 4RAGA 2Y69H 5E3MA 2L9SA 1W0UA 4ZYDA 2PQ8A 3BCBA 4M3EA 2W4SA 3BCAA 2V1DA 3WG7H 5FO5A 5J6XA 1SEUA 1NK2P 4ESJA 1XN7A 4XLFA 1JHHA 4RAFA 4ZDOA 5C4XJ 4E7LA 1GLNA 2V1NA 2AQEA 5K5RA 2KKOA 3IC7A 2ZJ2A 3LA7A 4KIFA 1G3WA 1H89C 2QZ8A 3N97A 3E5XA 3FIWA 3A4CA 4WXHA 3W6KB 1SVOA 3KE2A 1Z0XA 5FD6A 1TWFJ 1H9TA 2XAJA 3BPVA 1UCRA 5ILVA 4HV6A 4GDFA 2P0WA 2MGQA 4ABZA 3J7AY 3J80Z 1F5TA 2K9SA 4JYKA 3SQNA 3TW6A 5DS9A 3CCLI 3PIPF 2VJJA 3RZOJ 3JAMK 1JJ6C 2ZMEB 2FBKA 5J47A 1Z6RA 3PFYA 1X3WB 2WWYA 1KU2A 3HZJA 3K4CA 2JA5J 2V1UA 1X1BA 3FXKA 3TDUC 4BEHB 2WC2A 1Z77A 2RQQA 4I0AA 2E2IJ 3JCUC 4XOTA 1ZTRA 5ERIA 2K7LA 2HZTA 4L9NA 3MKYB 1EF4A 2LBFA 1VQ6I 1T33A 3Q5FA 1G6NA 1XG1A 2WAEA 2QVOA 3EETA 4AIHA 2XV4S 4D1QA 4HA8A 2Y31A 4IEJA 4QTRA 2RQPA 2Z33A 4HDUA 4AYBA 5LHIA 3IUOA 2AQFA 1MMAA 3F6VA 1F9NA 3ZQIA 3B6AA 2JRTA 3C1DA 3WHCA 3U9GA 3DKXA 3IL2A 1TL8A 1LFUP 3KPHA 2XSDC 3I53A 3C18A 2C6YA 3RKWA 1LVAA 3A01B 1U8BA 4PJLA 1NG7A 2XB5A 3TMOA 3SEQA 4OU0A 1U3EM 1PUFA 2VOOA 5ICEA 1BW5A 4QSHA 3UKGA 1BBYA 1BOBA 1ZARA 4IHVA 1G3YA 1A31A 1D5VA 2BVMA 2FMYA 3FKJA 1E0EA 3MD2A 1S7OA 1X2MA 3OOUA 4A3CJ 4CCNA 3ECHA 3MEXA 3WHBA 1TTYA 4JP0A 2JN6A 2VIXA 1AOYA 1RPWA 3EPZA 3ASNH 5B3SH 1NG6A 3GFMA 5CPRB 4M71A 3T0YA 3ABUA 2F5VA 2L9NA 1ZGWA 2NYXA 5GTHC 3E97A 2K9MA 1JUSA 2VJ4A 2XPWA 5IT3A 3I56I 1XX5A 4EMSA 2FXAA 4B48A 1XS9A 2GIVA 4P9UA 2ZXWH 3HM5A 1RKWA 1H88C 1I3AA 1V4RA 3AFHA 2BY2A 2WTEA 4OAZA 4BHCA 4BYYA 3DTKA 1T95A 2MH2A 4RGSA 4BXUA 4RMNA 4CZZA 1YO5C 3M1EA 2DAOA 2DFHA 2KP6A 3I59A 4XKVA 1LKXA 1ON1A 4PJJA 1NH3A 2OTJI 4M3BA 3PFIA 4AYBN 4PSWA 5LEJA 2DMPA 2FU4A 5F64A 1B59A 3DWLE 1FOKA 1ZAOA 1T56A 2R92J 1M1EB 2FSWA 3GZ5A 4M73A 3FISA 4C3JJ 3GTQJ 4EJTA 2BXYA 5F04A 2QLZA 4X0GA 2ICWG 2R7RA 4LG3A 2K9NA 3SFIA 3RPQA 2VPRA 2ME6A 3W2AA 2DFFA 4KA4A 4ESBA 3VSKA 2BY1A 1O7LA 4J01A 3COAC 1B72A 1Z67A 3K4LA 1K79A 2PMUA 3OSGA 4RS8A 2GA1A 2VQLA 2LLKA 4AU7A 1YW7A 5EGOA 2RGVA 4XRSG 5FJ8J 2V9PA 4P96A 2E1MB 3A1YA 4F3QA 1T6SA 2JK3A 2MABA 3IH4A 3V42A 2LY2A 4BAYA 2ZSIB 3ZQCA 1XDUA 3BG9A 4II2A 3PQJA 3BG6A 3DV8A 3S2DJ 4IJAA 1QHGA 3V7CA 2E1CA 3JRFA 3JRDA 2DYSH 3S3NA 4GGGA 3VYTB 1TNSA 3K4MA 3H9QA 4A5MA 2B9SA 1KU9A 4OMZA 1BIBA 2V9KA 2CO5A 3SJMA 1VZ0A 3HIFA 2M8EA 3R0JA 1IZ1A 4WF2A 5EG0B 4I01A 2GIZA 2FE3A 4A3LJ 4YG2F 2KDZA 2XF7A 2NRAC 4HZFA 4AD9A 2QQAA 1KZHA 1H9GA 2LSOA 2DJIA 1YFHA 1JKPC 4G7OF 2QM3A 2OPTA 2ELHA 3K9TA 4XRSA 3MKZA 3LAJA 1LE8B 1MBKA 4XLCA 5JVGF 4IRIA 1W36D 1AA7A 1OKRA 4S05A 4G12A 2L9VA 5DCMB 1MNMC 2GLOA 2DA7A 2DU9A 4S0HB 4BKXA 2WAFA 1T98A 4G94A 2D5VA 4BQOA 4E7HA 1ZR2A 2VT2A 4I99C 3H1CA 4IX7A 4CCKA 2M7BA 2P5KA 3L2CA 1FT9A 2CYYA 4J19A 5HNFA 1AKHB 1LVKA 4C3HJ 2DOEA 2I10A 2DMTA 3TL4X 4UVAA 2VBZA 1ZGJA 3U2RA 2FQ3A 4M9SA 4W1UA 1TNTA 1I1GA 1FBQA 1S3JA 5IP6A 3TP3A 3G71I 1HKQA 2UXNA 3RPUA 1LDDA 1Y0NA 3FXQA 5FLXZ 1WJFA 4KMUX 1LJ9A 2JUGA 4IHXA 3LMMA 5C4JJ 2X1EA 1MGTA 2KHMA 2Z5UA 2W1OA 1L0OC 1S7EA 2L02A 3K0LA 1CF7B 3H92A 3CCJI 3F9KA 1YX5A 3GTMJ 1MIJA 4MO7A 4OAYA 4KIGA 3E3VA 1WHUA 3S16J 3WG9A 1QZEA 5DUKA 2R3SA 3V8JA 4BGDA 5ICGA 1HXDA 4PJ0C 2EILH 4HPQA 3KP6A 1U5TC 3LOCA 2EINH 3KZIC 5KAFC 3OYIA 3VYSB 4NQWB 1SFUA 3HHHA 3PO3J 4XOPA 3S1QJ 1WVRA 3ELKA 5LFAA 2ISZA 3HG9A 4H4KC 4XLPF 1RI7A 3GEZA 3GTPJ 1LB2A 3HTSB 1J7KA 1KQ0A 3GTJJ 4YFNF 5J1RA 1YLFA 1W7PD 3H3VK 3O8HA 1E17A 2F4MB 1I6HJ 2LK2A 2CGPA 4LITA 2MH9A 1K78B 1SC7A 1MSEC 2KMUA 5EEHA 3BC8A 1F1ZA 1TWGJ 1BC7C 2PLYA 2BXZA 2RNJA 3GVAA 5IT9Z 5DM6F 3LQRA 3J7AO 3S32A 3R6SA 4XN0A 3E7LA 5A2QZ 4RAYA 1GVJA 4ZTFA 2HYGD 2CQ7A 5FKKA 3OIOA 5IP9J 4UUVA 1JKRC 1TP4A 1SANA 2LYCA 2ZC2A 1UHSA 5M3FJ 3HRMA 1EH8A 1G8XA 3V7RA 2LY1A 3AG4H 5BPDA 3OYHA 1FC3A 1ULYA 2PFBA 4NDLA 1X4OA 4PK4A 2ZCWA 1UG0A 4A12A 3G73A 1MJ9A 1S6LA 2NOJB 2QGUA 2M9HA 3HRSA 4MIMA 4NC8A 4Y13A 1FJLA 2FMLA 3FMQA 3AL0B 2JA8J 2R7ZJ 1MMNA 2DA5A 4MNUA 2MLGA 2HDCA 3ABMH 4CYDA 1OISA 2IA2A 3BR2A 1Z3XA 3BTCA 2Z9OA
chains in the Genus database with same CATH topology
2KIFA 4HBLA 3M7GA 1W5SA 4HX4A 4WX9A 4ZYEA 2F5FA 1PP7U 3RTRA 3DF8A 3HRUA 2Z3YA 4KMFA 3I64A 2ZXJA 2FA5A 1TQPA 3F72A 2DK5A 1P4WA 2CWEA 2CSOA 2F2EA 4EM0B 4L5IA 1J75A 2VOPA 3E6DA 3KFWX 3E6MA 2ZO4A 3DPLC 4L0YB 4YIFA 3SZTA 2E7WA 3GW2A 2FF4A 2OBPA 3GFLA 3KP3A 1XGOA 2A6HF 3FMRA 4FT8A 3V8KA 1KU7A 1ODDA 2JT1A 2L4AA 3ZPLA 3DFGA 3QPTA 1I27A 2Q0OA 4LG0A 2A61A 5HDNA 1Z7UA 2DO7A 3WTUC 5E17F 2XVCA 4OOIA 5H20A 4PGHA 4HLXA 3E6CC 2A68F 2VBYA 5FFZA 5H6QA 3KLNA 1D3YA 3I0TA 4GCVA 1DUXC 3R60A 2MBFA 3KCCA 2QENA 4G6QA 2OZUA 5TJJA 5L3FA 1YS6A 2GQQA 5KVRA 2RV8A 1IXCA 5CVUA 4MTDA 2ZNYA 1R1TA 2UZKA 2PJPA 4UV9A 4HLYA 2Q2EA 1I5ZA 1TQIA 2DFIA 3GFIA 5L3GA 4FHTA 2GXBA 2LF7A 4ENNA 5ILUA 3EYIA 3GYHX 3I58A 3WU0A 1P92A 3FXRA 1J5YA 5E20A 4R8HA 1XB4A 2XGXA 5JVTA 2FNAA 3FXUA 3HYIA 5DEQA 1QQIA 4RB1A 2QBYB 1OR7A 3V4GA 3VOEA 1R1VA 3MZYA 5D5XB 4QWQA 1DPUA 1J2XA 1FZPB 3TOAA 1R1UA 2D1VA 2LDUA 5J8CA 3IKVA 3CUOA 1HW2A 1D8JA 4UHTA 3TGNA 2V1XA 2LF8A 4B8XA 5E18F 3BPXA 1UB9A 4HW0A 4LMYA 3FHZA 4MEYF 3FMSA 3QU6A 4EJVA 2M30A 1RUNA 3SHFA 4RB2C 3ZN0A 2CQKA 3GX4X 1PDNC 5DCFA 2G7UA 4BQAA 3I59B 4HF0A 3TO7A 3HUGA 2XAGA 4XLNF 3CLOA 4P5OA 2EFWA 4XSXF 2STTA 1SD4A 3DEUA 1YS7A 1G3SA 5BPIA 3T8TA 5L3CA 2F5EA 3Q9SA 3BDDA 4G9YA 1P4XA 1X3UA 3WTZA 1USTA 3BOQA 5BQTA 1W7PB 2O8XA 1LNWA 5D4SA 5ED4A 2O61A 4HX8A 3M8FA 2NS0A 4GO1A 1Y0UA 2HS5A 5L3BA 4RGUA 1H0MA 1EH7A 3KLOA 1BN5A 2P7CB 3BWGA 3WU1B 4M6YA 1ZRFA 2JSCA 4OMYA 2RDPA 3F8CA 1CGPA 2QUFA 2EK5A 1R00A 2EV5A 2UXXA 1HKTA 2DQRA 1T2KA 2EWNA 3KP2A 1SFXA 1LEBA 2DPDA 2Q8KA 1QBJA 2A07F 3GO5A 1GHCA 3FX3A 2STWA 4IRGA 2IA0A 1YTYA 1IRFA 3GLXA 4N9HA 3ZMTA 3VFZA 2QQBA 2KJBA 2YX7A 2CW0F 2VT3A 1EV7A 2W85A 4L9VA 4A0XA 1XMAA 3GUDA 5CVJA 1LQ1A 2OZ6A 4Q4ZF 4ON0A 5HLGA 3GF2A 2BE5F 5ICFA 4I02A 2IJLA 3L00A 2L01A 1RNLA 5JHUA 3KP7A 4HX7A 2D2WA 1QZYA 3AAFA 2HKXA 1JHFA 3E5QA 4D0PA 2XHKA 5TRDA 3CUQB 1WI9A 3ZN1A 4I7HA 4CO8A 2YU3A 2DLLA 3WTXC 3J81Z 2IA1A 4M6XA 3GFJA 2VC1A 1XD7A 2H94A 1W5TA 4EV0A 2DW4A 2EFQA 1Z9CA 1XSXA 2TDXA 3ULQB 2DBBA 5CYVA 1IXRC 3K69A 3WTVC 2G9WA 3RI4A 1XCBA 4LK0F 2ISYA 4ZZLA 2UWMA 3KEOA 1HSJA 2V9VA 4LJZF 4EM1A 5LHHA 3WTTC 2XASA 3FM5A 2R7FA 3OOPA 3C3WA 4KFCA 2IVMA 2VONA 2IW5A 2XUBA 5DYMA 5E1ZB 3EUHA 5LEKA 5LHGA 3MQ0A 3WGGA 1O3QA 3GWZA 4I98B 2VBXA 4XBFA 1ZG5A 4PCQA 3R61A 1KYWA 2P5LC 2IP2A 1FNNA 5BOXA 1I1SA 4ZYGA 3WE3A 5F6FA 1AWCA 1OPCA 3LAPA 4KT5C 4IHSA 3U1DA 3P9IA 1SFEA 4I2OA 1NHAA 4WXCA 1U5TA 2QYOA 2FRHA 3RIRA 1DP7P 3F8BA 2GZWA 2HFHA 2JPBA 2AS5F 3I4PA 1SD6A 5CJ9A 1JE8A 2BYVE 3P9KA 1YIOA 2EA2A 5K1YA 4MEXF 3NRVA 3RJPA 4P9FA 3QOPA 3BROA 1XMKA 5HDKA 5AIQA 2XROA 4G8XA 1QO0D 5HDGA 3EDPA 3HRTA 1O3TA 1STZA 4CICA 4UNOA 2LKPA 3ERED 5AIPA 2OA4A 3F22A 1IF1A 3H3ZA 3QP6A 5HOOA 1WQ2A 2DT5A 4KIBA 4WK8F 1USSA 1BI0A 3V8LA 1IRGA 2IPQX 4ENJA 4EVIA 1D8KA 1WRJA 4LB5A 1MKMA 2YPRA 4DQ2A 3E5UA 2K4JA 2XKPA 1O3SA 5DCMA 3VEPA 2NNYA 1QZZA 4ETSA 1QGPA 3DKWA 4N9IA 3RKXA 4PZJA 4QLCU 4I09A 1IAWA 3Q9VA 2XAQA 4WCGA 1IN7A 4L9TA 3RYRA 1P2FA 1MDMB 4EQQA 1WSUA 2VE8A 1TQMA 3FWEA 1IN6A 2P6TA 2H6CA 3GXOA 3S2WA 4M9XA 4L5JA 1R5GA 1YQAA 2JPCA 4O5VA 3LA2A 1SAXA 3DP7A 4AWXB 2MD5A 2R7DA 3QU3A 2EA4A 4B09A 2DQLA 4NQWA 4IF4A 4YFXF 2P5VA 1T0FA 2W24A 1BIAA 4K2EA 5DDGA 1S8NA 1S7AA 4EJWA 1FBUA 3QP5A 1PUEE 2DPUA 2MLKA 3EYYA 3RYPA 3B02A 2FEZA 3TDZC 1K78A 2HTJA 2DK8A 2KIMA 1FLIA 2BBYA 4FX4A 3TO9A 3I54A 1O57A 3SXYA 2RC4A 2HWVA 3WTSC 2ZBKA 1T38A 2EFPA 2W57A 3LSTA 3SZPA 2IT0A 2KJCA 2HR3A 1J0RA 2K86A 1BI1A 3MCZA 1XDSA 1BC8C 1S29A 3ML6A 1ZRDA 1B6AA 2QWWA 3R0AA 2ETHA 5D5UB 4UVCA 3C7JA 3RDIA 1IUYA 2Y0MA 2BGCA 2OQRA 4CHUA 1TBXA 3JAMZ 3F21A 2VC0A 3WTWC 1YW8A 3EQLF 4EGYA 5ILSA 2EJRA 1RIOH 1SMTA 3V7SA 4CGZA 4HQEA 1REPC 1LEAA 1DDNA 2L54A 1HW5A 3ZMUA 3M8EA 1XGSA 2D1HA 4U0VA 5LRSA 2F5DA 1W4MA 1KU3A 3CTAA 1KQ9A 5CVIA 4UV8A 5LRRA 2KIUA 4WWCA 2VODA 1XGNA 4JQFA 2HOEA 1HBXG 2BEOA 5FGMA 3IKTA 1L3LA 3K1MA 2ACJA 5DD4A 4MQVA 1FX7A 3P9CA 3BJAA 1TW2A 2D45A 2JZYA 1B4AA 3DPTA 2NAZA 3F8FA 3LA3A 1BI2A 4IPAA 4YIIA 2HQRA 1QNTA 5E8IA 4JBAA 4A6DA 5KK1A 4H0EA 4ZH4F 1JXSA 2A5YB 4KUMA 2CFXA 5CVRA 3O3KA 3IRRA 3HHGA 4Q47A 1J59A 2QQ9A 5HS9A 1BJAA 3T8RA 5CVVA 2GXGA 1KA8A 3T1BA 1ZN2A 2EB7A 2X0LA 4OIOF 1IN4A 5LBQA 2XIGA 1LDKB 1OMIA 5D8KB 3WGIA 4HV5A 1KGSA 4OINF 4MHGA 2EFNA 1FY7A 1FP2A 4LLGF 1IXSB 4M72A 3F6OA 2GWRA 3I71A 2XKOA 4Y17A 1ZLKA 5HVQC 5H6RA 3F8MA 5LGTA 5HLHA 4U88A 4JK1X 5E1WA 4YFKF 2HEOA 1T39A 1UHMA 3HSEA 3OV8A 4HYEA 4Q5SF 2O03A 3ZMVA 1EH6A 4CXFA 2M45A 1OYYA 2YSRA 5K5OA 2P6SA 4PGGA 3WGHA 5LLQA 2K4BA 4TV7A 1J9IA 4GYIA 2XAHA 1ZLJA 3HOTA 5L3EA 3T5XA 4N0BA 5FB2A 2B0LA 3P7NA 4IRHA 3ZQ7A 2YX4A 3HSFA 4A0YA 5EEGA 