4OPKA

Bh-rnaseh:2'-sme-dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
133
structure length
133
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Generating Crystallographic Models of DNA Dodecamers from Structures of RNase H:DNA Complexes.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 38
structure length 133
sequence length 133
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2014-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4opkA00
4CFAA 4FM1A 2JGUA 3DOKA 1X9WA 1UA0A 3OVNA 1SL0A 4QAGA 1HPZA 4NYNA 4OVLA 5KTQA 5C25A 1HYSA 2D0CA 1I39A 1JLGA 1VSIA 3L2QA 3KLFA 3SV3A 1S1XA 1S6PA 2YV0X 3MAQA 3AVAA 3PO4A 4B8CA 3AVNA 4O0IA 2IDOA 4FJIA 3PX6A 1NKBA 1RT2A 3DLBA 3EZ5A 4DFMA 2G8KA 1FK9A 4DLGA 4C8OA 3QIPA 3VQQA 1NJWA 4QOZB 1LWCA 4KAZA 3V9SA 2HHVA 3S3NA 1NKCA 1VRTA 3HPGA 4LH4A 4GMJB 1RT1A 3ZCMA 4EP5A 4CIFA 4N5SA 3OYNA 4E7HA 3LPTA 3AVGA 4JRQA 3OYBA 3OY9A 3LP3A 5J2NA 3SUOA 4KV8A 3ZSOA 2KZZA 4BE1A 2B6AA 3DM2A 4CF2A 1X9SA 4I2QA 3OYDA 1CLQA 3LP0A 1NJZA 3HVRA 3I0SA 4DLEA 2QXFA 4DS4A 1X9MA 4Q5VA 3HPHA 1CZBA 4DSEA 4RG8A 5HRSA 3SI6A 4BWJA 1L3SA 2XHBA 3ITHA 4MQ3A 4PQUA 2HHXA 2OPRA 1JLAA 3VQ8A 3L2RA 4RW4A 4BE0A 3OYGA 4CHQA 4N47A 3NE6A 4FJKA 4FZZA 4E89A 2IOCA 2RPIA 2HMIA 3LPUA 3ALYA 3C95A 3ZT2A 1KSPA 3TAFA 5D3GA 1NK4A 2FBTA 3FFIA 3WNEA 5SWMA 3LDSA 4B9TA 3VQ7A 1U4BA 1F21A 1VSMA 1WLJA 5EU7A 3V9UA 4ELUA 3HJFA 4CIGA 3K58A 3AA4A 3K2PA 2LSNA 3TAMA 3CG7A 1B92A 3C6TA 3MECA 4O5BA 2IC3A 3OJSA 4CCHA 3AO4A 1JLCA 1S6QA 1KVBA 1WN7A 4CGHA 1WSFA 4C8MA 3KKRA 4CJ5A 1NOYA 1QSLA 2QKKA 3QESA 4FJHA 1KVCA 4J2EA 2KFNA 3DRSA 5DK5A 5CY4A 1NK5A 2RF2A 4E7KA 4DF8A 2BDPA 2QK9A 3C6UA 4KHQA 3HL8A 2RN2A 3ISNC 5KGWA 1ZBLA 4HVJA 4FJJA 4DTXA 1DLOA 4H4OA 1TL1A 1WSEA 3AVFA 4Z4FA 4CHNA 4W5QA 3U3GA 3K59A 4MFBA 4CGGA 3ZSXA 3OYCA 3QNOA 3RRGA 3SNNA 2F8SA 1S1UA 4AHVA 3HPOA 4DSIA 2HVHA 4CJEA 3VA3A 4CJRA 3TAGA 2Z1IA 4KI4A 4EZ6A 1BQNA 3TWHA 4FLTA 4FJLA 1NKEA 4EP4A 3QERA 4CJSA 1T8EA 4B9UA 1BISA 5HRRA 1HNIA 3OYHA 4DMNA 1C6VA 4UQGA 5FRMA 3AO2A 4Z4EA 4O55A 1ITGA 4NCGA 4GVMA 3M8PA 4F3OA 4DU1A 1SL2A 4BE2A 2O4IA 4OJRA 3QO9A 2R7YA 3OS0A 1NOZA 3QINA 3V6DA 3TI0A 4DFPA 4J2AA 1IKYA 4B9VA 5C24A 1RTJA 3NGZA 4B9MA 2GUIA 3OS2A 5HP1A 3PV8A 3K57A 1EETA 1NK9A 1IKXA 4HUGA 1T05A 4FJNA 1SL1A 4CF1A 2DFHA 2X6NA 3S3OA 3LP1A 4BACA 1J54A 2EX3A 3AVKA 1RT6A 1HJRA 4DG1A 3ULDA 4Y1CA 2GBZA 3L2VA 4E0DA 2YNHA 4F3TA 3ZSVA 3M8SA 3L2WA 4AHUA 1VRUA 1Q9YA 1BGXT 4I9QA 4DTJA 3ZSWA 3CM5A 5FDLA 4J2BA 2G8IA 3V1QA 1TK8A 4HUFA 1U48A 4ELVA 3LZJA 2FBXA 1S1VA 2DFEA 4CF0A 5J2PA 3LANA 2KZMA 3RTVA 2VWJA 1VSJA 3KK3A 4N76A 1KLMA 4FJ5A 4KKOA 4KHUA 4E7IA 5J2QA 1T7PA 3VQ6A 3WNFA 1ZBFA 4W5RA 4AH9A 1SUQA 3KD5E 2FBVA 3NFAA 1HQUA 3LWMA 4DTPA 1BL3A 4JLHA 1W9HA 3AVCA 4CJQA 1KFSA 3NH1A 3NF6A 2XY5A 1RTDA 1RCHA 1BIZA 3ZSYA 4M3XA 2HNYA 1VSLA 4CF9A 1B9FA 3QIOA 4CFBA 1O1WA 1IKWA 3HXMA 2HHTA 3L2UA 1RBVA 3BGRA 3I8DA 1CZ9A 1IO2A 3CFPA 4CJPA 1HMVA 3AVLA 1HYZA 4IFVA 4O44A 4KHSA 3DRPA 2HW3A 2IS3A 3CYMA 1D8YA 4CEEA 4KPYA 3T1AA 3OJUA 4FLXA 3QETA 1LW2A 4WE1A 3V1OA 5CYMA 5CZ2A 4W5NA 4KTZA 1KFDA 2G8HA 1R0AA 4CJUA 4I2PA 4HUEA 4FK2A 1RILA 4CHZA 1A5XA 1EXQA 4ZHRA 4BDYA 2ZD1A 1KRPA 2Y1JA 1NK8A 1SKSA 1A5WA 1C1CA 3OYFA 3AA2A 2X74A 4KO0A 4CHOA 4FYDA 1CXUA 3V9WA 1HQEA 1NJYA 3QEVA 2P5GA 4H8KA 1JXEA 1Z25A 2VG7A 1TK0A 1RT4A 4LY7A 1QQCA 3CFOA 1VK0A 5KRTA 4CEAA 1EX4A 4C8KA 2ZE2A 3EY1A 4TSXA 5CYQA 1WSIA 3ZSZA 4KI6A 2G8WA 4JS4A 1YT3A 3AO5A 3SUQA 4PY5A 3DLKA 4IG0A 4FCYA 4Z4IA 3TAQA 1KVAA 3AO1A 2G8VA 3KLHA 3SUPA 4DTUA 3VQDA 2ITGA 3SYZA 3QEPA 4FLVA 1RDBA 4BWMA 4DQSA 2OZSA 4K8XA 4KHYA 2KQ2A 3DYAA 3L3VA 1XC9A 4FK0A 1J9AA 5J2MA 1L3UA 4B8AB 3SUNA 1A5VA 3QLHA 3ZT4A 2BE2A 3S9HA 3HP9A 3AVIA 4DTNA 1ZBIA 4DU4A 2HHQA 4EZ9A 3AVBA 3KK2A 4CGJA 3K5NA 3V9ZA 4QCLA 3T3FA 4PUOA 2I5JA 1U47A 5JS1A 3QEWA 1C1AA 3KKSA 1IG9A 3IS9A 1RDCA 3DMJA 4OPJA 3RMBA 4CGFA 4F8RA 4IDKA 4KB1A 3I0RA 3O3FA 3RR8A 4FJ7A 4M42A 3QEXA 3ASMA 1KTQA 3VQ4A 1UA1A 2X6SA 1ZBUA 4CEOA 3PX0A 4AILC 2G8FA 4N56A 3HK2A 2KW4A 1VSHA 4E19A 1Q9XA 4DFKA 3PO5A 4K8ZA 1VSDA 1XI1A 1SV5A 1U45A 1RNHA 3G0ZA 4DFJA 2OYQA 3RMCA 2DFFA 1TVRA 1GOCA 1WSHA 1RBSA 2AJQA 4CE9A 1S1WA 1LV5A 4FJGA 1NK6A 1QSSA 1TV6A 1JLBA 4CK2A 1UAXA 1JXBA 4DSLA 2KTQA 4FW2A 3NF9A 3DOLA 2OPQA 3MEGA 4CECA 2XRIA 2A1RA 4NCAA 4KHWA 3LP2A 2DY4A 1LWEA 3KIOA 3O3GA 2X78A 3WNHA 4OKKA 3RRHA 3IAYA 4B3OA 3AV9A 1Q8IA 4M45A 3HP6A 3KTQA 1QE1A 3RR7A 4KHNA 4M3TA 3AVHA 3RMAA 1U04A 1L5UA 4DQIA 3H08A 1RT5A 1RDDA 1G15A 3SPZA 4KTQA 2OPPA 4FLUA 4FM2A 2E6MA 2PY5A 4FJ8A 1KCFA 4OGCA 4DQPA 1WSGA 1DTTA 1BQMA 3G10A 3HO1A 1LAVA 4NYFA 4OLBA 1YTUA 1S9EA 4CJLA 3TANA 3LZIA 2Z1HA 3OYMA 5I42A 3P5JA 5KRSA 1UOCA 1YTAA 2IAJA 4CFCA 1TK5A 1TKXA 1J5OA 2P1JA 4OKEA 1N5YA 4CJKA 4HCCA 3U3YA 4FZXC 3AA3A 5HRNA 1D9FA 4DSKA 1MU2A 1BCMA 3QEIA 4I7FA 1ASUA 4CGIA 4YNQA 4AHCA 2D0BA 3VN5A 3B6OA 3A2FA 4CEQA 1ASVA 3RMDA 3VQ9A 3SCXA 4J2DA 3T19A 3AVMA 2OZMA 5HRPA 3C94A 4CK3A 4YFUA 3D0PA 3HVTA 4PWDA 5FROA 1D9DA 4OGEA 3MXIA 1WSJA 4HHTA 4Q0BA 4CHPA 3K5LA 4M41A 4CHYA 1QTMA 1ZBHA 2BGGA 4CJWA 4FM0A 3NGIA 3JYTA 4HCBA 5KI6A 4FJXA 4E1MA 4N41A 3L3UA 1Y97A 4M3YA 1LAWA 4Z4CA 4DTOA 3TR8A 2YKNA 1IH7A 3DRRA 2XY8A 5C42A 4CJTA 5E41A 3DLHA 1KLNA 4DSJA 1JLEA 1FKOA 4BDZA 3TAPA 5KGXA 1UWBA 3OYAA 4FVMA 3VA0A 3LAKA 3ZT1A 4W5TA 4JS5A 4FW1A 5SZTA 3DLRA 4AHTA 1C0MA 2D5RA 4G1QA 4Z0UA 2QKBA 3RWUA 1RBUA 3V4IA 4DU3A 1NK0A 5J1EA 4Z4GA 2O4GA 4H4MA 4ID1A 4DF4A 3S3MA 1TL3A 2JLEA 3MEDA 4M3WA 4FJ9A 2HHUA 2YHAA 3MXJA 2ZQBA 3NF8A 4IFYA 3PUFA 4CEFA 4CIEA 3SQ4A 1QS4A 4C8NA 3NBPA 3NDKA 3BDPA 4KTWA 3KLIA 4DQRA 1XHZA 1N6QA 1TAUA 1S1TA 1GOAA 3DI6A 1WAFA 2YHBA 4OKJA 3VQBA 2E4LA 4GW6A 3CQ8A 2F8TA 4KRFA 