2VN2A 2QBYA 4A2UA 3JSOA 3MAJA 2KRFA 3ECOA 3I5UA 4R1HA 2COMA 3LWFA 4ZYHA 3E6BA 2Y75A 4U0WA 3JTHA 3ZMDA 4FX0A 1FBSA 4RGXA 3H3UA 4PDKA 3BZ6A 3NQOA 3F8NA 2PBIA 5HLIA 1ONVA 3F3XA 5BS6A 3FZVA 5F1RA 1MZBA 1U5TB 4Z2YA 2HGCA 2H09A 4UXNA 3VB2A 3J80K 4OIRF 3N4MA 4G6DA 1K7AA 4IHTA 4BHBA 3ROUA 1FSHA 2HQNA 2OAZA 5D6EA 1O3RA 4XSZF 4A5NA 4LLNA 3JSPA 4O3MA 3MZHA 3TKYA 1HKSA 2F5CA 2OD5A 3L7WA 4L0ZB 4HAMA 5JR3A 2ZMEA 3QRFF 1W7PA 4KDPA 1HW1A 1YG2A 3TOBA 2JTVA 5BMZA 1FSEA 2OQGA 1U6GA 5FFXA 4HOBA 4EM2A 1GXPA 1ZYRF 3D5LA 1UFMA 4KN4X 1DPRA 1FWZA 4Y15A 3TQNA 3IWFA 4U0YA 2PI0A 4LB6B 5ICCA 5D5VB 1Q1HA 5LGNA 1MD0A 4M9ZA 2RKHA 6PAXA 3DQVC 1F4KA 2EFOA 2VBWA 3LFKA 3R4KA 4ENMA 2P8TA 1TW3A 1ZHFA 1OYWA 3JW4A 1Z6TA 3LQQA 2ZNZA 3GZ6A 2W25A 4LFUA 4UVBA 1R5HA 1SD7A 4IXAA 3D0SA 4HF2A 1Z91A 4LK1F 4P55A 1XGMA 2ZFWA 1Z1DA 4NHJA 3L9FA 3BJ6A 2L4MA 1VTNC 1P6RA 2O6GE 2OU2A 2GAUA 1R23A 2H27A 2M1BA 2M87A 4DNCA 2H6BA 2MC3A 2ESHA 4ESFA 2HYFA 4RB3C 3KZYA 4BNCA 4KICA 4XRFA 1ZREA 2M5WA 3NEUA 4OIQF 4RAZA 3J81K 5D6FA 4LG0B 2EV0A 2XRNA 1U2WA 4S04A 3CUQA 2A6EF 1U8RA 1LDJA 3CUQC 5JFRA 5FD5A 1B1BA 1IN5A 5HS8A 2A3SA 4F7ZA 3WODF 3MFKA 4KN7X 3ABTA 2DTRA 1YYVA 5D8LB 1BOAA 4LLLA 1OYIA 1SMYF 5DV5A 1ZH5A 2VE9A 1JGSA 3KP4A 3K2ZA 1R58A 1GXQA 4KYWA 4EJOA 4MQ9F 3VODA 2W84A 1BM9A 4IVNA 2J5OA 4ZZDA 3PQKA 2MA3A 3REOA 4KNYA 4G7HF 5L3DA 3CJNA 1R36A 3HOSA 1G4DA 4LGWA 1A04A 2PEXA 2HKOA 5J8FA 4AVPA 1QPMA 4OIPF 1ZRCA 2L3DA 2O0YA 2PG4A 2GA2A 5FLXK 4AIKA 3ZMSA 4HDVA 3HSRA 1FP1D 1HSTA 5LGUA 1KYZA 3JTGA 5AONA 4CDGA 5E8GA 1WKMA 1G3TA 1ZG3A 3CDHA 4EJUA 4EGZA 1R22A 4HF1A 1MJBA 4I0BA 2BV6A 3DXJF 4GXOA 3IWZA 2V79A 5JI6A 3ISPA 4L18B 1FYKA 3K1PA 4MTEA 4L9JA 3K1NA 3CO7C 2EV6A 4R79A 1V3FA 2PN6A 2ADUA 3G3ZA 4U7BA 1BI3A 4AIJA 2A69F 1XSVA 4NB5A 1CF7A 1E2XA 4O6JA 4ENKA 4G7ZF 1RUOA 3CO6C 3M9AA 1WWXA 3KZZA 1ON2A 1FPQA 1TLHB 5CLSA 3MWMA 5K5QA 2P7VB 5DUIA 3KP5A 5IT9K 1ZGAA 1IW7F 2NNNA 5A2QK 1I6XA 4MGRA 2XAFA 1K6OA 1U78A 2FNPA 2E7XA 2O3FA 3FM3A 3IHUA 2HTSA 3ZP5A 1FYMA 3HTUA 1MJAA 4Q48A 5HS7A 2FBIA 1PP8F 2ESNA 3WTYC 2ZKZA 1RZ4A 1C0WA 2DI3A 5E1XA 3L09A 3FF5A 4E70A 5D4RA 2RN7A 3KETA 1O7FA 1YW9A 3BJOA 2X4HA 4ASNA 2K02A 2FBHA 2G7HA 1FYLA 1XCVA 2IRFG 2P4WA 4RB0A 4BH9A 3ZMZA 3W6JB 4M74A 2AXLA 5DD8A 2FOKA 4A6EA 4A0ZA 3QAHA 3TO6A 1HQCA 2PMHA 4U7DA 2RVCA 1B9NA 2CG4A 1KQ8A 2J5PA 1ZG1A 2YR2A 3KEQA 2LNBA 3BY6A 2E1NA 1UHWA 1R7JA 3O2PE 4RGRA 2V6CA 1MDMA 1SD5A 3BP8A 3IRQA 2Z99A 2K27A 1Z05A 4BHPA 4LD5A 4HQMA 5D5WB 1B9MA 1IN8A 1XSDA 3O6BB 3SFZA 3F23A 2WV0A 4GYGA 3QPHA 2Y48A 3WE2A 1P4AA 3RKYA 3B73A 4WXDA 2VXZA 4ZYDA 2PQ8A 2V1DA 5FO5A 5J6XA 4ESJA 1XN7A 1JHHA 5K5RA 2KKOA 3IC7A 2ZJ2A 3LA7A 4KIFA 1G3WA 2QZ8A 3N97A 3E5XA 4WXHA 5FD6A 3W6KB 3KE2A 1H9TA 2XAJA 3BPVA 1UCRA 5ILVA 4HV6A 3J80Z 1F5TA 3SQNA 3JAMK 2ZMEB 2FBKA 1Z6RA 2WWYA 1KU2A 2V1UA 3TDUC 2WC2A 4I0AA 5ERIA 2K7LA 2HZTA 4L9NA 3Q5FA 1G6NA 2QVOA 3EETA 4AIHA 2XV4S 4HA8A 2RQPA 2Z33A 4HDUA 5LHIA 3F6VA 1F9NA 2JRTA 3C1DA 3U9GA 3IL2A 3I53A 3C18A 2C6YA 3RKWA 1LVAA 4OU0A 1U3EM 2VOOA 5ICEA 1BBYA 1ZARA 1G3YA 1D5VA 2FMYA 1S7OA 3ECHA 3MEXA 1TTYA 1AOYA 3GFMA 4M71A 3T0YA 3ABUA 2NYXA 3E97A 5IT3A 4EMSA 2FXAA 2GIVA 4P9UA 1V4RA 2WTEA 4BHCA 4BYYA 2MH2A 4RGSA 4BXUA 4CZZA 1YO5C 3M1EA 2DAOA 3I59A 1ON1A 3PFIA 5LEJA 2FU4A 5F64A 1B59A 1FOKA 1ZAOA 3GZ5A 2FSWA 4M73A 4EJTA 2QLZA 3RPQA 4KA4A 4ESBA 1O7LA 3COAC 1K79A 2PMUA 4RS8A 2GA1A 1YW7A 2RGVA 4P96A 1T6SA 4BAYA 1XDUA 3PQJA 3DV8A 4IJAA 3V7CA 2E1CA 4GGGA 1TNSA 4A5MA 1KU9A 4OMZA 1BIBA 2CO5A 3HIFA 2M8EA 3R0JA 1IZ1A 4WF2A 4I01A 2FE3A 4YG2F 2NRAC 4HZFA 4AD9A 2QQAA 1H9GA 2LSOA 1YFHA 4G7OF 2QM3A 2ELHA 3K9TA 3LAJA 4IRIA 1OKRA 4S05A 5DCMB 2DU9A 1T98A 4G94A 2VT2A 2P5KA 3L2CA 1FT9A 2CYYA 4UVAA 2VBZA 1ZGJA 3U2RA 2FQ3A 4M9SA 1TNTA 1I1GA 1FBQA 1S3JA 1HKQA 2UXNA 3RPUA 1LDDA 3FXQA 5FLXZ 4KMUX 1LJ9A 1MGTA 2Z5UA 1L0OC 2L02A 3K0LA 1CF7B 3H92A 4KIGA 3E3VA 3WG9A 3V8JA 5DUKA 2R3SA 5ICGA 1HXDA 3KP6A 1U5TC 1SFUA 3HHHA 3ELKA 2ISZA 4XLPF 1RI7A 3GEZA 1LB2A 3HTSB 1J7KA 1KQ0A 4YFNF 1YLFA 1W7PD 1E17A 2CGPA 2MH9A 1K78B 5EEHA 1F1ZA 1BC7C 2PLYA 2RNJA 3GVAA 5IT9Z 3LQRA 3J7AO 3R6SA 5A2QZ 4RAYA 1GVJA 2HYGD 4UUVA 3HRMA 1EH8A 3V7RA 5BPDA 1FC3A 1ULYA 2PFBA 2ZCWA 4A12A 3G73A 1MJ9A 1S6LA 3HRSA 4Y13A 2FMLA 3FMQA 4MNUA 2MLGA 2HDCA 4CYDA 2IA2A 2Z9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIF A;  4HBL A;  3M7G A;  1W5S A;  4HX4 A;  4WX9 A;  4ZYE A;  2F5F A;  1PP7 U;  3RTR A;  3DF8 A;  3HRU A;  2Z3Y A;  4KMF A;  3I64 A;  2ZXJ A;  2FA5 A;  1TQP A;  3F72 A;  2DK5 A;  1P4W A;  2CWE A;  2CSO A;  2F2E A;  4EM0 B;  4L5I A;  1J75 A;  2VOP A;  3E6D A;  3KFW X;  3E6M A;  2ZO4 A;  3DPL C;  4L0Y B;  4YIF A;  3SZT A;  2E7W A;  3GW2 A;  2FF4 A;  2OBP A;  3GFL A;  3KP3 A;  1XGO A;  2A6H F;  3FMR A;  4FT8 A;  3V8K A;  1KU7 A;  1ODD A;  2JT1 A;  2L4A A;  3ZPL A;  3DFG A;  3QPT A;  1I27 A;  2Q0O A;  4LG0 A;  2A61 A;  5HDN A;  1Z7U A;  2DO7 A;  3WTU C;  5E17 F;  2XVC A;  4OOI A;  5H20 A;  4PGH A;  4HLX A;  3E6C C;  2A68 F;  2VBY A;  5FFZ A;  5H6Q A;  3KLN A;  1D3Y A;  3I0T A;  4GCV A;  1DUX C;  3R60 A;  2MBF A;  3KCC A;  2QEN A;  4G6Q A;  2OZU A;  5TJJ A;  5L3F A;  1YS6 A;  2GQQ A;  5KVR A;  2RV8 A;  1IXC A;  5CVU A;  4MTD A;  2ZNY A;  1R1T A;  2UZK A;  2PJP A;  4UV9 A;  4HLY A;  2Q2E A;  1I5Z A;  1TQI A;  2DFI A;  3GFI A;  5L3G A;  4FHT A;  2GXB A;  2LF7 A;  4ENN A;  5ILU A;  3EYI A;  3GYH X;  3I58 A;  3WU0 A;  1P92 A;  3FXR A;  1J5Y A;  5E20 A;  4R8H A;  1XB4 A;  2XGX A;  5JVT A;  2FNA A;  3FXU A;  3HYI A;  5DEQ A;  1QQI A;  4RB1 A;  2QBY B;  1OR7 A;  3V4G A;  3VOE A;  1R1V A;  3MZY A;  5D5X B;  4QWQ A;  1DPU A;  1J2X A;  1FZP B;  3TOA A;  1R1U A;  2D1V A;  2LDU A;  5J8C A;  3IKV A;  3CUO A;  1HW2 A;  1D8J A;  4UHT A;  3TGN A;  2V1X A;  2LF8 A;  4B8X A;  5E18 F;  3BPX A;  1UB9 A;  4HW0 A;  4LMY A;  3FHZ A;  4MEY F;  3FMS A;  3QU6 A;  4EJV A;  2M30 A;  1RUN A;  3SHF A;  4RB2 C;  3ZN0 A;  2CQK A;  3GX4 X;  1PDN C;  5DCF A;  2G7U A;  4BQA A;  3I59 B;  4HF0 A;  3TO7 A;  3HUG A;  2XAG A;  4XLN F;  3CLO A;  4P5O A;  2EFW A;  4XSX F;  2STT A;  1SD4 A;  3DEU A;  1YS7 A;  1G3S A;  5BPI A;  3T8T A;  5L3C A;  2F5E A;  3Q9S A;  3BDD A;  4G9Y A;  1P4X A;  1X3U A;  3WTZ A;  1UST A;  3BOQ A;  5BQT A;  1W7P B;  2O8X A;  1LNW A;  5D4S A;  5ED4 A;  2O61 A;  4HX8 A;  3M8F A;  2NS0 A;  4GO1 A;  1Y0U A;  2HS5 A;  5L3B A;  4RGU A;  1H0M A;  1EH7 A;  3KLO A;  1BN5 A;  2P7C B;  3BWG A;  3WU1 B;  4M6Y A;  1ZRF A;  2JSC A;  4OMY A;  2RDP A;  3F8C A;  1CGP A;  2QUF A;  2EK5 A;  1R00 A;  2EV5 A;  2UXX A;  1HKT A;  2DQR A;  1T2K A;  2EWN A;  3KP2 A;  1SFX A;  1LEB A;  2DPD A;  2Q8K A;  1QBJ A;  2A07 F;  3GO5 A;  1GHC A;  3FX3 A;  2STW A;  4IRG A;  2IA0 A;  1YTY A;  1IRF A;  3GLX A;  4N9H A;  3ZMT A;  3VFZ A;  2QQB A;  2KJB A;  2YX7 A;  2CW0 F;  2VT3 A;  1EV7 A;  2W85 A;  4L9V A;  4A0X A;  1XMA A;  3GUD A;  5CVJ A;  1LQ1 A;  2OZ6 A;  4Q4Z F;  4ON0 A;  5HLG A;  3GF2 A;  2BE5 F;  5ICF A;  4I02 A;  2IJL A;  3L00 A;  2L01 A;  1RNL A;  5JHU A;  3KP7 A;  4HX7 A;  2D2W A;  1QZY A;  3AAF A;  2HKX A;  1JHF A;  3E5Q A;  4D0P A;  2XHK A;  5TRD A;  3CUQ B;  1WI9 A;  3ZN1 A;  4I7H A;  4CO8 A;  2YU3 A;  2DLL A;  3WTX C;  3J81 Z;  2IA1 A;  4M6X A;  3GFJ A;  2VC1 A;  1XD7 A;  2H94 A;  1W5T A;  4EV0 A;  2DW4 A;  2EFQ A;  1Z9C A;  1XSX A;  2TDX A;  3ULQ B;  2DBB A;  5CYV A;  1IXR C;  3K69 A;  3WTV C;  2G9W A;  3RI4 A;  1XCB A;  4LK0 F;  2ISY A;  4ZZL A;  2UWM A;  3KEO A;  1HSJ A;  2V9V A;  4LJZ F;  4EM1 A;  5LHH A;  3WTT C;  2XAS A;  3FM5 A;  2R7F A;  3OOP A;  3C3W A;  4KFC A;  2IVM A;  2VON A;  2IW5 A;  2XUB A;  5DYM A;  5E1Z B;  3EUH A;  5LEK A;  5LHG A;  3MQ0 A;  3WGG A;  1O3Q A;  3GWZ A;  4I98 B;  2VBX A;  4XBF A;  1ZG5 A;  4PCQ A;  3R61 A;  1KYW A;  2P5L C;  2IP2 A;  1FNN A;  5BOX A;  1I1S A;  4ZYG A;  3WE3 A;  5F6F A;  1AWC A;  1OPC A;  3LAP A;  4KT5 C;  4IHS A;  3U1D A;  3P9I A;  1SFE A;  4I2O A;  1NHA A;  4WXC A;  1U5T A;  2QYO A;  2FRH A;  3RIR A;  1DP7 P;  3F8B A;  2GZW A;  2HFH A;  2JPB A;  2AS5 F;  3I4P A;  1SD6 A;  5CJ9 A;  1JE8 A;  2BYV E;  3P9K A;  1YIO A;  2EA2 A;  5K1Y A;  4MEX F;  3NRV A;  3RJP A;  4P9F A;  3QOP A;  3BRO A;  1XMK A;  5HDK A;  5AIQ A;  2XRO A;  4G8X A;  1QO0 D;  5HDG A;  3EDP A;  3HRT A;  1O3T A;  1STZ A;  4CIC A;  4UNO A;  2LKP A;  3ERE D;  5AIP A;  2OA4 A;  3F22 A;  1IF1 A;  3H3Z A;  3QP6 A;  5HOO A;  1WQ2 A;  2DT5 A;  4KIB A;  4WK8 F;  1USS A;  1BI0 A;  3V8L A;  1IRG A;  2IPQ X;  4ENJ A;  4EVI A;  1D8K A;  1WRJ A;  4LB5 A;  1MKM A;  2YPR A;  4DQ2 A;  3E5U A;  2K4J A;  2XKP A;  1O3S A;  5DCM A;  3VEP A;  2NNY A;  1QZZ A;  4ETS A;  1QGP A;  3DKW A;  4N9I A;  3RKX A;  4PZJ A;  4QLC U;  4I09 A;  1IAW A;  3Q9V A;  2XAQ A;  4WCG A;  1IN7 A;  4L9T A;  3RYR A;  1P2F A;  1MDM B;  4EQQ A;  1WSU A;  2VE8 A;  1TQM A;  3FWE A;  1IN6 A;  2P6T A;  2H6C A;  3GXO A;  3S2W A;  4M9X A;  4L5J A;  1R5G A;  1YQA A;  2JPC A;  4O5V A;  3LA2 A;  1SAX A;  3DP7 A;  4AWX B;  2MD5 A;  2R7D A;  3QU3 A;  2EA4 A;  4B09 A;  2DQL A;  4NQW A;  4IF4 A;  4YFX F;  2P5V A;  1T0F A;  2W24 A;  1BIA A;  4K2E A;  5DDG A;  1S8N A;  1S7A A;  4EJW A;  1FBU A;  3QP5 A;  1PUE E;  2DPU A;  2MLK A;  3EYY A;  3RYP A;  3B02 A;  2FEZ A;  3TDZ C;  1K78 A;  2HTJ A;  2DK8 A;  2KIM A;  1FLI A;  2BBY A;  4FX4 A;  3TO9 A;  3I54 A;  1O57 A;  3SXY A;  2RC4 A;  2HWV A;  3WTS C;  2ZBK A;  1T38 A;  2EFP A;  2W57 A;  3LST A;  3SZP A;  2IT0 A;  2KJC A;  2HR3 A;  1J0R A;  2K86 A;  1BI1 A;  3MCZ A;  1XDS A;  1BC8 C;  1S29 A;  3ML6 A;  1ZRD A;  1B6A A;  2QWW A;  3R0A A;  2ETH A;  5D5U B;  4UVC A;  3C7J A;  3RDI A;  1IUY A;  2Y0M A;  2BGC A;  2OQR A;  4CHU A;  1TBX A;  3JAM Z;  3F21 A;  2VC0 A;  3WTW C;  1YW8 A;  3EQL F;  4EGY A;  5ILS A;  2EJR A;  1RIO H;  1SMT A;  3V7S A;  4CGZ A;  4HQE A;  1REP C;  1LEA A;  1DDN A;  2L54 A;  1HW5 A;  3ZMU A;  3M8E A;  1XGS A;  2D1H A;  4U0V A;  5LRS A;  2F5D A;  1W4M A;  1KU3 A;  3CTA A;  1KQ9 A;  5CVI A;  4UV8 A;  5LRR A;  2KIU A;  4WWC A;  2VOD A;  1XGN A;  4JQF A;  2HOE A;  1HBX G;  2BEO A;  5FGM A;  3IKT A;  1L3L A;  3K1M A;  2ACJ A;  5DD4 A;  4MQV A;  1FX7 A;  3P9C A;  3BJA A;  1TW2 A;  2D45 A;  2JZY A;  1B4A A;  3DPT A;  2NAZ A;  3F8F A;  3LA3 A;  1BI2 A;  4IPA A;  4YII A;  2HQR A;  1QNT A;  5E8I A;  4JBA A;  4A6D A;  5KK1 A;  4H0E A;  4ZH4 F;  1JXS A;  2A5Y B;  4KUM A;  2CFX A;  5CVR A;  3O3K A;  3IRR A;  3HHG A;  4Q47 A;  1J59 A;  2QQ9 A;  5HS9 A;  1BJA A;  3T8R A;  5CVV A;  2GXG A;  1KA8 A;  3T1B A;  1ZN2 A;  2EB7 A;  2X0L A;  4OIO F;  1IN4 A;  5LBQ A;  2XIG A;  1LDK B;  1OMI A;  5D8K B;  3WGI A;  4HV5 A;  1KGS A;  4OIN F;  4MHG A;  2EFN A;  1FY7 A;  1FP2 A;  4LLG F;  1IXS B;  4M72 A;  3F6O A;  2GWR A;  3I71 A;  2XKO A;  4Y17 A;  1ZLK A;  5HVQ C;  5H6R A;  3F8M A;  5LGT A;  5HLH A;  4U88 A;  4JK1 X;  5E1W A;  4YFK F;  2HEO A;  1T39 A;  1UHM A;  3HSE A;  3OV8 A;  4HYE A;  4Q5S F;  2O03 A;  3ZMV A;  1EH6 A;  4CXF A;  2M45 A;  1OYY A;  2YSR A;  5K5O A;  2P6S A;  4PGG A;  3WGH A;  5LLQ A;  2K4B A;  4TV7 A;  1J9I A;  4GYI A;  2XAH A;  1ZLJ A;  3HOT A;  5L3E A;  3T5X A;  4N0B A;  5FB2 A;  2B0L A;  3P7N A;  4IRH A;  3ZQ7 A;  2YX4 A;  3HSF A;  4A0Y A;  5EEG A;  2VN2 A;  2QBY A;  4A2U A;  3JSO A;  3MAJ A;  2KRF A;  3ECO A;  3I5U A;  4R1H A;  2COM A;  3LWF A;  4ZYH A;  3E6B A;  2Y75 A;  4U0W A;  3JTH A;  3ZMD A;  4FX0 A;  1FBS A;  4RGX A;  3H3U A;  4PDK A;  3BZ6 A;  3NQO A;  3F8N A;  2PBI A;  5HLI A;  1ONV A;  3F3X A;  5BS6 A;  3FZV A;  5F1R A;  1MZB A;  1U5T B;  4Z2Y A;  2HGC A;  2H09 A;  4UXN A;  3VB2 A;  3J80 K;  4OIR F;  3N4M A;  4G6D A;  1K7A A;  4IHT A;  4BHB A;  3ROU A;  1FSH A;  2HQN A;  2OAZ A;  5D6E A;  1O3R A;  4XSZ F;  4A5N A;  4LLN A;  3JSP A;  4O3M A;  3MZH A;  3TKY A;  1HKS A;  2F5C A;  2OD5 A;  3L7W A;  4L0Z B;  4HAM A;  5JR3 A;  2ZME A;  3QRF F;  1W7P A;  4KDP A;  1HW1 A;  1YG2 A;  3TOB A;  2JTV A;  5BMZ A;  1FSE A;  2OQG A;  1U6G A;  5FFX A;  4HOB A;  4EM2 A;  1GXP A;  1ZYR F;  3D5L A;  1UFM A;  4KN4 X;  1DPR A;  1FWZ A;  4Y15 A;  3TQN A;  3IWF A;  4U0Y A;  2PI0 A;  4LB6 B;  5ICC A;  5D5V B;  1Q1H A;  5LGN A;  1MD0 A;  4M9Z A;  2RKH A;  6PAX A;  3DQV C;  1F4K A;  2EFO A;  2VBW A;  3LFK A;  3R4K A;  4ENM A;  2P8T A;  1TW3 A;  1ZHF A;  1OYW A;  3JW4 A;  1Z6T A;  3LQQ A;  2ZNZ A;  3GZ6 A;  2W25 A;  4LFU A;  4UVB A;  1R5H A;  1SD7 A;  4IXA A;  3D0S A;  4HF2 A;  1Z91 A;  4LK1 F;  4P55 A;  1XGM A;  2ZFW A;  1Z1D A;  4NHJ A;  3L9F A;  3BJ6 A;  2L4M A;  1VTN C;  1P6R A;  2O6G E;  2OU2 A;  2GAU A;  1R23 A;  2H27 A;  2M1B A;  2M87 A;  4DNC A;  2H6B A;  2MC3 A;  2ESH A;  4ESF A;  2HYF A;  4RB3 C;  3KZY A;  4BNC A;  4KIC A;  4XRF A;  1ZRE A;  2M5W A;  3NEU A;  4OIQ F;  4RAZ A;  3J81 K;  5D6F A;  4LG0 B;  2EV0 A;  2XRN A;  1U2W A;  4S04 A;  3CUQ A;  2A6E F;  1U8R A;  1LDJ A;  3CUQ C;  5JFR A;  5FD5 A;  1B1B A;  1IN5 A;  5HS8 A;  2A3S A;  4F7Z A;  3WOD F;  3MFK A;  4KN7 X;  3ABT A;  2DTR A;  1YYV A;  5D8L B;  1BOA A;  4LLL A;  1OYI A;  1SMY F;  5DV5 A;  1ZH5 A;  2VE9 A;  1JGS A;  3KP4 A;  3K2Z A;  1R58 A;  1GXQ A;  4KYW A;  4EJO A;  4MQ9 F;  3VOD A;  2W84 A;  1BM9 A;  4IVN A;  2J5O A;  4ZZD A;  3PQK A;  2MA3 A;  3REO A;  4KNY A;  4G7H F;  5L3D A;  3CJN A;  1R36 A;  3HOS A;  1G4D A;  4LGW A;  1A04 A;  2PEX A;  2HKO A;  5J8F A;  4AVP A;  1QPM A;  4OIP F;  1ZRC A;  2L3D A;  2O0Y A;  2PG4 A;  2GA2 A;  5FLX K;  4AIK A;  3ZMS A;  4HDV A;  3HSR A;  1FP1 D;  1HST A;  5LGU A;  1KYZ A;  3JTG A;  5AON A;  4CDG A;  5E8G A;  1WKM A;  1G3T A;  1ZG3 A;  3CDH A;  4EJU A;  4EGZ A;  1R22 A;  4HF1 A;  1MJB A;  4I0B A;  2BV6 A;  3DXJ F;  4GXO A;  3IWZ A;  2V79 A;  5JI6 A;  3ISP A;  4L18 B;  1FYK A;  3K1P A;  4MTE A;  4L9J A;  3K1N A;  3CO7 C;  2EV6 A;  4R79 A;  1V3F A;  2PN6 A;  2ADU A;  3G3Z A;  4U7B A;  1BI3 A;  4AIJ A;  2A69 F;  1XSV A;  4NB5 A;  1CF7 A;  1E2X A;  4O6J A;  4ENK A;  4G7Z F;  1RUO A;  3CO6 C;  3M9A A;  1WWX A;  3KZZ A;  1ON2 A;  1FPQ A;  1TLH B;  5CLS A;  3MWM A;  5K5Q A;  2P7V B;  5DUI A;  3KP5 A;  5IT9 K;  1ZGA A;  1IW7 F;  2NNN A;  5A2Q K;  1I6X A;  4MGR A;  2XAF A;  1K6O A;  1U78 A;  2FNP A;  2E7X A;  2O3F A;  3FM3 A;  3IHU A;  2HTS A;  3ZP5 A;  1FYM A;  3HTU A;  1MJA A;  4Q48 A;  5HS7 A;  2FBI A;  1PP8 F;  2ESN A;  3WTY C;  2ZKZ A;  1RZ4 A;  1C0W A;  2DI3 A;  5E1X A;  3L09 A;  3FF5 A;  4E70 A;  5D4R A;  2RN7 A;  3KET A;  1O7F A;  1YW9 A;  3BJO A;  2X4H A;  4ASN A;  2K02 A;  2FBH A;  2G7H A;  1FYL A;  1XCV A;  2IRF G;  2P4W A;  4RB0 A;  4BH9 A;  3ZMZ A;  3W6J B;  4M74 A;  2AXL A;  5DD8 A;  2FOK A;  4A6E A;  4A0Z A;  3QAH A;  3TO6 A;  1HQC A;  2PMH A;  4U7D A;  2RVC A;  1B9N A;  2CG4 A;  1KQ8 A;  2J5P A;  1ZG1 A;  2YR2 A;  3KEQ A;  2LNB A;  3BY6 A;  2E1N A;  1UHW A;  1R7J A;  3O2P E;  4RGR A;  2V6C A;  1MDM A;  1SD5 A;  3BP8 A;  3IRQ A;  2Z99 A;  2K27 A;  1Z05 A;  4BHP A;  4LD5 A;  4HQM A;  5D5W B;  1B9M A;  1IN8 A;  1XSD A;  3O6B B;  3SFZ A;  3F23 A;  2WV0 A;  4GYG A;  3QPH A;  2Y48 A;  3WE2 A;  1P4A A;  3RKY A;  3B73 A;  4WXD A;  2VXZ A;  4ZYD A;  2PQ8 A;  2V1D A;  5FO5 A;  5J6X A;  4ESJ A;  1XN7 A;  1JHH A;  5K5R A;  2KKO A;  3IC7 A;  2ZJ2 A;  3LA7 A;  4KIF A;  1G3W A;  2QZ8 A;  3N97 A;  3E5X A;  4WXH A;  5FD6 A;  3W6K B;  3KE2 A;  1H9T A;  2XAJ A;  3BPV A;  1UCR A;  5ILV A;  4HV6 A;  3J80 Z;  1F5T A;  3SQN A;  3JAM K;  2ZME B;  2FBK A;  1Z6R A;  2WWY A;  1KU2 A;  2V1U A;  3TDU C;  2WC2 A;  4I0A A;  5ERI A;  2K7L A;  2HZT A;  4L9N A;  3Q5F A;  1G6N A;  2QVO A;  3EET A;  4AIH A;  2XV4 S;  4HA8 A;  2RQP A;  2Z33 A;  4HDU A;  5LHI A;  3F6V A;  1F9N A;  2JRT A;  3C1D A;  3U9G A;  3IL2 A;  3I53 A;  3C18 A;  2C6Y A;  3RKW A;  1LVA A;  4OU0 A;  1U3E M;  2VOO A;  5ICE A;  1BBY A;  1ZAR A;  1G3Y A;  1D5V A;  2FMY A;  1S7O A;  3ECH A;  3MEX A;  1TTY A;  1AOY A;  3GFM A;  4M71 A;  3T0Y A;  3ABU A;  2NYX A;  3E97 A;  5IT3 A;  4EMS A;  2FXA A;  2GIV A;  4P9U A;  1V4R A;  2WTE A;  4BHC A;  4BYY A;  2MH2 A;  4RGS A;  4BXU A;  4CZZ A;  1YO5 C;  3M1E A;  2DAO A;  3I59 A;  1ON1 A;  3PFI A;  5LEJ A;  2FU4 A;  5F64 A;  1B59 A;  1FOK A;  1ZAO A;  3GZ5 A;  2FSW A;  4M73 A;  4EJT A;  2QLZ A;  3RPQ A;  4KA4 A;  4ESB A;  1O7L A;  3COA C;  1K79 A;  2PMU A;  4RS8 A;  2GA1 A;  1YW7 A;  2RGV A;  4P96 A;  1T6S A;  4BAY A;  1XDU A;  3PQJ A;  3DV8 A;  4IJA A;  3V7C A;  2E1C A;  4GGG A;  1TNS A;  4A5M A;  1KU9 A;  4OMZ A;  1BIB A;  2CO5 A;  3HIF A;  2M8E A;  3R0J A;  1IZ1 A;  4WF2 A;  4I01 A;  2FE3 A;  4YG2 F;  2NRA C;  4HZF A;  4AD9 A;  2QQA A;  1H9G A;  2LSO A;  1YFH A;  4G7O F;  2QM3 A;  2ELH A;  3K9T A;  3LAJ A;  4IRI A;  1OKR A;  4S05 A;  5DCM B;  2DU9 A;  1T98 A;  4G94 A;  2VT2 A;  2P5K A;  3L2C A;  1FT9 A;  2CYY A;  4UVA A;  2VBZ A;  1ZGJ A;  3U2R A;  2FQ3 A;  4M9S A;  1TNT A;  1I1G A;  1FBQ A;  1S3J A;  1HKQ A;  2UXN A;  3RPU A;  1LDD A;  3FXQ A;  5FLX Z;  4KMU X;  1LJ9 A;  1MGT A;  2Z5U A;  1L0O C;  2L02 A;  3K0L A;  1CF7 B;  3H92 A;  4KIG A;  3E3V A;  3WG9 A;  3V8J A;  5DUK A;  2R3S A;  5ICG A;  1HXD A;  3KP6 A;  1U5T C;  1SFU A;  3HHH A;  3ELK A;  2ISZ A;  4XLP F;  1RI7 A;  3GEZ A;  1LB2 A;  3HTS B;  1J7K A;  1KQ0 A;  4YFN F;  1YLF A;  1W7P D;  1E17 A;  2CGP A;  2MH9 A;  1K78 B;  5EEH A;  1F1Z A;  1BC7 C;  2PLY A;  2RNJ A;  3GVA A;  5IT9 Z;  3LQR A;  3J7A O;  3R6S A;  5A2Q Z;  4RAY A;  1GVJ A;  2HYG D;  4UUV A;  3HRM A;  1EH8 A;  3V7R A;  5BPD A;  1FC3 A;  1ULY A;  2PFB A;  2ZCW A;  4A12 A;  3G73 A;  1MJ9 A;  1S6L A;  3HRS A;  4Y13 A;  2FML A;  3FMQ A;  4MNU A;  2MLG A;  2HDC A;  4CYD A;  2IA2 A;  2Z9O A; 