4PA1A 4ZTJA 1SKRA 4KFBA 1ZYQA 3PX4A 4L8RB 4DTSA 3SPYA 1NJXA 2P5OA 5HROA 1K6YA 4ZTFA 1RBRA 2HHSA 1Z26A 3F73A 2B5JA 3B6PA 3AA5X 3O3HA 4LH5A 4OPKA 4ICLA 3NAEA 3V81A 1WAJA 3V1RA 3ZT0A 1JKHA 2YNFA 4CESA 3KJVA 3TABA 4M3UA 4FK4A 2PYJA 4O4GA 2Q3SA 4M3RA 4ID5A 2P51A 4W5OA 1QHTA 3SV4A 2GV9A 1B9DA 4RW9A 3HM9A 1NK7A 1BI4A 3KLGA 1HNVA 1EKEA 2WOMA 1BI4B 2ATQA 3U6FA 3IG1A 3VQCA 2HNZA 3O4QA 3EYZA 3QNNA 3MEEA 3OYLA 1JLFA 3CFRA 3LAMA 4B9SA 4RW6A 1JLQA 3DLGA 4LSLA 4ELTA 1I3AA 1YVUA 4IKFA 4CERA 4CEDA 4Z4HA 1VSEA 4AHSA 1TAQA 1SKWA 4B9NA 2OA8A 4DSFA 1BIUA 5HLFA 1U49A 3L8BA 2VWKA 1QSYA 2RKIA 1S9GA 4DTMA 3AO3A 2PZSA 1CXQA 3SQ2A 4OLAA 3OYEA 3PY8A 4F2RA 3ZSRA 4IBNA 4E1NA 1LWFA 3JSMA 1W0HA 4RW8A 1C0TA 4FLWA 1VSKA 2VG6A 3VQ5A 1REVA 4CEZA 1DTQA 2IGIA 3WNGA 4FJMA 1J53A 4CJ3A 2HHWA 1RBTA 3TAEA 3NHGA 3O4NA 1XHXA 1TGOA 4B9LA 2Y1IA 4CEBA 4I9LA 1WNSA 5T7BA 3TARA 2HVIA 3OYKA 2E6LA 2Z1GA 4O0JA 5JS2A 1JL2A 4CJFA 3OS1A 2VG5A 3OYJA 3NCIA 2XO7A 3F9KA 5FRNA 3ZT3A 2YNIA 4IG3A 3MXMA 5DMRA 4CJ4A 3ZSQA 2XY7A 1L3VA 3AVJA 4KREA 3HYFA 3NH2A 3V9XA 1D5AA 2YKMA 3SQ0A 2BANA 3KLEA 4E7JA 2F96A 4Y1DA 3SZ2A 1TKTA 4FLYA 4RW7A 3K5OA 1X1PA 5I3UA 2A1SA 1RT7A 2PYLA 1C1BA 3HSTB 4HTUA 3UIQA 4E3SA 2ETJA 2HB5A 3LALA 1T03A 4DWIA 4LD0A 3SQ1A 1VSFA 3K5MA 2D0AA 4C8LA 1GOBA 1FXXA 4AHRA 2FBYA 1C0UA 1RT3A 1BCOA 2W42A 3P83D 1RDAA 3IRXA 4E7LA 2NUBA 3E01A 3HT3A 1RTHA 2Z1JA 3LWLA 4NCBA 4LSNA 3VQPA 2G8UA 4R5PA 1TKDA 3VQEA 4M3ZA 3DLEA 4JRPA 1LW0A 2WONA 4CK1A 4CGDA 1EP4A 3KD1E 3CM6A 3NGYA 2B4JA 2FC0A 1HRHA 1TKZA 2EHGA 5CZ1A 4FZYA 2DTUA 4DQQA 4KB0A 2XY6A 3SJJA 5K14A 1XWLA 1IKVA 4XIUA 1S5JA 1RTIA 3NH0A 4FXDA 3D45A 4CJVA 4CFDA 2YNGA 2OPSA 3VQAA 4B08A 3M8QA 1HYVA 3NF7A 5HBMA 4CF8A 3OYIA 4BDPA 4F4KA 1L3TA 4F2SA 1FKPA 2KFZA 1ASWA 4DS5A 4DTRA 3THVA 3KK1A 4FLZA 3P1GA 1BHLA 3M8RA 1JL1A 2HNDA
chains in the Genus database with same CATH superfamily
2JGUA 3DOKA 3PIPL 1SL0A 2OTJN 1HPZA 1HYSA 2D0CA 1I39A 1JLGA 1VSIA 4GVEA 3KLFA 4B8CA 3PX6A 4FWRA 4CJ7A 3WEEB 3DLBA 1Q18A 4DFMA 1FK9A 4BRQA 1NGGA 2E8AA 1NKCA 1VRTA 4LH4A 3HPGA 3EE8A 1RT1A 3GDQA 2IIRA 4GMJB 4NLCA 3OYNA 4E7HA 3LPTA 4JRQA 4EFHA 4JAXA 2KZZA 3ZSOA 2B6AA 5AR0A 2P9UA 3MX5A 3DXMB 4DSEA 3NVKA 4BWJA 1HX1A 3ITHA 3O80A 4MQ3A 4PQUA 2OPRA 4IFEA 4BE0A 4CHQA 5I9EB 2VQFK 3KZBA 4IXCA 3R6MA 4J8FA 1NK4A 1V4SA 2YHWA 3LDSA 4B9TA 1VSMA 5EU7A 3O1WA 4CIGA 3UE5A 4A59A 1OVQA 3CG7A 1B92A 3EKUA 3OJSA 4A2BA 3DWLA 1ZBSA 1WN7A 1NOYA 4FWSA 4JD2B 1OH8A 2QKKA 3DRSA 1IJJA 1NGFA 5DK5A 2RF2A 5BN8A 1NGHA 3HL8A 4DTXA 1DLOA 1W97L 1TL1A 4Z4FA 4EIAA 2E1YA 3K59A 4MFBA 3RRGA 3ZSXA 1S1UA 3BZKA 4AHVA 2O8CA 4EZ6A 4A5BA 1E3MA 2QTDA 4RWTA 1ZXOA 3DLLL 4RCHA 3O9RA 3WT0A 5LY3A 4H0PA 3OYHA 4UQGA 4YDUC 5FRMA 3AO2A 1ITGA 4BRAA 4BRDA 4DU1A 1KQSM 1SL2A 1YJWN 3QO9A 3OS0A 1NOZA 4B9VA 3AGRA 3LDNA 4B9MA 2GUIA 3OS2A 5HP1A 3K57A 1EETA 1NK9A 4K0KK 1YIJN 3QICA 1T05A 2P9KA 4CF1A 2DFHA 4WFBL 1HJRA 4Y1CA 3L2VA 4F3TA 4JI5K 3M8SA 3LL3A 1DGKN 1VRUA 4JHDB 4I9QA 4BRGA 3EZWA 2G8IA 3V1QA 3CXCM 3LZJA 4CF0A 5J2PA 3LANA 4JI0K 1VSJA 4KH6A 4N76A 4BRFA 1KLMA 1EWRA 3MN9A 1ZBFA 1WBBA 4DTPA 4CJQA 1KFSA 4GV3A 3BY5A 2ZM6K 3QIOA 4CFBA 2A3ZA 3BEXA 4BRMA 3DRPA 3HOTA 4FLXA 5HOOA 5CYMA 1JCGA 3HM8A 4JKGB 3CCEN 1C0GA 4FK2A 4ZHRA 1QHAA 3CHWA 2OCEA 3OYFA 4KO0A 3NMUA 2P9SA 3QEVA 5AQOA 3VERA 3QBXA 3CFOA 2ZE2A 1O13A 2EWSA 3LDQA 4JS4A 1KVAA 2OTLN 5GAGP 3SUPA 4BC5A 3SYZA 1M1KO 3L3VA 2Q0UA 4X62K 3QLHA 3GOIA 3ID6A 4FWQA 3AVIA 3ZEUA 4B1VA 4DU4A 4EZ9A 3K5NA 2ZGYA 4QCLA 4YHHK 3FZFA 5JS1A 3HI0A 3IKMA 4YORA 1IG9A 3IS9A 3DMJA 1QQOA 4BRPA 3RR8A 2FLOA 3VEXA 2HBKA 3VPZA 4BG8A 3O3FA 2KHOA 1G99A 2H3GX 4FSVA 2G8FA 4NXMK 2KW4A 4IO9L 4E19A 1Q9XA 1NGDA 4DFKA 2QWLA 1XI1A 4YY3K 4IEEA 4PKGA 1RNHA 2F7TA 1GLJO 2OYQA 2ASPA 3AGKA 2DFFA 3VF4A 5KPZA 1VQ5N 1LV5A 1JLBA 4HWIA 4CK2A 1UAXA 1VQ6N 3MN7A 3MEGA 2WTUA 1VQKN 3ZX2A 2A1RA 3LP2A 4WQ5A 3K9JA 1NGEA 4M45A 3KTQA 1QE1A 2O8EA 3RMAA 1L5UA 4DQIA 1G15A 3MCPA 2ZJQL 4B9QA 2UU9K 3CMEN 3G10A 3FGUA 1LAVA 4CJLA 5JVGL 5F2RA 1UOCA 2IAJA 1TK5A 4CFCA 3TSPA 4U67L 5BREA 4OKEA 1J5OA 4XH4A 3U3YA 1VQ9N 4DSKA 1HPMA 4CGIA 3A2FA 3TPQA 3VESA 3H46O 4CK3A 1SQKA 3HVTA 4PWDA 2V7ZA 5FROA 4B3TK 4H0OA 4PL8A 1WB9A 3NGIA 3PSFA 3C65A 4CZIA 1YI2N 4FJXA 5AZJB 1N36K 3TTFA 4CJTA 5AQHA 1KLNA 3CC7N 4JKHA 2P9NA 3OYAA 2A6AA 4JYAK 3LAKA 4FW1A 5SZTA 1C0MA 1T3VA 2FXUA 4G1QA 4PKHA 5J1EA 4H4MA 4ID1A 3MCAB 3S3MA 1TL3A 3NF8A 4CEFA 1QS4A 4C8NA 3BDPA 4DQRA 3NVMA 1S1TA 3DI6A 3O8MA 3VQBA 1WAFA 4KBOA 4KRFA 1SKRA 1ZYQA 4DTSA 3CCQN 5AQWA 4ZTFA 1HKBA 1TUYA 3J80O 4LH5A 2V52B 1WAJA 5E26A 3D2FA 5AQMA 1JKHA 2YNFA 3ZT0A 1NMNA 5AQZA 2P51A 1QHTA 3SV4A 1B9DA 1BI4A 3MN6A 1Z6RA 4B1XB 3OYLA 4RW6A 3LDPA 4GV9A 4CERA 1VSEA 4AHSA 2O8DA 4B9NA 2OA8A 3U4LA 4DSFA 4UY8O 4HTLA 5AQVA 1QSYA 3AO3A 4OLAA 1U6ZA 4QS7A 3ZSRA 4IBNA 1BA0A 1DT9A 1XMQK 2VG6A 4CEZA 4FJMA 3AAQA 2Q1NA 3NHGA 4IZ9A 3O4NA 3VF6A 5TKYA 3OS1A 4CJFA 4NO7A 3F9KA 5DMRA 3AVJA 2UUCK 2E2PA 3HYFA 4DV0K 2A40A 4YOVA 4IO8A 4QS9A 1X1PA 4JKCA 1C1BA 3UIQA 4LF4K 1J5EK 2HB5A 4BY9C 4BRLA 3C7NA 1VSFA 3U9ZA 5GIOA 2FBYA 3UKUB 2Q36A 3P83D 3IRXA 5AQSA 4E7LA 2NUBA 4FOEA 3L4IA 3LWLA 1VAZA 2G8UA 4R5PA 1TKDA 1XC3A 4M3ZA 3DLEA 5AQQA 4CK1A 4CGDA 3A5MC 2FC0A 1HRHA 2DTUA 5EY4A 1YVNA 4DV6K 2QEXN 3OBWA 3SJJA 1XWLA 1S5JA 4B3SK 3FZMA 2OPSA 3CJ9A 4B08A 3NF7A 4F4KA 4CF8A 4G9ZA 2KFZA 3KK1A 2HNDA 1NGCA 4CFAA 1D4XA 4FM1A 3HZ6A 3VGMA 4H5NA 3OVNA 5KTQA 5C25A 3L2QA 4H0TB 1S6PA 3CERA 4JKBA 3AVAA 5AQUA 3PO4A 4FWOA 3AVNA 4FJIA 1J6ZA 5C0YA 2G8KA 3QIPA 3I8BA 3VQQA 1NJWA 4QOZB 2HHVA 3V9SA 3S3NA 1X3NA 2QWOA 3SLCA 4LC9B 3AVGA 4MLEA 4C23A 2UYTA 1GLLO 5C2FA 4KV8A 1P90A 5LMNK 3DM2A 1X9JA 1ESVA 4I2QA 3OYDA 1NWKA 1IBKK 2WFBA 1CLQA 3LP0A 3ZETB 3KK7A 1GLDG 4A57A 3CQYA 2QXFA 1X3MA 1CZBA 1IBMK 3FE1A 3C6AA 1L3SA 1JLAA 4KH4A 4FWNA 2KLAA 2BTFA 3GL1A 3ZT2A 3U9DA 5M1KA 3FFIA 1U4BA 2I7NA 4BRHA 3IFRA 5LJVA 1YITN 3MECA 1T6DA 2O8BA 3MWPA 3E9LA 2QXLA 4CGHA 3UKRB 3KKRA 3QESA 2F4VK 5AQTA 3LDLA 4K41A 4E7KA 4DF8A 2BDPA 2QK9A 4KHQA 1ZBLA 4HVJA 2E5LK 3ZX3A 1T44A 4H4OA 3AVFA 1QZ6A 2UUBK 1BO5O 4Y0WA 2F8SA 4DSIA 2HVHA 4CJEA 3TAGA 4LF5K 3TWHA 4EP4A 4LF8K 4B9UA 2QWRA 5HRRA 1HNZK 4BREA 3CCJN 4F3OA 2O4IA 2R7YA 1E4GT 4DR6K 3TI0A 1YAGA 3VTHA 4J2AA 3QFPA 3KVGA 5C24A 4BGBA 3PV8A 4HUGA 1NGBA 1VQON 4FWMA 3LP1A 3A5LC 4KH5A 2EX3A 2F9WA 3CC2N 3AAPA 2HMPA 4BRKA 3OW2M 4GKKK 3FZKA 3U8XA 2FSNA 3VGLA 4AHUA 1QZ5A 3THXB 4DTJA 3CM5A 5A2QO 1TK8A 4HUFA 1Z05A 4LFBK 5TKWA 1YJNN 2KZMA 2VWJA 1XNQK 3KD5E 4GKJK 3J81O 2FBVA 3NFAA 1HQUA 4DV5K 1W9HA 3AVCA 1RTDA 1BIZA 1NM1A 2PBDA 1BDGA 2HHTA 3HXMA 3BGRA 3SMSA 1M90O 3CFPA 3THWA 4OX9K 3AVLA 3CCUN 4O44A 1D8YA 4CEEA 5IWAK 3T1AA 3OJUA 3QETA 3PLAA 5CZ2A 4W5NA 4KTZA 1KFDA 2G8HA 1R0AA 1EXQA 2HBLA 3MDQA 2ZD1A 1KRPA 3FZLA 3P39A 4CHOA 4FYDA 3WXJA 4M63C 3CJCA 4H8KA 1BUPA 5C10A 3MMVA 1NLVA 1QQCA 3CCMN 5KRTA 4CEAA 1EX4A 3P31A 3EY1A 3QBWA 1WSIA 3ZSZA 3CJ7A 4PY5A 3SUQA 5EVZA 2G8VA 3CC4N 4BR4A 3VQDA 2ITGA 5BRHA 3QEPA 1RDBA 4BWMA 2OZSA 3CIPA 2E88A 3DYAA 4FK0A 2HOEA 1J9AA 5M1NA 4CZJA 2JWKA 3D2FB 3S9HA 2HHQA 4OPAA 3AVBA 3V9ZA 4X64K 1YHQN 4PUOA 4B3RK 3QEWA 3KKSA 4BQZA 3I0RA 3QEXA 4R79A 3ZX0A 2X6SA 1ZBUA 4CEOA 5EXWA 4AILC 3HK2A 3RVCA 1VSHA 2A42A 3QDKA 3PO5A 4JI3K 3H1VX 1VSDA 2NRVA 2YHXA 1WSHA 1LOTB 4CE9A 4FOIA 3ENHA 1QSSA 1NJIO 4B1UB 5H1SQ 4FW2A 4CECA 2OPQA 4DB3A 1LWEA 2X78A 1Q8IA 1HJOA 3HP6A 1IV0A 3RR7A 4M3TA 4KHNA 1ILYA 3TU5A 4OO1J 3K0SA 4BGAA 5GADP 4FJ8A 1KCFA 4BR7A 1K73O 1VQ7N 1DTTA 3HO1A 4EHTA 4NYFA 3BF1A 3BF3A 3OYMA 3Q7CA 1ZBHA 2KFNA 2P1JA 1N5YA 4HCCA 1N32K 2CH6A 1D9FA 4YNQA 3VN5A 3B6OA 2ASMA 3SCXA 4J2DA 5HRPA 3H3NO 4OGEA 3MXIA 3FLCO 5JLFA 3F9MA 4C1NK 4M41A 2NZTA 2A41A 4RTFD 2NRTA 3JYTA 5JMVA 1S3XA 3L3UA 4H5VA 4Z4CA 2ZF5O 2YKNA 1SZ2A 2FF3B 3DRRA 4DSJA 5E41A 1FKOA 3N4QA 1U2VA 2GWKA 5KGXA 3T1HK 4FVMA 3VA0A 5KPTA 3ZT1A 4JS5A 3CCVN 3G6EN 3DLRA 3MK6A 4AHTA 3MN5A 4Z0UA 3V4IA 5BPMA 1NGJA 5AZIA 1NK0A 2CGJA 4Z4GA 2O4GA 1ATNA 4B1YB 3E66A 3VEWA 4M3WA 2YHAA 3MXJA 3G4SN 4JK8A 1XHZA 1GOAA 5AQYA 1MWMA 2F8TA 1S22A 4XEIA 3SPYA 2P5OA 1RBRA 2HHSA 1VHXA 3SAGA 3F73A 3AA5X 3NAEA 4CESA 4WQ4C 3W3DA 3TABA 4M3UA 1RDUA 2PYJA 4M3RA 1YUWA 4ID5A 4K42A 5BR9A 4JI6K 2Q0RA 3J7AP 3VETA 3KLGA 2P9PA 3U6FA 4FPBA 3VQCA 3QMLA 4JK7A 2W40A 3CETA 3KWGA 3EYZA 1E4FT 5FPMA 1XQSC 2QI2A 1Q86O 4B9SA 4LSLA 2YX6A 4X65K 1I3AA 4IKFA 1TAQA 5HLFA 3A5OC 1U49A 3D2EA 2V51B 3EL2A 1JCEA 2RKIA 3UB5A 2O8BB 2PZSA 1CXQA 5BRDA 5AQKA 1NNEA 1LWFA 3JSMA 1W0HA 3WNGA 5JVHL 4I6MA 1K8KB 1XHXA 4I9LA 1TYQB 4PHTX 3R3LA 5JS2A 1JL2A 3NCIA 4AQYK 3W0LA 2XO7A 5FRNA 3OBYA 1NGIA 2D4WA 3LM9A 1IG8A 3ZSQA 2XY7A 3NH2A 2YKMA 3OA9A 3SQ0A 2BANA 4E7JA 4Y1DA 3SZ2A 1TKTA 4FLYA 4RW7A 4X66K 4HTUA 4BQLA 4MO4A 4DV3K 1WBDA 3K5MA 4C8LA 1FXXA 1C0UA 2W42A 5CR4A 2VCPA 2NRHA 3E01A 3HT3A 4A5AA 1QVFM 2Z1JA 3ENOA 2QWMA 1KC8O 4BR2A 5DM6L 1LW0A 1EP4A 4PKIA 4FZYA 3SBTA 4DQQA 1XMOK 2YI1A 3NH0A 2A5XA 2IVOA 4CFDA 3VQAA 2RHKA 3M8QA 4BDPA 1FKPA 1RDWX 5AQXA 4BRNA 3M1FA 1BHLA 4CD3A 4CZGA 1UA0A 3ZLJA 4PL7A 4QAGA 4NYNA 4OVLA 1JJ2M 3GG4A 1S1XA 3MAQA 3WEEA 4O0IA 4FVUA 1NKBA 2VQEK 1RT2A 3THWB 3HRGA 3EZ5A 3T69A 4KAZA 1GLEG 2FF6A 3ZCMA 4CIFA 3HBTA 2P9IA 3OYBA 4DUZK 4CD1A 3SUOA 3QFUA 3FZHA 4BE1A 4H5RA 1NJZA 3HVRA 3I0SA 4DLEA 2P9UB 4IJAA 2GELA 3GE1A 3HPHA 4Q5VA 1QQNA 4LF9K 5HRSA 3SI6A 2XHBA 3HSCA 3ENBA 4IDHA 3L2RA 4NLBA 3OYGA 5M1FA 3E9OA 4FZZA 4LFAK 2HMIA 4MDBA 4CZKA 3ALYA 3C95A 4IJNA 1KSPA 3TAFA 2FBTA 5C12A 4DV1K 1FW6A 3VQ7A 4ELUA 1F21A 4BRCA 1R59O 3K2PA 3L4QA 4O5BA 3AO4A 2QM1A 1FJGK 2ZGZA 1KVBA 1Y64A 4FJHA 5FLXO 1QSLA 1KVCA 3OHRA 3A8YA 3I33A 2PFUA 5M1QA 5CY4A 5HL7L 4JI1K 5EX5A 4FJJA 5LMUK 4FO0A 1WSEA 5KPRA 4CHNA 3U3GA 3QNOA 4U7BA 3SNNA 3HPOA 4YDUA 4CJRA 2Z1IA 1BQNA 2D0PA 4FJLA 1DEJA 2O8CB 2YCHA 4WFAL 3QERA 4CJSA 1T8EA 1N34K 1C6VA 4Z4EA 4O55A 3L0QA 1GLCG 1NGAA 4K25A 4BE2A 5EOYA 3WXMB 1DKGD 3QINA 4DFPA 1IKYA 4Z94A 1RTJA 3NGZA 1IKXA 2X6NA 4DR4K 2P9KB 4BACA 1J54A 2QWPA 2E2OA 4E0DA 3ULDA 3L2WA 3VMFB 3O5BA 3D6RA 1Q9YA 1HKCA 1BGXT 4JV5K 1IBLK 4A62A 4BR9A 1OH5A 5FDLA 4J2BA 1U48A 5AQGA 1S1VA 3VGKA 1JCFA 1VQNN 3RTVA 4FJ5A 5BN9A 4ISEA 3DAWA 3CQXA 1RGIA 4W5RA 1T7PA 4DUYK 4JLHA 3NH1A 3NF6A 5FPEA 2XY5A 1RCHA 3WUHA 4CF9A 1B9FA 4MO5A 3O9SA 1O1WA 1IKWA 3L2UA 1CZ9A 1IO2A 2ZJRL 1N33K 5AQJA 1HMVA 4QS8A 4KPYA 3BUZB 1SAZA 4CZLA 4JKGA 3V1OA 2VGMA 4XH5A 3E9PA 4HUEA 1RILA 4BC4A 3ULEA 1U2VB 4BDYA 1EO1A 4CBXA 1NK8A 1SKSA 1C1CA 3AA2A 3ATVA 1KD1O 3PSIA 3V9WA 1HQEA 5AQNA 2P9SB 2P5GA 1TK0A 1RT4A 4LY7A 1YJ9N 1VK0A 4CI6A 4C8KA 4JKAA 2P9LA 4KI6A 4H5WA 3VOVA 3AO5A 4WQ4A 3DLKA 4IG0A 4FCYA 4Z4IA 3TAQA 3CCLN 4O5FA 4FLVA 4DQSA 2KQ2A 3CPEA 1XC9A 3O9UA 4A61A 4B8AB 3SUNA 2BE2A 2GX9A 5MLCQ 3HP9A 4DTNA 1ZBIA 4DR7K 3KK2A 4B1ZA 3ZEUB 3MWTA 1YF5L 2I5JA 1U47A 1MA9B 2GTDA 2NRZA 5JICA 1RDCA 4OPJA 4IDKA 3DJCA 3S41A 2NRXA 4M42A 5IT9O 3DXKA 1RFQA 3F2KA 4JI4K 4CZHA 3VQ4A 1UA1A 5AQIA 3WXIA 3PX0A 3J8AA 4N56A 5JLHA 3VTIA 4IWVA 4K8ZA 3CD6N 1SV5A 4IOAL 2UXCK 4FJGA 5AQFA 1JXBA 4K43A 2KTQA 3SMPA 2XRIA 4KHWA 4NCAA 4GY2B 3IAYA 3O3GA 4B3OA 3AV9A 4I6MB 2YJEA 4E1JA 3H08A 2O8EB 3LDOA 3SPZA 4KTQA 1LCUA 2OPPA 4FLUA 3T1YK 4ILGB 4WQ5C 4FM2A 2PY5A 4DQPA 1CZAN 1VQPN 4OLBA 2QWQA 5I42A 5F0XA 4CJKA 4FZXC 5HRNA 4L3QA 3QEIA 4I7FA 2D0BA 2ZJPL 4CEQA 1ASVA 5BPNA 5KQDA 2OZMA 1SS6A 4H0VB 1WSJA 3QB0A 3BZCA 3VF2A 4Q0BA 4CHPA 3K5LA 1QTMA 4CHYA 1ATRA 1EQYA 3SBGA 3CJAA 4WF9L 4DHYA 5KI6A 4HCBA 4N41A 4M3YA 