#chains in the Genus database with same CATH topology
 2LD5 A;  2DA3 A;  2KIF A;  4HBL A;  1MBH A;  3M7G A;  1W5S A;  4HX4 A;  4WX9 A;  2O5R A;  4ZYE A;  2BW3 A;  2F5F A;  5CQG A;  2DN0 A;  1OCR H;  1PP7 U;  3RTR A;  5BNG A;  3DF8 A;  2JMW A;  3HRU A;  3KYC B;  2Z3Y A;  3D5S C;  4AUX A;  3I64 A;  1S5L C;  4KMF A;  1Y6I A;  2ZXJ A;  1X4P A;  4XRM A;  2FA5 A;  1FTZ A;  1TQP A;  2CFO A;  4PFO A;  3F72 A;  2DK5 A;  1P4W A;  3RPU D;  2EIM H;  2CWE A;  1VQP I;  2CSO A;  5EZH A;  1LFP A;  2F2E A;  4EM0 B;  4L5I A;  2VLA A;  2JUC A;  1FEX A;  1J75 A;  2VOP A;  3E6D A;  3KFW X;  1WH5 A;  3E6M A;  4DBR A;  1TC3 C;  2IS4 A;  2ZO4 A;  2M0C A;  1SAU A;  3DPL C;  3JRH A;  4L0Y B;  4YIF A;  3SZT A;  2UV1 A;  2E7W A;  2X1D A;  2FF4 A;  2OBP A;  3GFL A;  3GW2 A;  3KP3 A;  4BUP A;  1XGO A;  2A6H F;  3C2H A;  3FMR A;  4FT8 A;  3V8K A;  1PYV A;  2XRL A;  3PUB A;  4IQJ A;  5F27 A;  4F52 A;  2JRM A;  1ETK A;  4D5C A;  1KU7 A;  1ODD A;  2JT1 A;  2L4A A;  4UUS A;  3CMA I;  3ZPL A;  3DFG A;  4FIS A;  2KT0 A;  2LMD A;  5M5W J;  3QPT A;  1WGX A;  3DLL F;  1TWC J;  3QYE A;  1I27 A;  3J7Z I;  2Q0O A;  4LG0 A;  1ETY A;  2A61 A;  1MMG A;  3CCS I;  5HDN A;  1Z7U A;  2H8R A;  2DO7 A;  3ZQG A;  1V55 H;  2TCT A;  3WTU C;  2M3A A;  5E17 F;  2WA0 A;  2XVC A;  1ZEL A;  4OOI A;  4XLH A;  5H20 A;  4GFB A;  2LKX A;  4PGH A;  2V7F A;  2QCO A;  4HLX A;  3E6C C;  2A68 F;  2E35 A;  5KAI C;  3DLA A;  3CLQ A;  1HDD C;  2VBY A;  5FFZ A;  5H6Q A;  3KLN A;  1D3Y A;  3F0C A;  2KZG A;  4CYC A;  1KON A;  1U9O A;  3I0T A;  4GCV A;  1AU7 A;  3AKZ A;  1DU0 A;  3AG3 H;  2JJ7 A;  1DUX C;  3R60 A;  2MBF A;  4QPQ A;  3KCC A;  1X1C A;  2QEN A;  2K3F A;  2E2H J;  3MKL A;  4G6Q A;  3EUA A;  5EF6 A;  2OZU A;  1PVE A;  2EZK A;  5TJJ A;  2R7V A;  4BXF A;  3CME I;  2XC7 A;  3M4O J;  2CH0 A;  5L3F A;  1VQ5 I;  1NTC A;  3CCR I;  1YS6 A;  2LG4 A;  3JRB A;  4BS9 A;  2GQQ A;  5EYR A;  2VKD A;  2OCC H;  5KVR A;  2CW8 A;  1FIA A;  1YX3 A;  2RV8 A;  1IXC A;  3H5A A;  5CVU A;  2FX0 A;  4MTD A;  3HB9 A;  5CKT A;  2ZNY A;  4C9Y A;  4BY7 J;  1R1T A;  2UZK A;  1UZC A;  2PJP A;  2HOA A;  4UV9 A;  4HLY A;  2L7K A;  3HDD A;  2WY7 Q;  4XLE A;  5F0C A;  2LBF B;  5C44 J;  3HOZ J;  2Q2E A;  4BDY A;  4IOA F;  1I5Z A;  1TQI A;  2DFI A;  2HQA A;  3GFI A;  4JX6 A;  2CRG A;  4A3G J;  5L3G A;  3VSL A;  5JLW A;  4FHT A;  2F48 A;  1WJB A;  2GXB A;  2LF7 A;  5F1J A;  4ENN A;  3BQY A;  1AHD P;  5ILU A;  3EYI A;  3J7Y J;  3GYH X;  2EPF A;  3I58 A;  1P92 A;  3FXR A;  3WU0 A;  3CCE I;  4PUS A;  1J5Y A;  5E20 A;  2E71 A;  2HDW A;  4R8H A;  1XB4 A;  1K61 A;  2XGX A;  2QKL B;  5JVT A;  2KFD A;  2FNA A;  3FXU A;  3HYI A;  5DEQ A;  1QQI A;  2DA1 A;  4RB1 A;  4XID A;  2O7O A;  4AM3 A;  4YEL A;  1PUF B;  9ANT A;  3D1N I;  2QBY B;  1OR7 A;  3V4G A;  3VOE A;  1VQ7 I;  3TP0 A;  1R1V A;  3ZR8 X;  3MZY A;  1OR7 C;  5D5X B;  2X1C A;  3BR5 A;  4QWQ A;  3VYU B;  1DPU A;  1J2X A;  3QPL A;  1FZP B;  3OL3 A;  1R1U A;  3TOA A;  2D1V A;  2LDU A;  5J8C A;  3IKV A;  1IUF A;  3CUO A;  3HEF A;  1ACI A;  1HW2 A;  2FD5 A;  1YHQ I;  1D8J A;  4UHT A;  3TGN A;  1U9N A;  1VQN I;  2V1X A;  2LF8 A;  2M4G A;  5FRO A;  4B8X A;  5E18 F;  3BPX A;  1N78 A;  4M3F A;  1HOM A;  1UB9 A;  1X2N A;  4HW0 A;  4LMY A;  2N8G A;  3FHZ A;  2QSH X;  3BG3 A;  1QA6 A;  4MEY F;  1A6Q A;  3FMS A;  3CCV I;  3LSI A;  3QU6 A;  4EJV A;  2M30 A;  1RUN A;  3SHF A;  4RB2 C;  3ZN0 A;  4BJ6 C;  2CQK A;  2X48 A;  3GX4 X;  1PDN C;  2OJE D;  5DCF A;  2HPI A;  2G7U A;  4BQA A;  4CCM A;  2BVL A;  3I59 B;  4MFE A;  4HF0 A;  3TO7 A;  3OMY A;  3HUG A;  3C2B A;  2XAG A;  4XLN F;  1IG7 A;  4JX4 A;  3CLO A;  1APL C;  2HOS A;  4ZDL A;  3BLY A;  3PSF A;  4P5O A;  3RSN A;  3ZGK A;  2DA4 A;  2EFW A;  2HPM A;  4XSX F;  3OIP A;  2STT A;  1SD4 A;  4B3X A;  3DEU A;  3K70 C;  1DGR M;  1YS7 A;  1G3S A;  5BPI A;  3T8T A;  2EIK H;  5IYD J;  5L3C A;  2F5E A;  1S72 I;  3A0H C;  3Q9S A;  3FK7 A;  3LSP A;  2LRD A;  4KJZ A;  3BDD A;  1RC9 A;  2X85 A;  4G9Y A;  5IPA A;  1P4X A;  1J09 A;  1B72 B;  1X3U A;  2M34 A;  3WTZ A;  1E3O C;  3IH3 A;  2KPM A;  5M5X J;  1UST A;  2DA2 A;  3BOQ A;  4ANJ A;  5EGO B;  1WI3 A;  5J40 A;  5BQT A;  1W7P B;  2O8X A;  1LNW A;  2AHQ A;  5D4S A;  2ZJR F;  5ED4 A;  1R5I D;  2O61 A;  4HX8 A;  1N75 A;  2R5Y A;  3M8F A;  2NS0 A;  5GPA A;  2LTP A;  1R4M B;  4GO1 A;  3ZCO A;  1Y0U A;  2HS5 A;  5L3B A;  4RGU A;  1H0M A;  3H5R A;  1EH7 A;  3KLO A;  1BN5 A;  2Y30 A;  2P7C B;  3BWG A;  5HOD A;  3WU1 B;  4M6Y A;  1ZRF A;  2ME0 A;  2JSC A;  3H0D A;  4OMY A;  4XNF A;  2RDP A;  3JR9 A;  4FET A;  3F8C A;  1CGP A;  1OLT A;  2QUF A;  4XLA A;  2EK5 A;  1G59 A;  3VYR B;  1XPX A;  1R00 A;  1IV6 A;  2ZFU A;  2XPV A;  2EV5 A;  3BTI A;  3FKI J;  2GM4 A;  3NWT A;  1JUM A;  2UXX A;  1HKT A;  1MBG A;  3PNY A;  3OYJ A;  2DQR A;  1T2K A;  2EWN A;  3KP2 A;  4U87 A;  1SFX A;  2OC6 A;  3RZD J;  4E7S A;  4RDU A;  4BBS J;  1LEB A;  2DPD A;  2Q8K A;  1QBJ A;  3KIO A;  3GO5 A;  2A07 F;  3SYT A;  1GHC A;  3FX3 A;  2STW A;  4IRG A;  1OCO H;  2IA0 A;  1YTY A;  4X6A J;  1IRF A;  2R7O A;  3GLX A;  4N9H A;  3ZMT A;  2KL4 A;  3VFZ A;  2QQB A;  2KJB A;  2YX7 A;  2CW0 F;  3FXM A;  2VT3 A;  4MFD A;  1D1C A;  1EV7 A;  2W85 A;  5HLT A;  4L9V A;  2NS7 A;  1V5G A;  4A0X A;  4B1R A;  4IQ4 A;  1XMA A;  3GUD A;  4UB8 C;  5CVJ A;  3HOY J;  1LQ1 A;  1B8I A;  2KZV A;  2OZ6 A;  4Q4Z F;  5IY5 H;  3OSF A;  3BT9 A;  3CP8 A;  4ON0 A;  3GF2 A;  4F55 A;  5HLG A;  2BE5 F;  2L2O A;  5ICF A;  2R7S A;  3CF5 F;  4I02 A;  2IJL A;  3EUK L;  3L00 A;  2L01 A;  4YRV A;  3GTL J;  1RNL A;  2IGK A;  5JHU A;  3CCM I;  1OCZ H;  4IOC F;  3TED A;  1BR2 A;  3KP7 A;  4HX7 A;  2D2W A;  3G4S I;  1QZY A;  3AAF A;  1HA8 A;  4NUB A;  5J1Y A;  2K9Q A;  2EBI A;  2HKX A;  3KYD B;  1JHF A;  1JI8 A;  3E5Q A;  1R6R A;  4D0P A;  1K83 J;  2XHK A;  4XKW A;  4BU2 A;  2IGN A;  3OS0 A;  5TRD A;  1Y8Q B;  3K4K A;  2WB1 A;  3SZG A;  3CUQ B;  1WI9 A;  3ZN1 A;  4CZC A;  5E79 C;  2X9D A;  3AG1 H;  2HOT A;  4I7H A;  2EQR A;  4CO8 A;  2YU3 A;  3Q3S A;  1MND A;  3OL4 A;  1ENH A;  1P9Q C;  1NK3 P;  2XGD A;  4HNU A;  4Y52 J;  1V54 H;  2DLL A;  2Y9Z A;  3WTX C;  3J81 Z;  3HPH A;  4CSW A;  2IA1 A;  2VXD A;  4M6X A;  3GFJ A;  3OY9 A;  2L9R A;  2VC1 A;  1XD7 A;  2YUS A;  3O8G A;  2BY0 A;  2H94 A;  3U21 A;  1T8I A;  1W5T A;  4EV0 A;  2DW4 A;  1X58 A;  4RBO A;  2EFQ A;  2O9L A;  2A05 A;  1Z9C A;  3LSJ A;  1XSX A;  2KLO A;  2TDX A;  2V4J C;  5EJC A;  3PSI A;  1IRZ A;  3ULQ B;  3D5R C;  2ZME C;  1WJE A;  2DBB A;  2VQC A;  5CYV A;  4BEH A;  1IXR C;  3K69 A;  3WTV C;  2DOF A;  2G9W A;  3RI4 A;  1XCB A;  4DYC A;  4LK0 F;  3L2Q A;  3E1S A;  2ISY A;  1LUJ B;  2XF6 A;  4OWR B;  3RQ4 A;  4ZZL A;  2UWM A;  3KEO A;  1HSJ A;  2R5Z B;  2CQQ A;  5B1B H;  2DMU A;  2V9V A;  3GBG A;  2L7Z A;  3HPG A;  2ZXI A;  2LRE A;  1VQ8 I;  3C2G A;  2PX9 A;  4NBQ A;  4LJZ F;  4EM1 A;  3HGY A;  2EIJ H;  3L1P A;  5LHH A;  1FOX A;  2WB1 N;  1UJ8 A;  5M3M J;  3WTT C;  2XAS A;  3FM5 A;  5FLV A;  2Y0S N;  4B44 A;  2R7F A;  3OOP A;  2E60 A;  3C3W A;  3BG5 A;  4KFC A;  2IVM A;  4BXX J;  2VON A;  4Y33 A;  2IW5 A;  2XUB A;  3NAR A;  5DYM A;  3EUH A;  5E1Z B;  4CA0 A;  5LEK A;  5LHG A;  3EUH C;  3CES A;  3MQ0 A;  3WGG A;  4BE0 A;  1O3Q A;  3GWZ A;  4I98 B;  2VBX A;  3HXL A;  2HNH A;  4XBF A;  4DZP A;  1ZG5 A;  4PCQ A;  2CQN A;  3K4B A;  3R61 A;  1KYW A;  2R7Q A;  1WJ5 A;  3HJE A;  3MMY B;  3PIO F;  2BW3 B;  2IP2 A;  2P5L C;  1D5Y A;  4XOR A;  3K2A A;  1FNN A;  3HC7 A;  2M2E A;  5BOX A;  1SFO J;  2LC2 A;  1TT5 B;  3CC2 I;  1I1S A;  4XON A;  3W6V A;  4ZYG A;  5FLM J;  3WE3 A;  2G0E A;  5F6F A;  1AWC A;  3FK6 A;  4J00 A;  1OPC A;  3LAP A;  1EKE A;  4KT5 C;  3ZQQ A;  3OYF A;  4YEJ A;  4IHS A;  2X51 A;  3U1D A;  3I3L A;  3BR0 A;  3P9I A;  1SFE A;  4I2O A;  5FKO A;  1NHA A;  2GOM A;  1D1B A;  3NWS A;  4WXC A;  1U5T A;  2QYO A;  3M3Y J;  2FRH A;  3RIR A;  4CUG A;  1DP7 P;  1WJA A;  2VKE A;  3F8B A;  2GZW A;  2HFH A;  2K40 A;  1Y8R B;  2JPB A;  2AS5 F;  3BZC A;  3I4P A;  4V19 K;  3S3O A;  1UG2 A;  1SD6 A;  5CJ9 A;  5EDN A;  1JE8 A;  2BYV E;  3P9K A;  4UUS B;  2LR8 A;  1YIO A;  3CP2 A;  3OYB A;  1VQ4 I;  2X6Y A;  1JGG A;  2EA2 A;  3I4M J;  2MD0 A;  3W2V A;  1LPQ A;  4L5E A;  4ZC3 A;  3BZK A;  5GAE J;  4FTH A;  5K1Y A;  2AXT C;  1RR8 C;  4MEX F;  3NRV A;  4XK4 A;  1CQT A;  2Y9Y A;  3RJP A;  3A03 A;  4P9F A;  3QOP A;  2IEK A;  3BRO A;  3CDL A;  1XMK A;  5HDK A;  5AIQ A;  2CV2 A;  2XRO A;  5GAH J;  4G8X A;  3ZXS A;  1QO0 D;  2E1M C;  1Y39 A;  3FXO A;  5HDG A;  3EDP A;  3HRT A;  1O3T A;  4XIC A;  1STZ A;  3CC4 I;  1WJC A;  4CIC A;  1ZK8 A;  4UNO A;  4CYC B;  2FUG 2;  4EAT A;  1T08 B;  2JA2 A;  2LKP A;  1RET A;  1Y1V J;  3ERE D;  4KIS A;  5AIP A;  2OA4 A;  3F22 A;  3MN2 A;  1IF1 A;  1YJW I;  3DCF A;  3H3Z A;  3QP6 A;  2KRC A;  5HOO A;  5EEA A;  4XN3 A;  3H36 A;  2MW8 A;  1WQ2 A;  2DT5 A;  5C3E J;  1ETX A;  3OYE A;  4KIB A;  4WK8 F;  3DU6 A;  1USS A;  2PJR A;  1BI0 A;  3OIQ A;  3QWL A;  2ZJQ F;  1R4N B;  3V8L A;  1YRN B;  3GLL A;  1IRG A;  2IPQ X;  4ENJ A;  4EVI A;  1D8K A;  1S9H A;  1WRJ A;  2WV1 A;  3CC7 I;  1YE9 A;  1N25 A;  1GT0 C;  3LSK A;  4LB5 A;  1MKM A;  1HF0 A;  2YPR A;  1V5E A;  3HL2 A;  4C3I J;  3E5U A;  2K4J A;  2XKP A;  1MBJ A;  4N4O B;  4PJM A;  4DQ2 A;  3S2H J;  1RRJ A;  2EZI A;  1O3S A;  5DCM A;  5E3L A;  1VQK I;  4DBQ A;  1HDP A;  4E7K A;  3VEP A;  3I55 I;  3QOE A;  2JQ7 A;  2NNY A;  4A3D J;  1QZZ A;  1P7I A;  4ETS A;  1QGP A;  1AKH A;  3DKW A;  4N9I A;  3RKX A;  1GV5 A;  4PZJ A;  4QLC U;  4I09 A;  3GTK J;  1IAW A;  3UR3 C;  3Q9V A;  4XR6 A;  3HOX J;  2E19 A;  3QOD A;  2XAQ A;  4WCG A;  1IN7 A;  2DOA A;  3Q0V A;  4HST A;  3JRG A;  5JLX A;  1HCR A;  1FTT A;  1X1A A;  4L9T A;  3W2W A;  4XKB A;  3RYR A;  1P2F A;  1MDM B;  4EQQ A;  1TWH J;  2BHZ A;  2VE8 A;  1TQM A;  3FWE A;  1IN6 A;  2P6T A;  2H6C A;  5KHD A;  1WSU A;  3IV5 A;  3GXO A;  3IH2 A;  2LFB A;  3S2W A;  3OYK A;  4M9X A;  2RRE A;  3OYA A;  4L5J A;  2KRH A;  1QVU A;  4FE7 A;  4DYQ A;  1R5G A;  3A0B C;  3S1N J;  1YQA A;  3DPU A;  3UNG C;  2JPC A;  4FE4 A;  4FQG A;  4O5V A;  3LNQ A;  3LA2 A;  4V2G A;  3OWT A;  1SAX A;  3QYF A;  3DP7 A;  2DMN A;  4AWX B;  4EEF G;  1VQO I;  2MD5 A;  2R7D A;  3QU3 A;  2EA4 A;  4B09 A;  2DQL A;  2JWT A;  5IYB J;  3JRI A;  4NQW A;  3CCQ I;  4IF4 A;  4YFX F;  2P5V A;  1T0F A;  2W24 A;  2VI6 A;  4M3G A;  1BIA A;  1T0F C;  4K2E A;  5DDG A;  4PFP A;  1S8N A;  1UAA A;  2JA7 J;  1IRX A;  1S7A A;  1IC8 A;  4EJW A;  1FBU A;  3QP5 A;  1PUE E;  4PSX A;  4ZJZ A;  2DPU A;  4XM3 A;  2E2J J;  2NVQ J;  2M8G X;  2MLK A;  3EYY A;  3RYP A;  2DDB A;  3HUG B;  3B02 A;  5J1U A;  2FEZ A;  4RM2 A;  3TDZ C;  1IDZ A;  1K78 A;  2HTJ A;  1YIJ I;  5EZG A;  1BR4 A;  2DK8 A;  2WBM A;  1RES A;  2KIM A;  1FLI A;  2HQ5 A;  1ETQ A;  3BR6 A;  5F0H A;  2BBY A;  3FXJ A;  5GTI C;  1VQ9 I;  4FX4 A;  3TO9 A;  2QQ8 A;  2E1O A;  3S17 J;  3I54 A;  1O57 A;  3SXY A;  2RC4 A;  2VB6 A;  2HWV A;  3WTS C;  1SFK A;  2ZBK A;  5B5E C;  1T38 A;  4E6K G;  1SVM A;  2EFP A;  4BE2 A;  2W57 A;  3LST A;  3SZP A;  2IT0 A;  1A5J A;  1GDT A;  2KJC A;  3LL7 A;  2HR3 A;  1J0R A;  2K86 A;  1BI1 A;  3MCZ A;  2OTL I;  2FOW A;  1O4X A;  2W48 A;  1XDS A;  1D1A A;  1S29 A;  3CJR B;  1BC8 C;  3ML6 A;  3JRC A;  2M7A A;  1ZRD A;  1B6A A;  2QWW A;  2VQH A;  2DYR H;  3R0A A;  3PUF A;  2ETH A;  2LKS A;  2NVX J;  5D5U B;  4UVC A;  3C7J A;  3IAS 2;  3RDI A;  4B4C A;  1IUY A;  2Y0M A;  2BGC A;  2E5Z A;  2OQR A;  4CHU A;  1TBX A;  2ID6 A;  3AL0 C;  3S1M J;  3JAM Z;  3F21 A;  2VC0 A;  3WTW C;  3ABL H;  1YW8 A;  2HVQ A;  2NXN B;  3EQL F;  4EGY A;  3M8J A;  3SDG A;  5ILS A;  3CMM A;  2EJR A;  1RIO H;  1SMT A;  3V7S A;  4CGZ A;  2NVT J;  2DMQ A;  4HQE A;  1REP C;  3M07 A;  3SDB A;  1MW7 A;  1LEA A;  3FHN A;  3LSR A;  1DDN A;  2L54 A;  3S8P A;  1OCP A;  1EA3 A;  1HW5 A;  3ZMU A;  2GXA A;  3OS1 A;  2DFE A;  3M8E A;  1A36 A;  1XGS A;  2D1H A;  4U0V A;  5LRS A;  5LD2 C;  2CUE A;  2F5D A;  2K5C A;  3BTL A;  1W4M A;  4D7N A;  1KU3 A;  3CTA A;  1VI0 A;  1KQ9 A;  5CVI A;  1MMS A;  4UV8 A;  1ETV A;  5K7H A;  1I50 J;  1UEL B;  5LRR A;  2KIU A;  3PO2 J;  4WWC A;  2VOD A;  4RM3 A;  1XGN A;  3CCY A;  2JA6 J;  4JQF A;  2QSG X;  2HOE A;  2L0K A;  4BE1 A;  3G2B A;  2V6E A;  1HBX G;  1D0X A;  5F08 A;  2NVU B;  1W5C C;  2BEO A;  3AG2 H;  5FGM A;  3IKT A;  3K1M A;  1L3L A;  1IV8 A;  2ACJ A;  5DD4 A;  2R0Q C;  4MQV A;  1FX7 A;  3RQI A;  1QPI A;  4UUT A;  2HU9 A;  3P9C A;  3BJA A;  1TW2 A;  2D45 A;  5FRM A;  4JOM A;  2JZY A;  1B4A A;  2HZD A;  3RKQ A;  3DPT A;  4DW6 A;  4DYR A;  2QEX I;  2NAZ A;  3F8F A;  4XKC A;  4IHW A;  3LA3 A;  2H8W A;  1BI2 A;  4IPA A;  4YII A;  3HOU J;  2NVY J;  2HQR A;  5M5Y J;  1QNT A;  2KDO A;  4IL6 C;  5E8I A;  4JBA A;  4A6D A;  5KK1 A;  2MSY A;  3DU5 A;  4H0E A;  4ZH4 F;  2VUM J;  1JXS A;  2A5Y B;  4KUM A;  2CFX A;  3HGG A;  5CVR A;  3O3K A;  2CS3 A;  3IRR A;  4IZZ A;  2NOG A;  2P81 A;  3HHG A;  1DQU A;  4Q47 A;  1J59 A;  2QQ9 A;  5E3N A;  2WY8 Q;  5HS9 A;  1BJA A;  3DEW A;  5TIS C;  3DTE A;  3T8R A;  1VQM I;  1F43 A;  5CVV A;  2QF7 A;  2GXG A;  1KA8 A;  2B7E A;  2MFZ A;  2QA4 I;  3ASO H;  3T1B A;  1ZN2 A;  2EB7 A;  5J3L A;  2E5N A;  2XB0 X;  3LSM A;  2R7W A;  3ZQL A;  4W97 A;  2X0L A;  2Y2Z A;  4OIO F;  5J4V A;  1VFC A;  1I39 A;  1IN4 A;  5LBQ A;  2E36 A;  2LY9 A;  2XIG A;  3WU2 C;  4FCY A;  4I6Z A;  1LDK B;  1OMI A;  5D8K B;  3K10 A;  4B3A A;  3WGI A;  3OYG A;  4HV5 A;  1KGS A;  4OIN F;  4MHG A;  1U0J A;  3DBL B;  3M1C A;  2EFN A;  1FY7 A;  1FP2 A;  4LLG F;  1IXS B;  3QQA A;  4M72 A;  1YJN I;  2MG4 A;  3F6O A;  5K7Z A;  2DTZ A;  2GWR A;  4BY1 J;  3I71 A;  2XKO A;  3IAM 2;  4A3K J;  4Y17 A;  3OYN A;  4HRI A;  1ZLK A;  4DZJ A;  4DJA A;  2IXS A;  5HVQ C;  5H6R A;  3F8M A;  2OF7 A;  5LGT A;  3ABK H;  5HLH A;  3FBN B;  4U88 A;  1F36 A;  2HYJ A;  4JK1 X;  5E1W A;  4YFK F;  1OJL A;  2HEO A;  1T39 A;  3S1R J;  1UHM A;  3HSE A;  2FQ4 A;  4PJN A;  2HDD A;  5FKM A;  3OV8 A;  4I76 A;  4HYE A;  4Q5S F;  2O03 A;  2X6X A;  4B47 A;  1XC5 A;  3ZMV A;  1EH6 A;  4CXF A;  3S15 J;  4CCO A;  2M45 A;  1OYY A;  1X1P A;  5GP9 A;  2YSR A;  5K5O A;  2P6S A;  3G1M A;  4PGG A;  5CQE A;  3VPR A;  3WGH A;  1JT6 A;  5LLQ A;  2H1K A;  2A6T A;  2K4B A;  3CZ6 A;  4TV7 A;  1J9I A;  5JHF A;  3BR1 A;  4BBR J;  4GYI A;  3PM1 A;  2XAH A;  1ZLJ A;  4MLO A;  2KIQ A;  3HOT A;  5IP7 J;  1BR1 A;  5L3E A;  2DT6 A;  4DGW B;  4DOZ A;  3T5X A;  4E4H A;  4N0B A;  4XMY A;  4BDZ A;  2EZL A;  5FB2 A;  2B0L A;  3P7N A;  4IRH A;  3ZQ7 A;  1W36 C;  2YX4 A;  3HSF A;  4A0Y A;  2ZJP F;  5EEG A;  3KYL A;  2VN2 A;  2QBY A;  4A2U A;  4CCJ A;  3JSO A;  3MAJ A;  1ZKG A;  2KRF A;  3ECO A;  3I5U A;  4R1H A;  2COM A;  4IKF A;  3LWF A;  2DJN A;  3A02 A;  4ZYH A;  3E6B A;  2Y75 A;  3K4N A;  4U0W A;  3JTH A;  4Y3O A;  3ZMD A;  4FX0 A;  1FBS A;  4RGX A;  2ID3 A;  3H3U A;  1OCC H;  4A93 J;  2CUZ A;  4PDK A;  2VKH A;  3DEE A;  3BZ6 A;  3NQO A;  3ZRG A;  1FOY A;  2X6O A;  3F8N A;  2PBI A;  3FBI B;  5HLI A;  2XPU A;  4XQF A;  1ONV A;  3L2R A;  3ZQF A;  3F3X A;  5BS6 A;  2VJI A;  1YJ9 I;  3FZV A;  2IGM A;  3K6G A;  5F1R A;  1MZB A;  5IOZ A;  1U5T B;  3KX2 A;  1P7J A;  4Z2Y A;  2XGE A;  4A3F J;  4D7M A;  2HGC A;  3K70 D;  5H2F C;  2H09 A;  4UXN A;  2VKV A;  3VB2 A;  2PMZ A;  3J80 K;  2Y0S A;  4OIR F;  3N4M A;  2IS1 A;  2E34 A;  2BZT A;  2JVG A;  4G6D A;  2Z16 A;  1K7A A;  2ZXH A;  1VQL I;  3HKZ A;  4IHT A;  2L5Q A;  4BHB A;  3ROU A;  2BY3 A;  1FSH A;  1X3Z B;  2HQN A;  2OAZ A;  4HNT A;  5D6E A;  1O3R A;  2HXI A;  2M4K A;  4XSZ F;  4A5N A;  5FRN A;  2Z1D A;  4IHY A;  1MMD A;  4LLN A;  2ZSH B;  2COB A;  3HBL A;  4B43 A;  3JSP A;  4O3M A;  3MZH A;  4CCL A;  3TKY A;  1HKS A;  2LH9 A;  2AO9 A;  2F5C A;  2OD5 A;  3L7W A;  1WCM J;  4L0Z B;  4HAM A;  1Z7L A;  3VDX A;  2DDA A;  2L7F P;  5JR3 A;  2IAI A;  2ZME A;  3QRF F;  4NNJ A;  1W7P A;  4KDP A;  1HW1 A;  1YG2 A;  3TOB A;  2CV1 A;  2JTV A;  5BMZ A;  1FSE A;  1DGW Y;  4ITV A;  1RKT A;  4LOC A;  2OQG A;  2Q1Z B;  1U6G A;  5FFX A;  2ZB9 A;  4HOB A;  4EM2 A;  2K9L A;  1GXP A;  1ZYR F;  2IBD A;  3D5L A;  4LIU A;  1H8A C;  1DU6 A;  1E3P A;  1UFM A;  4KN4 X;  1DPR A;  1FWZ A;  1OQY A;  4Y15 A;  2VAS A;  3TQN A;  3IWF A;  4ZDP A;  4U0Y A;  2PI0 A;  4A3J J;  