4DTOA 3TR8A 2XY8A 3B8AX 1BU6O 3A5NC 2P9NB 3R1XA 1NBWA 3TTCA 4CZFA 4V19S 2QKBA 3IUCA 4DU3A 3L6QA 4H0YB 4MDAA 2O8FA 2GEMA 3PUFA 3NBPA 4KTWA 1TAUA 1Q82O 1N6QA 3F5TA 4OKJA 3H1QA 4PA1A 4ZTJA 4KFBA 4L8RB 3GBTA 1NJXA 1K6YA 2D0OA 1KXPA 2P9IB 2B5JA 4OPKA 3V81A 1I94K 2KKZA 4JKEA 2F9TA 4O4GA 4W5OA 2GV9A 4JI2K 3THYA 1NK7A 4DV4K 4DR2K 1XUPO 2WOMA 1BI4B 3IG1A 3O4QA 4NB4A 4DV2K 3CFRA 1JLQA 3DLGA 4ELTA 2CH5A 2GUPA 1YVUA 2FSJA 4Z4HA 3K9KA 5C2DA 4LF6K 1SKWA 2O8DB 1BIUA 3L8BA 5AJ3K 3WXKA 3SQ2A 3CF5L 4RW8A 1C0TA 1REVA 1DTQA 2IGIA 4CJ3A 3TAEA 3G71N 1TGOA 2Y1IA 2HBMA 4H03B 5T7BA 3OYJA 2VG5A 3EE9A 4AM6A 4CBUA 2YNIA 4IG3A 3MXMA 2QWNA 3SK3A 1L3VA 3WQTA 4KREA 1KAZA 5GAHP 3V9XA 1D5AA 2QW9A 4DR1K 3KLEA 1T6CA 2A1SA 1RT7A 2PYLA 3HSTB 2ETJA 1WOQA 1T03A 4JEPA 4LD0A 3UKUA 4BROA 3C7NB 1RT3A 1RDAA 2CGKA 1RTHA 4M7XA 3VQPA 1W7AA 2PAVA 3VQEA 2GWJA 2WONA 2WBNA 3NGYA 3RSEA 2EHGA 5CZ1A 2NNWA 1BWFO 3JAMO 5K14A 5B8HA 1IKVA 3PIOL 5AQPA 3OYIA 4GV6A 4F2SA 1L3TA 1ASWA 4DS5A 3VEOA 4FLZA 3H3OB 3H45C 5E84A 4BG9A 3P1GA 4H0XB 3ID8A 2Q97A 3R9PA 1X9WA 4DV7K 3M5RA 3IDHA 4LFCK 3SV3A 2YV0X 4XH1A 4JI7K 3TTDA 2IDOA 2BH1A 4DLGA 4C8OA 1LWCA 2W6KA 3O4WA 4EP5A 4N5SA 2W6LA 3ULEB 1VQ8N 3OY9A 3LP3A 5J2NA 1GLAG 3OTOK 4CF2A 1X9SA 3ZETA 5CHIA 2VGNA 1HKGA 4DS4A 3WQUA 3MX2A 1X9MA 4RG8A 2BUPA 1HLUA 2E1ZA 5ADXH 2P9LB 4CZEA 2HHXA 1BOTO 3VQ8A 4RW4A 4N47A 3NE6A 4FJKA 5BR8K 4E89A 2IOCA 2RPIA 3LPUA 3P38A 4JKFA 5D3GA 2WC9A 3WNEA 5SWMA 1KAYA 1WLJA 3HJFA 3O1BA 3O9TA 1H1VA 2NRRA 1MDUB 3K58A 3V9UA 3AA4A 4GNIA 2LSNA 3TAMA 3C6TA 5BRFA 2IC3A 4CCHA 1JLCA 1V4TA 3UKRA 4IEIA 1S6QA 4CJ5A 1WSFA 4C8MA 5AQLA 4J2EA 5AFUA 2FSKA 2JWLA 1NK5A 4O8UA 3C6UA 3DXKB 2RN2A 3ISNC 5KGWA 1VQMN 4DR3K 4AM7A 2UXBK 4AF1A 4W5QA 4CGGA 3OYCA 3FR0A 3VA3A 4KI4A 2DPNA 3FFKB 4JKDA 4FLTA 2E20A 4CW7B 4FPAA 1NKEA 1OH6A 3O08A 4BC2A 1BISA 1HNIA 4DMNA 3WXLA 4NCGA 4GVMA 3M8PA 3SAFA 4OJRA 1WUAA 2VWBA 4O8KA 5FPDA 4A2AA 3V6DA 1W2BM 3SJHA 3KHYA 4FJNA 1SL1A 1P8ZA 3S3OA 1BA1A 3AVKA 1RT6A 4DG1A 2GBZA 2YNHA 3O6WA 3ZSVA 3AY9A 3THXA 2CGLA 3D7EO 3ZSWA 4YOXA 4FL9A 4ELVA 2FBXA 4EHUA 2DFEA 3HTVA 4FWPA 2W41A 3KK3A 4KKOA 4KHUA 3EO3A 4IOXA 4E7IA 3VQ6A 3WNFA 5J2QA 4AH9A 1SUQA 2YJFA 3LWMA 5F1XA 1GLBG 5M1OA 1BL3A 5M1PA 3SAHA 1C0FA 3ZSYA 4M3XA 1QVGM 2HNYA 1VSLA 4ILHA 3CMAN 3T7ZA 3M3ZA 1RBVA 2ZWHA 3I8DA 4CJPA 1HYZA 4IFVA 4KHSA 2IS3A 3CYMA 2YHYA 4JN4A 1LW2A 3CCRN 4WE1A 4CJUA 4I2PA 1K9MO 4CHZA 1A5XA 2Y1JA 3JXUA 1A5WA 2X74A 1CXUA 1NJYA 3Q7BA 2NLXA 1JXEA 1Z25A 2VG7A 3DXMA 2D1KA 2O8FB 4BC3A 4TSXA 5CYQA 4JI8K 3EKSA 1Q81O 3VEYA 4CBWA 2G8WA 1YT3A 4LF7K 2I7PA 3AO1A 3KLHA 1BG3A 4DTUA 3N4PA 4KHYA 4K8XA 4BRIA 5J2MA 1L3UA 3HOSA 1A5VA 3ZT4A 5GAEP 1OVYA 3EEQA 5FPNA 4CGJA 2AA4A 3THYB 4JD2A 1OH7A 3T3FA 1C1AA 2WUSA 3EN9A 4KB1A 4F8RA 3RMBA 4CGFA 1ZC6A 4JNEA 1K8AO 4FJ7A 3ASMA 1KTQA 5BPLA 3M6GA 1NMDA 2VYPA 1U45A 4YOUA 3G0ZA 4DFJA 4F9OA 3RMCA 1TVRA 1GOCA 1RBSA 2AJQA 1S1WA 1NK6A 3O9QA 1TV6A 4DSLA 3NF9A 3DOLA 2DY4A 3KIOA 3WNHA 3RRHA 4OKKA 4CZMA 4OPHA 1YXQA 3AVHA 1U04A 5GINA 1RT5A 1RDDA 3J7YP 2NRWA 4EAHD 2E6MA 4OGCA 1WSGA 1BQMA 1YTUA 1S9EA 3TANA 5AQRA 3LZIA 2Z1HA 4JHDA 3P5JA 4FWLA 1YTAA 5KRSA 4B3MK 1TKXA 4YOWA 3A0IX 3AA3A 3R8EA 1MU2A 1BCMA 1ASUA 4AHCA 1HNXK 4BVPA 2HF4A 3RMDA 3VQ9A 3T19A 3CCSN 3AVMA 3C94A 3LM2A 4YFUA 3D0PA 2UXDK 3VENA 1D9DA 4HHTA 1HUXA 3RSEB 2BGGA 4CJWA 4FM0A 2AP1A 3IMXA 1EWQA 5C15A 2Q31A 4E1MA 1Y97A 1Q7YO 1LAWA 5ELZA 1IH7A 5C42A 3DLHA 4M7YA 4DQ8A 1JLEA 2IVPA 4BDZA 3TAPA 4C1NI 3I56N 1UWBA 4W5TA 4KHPK 2D5RA 4BR0A 5KQ8A 3VEVA 1RBUA 4ISGA 3RWUA 4WCEL 4DR5K 4DF4A 5AZIB 2JLEA 3MEDA 2HHUA 4FJ9A 2ZQBA 2OANA 4IFYA 3TSQA 3SQ4A 4CIEA 1VQ4N 2J4RA 3NDKA 3KLIA 3CQ8A 2YHBA 3G25A 2E4LA 4GW6A 5CE3A 3PX4A 1KAXA 5HROA 1GLFO 1HNWK 3CI5A 4B1WB 1Z26A 3B6PA 4BR5A 3O3HA 4ICLA 1QQMA 3V1RA 3KJVA 4FK4A 2Q3SA 3BP8A 5ADXA 1S72N 3HM9A 4RW9A 2QA4N 3KWIA 1HNVA 1EKEA 2ATQA 2P9PB 5LJWA 2HNZA 3QNNA 3CJ1A 3MEEA 1OKJA 1JLFA 3LAMA 4YOYA 5LL6Z 4ILJA 2RE2A 5AFUH 2HF3A 3P4IA 4CEDA 2HHHK 4IOCL 3J7ZO 3TSUA 2VWKA 2ITMA 1NU0A 3D2EB 1S9GA 4DCHA 4DTMA 4BVOA 3OYEA 3PY8A 1NG9A 4F2RA 4E1NA 3C0BA 3AARA 4FLWA 1VSKA 3VQ5A 1J53A 2HHWA 1K8KA 1RBTA 5GIPA 1TUUA 1TYQA 4B9LA 4ISFA 4CEBA 1WNSA 3TARA 2HVIA 3OYKA 2E6LA 2Z1GA 3JS6A 4O0JA 2HW3A 2IVNA 3ZT3A 4FWKA 4CJ4A 4WYBA 4CVNE 2F96A 2HBJA 4DKWA 2UUAK 3K5OA 4H5TA 5I3UA 2HSTA 2Q2RA 3CJBA 4E3SA 3CPWM 3LALA 1N8RO 4DWIA 3I55N 3SQ1A 2D0AA 1GOBA 1ATSA 4AHRA 1BCOA 4YOTA 1MWKA 3VEZA 4NCBA 3C6HA 4LSNA 4WFNL 4JRPA 3E1YA 3KD1E 3CM6A 2B4JA 2E2NA 1TKZA 3H6EA 1HR0K 5DM7L 4KB0A 2XY6A 5AZJA 4XIUA 1RTIA 1XNRK 4FXDA 3D45A 4CJVA 2YNGA 5HBMA 1HYVA 4MLHA 1VQLN 2E2QA 4JK9A 4DTRA 3THVA 3ZYYX 4NXNK 2ASOA 3M8RA 2V7YA 1JL1A 3ATUA
chains in the Genus database with same CATH topology
4CFAA 4FM1A 2JGUA 3DOKA 1X9WA 1UA0A 3OVNA 1SL0A 4QAGA 1HPZA 4NYNA 4OVLA 5KTQA 5C25A 1HYSA 2D0CA 1I39A 1JLGA 1VSIA 3L2QA 3KLFA 3SV3A 1S1XA 1S6PA 2YV0X 3MAQA 3AVAA 3PO4A 4B8CA 3AVNA 4O0IA 2IDOA 4FJIA 3PX6A 1NKBA 1RT2A 3DLBA 3EZ5A 4DFMA 2G8KA 1FK9A 4DLGA 4C8OA 3QIPA 3VQQA 1NJWA 4QOZB 1LWCA 4KAZA 3V9SA 2HHVA 3S3NA 1NKCA 1VRTA 3HPGA 4LH4A 4GMJB 1RT1A 3ZCMA 4EP5A 4CIFA 4N5SA 3OYNA 4E7HA 3LPTA 3AVGA 4JRQA 3OYBA 3OY9A 3LP3A 5J2NA 3SUOA 4KV8A 3ZSOA 2KZZA 4BE1A 2B6AA 3DM2A 4CF2A 1X9SA 4I2QA 3OYDA 1CLQA 3LP0A 1NJZA 3HVRA 3I0SA 4DLEA 2QXFA 4DS4A 1X9MA 4Q5VA 3HPHA 1CZBA 4DSEA 4RG8A 5HRSA 3SI6A 4BWJA 1L3SA 2XHBA 3ITHA 4MQ3A 4PQUA 2HHXA 2OPRA 1JLAA 3VQ8A 3L2RA 4RW4A 4BE0A 3OYGA 4CHQA 4N47A 3NE6A 4FJKA 4FZZA 4E89A 2IOCA 2RPIA 2HMIA 3LPUA 3ALYA 3C95A 3ZT2A 1KSPA 3TAFA 5D3GA 1NK4A 2FBTA 3FFIA 3WNEA 5SWMA 3LDSA 4B9TA 3VQ7A 1U4BA 1F21A 1VSMA 1WLJA 5EU7A 3V9UA 4ELUA 3HJFA 4CIGA 3K58A 3AA4A 