1JJ8 C;  2JSP A;  1X19 A;  4RLF A;  4LB6 B;  1JKO C;  3ONQ A;  2LOO A;  1EJ9 A;  5ICC A;  5D5V B;  2CV0 A;  1Q1H A;  3OS2 A;  3H5N A;  5LGN A;  1MD0 A;  3CCU I;  3CJT B;  5IOY A;  2HVR A;  3U1K A;  1DP3 A;  5FKN A;  3IP4 B;  3CJQ B;  4M9Z A;  2PMZ N;  2F6C A;  4NC7 A;  3BG7 A;  2R7T A;  2RKH A;  5DTD A;  2DCE A;  6PAX A;  3DQV C;  3A01 A;  4C30 A;  1F4K A;  2ELK A;  2PJR B;  2EFO A;  2VBW A;  3LFK A;  3HKZ N;  3R4K A;  3H9J A;  2R4G A;  4ENM A;  3GCM A;  2P8T A;  2QKM B;  2CQX A;  3HOV J;  1TW3 A;  1ZHF A;  3OR1 C;  1OYW A;  1RR7 A;  3H35 A;  3MZ8 A;  3JW4 A;  1Z6T A;  1E3H A;  2ZNZ A;  3LQQ A;  3GZ6 A;  1FMV A;  2W25 A;  4LFU A;  4UVB A;  3TBI A;  1R5H A;  1SD7 A;  4IXA A;  3D0S A;  1IJW C;  1TZL A;  2LVS A;  4HF2 A;  4ZYA A;  1PJR A;  1Z91 A;  5FKL A;  4LK1 F;  4P55 A;  1XGM A;  1FOW A;  2ZFW A;  1Z1D A;  4NHJ A;  1Z3Y A;  2DOD A;  3L9F A;  3BJ6 A;  1WZ2 A;  2L4M A;  2VJ5 A;  1VTN C;  4E7J A;  1P6R A;  2O6G E;  1UMQ A;  1XTA A;  2OU2 A;  2HVS A;  2GAU A;  1A6I A;  1R23 A;  1V5F A;  4BQN A;  2H27 A;  2M1B A;  2M87 A;  1R9T J;  4G6T B;  4DNC A;  3G1L A;  1TT0 A;  2A5W A;  4XL9 A;  1BL0 A;  3CD6 I;  3GTO J;  3S3M A;  2H6B A;  2MC3 A;  2ESH A;  4D5F A;  2L7M P;  1Y56 A;  4IO9 F;  4ESF A;  4M6V A;  2W7N A;  2HYF A;  3CF2 A;  4RB3 C;  3KZY A;  3OYL A;  4BNC A;  4KIC A;  4XRF A;  1ZRE A;  3ESW B;  3NAU A;  3E0J B;  2RNG A;  2M5W A;  2NS8 A;  3FXL A;  4HEA 2;  3NEU A;  4OIQ F;  4RAZ A;  1Z21 A;  4F93 B;  1BW6 A;  3J81 K;  4GRI A;  4NC6 A;  1QU3 A;  5D6F A;  3CMY A;  4LG0 B;  1MH3 A;  2O8K A;  2OCE A;  2XRN A;  2EV0 A;  1U2W A;  2TRT A;  3B6C A;  4S04 A;  1ETO A;  2A6E F;  3CUQ A;  1U8R A;  1LDJ A;  4RLQ A;  3CUQ C;  5JFR A;  3N05 A;  4UB6 C;  5FD5 A;  1B1B A;  1IN5 A;  4Y4R A;  5HS8 A;  2A3S A;  5B1A H;  1OFC X;  3JRE A;  3G1O A;  4F7Z A;  5E3O A;  1ITY A;  1TWA J;  3Q0W A;  3WOD F;  3MFK A;  1MNE A;  4KN7 X;  3S93 A;  3ABT A;  4A3B J;  2DTR A;  4ZTJ A;  1YYV A;  5D8L B;  1BOA A;  4LLL A;  1OYI A;  4DIQ A;  1SMY F;  2K85 A;  5DV5 A;  3Q0U A;  1ZH5 A;  5IYC J;  2VE9 A;  1JGS A;  3KP4 A;  4RA2 A;  1I3Q J;  3K2Z A;  1R58 A;  1GXQ A;  3QPS A;  1VF9 A;  3DTI A;  1OCT C;  1MBE A;  3DKY A;  4KYW A;  4EJO A;  4MQ9 F;  3VOD A;  3L2W A;  4KT6 A;  2ECB A;  5DM7 F;  2X6W A;  1ZR4 A;  2W84 A;  3P5J A;  1BM9 A;  4IVN A;  3JRA A;  3H9G A;  4M3D A;  3GTG J;  1IO2 A;  3SEZ A;  1GV2 A;  2R7U A;  2J5O A;  4ZZD A;  4AC0 A;  2DXI A;  2CUJ A;  2F4O B;  3PQK A;  2DA6 A;  3W3C A;  1VND A;  1W0T A;  4X1E A;  2MA3 A;  3REO A;  4KNY A;  5EG0 A;  4N4N B;  4BJ5 C;  4G7H F;  5L3D A;  3CJN A;  5GAG J;  2H1L A;  2RAE A;  1R36 A;  2R5Z A;  3HOS A;  1G4D A;  4LGW A;  1QVT A;  4E7Z A;  1WPK A;  1A04 A;  2PEX A;  3OYD A;  1LE8 A;  2HKO A;  3KEY A;  5J8F A;  1BA5 A;  4AVP A;  1IGN A;  1QPM A;  3MVP A;  4OIP F;  1ZRC A;  2L3D A;  2O0Y A;  1R71 A;  1D0Y A;  2Q2E B;  2PG4 A;  2GA2 A;  5FLX K;  4AIK A;  3ZMS A;  4HDV A;  2WAQ A;  1K4S A;  3HSR A;  1FP1 D;  1HST A;  5B66 C;  5LGU A;  1KYZ A;  4HNV A;  1YIT I;  3G6E I;  1D0Z A;  3JTG A;  5AON A;  1K6Y A;  4CDG A;  5E8G A;  2MC4 A;  1WKM A;  1G3T A;  1ZG3 A;  3CDH A;  2XF5 A;  4EJU A;  4F91 B;  4EGZ A;  3BQZ A;  1R22 A;  2DT7 B;  4HF1 A;  1MJB A;  4C2T A;  4FAS D;  4I0B A;  2BV6 A;  3DXJ F;  4GXO A;  3IWZ A;  2V79 A;  3CDI A;  5JI6 A;  3ISP A;  2KQR A;  2MYS A;  4L18 B;  1ETW A;  1FYK A;  1BJZ A;  3PL8 A;  1LFB A;  1MSF C;  3TW7 A;  3K1P A;  3L2U A;  2R7X A;  4MTE A;  1N77 A;  4Y7N J;  3GZN B;  4L9J A;  3K1N A;  5GAD J;  3CO7 C;  2EV6 A;  1QRY A;  5KCM A;  4R79 A;  1V3F A;  2PN6 A;  2ADU A;  2UUZ A;  3G3Z A;  3X2Q H;  4U7B A;  1MBF A;  1BI3 A;  2A69 F;  4AIJ A;  1XSV A;  4NB5 A;  2WAD A;  1W1W E;  1CF7 A;  1E2X A;  4O6J A;  4CH7 A;  2JVH A;  4ENK A;  4G7Z F;  3L2V A;  2CU7 A;  1HC8 A;  1RUO A;  3QYB A;  3CO6 C;  2ECC A;  3M9A A;  1POG A;  1WWX A;  2LP0 A;  3KZZ A;  1ON2 A;  1FPQ A;  4A3E J;  3ERM A;  2CMP A;  1TLH B;  3PNT A;  5CLS A;  3MWM A;  5K5Q A;  2P7V B;  1FIP A;  5DUI A;  3LSH A;  1WH7 A;  3PNV A;  3KP5 A;  5IT9 K;  2XDV A;  1ZGA A;  2CW7 A;  1IW7 F;  2XGC A;  1JUP A;  2NNN A;  2BHY A;  2IS2 A;  5A2Q K;  2WAQ N;  4P1W A;  1QHH D;  1I6X A;  4MGR A;  3BTJ A;  1SVL A;  2GOX B;  2OV7 A;  4JX5 A;  2XAF A;  3K7A J;  4AID A;  2BOL A;  3BR3 A;  1K6O A;  4QPO A;  4AVZ A;  2EH3 A;  3K4J A;  1U78 A;  2FNP A;  3I4N J;  4HG2 A;  4KIT B;  2CJJ A;  4UY8 I;  2E7X A;  2O3F A;  3FM3 A;  3IHU A;  3OR2 C;  2HTS A;  4HSR A;  3CQZ J;  3ZP5 A;  1FYM A;  4Z6Y A;  3HTU A;  3RCO A;  1MH4 A;  4YIR X;  1YI2 I;  1ORK A;  1MJA A;  4Q48 A;  3LSG A;  5HS7 A;  1K4T A;  4E7I A;  3I9V 2;  2FBI A;  2I5U A;  1PP8 F;  2ESN A;  5KNL A;  1XMX A;  1JT0 A;  3WTY C;  1X1D A;  2ZKZ A;  3VWB A;  2OUM A;  3DBR B;  1RZ4 A;  2W00 A;  5F0F A;  1C0W A;  2DI3 A;  5E1X A;  3L09 A;  3FF5 A;  4E70 A;  4A3M J;  1JKQ C;  5D4R A;  2RN7 A;  3KET A;  4QIW N;  1JTX A;  1O7F A;  2R5Y B;  2V26 A;  2R93 J;  5HNH A;  1YW9 A;  1WFX A;  3BJO A;  2X4H A;  2QSF X;  4V2F A;  4ASN A;  3LFU A;  2GBY A;  2K02 A;  4F92 B;  2FBH A;  2G7H A;  4BL0 B;  1FYL A;  5TGT A;  4A69 C;  1XCV A;  5J4Y A;  2IRF G;  3DBH B;  1YRN A;  2FJ1 A;  4II3 A;  2P4W A;  4RB0 A;  2M0M A;  2VPL A;  3MKW B;  1GUU A;  4BH9 A;  4A3I J;  2F4I A;  3ZMZ A;  3W6J B;  4M74 A;  2AXL A;  3FDY A;  5DD8 A;  2FOK A;  4A6E A;  4A0Z A;  3QAH A;  1WJD A;  4BAC A;  1ZQ3 P;  3TO6 A;  1HQC A;  2PMH A;  2KIS A;  4U7D A;  2RVC A;  1FMW A;  1B9N A;  3ZQH A;  3ZOB A;  2CG4 A;  1KQ8 A;  3A2K A;  2J5P A;  4BQQ A;  2IGO A;  2YU9 J;  1ZG1 A;  2YR2 A;  3KEQ A;  2XAU A;  2LNB A;  3S14 J;  3BY6 A;  2E1N A;  1UHW A;  3HOW J;  1GVD A;  1ERD A;  1R7J A;  3O2P E;  4RGR A;  5K7F A;  2HXO A;  2B63 J;  2IS6 A;  3OYM A;  2V6C A;  2I8D A;  1MDM A;  1SD5 A;  2ELJ A;  3BP8 A;  3IRQ A;  1Y1W J;  2EZH A;  1G2H A;  2Z99 A;  2K27 A;  2HI3 A;  2W82 A;  3PJR A;  1Z05 A;  2YS9 A;  4BHP A;  4LD5 A;  1B8I B;  4HQM A;  4C2M J;  5D5W B;  1JTY A;  1B9M A;  1IN8 A;  4D9J A;  1Q1V A;  1IDY A;  1YOV B;  1A35 A;  3OYC A;  3GME A;  4BJT A;  1XSD A;  3O6B B;  3SFZ A;  2K3P A;  4C2U A;  2VL8 A;  2Z2S B;  1R49 A;  2XSJ C;  3F23 A;  2WV0 A;  4GYG A;  1HLV A;  3QPH A;  2Y48 A;  4LIV A;  3WE2 A;  1P4A A;  3RKY A;  5GPC A;  3B73 A;  3H0G J;  2VQG A;  4WXD A;  2CUF A;  2VXZ A;  4RAG A;  2Y69 H;  5E3M A;  2L9S A;  1W0U A;  4ZYD A;  2PQ8 A;  3BCB A;  4M3E A;  2W4S A;  3BCA A;  2V1D A;  3WG7 H;  5FO5 A;  5J6X A;  1SEU A;  1NK2 P;  4ESJ A;  1XN7 A;  4XLF A;  1JHH A;  4RAF A;  4ZDO A;  5C4X J;  4E7L A;  1GLN A;  2V1N A;  2AQE A;  5K5R A;  2KKO A;  3IC7 A;  2ZJ2 A;  3LA7 A;  4KIF A;  1G3W A;  1H89 C;  2QZ8 A;  3N97 A;  3E5X A;  3FIW A;  3A4C A;  4WXH A;  3W6K B;  1SVO A;  3KE2 A;  1Z0X A;  5FD6 A;  1TWF J;  1H9T A;  2XAJ A;  3BPV A;  1UCR A;  5ILV A;  4HV6 A;  4GDF A;  2P0W A;  2MGQ A;  4ABZ A;  3J7A Y;  3J80 Z;  1F5T A;  2K9S A;  4JYK A;  3SQN A;  3TW6 A;  5DS9 A;  3CCL I;  3PIP F;  2VJJ A;  3RZO J;  3JAM K;  1JJ6 C;  2ZME B;  2FBK A;  5J47 A;  1Z6R A;  3PFY A;  1X3W B;  2WWY A;  1KU2 A;  3HZJ A;  3K4C A;  2JA5 J;  2V1U A;  1X1B A;  3FXK A;  3TDU C;  4BEH B;  2WC2 A;  1Z77 A;  2RQQ A;  4I0A A;  2E2I J;  3JCU C;  4XOT A;  1ZTR A;  5ERI A;  2K7L A;  2HZT A;  4L9N A;  3MKY B;  1EF4 A;  2LBF A;  1VQ6 I;  1T33 A;  3Q5F A;  1G6N A;  1XG1 A;  2WAE A;  2QVO A;  3EET A;  4AIH A;  2XV4 S;  4D1Q A;  4HA8 A;  2Y31 A;  4IEJ A;  4QTR A;  2RQP A;  2Z33 A;  4HDU A;  4AYB A;  5LHI A;  3IUO A;  2AQF A;  1MMA A;  3F6V A;  1F9N A;  3ZQI A;  3B6A A;  2JRT A;  3C1D A;  3WHC A;  3U9G A;  3DKX A;  3IL2 A;  1TL8 A;  1LFU P;  3KPH A;  2XSD C;  3I53 A;  3C18 A;  2C6Y A;  3RKW A;  1LVA A;  3A01 B;  1U8B A;  4PJL A;  1NG7 A;  2XB5 A;  3TMO A;  3SEQ A;  4OU0 A;  1U3E M;  1PUF A;  2VOO A;  5ICE A;  1BW5 A;  4QSH A;  3UKG A;  1BBY A;  1BOB A;  1ZAR A;  4IHV A;  1G3Y A;  1A31 A;  1D5V A;  2BVM A;  2FMY A;  3FKJ A;  1E0E A;  3MD2 A;  1S7O A;  1X2M A;  3OOU A;  4A3C J;  4CCN A;  3ECH A;  3MEX A;  3WHB A;  1TTY A;  4JP0 A;  2JN6 A;  2VIX A;  1AOY A;  1RPW A;  3EPZ A;  3ASN H;  5B3S H;  1NG6 A;  3GFM A;  5CPR B;  4M71 A;  3T0Y A;  3ABU A;  2F5V A;  2L9N A;  1ZGW A;  2NYX A;  5GTH C;  3E97 A;  2K9M A;  1JUS A;  2VJ4 A;  2XPW A;  5IT3 A;  3I56 I;  1XX5 A;  4EMS A;  2FXA A;  4B48 A;  1XS9 A;  2GIV A;  4P9U A;  2ZXW H;  3HM5 A;  1RKW A;  1H88 C;  1I3A A;  1V4R A;  3AFH A;  2BY2 A;  2WTE A;  4OAZ A;  4BHC A;  4BYY A;  