3K2PA 2LSNA 3TAMA 3CG7A 1B92A 3C6TA 3MECA 4O5BA 2IC3A 3OJSA 4CCHA 3AO4A 1JLCA 1S6QA 1KVBA 1WN7A 4CGHA 1WSFA 4C8MA 3KKRA 4CJ5A 1NOYA 1QSLA 2QKKA 3QESA 4FJHA 1KVCA 4J2EA 2KFNA 3DRSA 5DK5A 5CY4A 1NK5A 2RF2A 4E7KA 4DF8A 2BDPA 2QK9A 3C6UA 4KHQA 3HL8A 2RN2A 3ISNC 5KGWA 1ZBLA 4HVJA 4FJJA 4DTXA 1DLOA 4H4OA 1TL1A 1WSEA 3AVFA 4Z4FA 4CHNA 4W5QA 3U3GA 3K59A 4MFBA 4CGGA 3ZSXA 3OYCA 3QNOA 3RRGA 3SNNA 2F8SA 1S1UA 4AHVA 3HPOA 4DSIA 2HVHA 4CJEA 3VA3A 4CJRA 3TAGA 2Z1IA 4KI4A 4EZ6A 1BQNA 3TWHA 4FLTA 4FJLA 1NKEA 4EP4A 3QERA 4CJSA 1T8EA 4B9UA 1BISA 5HRRA 1HNIA 3OYHA 4DMNA 1C6VA 4UQGA 5FRMA 3AO2A 4Z4EA 4O55A 1ITGA 4NCGA 4GVMA 3M8PA 4F3OA 4DU1A 1SL2A 4BE2A 2O4IA 4OJRA 3QO9A 2R7YA 3OS0A 1NOZA 3QINA 3V6DA 3TI0A 4DFPA 4J2AA 1IKYA 4B9VA 5C24A 1RTJA 3NGZA 4B9MA 2GUIA 3OS2A 5HP1A 3PV8A 3K57A 1EETA 1NK9A 1IKXA 4HUGA 1T05A 4FJNA 1SL1A 4CF1A 2DFHA 2X6NA 3S3OA 3LP1A 4BACA 1J54A 2EX3A 3AVKA 1RT6A 1HJRA 4DG1A 3ULDA 4Y1CA 2GBZA 3L2VA 4E0DA 2YNHA 4F3TA 3ZSVA 3M8SA 3L2WA 4AHUA 1VRUA 1Q9YA 1BGXT 4I9QA 4DTJA 3ZSWA 3CM5A 5FDLA 4J2BA 2G8IA 3V1QA 1TK8A 4HUFA 1U48A 4ELVA 3LZJA 2FBXA 1S1VA 2DFEA 4CF0A 5J2PA 3LANA 2KZMA 3RTVA 2VWJA 1VSJA 3KK3A 4N76A 1KLMA 4FJ5A 4KKOA 4KHUA 4E7IA 5J2QA 1T7PA 3VQ6A 3WNFA 1ZBFA 4W5RA 4AH9A 1SUQA 3KD5E 2FBVA 3NFAA 1HQUA 3LWMA 4DTPA 1BL3A 4JLHA 1W9HA 3AVCA 4CJQA 1KFSA 3NH1A 3NF6A 2XY5A 1RTDA 1RCHA 1BIZA 3ZSYA 4M3XA 2HNYA 1VSLA 4CF9A 1B9FA 3QIOA 4CFBA 1O1WA 1IKWA 3HXMA 2HHTA 3L2UA 1RBVA 3BGRA 3I8DA 1CZ9A 1IO2A 3CFPA 4CJPA 1HMVA 3AVLA 1HYZA 4IFVA 4O44A 4KHSA 3DRPA 2HW3A 2IS3A 3CYMA 1D8YA 4CEEA 4KPYA 3T1AA 3OJUA 4FLXA 3QETA 1LW2A 4WE1A 3V1OA 5CYMA 5CZ2A 4W5NA 4KTZA 1KFDA 2G8HA 1R0AA 4CJUA 4I2PA 4HUEA 4FK2A 1RILA 4CHZA 1A5XA 1EXQA 4ZHRA 4BDYA 2ZD1A 1KRPA 2Y1JA 1NK8A 1SKSA 1A5WA 1C1CA 3OYFA 3AA2A 2X74A 4KO0A 4CHOA 4FYDA 1CXUA 3V9WA 1HQEA 1NJYA 3QEVA 2P5GA 4H8KA 1JXEA 1Z25A 2VG7A 1TK0A 1RT4A 4LY7A 1QQCA 3CFOA 1VK0A 5KRTA 4CEAA 1EX4A 4C8KA 2ZE2A 3EY1A 4TSXA 5CYQA 1WSIA 3ZSZA 4KI6A 2G8WA 4JS4A 1YT3A 3AO5A 3SUQA 4PY5A 3DLKA 4IG0A 4FCYA 4Z4IA 3TAQA 1KVAA 3AO1A 2G8VA 3KLHA 3SUPA 4DTUA 3VQDA 2ITGA 3SYZA 3QEPA 4FLVA 1RDBA 4BWMA 4DQSA 2OZSA 4K8XA 4KHYA 2KQ2A 3DYAA 3L3VA 1XC9A 4FK0A 1J9AA 5J2MA 1L3UA 4B8AB 3SUNA 1A5VA 3QLHA 3ZT4A 2BE2A 3S9HA 3HP9A 3AVIA 4DTNA 1ZBIA 4DU4A 2HHQA 4EZ9A 3AVBA 3KK2A 4CGJA 3K5NA 3V9ZA 4QCLA 3T3FA 4PUOA 2I5JA 1U47A 5JS1A 3QEWA 1C1AA 3KKSA 1IG9A 3IS9A 1RDCA 3DMJA 4OPJA 3RMBA 4CGFA 4F8RA 4IDKA 4KB1A 3I0RA 3O3FA 3RR8A 4FJ7A 4M42A 3QEXA 3ASMA 1KTQA 3VQ4A 1UA1A 2X6SA 1ZBUA 4CEOA 3PX0A 4AILC 2G8FA 4N56A 3HK2A 2KW4A 1VSHA 4E19A 1Q9XA 4DFKA 3PO5A 4K8ZA 1VSDA 1XI1A 1SV5A 1U45A 1RNHA 3G0ZA 4DFJA 2OYQA 3RMCA 2DFFA 1TVRA 1GOCA 1WSHA 1RBSA 2AJQA 4CE9A 1S1WA 1LV5A 4FJGA 1NK6A 1QSSA 1TV6A 1JLBA 4CK2A 1UAXA 1JXBA 4DSLA 2KTQA 4FW2A 3NF9A 3DOLA 2OPQA 3MEGA 4CECA 2XRIA 2A1RA 4NCAA 4KHWA 3LP2A 2DY4A 1LWEA 3KIOA 3O3GA 2X78A 3WNHA 4OKKA 3RRHA 3IAYA 4B3OA 3AV9A 1Q8IA 4M45A 3HP6A 3KTQA 1QE1A 3RR7A 4KHNA 4M3TA 3AVHA 3RMAA 1U04A 1L5UA 4DQIA 3H08A 1RT5A 1RDDA 1G15A 3SPZA 4KTQA 2OPPA 4FLUA 4FM2A 2E6MA 2PY5A 4FJ8A 1KCFA 4OGCA 4DQPA 1WSGA 1DTTA 1BQMA 3G10A 3HO1A 1LAVA 4NYFA 4OLBA 1YTUA 1S9EA 4CJLA 3TANA 3LZIA 2Z1HA 3OYMA 5I42A 3P5JA 5KRSA 1UOCA 1YTAA 2IAJA 4CFCA 1TK5A 1TKXA 1J5OA 2P1JA 4OKEA 1N5YA 4CJKA 4HCCA 3U3YA 4FZXC 3AA3A 5HRNA 1D9FA 4DSKA 1MU2A 1BCMA 3QEIA 4I7FA 1ASUA 4CGIA 4YNQA 4AHCA 2D0BA 3VN5A 3B6OA 3A2FA 4CEQA 1ASVA 3RMDA 3VQ9A 3SCXA 4J2DA 3T19A 3AVMA 2OZMA 5HRPA 3C94A 4CK3A 4YFUA 3D0PA 3HVTA 4PWDA 5FROA 1D9DA 4OGEA 3MXIA 1WSJA 4HHTA 4Q0BA 4CHPA 3K5LA 4M41A 4CHYA 1QTMA 1ZBHA 2BGGA 4CJWA 4FM0A 3NGIA 3JYTA 4HCBA 5KI6A 4FJXA 4E1MA 4N41A 3L3UA 1Y97A 4M3YA 1LAWA 4Z4CA 4DTOA 3TR8A 2YKNA 1IH7A 3DRRA 2XY8A 5C42A 4CJTA 5E41A 3DLHA 1KLNA 4DSJA 1JLEA 1FKOA 4BDZA 3TAPA 5KGXA 1UWBA 3OYAA 4FVMA 3VA0A 3LAKA 3ZT1A 4W5TA 4JS5A 4FW1A 5SZTA 3DLRA 4AHTA 1C0MA 2D5RA 4G1QA 4Z0UA 2QKBA 3RWUA 1RBUA 3V4IA 4DU3A 1NK0A 5J1EA 4Z4GA 2O4GA 4H4MA 4ID1A 4DF4A 3S3MA 1TL3A 2JLEA 3MEDA 4M3WA 4FJ9A 2HHUA 2YHAA 3MXJA 2ZQBA 3NF8A 4IFYA 3PUFA 4CEFA 4CIEA 3SQ4A 1QS4A 4C8NA 3NBPA 3NDKA 3BDPA 4KTWA 3KLIA 4DQRA 1XHZA 1N6QA 1TAUA 1S1TA 1GOAA 3DI6A 1WAFA 2YHBA 4OKJA 3VQBA 2E4LA 4GW6A 3CQ8A 2F8TA 4KRFA 4PA1A 4ZTJA 1SKRA 4KFBA 1ZYQA 3PX4A 4L8RB 4DTSA 3SPYA 1NJXA 2P5OA 5HROA 1K6YA 4ZTFA 1RBRA 2HHSA 1Z26A 3F73A 2B5JA 3B6PA 3AA5X 3O3HA 4LH5A 4OPKA 4ICLA 3NAEA 3V81A 1WAJA 3V1RA 3ZT0A 1JKHA 2YNFA 4CESA 3KJVA 3TABA 4M3UA 4FK4A 2PYJA 4O4GA 2Q3SA 4M3RA 4ID5A 2P51A 4W5OA 1QHTA 3SV4A 2GV9A 1B9DA 4RW9A 3HM9A 1NK7A 1BI4A 3KLGA 1HNVA 1EKEA 2WOMA 1BI4B 2ATQA 3U6FA 3IG1A 3VQCA 2HNZA 3O4QA 3EYZA 3QNNA 3MEEA 3OYLA 1JLFA 3CFRA 3LAMA 4B9SA 4RW6A 1JLQA 3DLGA 4LSLA 4ELTA 1I3AA 1YVUA 4IKFA 4CERA 4CEDA 4Z4HA 1VSEA 4AHSA 1TAQA 1SKWA 4B9NA 2OA8A 4DSFA 1BIUA 5HLFA 1U49A 3L8BA 2VWKA 1QSYA 2RKIA 1S9GA 4DTMA 3AO3A 2PZSA 1CXQA 3SQ2A 4OLAA 3OYEA 3PY8A 4F2RA 3ZSRA 4IBNA 4E1NA 1LWFA 3JSMA 1W0HA 4RW8A 1C0TA 4FLWA 1VSKA 2VG6A 3VQ5A 1REVA 4CEZA 1DTQA 2IGIA 3WNGA 4FJMA 1J53A 4CJ3A 2HHWA 1RBTA 3TAEA 3NHGA 3O4NA 1XHXA 1TGOA 4B9LA 2Y1IA 4CEBA 4I9LA 1WNSA 5T7BA 3TARA 2HVIA 3OYKA 2E6LA 2Z1GA 4O0JA 5JS2A 1JL2A 4CJFA 3OS1A 2VG5A 3OYJA 3NCIA 2XO7A 3F9KA 5FRNA 3ZT3A 2YNIA 4IG3A 3MXMA 5DMRA 4CJ4A 3ZSQA 2XY7A 1L3VA 3AVJA 4KREA 3HYFA 3NH2A 3V9XA 1D5AA 2YKMA 3SQ0A 2BANA 3KLEA 4E7JA 2F96A 4Y1DA 3SZ2A 1TKTA 4FLYA 4RW7A 3K5OA 1X1PA 5I3UA 2A1SA 1RT7A 2PYLA 1C1BA 3HSTB 4HTUA 3UIQA 4E3SA 2ETJA 2HB5A 3LALA 1T03A 4DWIA 4LD0A 3SQ1A 1VSFA 3K5MA 2D0AA 4C8LA 1GOBA 1FXXA 4AHRA 2FBYA 1C0UA 1RT3A 1BCOA 2W42A 3P83D 1RDAA 3IRXA 4E7LA 2NUBA 3E01A 3HT3A 1RTHA 2Z1JA 3LWLA 4NCBA 4LSNA 3VQPA 2G8UA 4R5PA 1TKDA 3VQEA 4M3ZA 3DLEA 4JRPA 1LW0A 2WONA 4CK1A 4CGDA 1EP4A 3KD1E 3CM6A 3NGYA 2B4JA 2FC0A 1HRHA 1TKZA 2EHGA 5CZ1A 4FZYA 2DTUA 4DQQA 4KB0A 2XY6A 3SJJA 5K14A 1XWLA 1IKVA 4XIUA 1S5JA 1RTIA 3NH0A 4FXDA 3D45A 4CJVA 4CFDA 2YNGA 2OPSA 3VQAA 4B08A 3M8QA 1HYVA 3NF7A 5HBMA 4CF8A 3OYIA 4BDPA 4F4KA 1L3TA 4F2SA 1FKPA 2KFZA 1ASWA 4DS5A 4DTRA 3THVA 3KK1A 4FLZA 3P1GA 1BHLA 3M8RA 1JL1A 2HNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFA A;  4FM1 A;  2JGU A;  3DOK A;  1X9W A;  1UA0 A;  3OVN A;  1SL0 A;  4QAG A;  1HPZ A;  4NYN A;  4OVL A;  5KTQ A;  5C25 A;  1HYS A;  2D0C A;  1I39 A;  1JLG A;  1VSI A;  3L2Q A;  3KLF A;  3SV3 A;  1S1X A;  1S6P A;  2YV0 X;  3MAQ A;  3AVA A;  3PO4 A;  4B8C A;  3AVN A;  4O0I A;  2IDO A;  4FJI A;  3PX6 A;  1NKB A;  1RT2 A;  3DLB A;  3EZ5 A;  4DFM A;  2G8K A;  1FK9 A;  4DLG A;  4C8O A;  3QIP A;  3VQQ A;  1NJW A;  4QOZ B;  1LWC A;  4KAZ A;  3V9S A;  2HHV A;  3S3N A;  1NKC A;  1VRT A;  3HPG A;  4LH4 A;  4GMJ B;  1RT1 A;  3ZCM A;  4EP5 A;  4CIF A;  4N5S A;  3OYN A;  4E7H A;  3LPT A;  3AVG A;  4JRQ A;  3OYB A;  3OY9 A;  3LP3 A;  5J2N A;  3SUO A;  4KV8 A;  3ZSO A;  2KZZ A;  4BE1 A;  2B6A A;  3DM2 A;  4CF2 A;  1X9S A;  4I2Q A;  3OYD A;  1CLQ A;  3LP0 A;  1NJZ A;  3HVR A;  3I0S A;  4DLE A;  2QXF A;  4DS4 A;  1X9M A;  4Q5V A;  3HPH A;  1CZB A;  4DSE A;  4RG8 A;  5HRS A;  3SI6 A;  4BWJ A;  1L3S A;  2XHB A;  3ITH A;  4MQ3 A;  4PQU A;  2HHX A;  2OPR A;  1JLA A;  3VQ8 A;  3L2R A;  4RW4 A;  4BE0 A;  3OYG A;  4CHQ A;  4N47 A;  3NE6 A;  4FJK A;  4FZZ A;  4E89 A;  2IOC A;  2RPI A;  2HMI A;  3LPU A;  3ALY A;  3C95 A;  3ZT2 A;  1KSP A;  3TAF A;  5D3G A;  1NK4 A;  2FBT A;  3FFI A;  3WNE A;  5SWM A;  3LDS A;  4B9T A;  3VQ7 A;  1U4B A;  1F21 A;  1VSM A;  1WLJ A;  5EU7 A;  3V9U A;  4ELU A;  3HJF A;  4CIG A;  3K58 A;  3AA4 A;  3K2P A;  2LSN A;  3TAM A;  3CG7 A;  1B92 A;  3C6T A;  3MEC A;  4O5B A;  2IC3 A;  3OJS A;  4CCH A;  3AO4 A;  1JLC A;  1S6Q A;  1KVB A;  1WN7 A;  4CGH A;  1WSF A;  4C8M A;  3KKR A;  4CJ5 A;  1NOY A;  1QSL A;  2QKK A;  3QES A;  4FJH A;  1KVC A;  4J2E A;  2KFN A;  3DRS A;  5DK5 A;  5CY4 A;  1NK5 A;  2RF2 A;  4E7K A;  4DF8 A;  2BDP A;  2QK9 A;  3C6U A;  4KHQ A;  3HL8 A;  2RN2 A;  3ISN C;  5KGW A;  1ZBL A;  4HVJ A;  4FJJ A;  4DTX A;  1DLO A;  4H4O A;  1TL1 A;  1WSE A;  3AVF A;  4Z4F A;  4CHN A;  4W5Q A;  3U3G A;  3K59 A;  4MFB A;  4CGG A;  3ZSX A;  3OYC A;  3QNO A;  3RRG A;  3SNN A;  2F8S A;  1S1U A;  4AHV A;  3HPO A;  4DSI A;  2HVH A;  4CJE A;  3VA3 A;  4CJR A;  3TAG A;  2Z1I A;  4KI4 A;  4EZ6 A;  1BQN A;  3TWH A;  4FLT A;  4FJL A;  1NKE A;  4EP4 A;  3QER A;  4CJS A;  1T8E A;  4B9U A;  1BIS A;  5HRR A;  1HNI A;  3OYH A;  4DMN A;  1C6V A;  4UQG A;  5FRM A;  3AO2 A;  4Z4E A;  4O55 A;  1ITG A;  4NCG A;  4GVM A;  3M8P A;  4F3O A;  4DU1 A;  1SL2 A;  4BE2 A;  2O4I A;  4OJR A;  3QO9 A;  2R7Y A;  3OS0 A;  1NOZ A;  3QIN A;  3V6D A;  3TI0 A;  4DFP A;  4J2A A;  1IKY A;  4B9V A;  5C24 A;  1RTJ A;  3NGZ A;  4B9M A;  2GUI A;  3OS2 A;  5HP1 A;  3PV8 A;  3K57 A;  1EET A;  1NK9 A;  1IKX A;  4HUG A;  1T05 A;  4FJN A;  1SL1 A;  4CF1 A;  2DFH A;  2X6N A;  3S3O A;  3LP1 A;  4BAC A;  1J54 A;  2EX3 A;  3AVK A;  1RT6 A;  1HJR A;  4DG1 A;  3ULD A;  4Y1C A;  2GBZ A;  3L2V A;  4E0D A;  2YNH A;  4F3T A;  3ZSV A;  3M8S A;  3L2W A;  4AHU A;  1VRU A;  1Q9Y A;  1BGX T;  4I9Q A;  4DTJ A;  3ZSW A;  3CM5 A;  5FDL A;  4J2B A;  2G8I A;  3V1Q A;  1TK8 A;  4HUF A;  1U48 A;  4ELV A;  3LZJ A;  2FBX A;  1S1V A;  2DFE A;  4CF0 A;  5J2P A;  3LAN A;  2KZM A;  3RTV A;  2VWJ A;  1VSJ A;  3KK3 A;  4N76 A;  1KLM A;  4FJ5 A;  4KKO A;  4KHU A;  4E7I A;  5J2Q A;  1T7P A;  3VQ6 A;  3WNF A;  1ZBF A;  4W5R A;  4AH9 A;  1SUQ A;  3KD5 E;  2FBV A;  3NFA A;  1HQU A;  3LWM A;  4DTP A;  1BL3 A;  4JLH A;  1W9H A;  3AVC A;  4CJQ A;  1KFS A;  3NH1 A;  3NF6 A;  2XY5 A;  1RTD A;  1RCH A;  1BIZ A;  3ZSY A;  4M3X A;  2HNY A;  1VSL A;  4CF9 A;  1B9F A;  3QIO A;  4CFB A;  1O1W A;  1IKW A;  3HXM A;  2HHT A;  3L2U A;  1RBV A;  3BGR A;  3I8D A;  1CZ9 A;  1IO2 A;  3CFP A;  4CJP A;  1HMV A;  3AVL A;  1HYZ A;  4IFV A;  4O44 A;  4KHS A;  3DRP A;  2HW3 A;  2IS3 A;  3CYM A;  1D8Y A;  4CEE A;  4KPY A;  3T1A A;  3OJU A;  4FLX A;  3QET A;  1LW2 A;  4WE1 A;  3V1O A;  5CYM A;  5CZ2 A;  4W5N A;  4KTZ A;  1KFD A;  2G8H A;  1R0A A;  4CJU A;  4I2P A;  4HUE A;  4FK2 A;  1RIL A;  4CHZ A;  1A5X A;  1EXQ A;  4ZHR A;  4BDY A;  2ZD1 A;  1KRP A;  2Y1J A;  1NK8 A;  1SKS A;  1A5W A;  1C1C A;  3OYF A;  3AA2 A;  2X74 A;  4KO0 A;  4CHO A;  4FYD A;  1CXU A;  3V9W A;  1HQE A;  1NJY A;  3QEV A;  2P5G A;  4H8K A;  1JXE A;  1Z25 A;  2VG7 A;  1TK0 A;  1RT4 A;  4LY7 A;  1QQC A;  3CFO A;  1VK0 A;  5KRT A;  4CEA A;  1EX4 A;  4C8K A;  2ZE2 A;  3EY1 A;  4TSX A;  5CYQ A;  1WSI A;  3ZSZ A;  4KI6 A;  2G8W A;  4JS4 A;  1YT3 A;  3AO5 A;  3SUQ A;  4PY5 A;  3DLK A;  4IG0 A;  4FCY A;  4Z4I A;  3TAQ A;  1KVA A;  3AO1 A;  2G8V A;  3KLH A;  3SUP A;  4DTU A;  3VQD A;  2ITG A;  3SYZ A;  3QEP A;  4FLV A;  1RDB A;  4BWM A;  4DQS A;  2OZS A;  4K8X A;  4KHY A;  2KQ2 A;  3DYA A;  3L3V A;  1XC9 A;  4FK0 A;  1J9A A;  5J2M A;  1L3U A;  4B8A B;  3SUN A;  1A5V A;  3QLH A;  3ZT4 A;  2BE2 A;  3S9H A;  3HP9 A;  3AVI A;  4DTN A;  1ZBI A;  4DU4 A;  2HHQ A;  4EZ9 A;  3AVB A;  3KK2 A;  4CGJ A;  3K5N A;  3V9Z A;  4QCL A;  3T3F A;  4PUO A;  2I5J A;  1U47 A;  5JS1 A;  3QEW A;  1C1A A;  3KKS A;  1IG9 A;  3IS9 A;  1RDC A;  3DMJ A;  4OPJ A;  3RMB A;  4CGF A;  4F8R A;  4IDK A;  4KB1 A;  3I0R A;  3O3F A;  3RR8 A;  4FJ7 A;  4M42 A;  3QEX A;  3ASM A;  1KTQ A;  3VQ4 A;  1UA1 A;  2X6S