3DTK A;  1T95 A;  2MH2 A;  4RGS A;  4BXU A;  4RMN A;  4CZZ A;  1YO5 C;  3M1E A;  2DAO A;  2DFH A;  2KP6 A;  3I59 A;  4XKV A;  1LKX A;  1ON1 A;  4PJJ A;  1NH3 A;  2OTJ I;  4M3B A;  3PFI A;  4AYB N;  4PSW A;  5LEJ A;  2DMP A;  2FU4 A;  5F64 A;  1B59 A;  3DWL E;  1FOK A;  1ZAO A;  1T56 A;  2R92 J;  1M1E B;  2FSW A;  3GZ5 A;  4M73 A;  3FIS A;  4C3J J;  3GTQ J;  4EJT A;  2BXY A;  5F04 A;  2QLZ A;  4X0G A;  2ICW G;  2R7R A;  4LG3 A;  2K9N A;  3SFI A;  3RPQ A;  2VPR A;  2ME6 A;  3W2A A;  2DFF A;  4KA4 A;  4ESB A;  3VSK A;  2BY1 A;  1O7L A;  4J01 A;  3COA C;  1B72 A;  1Z67 A;  3K4L A;  1K79 A;  2PMU A;  3OSG A;  4RS8 A;  2GA1 A;  2VQL A;  2LLK A;  4AU7 A;  1YW7 A;  5EGO A;  2RGV A;  4XRS G;  5FJ8 J;  2V9P A;  4P96 A;  2E1M B;  3A1Y A;  4F3Q A;  1T6S A;  2JK3 A;  2MAB A;  3IH4 A;  3V42 A;  2LY2 A;  4BAY A;  2ZSI B;  3ZQC A;  1XDU A;  3BG9 A;  4II2 A;  3PQJ A;  3BG6 A;  3DV8 A;  3S2D J;  4IJA A;  1QHG A;  3V7C A;  2E1C A;  3JRF A;  3JRD A;  2DYS H;  3S3N A;  4GGG A;  3VYT B;  1TNS A;  3K4M A;  3H9Q A;  4A5M A;  2B9S A;  1KU9 A;  4OMZ A;  1BIB A;  2V9K A;  2CO5 A;  3SJM A;  1VZ0 A;  3HIF A;  2M8E A;  3R0J A;  1IZ1 A;  4WF2 A;  5EG0 B;  4I01 A;  2GIZ A;  2FE3 A;  4A3L J;  4YG2 F;  2KDZ A;  2XF7 A;  2NRA C;  4HZF A;  4AD9 A;  2QQA A;  1KZH A;  1H9G A;  2LSO A;  2DJI A;  1YFH A;  1JKP C;  4G7O F;  2QM3 A;  2OPT A;  2ELH A;  3K9T A;  4XRS A;  3MKZ A;  3LAJ A;  1LE8 B;  1MBK A;  4XLC A;  5JVG F;  4IRI A;  1W36 D;  1AA7 A;  1OKR A;  4S05 A;  4G12 A;  2L9V A;  5DCM B;  1MNM C;  2GLO A;  2DA7 A;  2DU9 A;  4S0H B;  4BKX A;  2WAF A;  1T98 A;  4G94 A;  2D5V A;  4BQO A;  4E7H A;  1ZR2 A;  2VT2 A;  4I99 C;  3H1C A;  4IX7 A;  4CCK A;  2M7B A;  2P5K A;  3L2C A;  1FT9 A;  2CYY A;  4J19 A;  5HNF A;  1AKH B;  1LVK A;  4C3H J;  2DOE A;  2I10 A;  2DMT A;  3TL4 X;  4UVA A;  2VBZ A;  1ZGJ A;  3U2R A;  2FQ3 A;  4M9S A;  4W1U A;  1TNT A;  1I1G A;  1FBQ A;  1S3J A;  5IP6 A;  3TP3 A;  3G71 I;  1HKQ A;  2UXN A;  3RPU A;  1LDD A;  1Y0N A;  3FXQ A;  5FLX Z;  1WJF A;  4KMU X;  1LJ9 A;  2JUG A;  4IHX A;  3LMM A;  5C4J J;  2X1E A;  1MGT A;  2KHM A;  2Z5U A;  2W1O A;  1L0O C;  1S7E A;  2L02 A;  3K0L A;  1CF7 B;  3H92 A;  3CCJ I;  3F9K A;  1YX5 A;  3GTM J;  1MIJ A;  4MO7 A;  4OAY A;  4KIG A;  3E3V A;  1WHU A;  3S16 J;  3WG9 A;  1QZE A;  5DUK A;  2R3S A;  3V8J A;  4BGD A;  5ICG A;  1HXD A;  4PJ0 C;  2EIL H;  4HPQ A;  3KP6 A;  1U5T C;  3LOC A;  2EIN H;  3KZI C;  5KAF C;  3OYI A;  3VYS B;  4NQW B;  1SFU A;  3HHH A;  3PO3 J;  4XOP A;  3S1Q J;  1WVR A;  3ELK A;  5LFA A;  2ISZ A;  3HG9 A;  4H4K C;  4XLP F;  1RI7 A;  3GEZ A;  3GTP J;  1LB2 A;  3HTS B;  1J7K A;  1KQ0 A;  3GTJ J;  4YFN F;  5J1R A;  1YLF A;  1W7P D;  3H3V K;  3O8H A;  1E17 A;  2F4M B;  1I6H J;  2LK2 A;  2CGP A;  4LIT A;  2MH9 A;  1K78 B;  1SC7 A;  1MSE C;  2KMU A;  5EEH A;  3BC8 A;  1F1Z A;  1TWG J;  1BC7 C;  2PLY A;  2BXZ A;  2RNJ A;  3GVA A;  5IT9 Z;  5DM6 F;  3LQR A;  3J7A O;  3S32 A;  3R6S A;  4XN0 A;  3E7L A;  5A2Q Z;  4RAY A;  1GVJ A;  4ZTF A;  2HYG D;  2CQ7 A;  5FKK A;  3OIO A;  5IP9 J;  4UUV A;  1JKR C;  1TP4 A;  1SAN A;  2LYC A;  2ZC2 A;  1UHS A;  5M3F J;  3HRM A;  1EH8 A;  1G8X A;  3V7R A;  2LY1 A;  3AG4 H;  5BPD A;  3OYH A;  1FC3 A;  1ULY A;  2PFB A;  4NDL A;  1X4O A;  4PK4 A;  2ZCW A;  1UG0 A;  4A12 A;  3G73 A;  1MJ9 A;  1S6L A;  2NOJ B;  2QGU A;  2M9H A;  3HRS A;  4MIM A;  4NC8 A;  4Y13 A;  1FJL A;  2FML A;  3FMQ A;  3AL0 B;  2JA8 J;  2R7Z J;  1MMN A;  2DA5 A;  4MNU A;  2MLG A;  2HDC A;  3ABM H;  4CYD A;  1OIS A;  2IA2 A;  3BR2 A;  1Z3X A;  3BTC A;  2Z9O A; 
#chains in the Genus database with same CATH homology
 2KIF A;  4HBL A;  3M7G A;  1W5S A;  4HX4 A;  4WX9 A;  4ZYE A;  2F5F A;  1PP7 U;  3RTR A;  3DF8 A;  3HRU A;  2Z3Y A;  4KMF A;  3I64 A;  2ZXJ A;  2FA5 A;  1TQP A;  3F72 A;  2DK5 A;  1P4W A;  2CWE A;  2CSO A;  2F2E A;  4EM0 B;  4L5I A;  1J75 A;  2VOP A;  3E6D A;  3KFW X;  3E6M A;  2ZO4 A;  3DPL C;  4L0Y B;  4YIF A;  3SZT A;  2E7W A;  3GW2 A;  2FF4 A;  2OBP A;  3GFL A;  3KP3 A;  1XGO A;  2A6H F;  3FMR A;  4FT8 A;  3V8K A;  1KU7 A;  1ODD A;  2JT1 A;  2L4A A;  3ZPL A;  3DFG A;  3QPT A;  1I27 A;  2Q0O A;  4LG0 A;  2A61 A;  5HDN A;  1Z7U A;  2DO7 A;  3WTU C;  5E17 F;  2XVC A;  4OOI A;  5H20 A;  4PGH A;  4HLX A;  3E6C C;  2A68 F;  2VBY A;  5FFZ A;  5H6Q A;  3KLN A;  1D3Y A;  3I0T A;  4GCV A;  1DUX C;  3R60 A;  2MBF A;  3KCC A;  2QEN A;  4G6Q A;  2OZU A;  5TJJ A;  5L3F A;  1YS6 A;  2GQQ A;  5KVR A;  2RV8 A;  1IXC A;  5CVU A;  4MTD A;  2ZNY A;  1R1T A;  2UZK A;  2PJP A;  4UV9 A;  4HLY A;  2Q2E A;  1I5Z A;  1TQI A;  2DFI A;  3GFI A;  5L3G A;  4FHT A;  2GXB A;  2LF7 A;  4ENN A;  5ILU A;  3EYI A;  3GYH X;  3I58 A;  3WU0 A;  1P92 A;  3FXR A;  1J5Y A;  5E20 A;  4R8H A;  1XB4 A;  2XGX A;  5JVT A;  2FNA A;  3FXU A;  3HYI A;  5DEQ A;  1QQI A;  4RB1 A;  2QBY B;  1OR7 A;  3V4G A;  3VOE A;  1R1V A;  3MZY A;  5D5X B;  4QWQ A;  1DPU A;  1J2X A;  1FZP B;  3TOA A;  1R1U A;  2D1V A;  2LDU A;  5J8C A;  3IKV A;  3CUO A;  1HW2 A;  1D8J A;  4UHT A;  3TGN A;  2V1X A;  2LF8 A;  4B8X A;  5E18 F;  3BPX A;  1UB9 A;  4HW0 A;  4LMY A;  3FHZ A;  4MEY F;  3FMS A;  3QU6 A;  4EJV A;  2M30 A;  1RUN A;  3SHF A;  4RB2 C;  3ZN0 A;  2CQK A;  3GX4 X;  1PDN C;  5DCF A;  2G7U A;  4BQA A;  3I59 B;  4HF0 A;  3TO7 A;  3HUG A;  2XAG A;  4XLN F;  3CLO A;  4P5O A;  2EFW A;  4XSX F;  2STT A;  1SD4 A;  3DEU A;  1YS7 A;  1G3S A;  5BPI A;  3T8T A;  5L3C A;  2F5E A;  3Q9S A;  3BDD A;  4G9Y A;  1P4X A;  1X3U A;  3WTZ A;  1UST A;  3BOQ A;  5BQT A;  1W7P B;  2O8X A;  1LNW A;  5D4S A;  5ED4 A;  2O61 A;  4HX8 A;  3M8F A;  2NS0 A;  4GO1 A;  1Y0U A;  2HS5 A;  5L3B A;  4RGU A;  1H0M A;  1EH7 A;  3KLO A;  1BN5 A;  2P7C B;  3BWG A;  3WU1 B;  4M6Y A;  1ZRF A;  2JSC A;  4OMY A;  2RDP A;  3F8C A;  1CGP A;  2QUF A;  2EK5 A;  1R00 A;  2EV5 A;  2UXX A;  1HKT A;  2DQR A;  1T2K A;  2EWN A;  3KP2 A;  1SFX A;  1LEB A;  2DPD A;  2Q8K A;  1QBJ A;  2A07 F;  3GO5 A;  1GHC A;  3FX3 A;  2STW A;  4IRG A;  2IA0 A;  1YTY A;  1IRF A;  3GLX A;  4N9H A;  3ZMT A;  3VFZ A;  2QQB A;  2KJB A;  2YX7 A;  2CW0 F;  2VT3 A;  1EV7 A;  2W85 A;  4L9V A;  4A0X A;  1XMA A;  3GUD A;  5CVJ A;  1LQ1 A;  2OZ6 A;  4Q4Z F;  4ON0 A;  5HLG A;  3GF2 A;  2BE5 F;  5ICF A;  4I02 A;  2IJL A;  3L00 A;  2L01 A;  1RNL A;  5JHU A;  3KP7 A;  4HX7 A;  2D2W A;  1QZY A;  3AAF A;  2HKX A;  1JHF A;  3E5Q A;  4D0P A;  2XHK A;  5TRD A;  3CUQ B;  1WI9 A;  3ZN1 A;  4I7H A;  4CO8 A;  2YU3 A;  2DLL A;  3WTX C;  3J81 Z;  2IA1 A;  4M6X A;  3GFJ A;  2VC1 A;  1XD7 A;  2H94 A;  1W5T A;  4EV0 A;  2DW4 A;  2EFQ A;  1Z9C A;  1XSX A;  2TDX A;  3ULQ B;  2DBB A;  5CYV A;  1IXR C;  3K69 A;  3WTV C;  2G9W A;  3RI4 A;  1XCB A;  4LK0 F;  2ISY A;  4ZZL A;  2UWM A;  3KEO A;  1HSJ A;  2V9V A;  4LJZ F;  4EM1 A;  5LHH A;  3WTT C;  2XAS A;  3FM5 A;  2R7F A;  3OOP A;  3C3W A;  4KFC A;  2IVM A;  2VON A;  2IW5 A;  2XUB A;  5DYM A;  5E1Z B;  3EUH A;  5LEK A;  5LHG A;  3MQ0 A;  3WGG A;  1O3Q A;  3GWZ A;  4I98 B;  2VBX A;  4XBF A;  1ZG5 A;  4PCQ A;  3R61 A;  1KYW A;  2P5L C;  2IP2 A;  1FNN A;  5BOX A;  1I1S A;  4ZYG A;  3WE3 A;  5F6F A;  1AWC A;  1OPC A;  3LAP A;  4KT5 C;  4IHS A;  3U1D A;  3P9I A;  1SFE A;  4I2O A;  1NHA A;  4WXC A;  1U5T A;  2QYO A;  2FRH A;  3RIR A;  1DP7 P;  3F8B A;  2GZW A;  2HFH A;  2JPB A;  2AS5 F;  3I4P A;  1SD6 A;  5CJ9 A;  1JE8 A;  2BYV E;  3P9K A;  1YIO A;  2EA2 A;  5K1Y A;  4MEX F;  3NRV A;  3RJP A;  4P9F A;  3QOP A;  3BRO A;  1XMK A;  5HDK A;  5AIQ A;  2XRO A;  4G8X A;  1QO0 D;  5HDG A;  3EDP A;  3HRT A;  1O3T A;  1STZ A;  4CIC A;  4UNO A;  2LKP A;  3ERE D;  5AIP A;  2OA4 A;  3F22 A;  1IF1 A;  3H3Z A;  3QP6 A;  5HOO A;  1WQ2 A;  2DT5 A;  4KIB A;  4WK8 F;  1USS A;  1BI0 A;  3V8L A;  1IRG A;  2IPQ X;  4ENJ A;  4EVI A;  1D8K A;  1WRJ A;  4LB5 A;  1MKM A;  2YPR A;  4DQ2 A;  3E5U A;  2K4J A;  2XKP A;  1O3S A;  5DCM A;  3VEP A;  2NNY A;  1QZZ A;  4ETS A;  1QGP A;  3DKW A;  4N9I A;  3RKX A;  4PZJ A;  4QLC U;  4I09 A;  1IAW A;  3Q9V A;  2XAQ A;  4WCG A;  1IN7 A;  4L9T A;  3RYR A;  1P2F A;  1MDM B;  4EQQ A;  1WSU A;  2VE8 A;  1TQM A;  3FWE A;  1IN6 A;  2P6T A;  2H6C A;  3GXO A;  3S2W A;  4M9X A;  4L5J A;  1R5G A;  1YQA A;  2JPC A;  4O5V A;  3LA2 A;  1SAX A;  3DP7 A;  4AWX B;  2MD5 A;  2R7D A;  3QU3 A;  2EA4 A;  4B09 A;  2DQL A;  4NQW A;  4IF4 A;  4YFX F;  2P5V A;  1T0F A;  2W24 A;  1BIA A;  4K2E A;  5DDG A;  1S8N A;  1S7A