A;  1ZBU A;  4CEO A;  3PX0 A;  4AIL C;  2G8F A;  4N56 A;  3HK2 A;  2KW4 A;  1VSH A;  4E19 A;  1Q9X A;  4DFK A;  3PO5 A;  4K8Z A;  1VSD A;  1XI1 A;  1SV5 A;  1U45 A;  1RNH A;  3G0Z A;  4DFJ A;  2OYQ A;  3RMC A;  2DFF A;  1TVR A;  1GOC A;  1WSH A;  1RBS A;  2AJQ A;  4CE9 A;  1S1W A;  1LV5 A;  4FJG A;  1NK6 A;  1QSS A;  1TV6 A;  1JLB A;  4CK2 A;  1UAX A;  1JXB A;  4DSL A;  2KTQ A;  4FW2 A;  3NF9 A;  3DOL A;  2OPQ A;  3MEG A;  4CEC A;  2XRI A;  2A1R A;  4NCA A;  4KHW A;  3LP2 A;  2DY4 A;  1LWE A;  3KIO A;  3O3G A;  2X78 A;  3WNH A;  4OKK A;  3RRH A;  3IAY A;  4B3O A;  3AV9 A;  1Q8I A;  4M45 A;  3HP6 A;  3KTQ A;  1QE1 A;  3RR7 A;  4KHN A;  4M3T A;  3AVH A;  3RMA A;  1U04 A;  1L5U A;  4DQI A;  3H08 A;  1RT5 A;  1RDD A;  1G15 A;  3SPZ A;  4KTQ A;  2OPP A;  4FLU A;  4FM2 A;  2E6M A;  2PY5 A;  4FJ8 A;  1KCF A;  4OGC A;  4DQP A;  1WSG A;  1DTT A;  1BQM A;  3G10 A;  3HO1 A;  1LAV A;  4NYF A;  4OLB A;  1YTU A;  1S9E A;  4CJL A;  3TAN A;  3LZI A;  2Z1H A;  3OYM A;  5I42 A;  3P5J A;  5KRS A;  1UOC A;  1YTA A;  2IAJ A;  4CFC A;  1TK5 A;  1TKX A;  1J5O A;  2P1J A;  4OKE A;  1N5Y A;  4CJK A;  4HCC A;  3U3Y A;  4FZX C;  3AA3 A;  5HRN A;  1D9F A;  4DSK A;  1MU2 A;  1BCM A;  3QEI A;  4I7F A;  1ASU A;  4CGI A;  4YNQ A;  4AHC A;  2D0B A;  3VN5 A;  3B6O A;  3A2F A;  4CEQ A;  1ASV A;  3RMD A;  3VQ9 A;  3SCX A;  4J2D A;  3T19 A;  3AVM A;  2OZM A;  5HRP A;  3C94 A;  4CK3 A;  4YFU A;  3D0P A;  3HVT A;  4PWD A;  5FRO A;  1D9D A;  4OGE A;  3MXI A;  1WSJ A;  4HHT A;  4Q0B A;  4CHP A;  3K5L A;  4M41 A;  4CHY A;  1QTM A;  1ZBH A;  2BGG A;  4CJW A;  4FM0 A;  3NGI A;  3JYT A;  4HCB A;  5KI6 A;  4FJX A;  4E1M A;  4N41 A;  3L3U A;  1Y97 A;  4M3Y A;  1LAW A;  4Z4C A;  4DTO A;  3TR8 A;  2YKN A;  1IH7 A;  3DRR A;  2XY8 A;  5C42 A;  4CJT A;  5E41 A;  3DLH A;  1KLN A;  4DSJ A;  1JLE A;  1FKO A;  4BDZ A;  3TAP A;  5KGX A;  1UWB A;  3OYA A;  4FVM A;  3VA0 A;  3LAK A;  3ZT1 A;  4W5T A;  4JS5 A;  4FW1 A;  5SZT A;  3DLR A;  4AHT A;  1C0M A;  2D5R A;  4G1Q A;  4Z0U A;  2QKB A;  3RWU A;  1RBU A;  3V4I A;  4DU3 A;  1NK0 A;  5J1E A;  4Z4G A;  2O4G A;  4H4M A;  4ID1 A;  4DF4 A;  3S3M A;  1TL3 A;  2JLE A;  3MED A;  4M3W A;  4FJ9 A;  2HHU A;  2YHA A;  3MXJ A;  2ZQB A;  3NF8 A;  4IFY A;  3PUF A;  4CEF A;  4CIE A;  3SQ4 A;  1QS4 A;  4C8N A;  3NBP A;  3NDK A;  3BDP A;  4KTW A;  3KLI A;  4DQR A;  1XHZ A;  1N6Q A;  1TAU A;  1S1T A;  1GOA A;  3DI6 A;  1WAF A;  2YHB A;  4OKJ A;  3VQB A;  2E4L A;  4GW6 A;  3CQ8 A;  2F8T A;  4KRF A;  4PA1 A;  4ZTJ A;  1SKR A;  4KFB A;  1ZYQ A;  3PX4 A;  4L8R B;  4DTS A;  3SPY A;  1NJX A;  2P5O A;  5HRO A;  1K6Y A;  4ZTF A;  1RBR A;  2HHS A;  1Z26 A;  3F73 A;  2B5J A;  3B6P A;  3AA5 X;  3O3H A;  4LH5 A;  4OPK A;  4ICL A;  3NAE A;  3V81 A;  1WAJ A;  3V1R A;  3ZT0 A;  1JKH A;  2YNF A;  4CES A;  3KJV A;  3TAB A;  4M3U A;  4FK4 A;  2PYJ A;  4O4G A;  2Q3S A;  4M3R A;  4ID5 A;  2P51 A;  4W5O A;  1QHT A;  3SV4 A;  2GV9 A;  1B9D A;  4RW9 A;  3HM9 A;  1NK7 A;  1BI4 A;  3KLG A;  1HNV A;  1EKE A;  2WOM A;  1BI4 B;  2ATQ A;  3U6F A;  3IG1 A;  3VQC A;  2HNZ A;  3O4Q A;  3EYZ A;  3QNN A;  3MEE A;  3OYL A;  1JLF A;  3CFR A;  3LAM A;  4B9S A;  4RW6 A;  1JLQ A;  3DLG A;  4LSL A;  4ELT A;  1I3A A;  1YVU A;  4IKF A;  4CER A;  4CED A;  4Z4H A;  1VSE A;  4AHS A;  1TAQ A;  1SKW A;  4B9N A;  2OA8 A;  4DSF A;  1BIU A;  5HLF A;  1U49 A;  3L8B A;  2VWK A;  1QSY A;  2RKI A;  1S9G A;  4DTM A;  3AO3 A;  2PZS A;  1CXQ A;  3SQ2 A;  4OLA A;  3OYE A;  3PY8 A;  4F2R A;  3ZSR A;  4IBN A;  4E1N A;  1LWF A;  3JSM A;  1W0H A;  4RW8 A;  1C0T A;  4FLW A;  1VSK A;  2VG6 A;  3VQ5 A;  1REV A;  4CEZ A;  1DTQ A;  2IGI A;  3WNG A;  4FJM A;  1J53 A;  4CJ3 A;  2HHW A;  1RBT A;  3TAE A;  3NHG A;  3O4N A;  1XHX A;  1TGO A;  4B9L A;  2Y1I A;  4CEB A;  4I9L A;  1WNS A;  5T7B A;  3TAR A;  2HVI A;  3OYK A;  2E6L A;  2Z1G A;  4O0J A;  5JS2 A;  1JL2 A;  4CJF A;  3OS1 A;  2VG5 A;  3OYJ A;  3NCI A;  2XO7 A;  3F9K A;  5FRN A;  3ZT3 A;  2YNI A;  4IG3 A;  3MXM A;  5DMR A;  4CJ4 A;  3ZSQ A;  2XY7 A;  1L3V A;  3AVJ A;  4KRE A;  3HYF A;  3NH2 A;  3V9X A;  1D5A A;  2YKM A;  3SQ0 A;  2BAN A;  3KLE A;  4E7J A;  2F96 A;  4Y1D A;  3SZ2 A;  1TKT A;  4FLY A;  4RW7 A;  3K5O A;  1X1P A;  5I3U A;  2A1S A;  1RT7 A;  2PYL A;  1C1B A;  3HST B;  4HTU A;  3UIQ A;  4E3S A;  2ETJ A;  2HB5 A;  3LAL A;  1T03 A;  4DWI A;  4LD0 A;  3SQ1 A;  1VSF A;  3K5M A;  2D0A A;  4C8L A;  1GOB A;  1FXX A;  4AHR A;  2FBY A;  1C0U A;  1RT3 A;  1BCO A;  2W42 A;  3P83 D;  1RDA A;  3IRX A;  4E7L A;  2NUB A;  3E01 A;  3HT3 A;  1RTH A;  2Z1J A;  3LWL A;  4NCB A;  4LSN A;  3VQP A;  2G8U A;  4R5P A;  1TKD A;  3VQE A;  4M3Z A;  3DLE A;  4JRP A;  1LW0 A;  2WON A;  4CK1 A;  4CGD A;  1EP4 A;  3KD1 E;  3CM6 A;  3NGY A;  2B4J A;  2FC0 A;  1HRH A;  1TKZ A;  2EHG A;  5CZ1 A;  4FZY A;  2DTU A;  4DQQ A;  4KB0 A;  2XY6 A;  3SJJ A;  5K14 A;  1XWL A;  1IKV A;  4XIU A;  1S5J A;  1RTI A;  3NH0 A;  4FXD A;  3D45 A;  4CJV A;  4CFD A;  2YNG A;  2OPS A;  3VQA A;  4B08 A;  3M8Q A;  1HYV A;  3NF7 A;  5HBM A;  4CF8 A;  3OYI A;  4BDP A;  4F4K A;  1L3T A;  4F2S A;  1FKP A;  2KFZ A;  1ASW A;  4DS5 A;  4DTR A;  3THV A;  3KK1 A;  4FLZ A;  3P1G A;  1BHL A;  3M8R A;  1JL1 A;  2HND A; 
#chains in the Genus database with same CATH topology