A;  4EJW A;  1FBU A;  3QP5 A;  1PUE E;  2DPU A;  2MLK A;  3EYY A;  3RYP A;  3B02 A;  2FEZ A;  3TDZ C;  1K78 A;  2HTJ A;  2DK8 A;  2KIM A;  1FLI A;  2BBY A;  4FX4 A;  3TO9 A;  3I54 A;  1O57 A;  3SXY A;  2RC4 A;  2HWV A;  3WTS C;  2ZBK A;  1T38 A;  2EFP A;  2W57 A;  3LST A;  3SZP A;  2IT0 A;  2KJC A;  2HR3 A;  1J0R A;  2K86 A;  1BI1 A;  3MCZ A;  1XDS A;  1BC8 C;  1S29 A;  3ML6 A;  1ZRD A;  1B6A A;  2QWW A;  3R0A A;  2ETH A;  5D5U B;  4UVC A;  3C7J A;  3RDI A;  1IUY A;  2Y0M A;  2BGC A;  2OQR A;  4CHU A;  1TBX A;  3JAM Z;  3F21 A;  2VC0 A;  3WTW C;  1YW8 A;  3EQL F;  4EGY A;  5ILS A;  2EJR A;  1RIO H;  1SMT A;  3V7S A;  4CGZ A;  4HQE A;  1REP C;  1LEA A;  1DDN A;  2L54 A;  1HW5 A;  3ZMU A;  3M8E A;  1XGS A;  2D1H A;  4U0V A;  5LRS A;  2F5D A;  1W4M A;  1KU3 A;  3CTA A;  1KQ9 A;  5CVI A;  4UV8 A;  5LRR A;  2KIU A;  4WWC A;  2VOD A;  1XGN A;  4JQF A;  2HOE A;  1HBX G;  2BEO A;  5FGM A;  3IKT A;  1L3L A;  3K1M A;  2ACJ A;  5DD4 A;  4MQV A;  1FX7 A;  3P9C A;  3BJA A;  1TW2 A;  2D45 A;  2JZY A;  1B4A A;  3DPT A;  2NAZ A;  3F8F A;  3LA3 A;  1BI2 A;  4IPA A;  4YII A;  2HQR A;  1QNT A;  5E8I A;  4JBA A;  4A6D A;  5KK1 A;  4H0E A;  4ZH4 F;  1JXS A;  2A5Y B;  4KUM A;  2CFX A;  5CVR A;  3O3K A;  3IRR A;  3HHG A;  4Q47 A;  1J59 A;  2QQ9 A;  5HS9 A;  1BJA A;  3T8R A;  5CVV A;  2GXG A;  1KA8 A;  3T1B A;  1ZN2 A;  2EB7 A;  2X0L A;  4OIO F;  1IN4 A;  5LBQ A;  2XIG A;  1LDK B;  1OMI A;  5D8K B;  3WGI A;  4HV5 A;  1KGS A;  4OIN F;  4MHG A;  2EFN A;  1FY7 A;  1FP2 A;  4LLG F;  1IXS B;  4M72 A;  3F6O A;  2GWR A;  3I71 A;  2XKO A;  4Y17 A;  1ZLK A;  5HVQ C;  5H6R A;  3F8M A;  5LGT A;  5HLH A;  4U88 A;  4JK1 X;  5E1W A;  4YFK F;  2HEO A;  1T39 A;  1UHM A;  3HSE A;  3OV8 A;  4HYE A;  4Q5S F;  2O03 A;  3ZMV A;  1EH6 A;  4CXF A;  2M45 A;  1OYY A;  2YSR A;  5K5O A;  2P6S A;  4PGG A;  3WGH A;  5LLQ A;  2K4B A;  4TV7 A;  1J9I A;  4GYI A;  2XAH A;  1ZLJ A;  3HOT A;  5L3E A;  3T5X A;  4N0B A;  5FB2 A;  2B0L A;  3P7N A;  4IRH A;  3ZQ7 A;  2YX4 A;  3HSF A;  4A0Y A;  5EEG A;  2VN2 A;  2QBY A;  4A2U A;  3JSO A;  3MAJ A;  2KRF A;  3ECO A;  3I5U A;  4R1H A;  2COM A;  3LWF A;  4ZYH A;  3E6B A;  2Y75 A;  4U0W A;  3JTH A;  3ZMD A;  4FX0 A;  1FBS A;  4RGX A;  3H3U A;  4PDK A;  3BZ6 A;  3NQO A;  3F8N A;  2PBI A;  5HLI A;  1ONV A;  3F3X A;  5BS6 A;  3FZV A;  5F1R A;  1MZB A;  1U5T B;  4Z2Y A;  2HGC A;  2H09 A;  4UXN A;  3VB2 A;  3J80 K;  4OIR F;  3N4M A;  4G6D A;  1K7A A;  4IHT A;  4BHB A;  3ROU A;  1FSH A;  2HQN A;  2OAZ A;  5D6E A;  1O3R A;  4XSZ F;  4A5N A;  4LLN A;  3JSP A;  4O3M A;  3MZH A;  3TKY A;  1HKS A;  2F5C A;  2OD5 A;  3L7W A;  4L0Z B;  4HAM A;  5JR3 A;  2ZME A;  3QRF F;  1W7P A;  4KDP A;  1HW1 A;  1YG2 A;  3TOB A;  2JTV A;  5BMZ A;  1FSE A;  2OQG A;  1U6G A;  5FFX A;  4HOB A;  4EM2 A;  1GXP A;  1ZYR F;  3D5L A;  1UFM A;  4KN4 X;  1DPR A;  1FWZ A;  4Y15 A;  3TQN A;  3IWF A;  4U0Y A;  2PI0 A;  4LB6 B;  5ICC A;  5D5V B;  1Q1H A;  5LGN A;  1MD0 A;  4M9Z A;  2RKH A;  6PAX A;  3DQV C;  1F4K A;  2EFO A;  2VBW A;  3LFK A;  3R4K A;  4ENM A;  2P8T A;  1TW3 A;  1ZHF A;  1OYW A;  3JW4 A;  1Z6T A;  3LQQ A;  2ZNZ A;  3GZ6 A;  2W25 A;  4LFU A;  4UVB A;  1R5H A;  1SD7 A;  4IXA A;  3D0S A;  4HF2 A;  1Z91 A;  4LK1 F;  4P55 A;  1XGM A;  2ZFW A;  1Z1D A;  4NHJ A;  3L9F A;  3BJ6 A;  2L4M A;  1VTN C;  1P6R A;  2O6G E;  2OU2 A;  2GAU A;  1R23 A;  2H27 A;  2M1B A;  2M87 A;  4DNC A;  2H6B A;  2MC3 A;  2ESH A;  4ESF A;  2HYF A;  4RB3 C;  3KZY A;  4BNC A;  4KIC A;  4XRF A;  1ZRE A;  2M5W A;  3NEU A;  4OIQ F;  4RAZ A;  3J81 K;  5D6F A;  4LG0 B;  2EV0 A;  2XRN A;  1U2W A;  4S04 A;  3CUQ A;  2A6E F;  1U8R A;  1LDJ A;  3CUQ C;  5JFR A;  5FD5 A;  1B1B A;  1IN5 A;  5HS8 A;  2A3S A;  4F7Z A;  3WOD F;  3MFK A;  4KN7 X;  3ABT A;  2DTR A;  1YYV A;  5D8L B;  1BOA A;  4LLL A;  1OYI A;  1SMY F;  5DV5 A;  1ZH5 A;  2VE9 A;  1JGS A;  3KP4 A;  3K2Z A;  1R58 A;  1GXQ A;  4KYW A;  4EJO A;  4MQ9 F;  3VOD A;  2W84 A;  1BM9 A;  4IVN A;  2J5O A;  4ZZD A;  3PQK A;  2MA3 A;  3REO A;  4KNY A;  4G7H F;  5L3D A;  3CJN A;  1R36 A;  3HOS A;  1G4D A;  4LGW A;  1A04 A;  2PEX A;  2HKO A;  5J8F A;  4AVP A;  1QPM A;  4OIP F;  1ZRC A;  2L3D A;  2O0Y A;  2PG4 A;  2GA2 A;  5FLX K;  4AIK A;  3ZMS A;  4HDV A;  3HSR A;  1FP1 D;  1HST A;  5LGU A;  1KYZ A;  3JTG A;  5AON A;  4CDG A;  5E8G A;  1WKM A;  1G3T A;  1ZG3 A;  3CDH A;  4EJU A;  4EGZ A;  1R22 A;  4HF1 A;  1MJB A;  4I0B A;  2BV6 A;  3DXJ F;  4GXO A;  3IWZ A;  2V79 A;  5JI6 A;  3ISP A;  4L18 B;  1FYK A;  3K1P A;  4MTE A;  4L9J A;  3K1N A;  3CO7 C;  2EV6 A;  4R79 A;  1V3F A;  2PN6 A;  2ADU A;  3G3Z A;  4U7B A;  1BI3 A;  4AIJ A;  2A69 F;  1XSV A;  4NB5 A;  1CF7 A;  1E2X A;  4O6J A;  4ENK A;  4G7Z F;  1RUO A;  3CO6 C;  3M9A A;  1WWX A;  3KZZ A;  1ON2 A;  1FPQ A;  1TLH B;  5CLS A;  3MWM A;  5K5Q A;  2P7V B;  5DUI A;  3KP5 A;  5IT9 K;  1ZGA A;  1IW7 F;  2NNN A;  5A2Q K;  1I6X A;  4MGR A;  2XAF A;  1K6O A;  1U78 A;  2FNP A;  2E7X A;  2O3F A;  3FM3 A;  3IHU A;  2HTS A;  3ZP5 A;  1FYM A;  3HTU A;  1MJA A;  4Q48 A;  5HS7 A;  2FBI A;  1PP8 F;  2ESN A;  3WTY C;  2ZKZ A;  1RZ4 A;  1C0W A;  2DI3 A;  5E1X A;  3L09 A;  3FF5 A;  4E70 A;  5D4R A;  2RN7 A;  3KET A;  1O7F A;  1YW9 A;  3BJO A;  2X4H A;  4ASN A;  2K02 A;  2FBH A;  2G7H A;  1FYL A;  1XCV A;  2IRF G;  2P4W A;  4RB0 A;  4BH9 A;  3ZMZ A;  3W6J B;  4M74 A;  2AXL A;  5DD8 A;  2FOK A;  4A6E A;  4A0Z A;  3QAH A;  3TO6 A;  1HQC A;  2PMH A;  4U7D A;  2RVC A;  1B9N A;  2CG4 A;  1KQ8 A;  2J5P A;  1ZG1 A;  2YR2 A;  3KEQ A;  2LNB A;  3BY6 A;  2E1N A;  1UHW A;  1R7J A;  3O2P E;  4RGR A;  2V6C A;  1MDM A;  1SD5 A;  3BP8 A;  3IRQ A;  2Z99 A;  2K27 A;  1Z05 A;  4BHP A;  4LD5 A;  4HQM A;  5D5W B;  1B9M A;  1IN8 A;  1XSD A;  3O6B B;  3SFZ A;  3F23 A;  2WV0 A;  4GYG A;  3QPH A;  2Y48 A;  3WE2 A;  1P4A A;  3RKY A;  3B73 A;  4WXD A;  2VXZ A;  4ZYD A;  2PQ8 A;  2V1D A;  5FO5 A;  5J6X A;  4ESJ A;  1XN7 A;  1JHH A;  5K5R A;  2KKO A;  3IC7 A;  2ZJ2 A;  3LA7 A;  4KIF A;  1G3W A;  2QZ8 A;  3N97 A;  3E5X A;  4WXH A;  5FD6 A;  3W6K B;  3KE2 A;  1H9T A;  2XAJ A;  3BPV A;  1UCR A;  5ILV A;  4HV6 A;  3J80 Z;  1F5T A;  3SQN A;  3JAM K;  2ZME B;  2FBK A;  1Z6R A;  2WWY A;  1KU2 A;  2V1U A;  3TDU C;  2WC2 A;  4I0A A;  5ERI A;  2K7L A;  2HZT A;  4L9N A;  3Q5F A;  1G6N A;  2QVO A;  3EET A;  4AIH A;  2XV4 S;  4HA8 A;  2RQP A;  2Z33 A;  4HDU A;  5LHI A;  3F6V A;  1F9N A;  2JRT A;  3C1D A;  3U9G A;  3IL2 A;  3I53 A;  3C18 A;  2C6Y A;  3RKW A;  1LVA A;  4OU0 A;  1U3E M;  2VOO A;  5ICE A;  1BBY A;  1ZAR A;  1G3Y A;  1D5V A;  2FMY A;  1S7O A;  3ECH A;  3MEX A;  1TTY A;  1AOY A;  3GFM A;  4M71 A;  3T0Y A;  3ABU A;  2NYX A;  3E97 A;  5IT3 A;  4EMS A;  2FXA A;  2GIV A;  4P9U A;  1V4R A;  2WTE A;  4BHC A;  4BYY A;  2MH2 A;  4RGS A;  4BXU A;  4CZZ A;  1YO5 C;  3M1E A;  2DAO A;  3I59 A;  1ON1 A;  3PFI A;  5LEJ A;  2FU4 A;  5F64 A;  1B59 A;  1FOK A;  1ZAO A;  3GZ5 A;  2FSW A;  4M73 A;  4EJT A;  2QLZ A;  3RPQ A;  4KA4 A;  4ESB A;  1O7L A;  3COA C;  1K79 A;  2PMU A;  4RS8 A;  2GA1 A;  1YW7 A;  2RGV A;  4P96 A;  1T6S A;  4BAY A;  1XDU A;  3PQJ A;  3DV8 A;  4IJA A;  3V7C A;  2E1C A;  4GGG A;  1TNS A;  4A5M A;  1KU9 A;  4OMZ A;  1BIB A;  2CO5 A;  3HIF A;  2M8E A;  3R0J A;  1IZ1 A;  4WF2 A;  4I01 A;  2FE3 A;  4YG2 F;  2NRA C;  4HZF A;  4AD9 A;  2QQA A;  1H9G A;  2LSO A;  1YFH A;  4G7O F;  2QM3 A;  2ELH A;  3K9T A;  3LAJ A;  4IRI A;  1OKR A;  4S05 A;  5DCM B;  2DU9 A;  1T98 A;  4G94 A;  2VT2 A;  2P5K A;  3L2C A;  1FT9 A;  2CYY A;  4UVA A;  2VBZ A;  1ZGJ A;  3U2R A;  2FQ3 A;  4M9S A;  1TNT A;  1I1G A;  1FBQ A;  1S3J A;  1HKQ A;  2UXN A;  3RPU A;  1LDD A;  3FXQ A;  5FLX Z;  4KMU X;  1LJ9 A;  1MGT A;  2Z5U A;  1L0O C;  2L02 A;  3K0L A;  1CF7 B;  3H92 A;  4KIG A;  3E3V A;  3WG9 A;  3V8J A;  5DUK A;  2R3S A;  5ICG A;  1HXD A;  3KP6 A;  1U5T C;  1SFU A;  3HHH A;  3ELK A;  2ISZ A;  4XLP F;  1RI7 A;  3GEZ A;  1LB2 A;  3HTS B;  1J7K A;  1KQ0 A;  4YFN F;  1YLF A;  1W7P D;  1E17 A;  2CGP A;  2MH9 A;  1K78 B;  5EEH A;  1F1Z A;  1BC7 C;  2PLY A;  2RNJ A;  3GVA A;  5IT9 Z;  3LQR A;  3J7A O;  3R6S A;  5A2Q Z;  4RAY A;  1GVJ A;  2HYG D;  4UUV A;  3HRM A;  1EH8 A;  3V7R A;  5BPD A;  1FC3 A;  1ULY A;  2PFB A;  2ZCW A;  4A12 A;  3G73 A;  1MJ9 A;  1S6L A;  3HRS A;  4Y13 A;  2FML A;  3FMQ A;  4MNU A;  2MLG A;  2HDC A;  4CYD A;  2IA2 A;  2Z9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...