 2JGU A;  3DOK A;  3PIP L;  1SL0 A;  2OTJ N;  1HPZ A;  1HYS A;  2D0C A;  1I39 A;  1JLG A;  1VSI A;  4GVE A;  3KLF A;  4B8C A;  3PX6 A;  4FWR A;  4CJ7 A;  3WEE B;  3DLB A;  1Q18 A;  4DFM A;  1FK9 A;  4BRQ A;  1NGG A;  2E8A A;  1NKC A;  1VRT A;  4LH4 A;  3HPG A;  3EE8 A;  1RT1 A;  3GDQ A;  2IIR A;  4GMJ B;  4NLC A;  3OYN A;  4E7H A;  3LPT A;  4JRQ A;  4EFH A;  4JAX A;  2KZZ A;  3ZSO A;  2B6A A;  5AR0 A;  2P9U A;  3MX5 A;  3DXM B;  4DSE A;  3NVK A;  4BWJ A;  1HX1 A;  3ITH A;  3O80 A;  4MQ3 A;  4PQU A;  2OPR A;  4IFE A;  4BE0 A;  4CHQ A;  5I9E B;  2VQF K;  3KZB A;  4IXC A;  3R6M A;  4J8F A;  1NK4 A;  1V4S A;  2YHW A;  3LDS A;  4B9T A;  1VSM A;  5EU7 A;  3O1W A;  4CIG A;  3UE5 A;  4A59 A;  1OVQ A;  3CG7 A;  1B92 A;  3EKU A;  3OJS A;  4A2B A;  3DWL A;  1ZBS A;  1WN7 A;  1NOY A;  4FWS A;  4JD2 B;  1OH8 A;  2QKK A;  3DRS A;  1IJJ A;  1NGF A;  5DK5 A;  2RF2 A;  5BN8 A;  1NGH A;  3HL8 A;  4DTX A;  1DLO A;  1W97 L;  1TL1 A;  4Z4F A;  4EIA A;  2E1Y A;  3K59 A;  4MFB A;  3RRG A;  3ZSX A;  1S1U A;  3BZK A;  4AHV A;  2O8C A;  4EZ6 A;  4A5B A;  1E3M A;  2QTD A;  4RWT A;  1ZXO A;  3DLL L;  4RCH A;  3O9R A;  3WT0 A;  5LY3 A;  4H0P A;  3OYH A;  4UQG A;  4YDU C;  5FRM A;  3AO2 A;  1ITG A;  4BRA A;  4BRD A;  4DU1 A;  1KQS M;  1SL2 A;  1YJW N;  3QO9 A;  3OS0 A;  1NOZ A;  4B9V A;  3AGR A;  3LDN A;  4B9M A;  2GUI A;  3OS2 A;  5HP1 A;  3K57 A;  1EET A;  1NK9 A;  4K0K K;  1YIJ N;  3QIC A;  1T05 A;  2P9K A;  4CF1 A;  2DFH A;  4WFB L;  1HJR A;  4Y1C A;  3L2V A;  4F3T A;  4JI5 K;  3M8S A;  3LL3 A;  1DGK N;  1VRU A;  4JHD B;  4I9Q A;  4BRG A;  3EZW A;  2G8I A;  3V1Q A;  3CXC M;  3LZJ A;  4CF0 A;  5J2P A;  3LAN A;  4JI0 K;  1VSJ A;  4KH6 A;  4N76 A;  4BRF A;  1KLM A;  1EWR A;  3MN9 A;  1ZBF A;  1WBB A;  4DTP A;  4CJQ A;  1KFS A;  4GV3 A;  3BY5 A;  2ZM6 K;  3QIO A;  4CFB A;  2A3Z A;  3BEX A;  4BRM A;  3DRP A;  3HOT A;  4FLX A;  5HOO A;  5CYM A;  1JCG A;  3HM8 A;  4JKG B;  3CCE N;  1C0G A;  4FK2 A;  4ZHR A;  1QHA A;  3CHW A;  2OCE A;  3OYF A;  4KO0 A;  3NMU A;  2P9S A;  3QEV A;  5AQO A;  3VER A;  3QBX A;  3CFO A;  2ZE2 A;  1O13 A;  2EWS A;  3LDQ A;  4JS4 A;  1KVA A;  2OTL N;  5GAG P;  3SUP A;  4BC5 A;  3SYZ A;  1M1K O;  3L3V A;  2Q0U A;  4X62 K;  3QLH A;  3GOI A;  3ID6 A;  4FWQ A;  3AVI A;  3ZEU A;  4B1V A;  4DU4 A;  4EZ9 A;  3K5N A;  2ZGY A;  4QCL A;  4YHH K;  3FZF A;  5JS1 A;  3HI0 A;  3IKM A;  4YOR A;  1IG9 A;  3IS9 A;  3DMJ A;  1QQO A;  4BRP A;  3RR8 A;  2FLO A;  3VEX A;  2HBK A;  3VPZ A;  4BG8 A;  3O3F A;  2KHO A;  1G99 A;  2H3G X;  4FSV A;  2G8F A;  4NXM K;  2KW4 A;  4IO9 L;  4E19 A;  1Q9X A;  1NGD A;  4DFK A;  2QWL A;  1XI1 A;  4YY3 K;  4IEE A;  4PKG A;  1RNH A;  2F7T A;  1GLJ O;  2OYQ A;  2ASP A;  3AGK A;  2DFF A;  3VF4 A;  5KPZ A;  1VQ5 N;  1LV5 A;  1JLB A;  4HWI A;  4CK2 A;  1UAX A;  1VQ6 N;  3MN7 A;  3MEG A;  2WTU A;  1VQK N;  3ZX2 A;  2A1R A;  3LP2 A;  4WQ5 A;  3K9J A;  1NGE A;  4M45 A;  3KTQ A;  1QE1 A;  2O8E A;  3RMA A;  1L5U A;  4DQI A;  1G15 A;  3MCP A;  2ZJQ L;  4B9Q A;  2UU9 K;  3CME N;  3G10 A;  3FGU A;  1LAV A;  4CJL A;  5JVG L;  5F2R A;  1UOC A;  2IAJ A;  1TK5 A;  4CFC A;  3TSP A;  4U67 L;  5BRE A;  4OKE A;  1J5O A;  4XH4 A;  3U3Y A;  1VQ9 N;  4DSK A;  1HPM A;  4CGI A;  3A2F A;  3TPQ A;  3VES A;  3H46 O;  4CK3 A;  1SQK A;  3HVT A;  4PWD A;  2V7Z A;  5FRO A;  4B3T K;  4H0O A;  4PL8 A;  1WB9 A;  3NGI A;  3PSF A;  3C65 A;  4CZI A;  1YI2 N;  4FJX A;  5AZJ B;  1N36 K;  3TTF A;  4CJT A;  5AQH A;  1KLN A;  3CC7 N;  4JKH A;  2P9N A;  3OYA A;  2A6A A;  4JYA K;  3LAK A;  4FW1 A;  5SZT A;  1C0M A;  1T3V A;  2FXU A;  4G1Q A;  4PKH A;  5J1E A;  4H4M A;  4ID1 A;  3MCA B;  3S3M A;  1TL3 A;  3NF8 A;  4CEF A;  1QS4 A;  4C8N A;  3BDP A;  4DQR A;  3NVM A;  1S1T A;  3DI6 A;  3O8M A;  3VQB A;  1WAF A;  4KBO A;  4KRF A;  1SKR A;  1ZYQ A;  4DTS A;  3CCQ N;  5AQW A;  4ZTF A;  1HKB A;  1TUY A;  3J80 O;  4LH5 A;  2V52 B;  1WAJ A;  5E26 A;  3D2F A;  5AQM A;  1JKH A;  2YNF A;  3ZT0 A;  1NMN A;  5AQZ A;  2P51 A;  1QHT A;  3SV4 A;  1B9D A;  1BI4 A;  3MN6 A;  1Z6R A;  4B1X B;  3OYL A;  4RW6 A;  3LDP A;  4GV9 A;  4CER A;  1VSE A;  4AHS A;  2O8D A;  4B9N A;  2OA8 A;  3U4L A;  4DSF A;  4UY8 O;  4HTL A;  5AQV A;  1QSY A;  3AO3 A;  4OLA A;  1U6Z A;  4QS7 A;  3ZSR A;  4IBN A;  1BA0 A;  1DT9 A;  1XMQ K;  2VG6 A;  4CEZ A;  4FJM A;  3AAQ A;  2Q1N A;  3NHG A;  4IZ9 A;  3O4N A;  3VF6 A;  5TKY A;  3OS1 A;  4CJF A;  4NO7 A;  3F9K A;  5DMR A;  3AVJ A;  2UUC K;  2E2P A;  3HYF A;  4DV0 K;  2A40 A;  4YOV A;  4IO8 A;  4QS9 A;  1X1P A;  4JKC A;  1C1B A;  3UIQ A;  4LF4 K;  1J5E K;  2HB5 A;  4BY9 C;  4BRL A;  3C7N A;  1VSF A;  3U9Z A;  5GIO A;  2FBY A;  3UKU B;  2Q36 A;  3P83 D;  3IRX A;  5AQS A;  4E7L A;  2NUB A;  4FOE A;  3L4I A;  3LWL A;  1VAZ A;  2G8U A;  4R5P A;  1TKD A;  1XC3 A;  4M3Z A;  3DLE A;  5AQQ A;  4CK1 A;  4CGD A;  3A5M C;  2FC0 A;  1HRH A;  2DTU A;  5EY4 A;  1YVN A;  4DV6 K;  2QEX N;  3OBW A;  3SJJ A;  1XWL A;  1S5J A;  4B3S K;  3FZM A;  2OPS A;  3CJ9 A;  4B08 A;  3NF7 A;  4F4K A;  4CF8 A;  4G9Z A;  2KFZ A;  3KK1 A;  2HND A;  1NGC A;  4CFA A;  1D4X A;  4FM1 A;  3HZ6 A;  3VGM A;  4H5N A;  3OVN A;  5KTQ A;  5C25 A;  3L2Q A;  4H0T B;  1S6P A;  3CER A;  4JKB A;  3AVA A;  5AQU A;  3PO4 A;  4FWO A;  3AVN A;  4FJI A;  1J6Z A;  5C0Y A;  2G8K A;  3QIP A;  3I8B A;  3VQQ A;  1NJW A;  4QOZ B;  2HHV A;  3V9S A;  3S3N A;  1X3N A;  2QWO A;  3SLC A;  4LC9 B;  3AVG A;  4MLE A;  4C23 A;  2UYT A;  1GLL O;  5C2F A;  4KV8 A;  1P90 A;  5LMN K;  3DM2 A;  1X9J A;  1ESV A;  4I2Q A;  3OYD A;  1NWK A;  1IBK K;  2WFB A;  1CLQ A;  3LP0 A;  3ZET B;  3KK7 A;  1GLD G;  4A57 A;  3CQY A;  2QXF A;  1X3M A;  1CZB A;  1IBM K;  3FE1 A;  3C6A A;  1L3S A;  1JLA A;  4KH4 A;  4FWN A;  2KLA A;  2BTF A;  3GL1 A;  3ZT2 A;  3U9D A;  5M1K A;  3FFI A;  1U4B A;  2I7N A;  4BRH A;  3IFR A;  5LJV A;  1YIT N;  3MEC A;  1T6D A;  2O8B A;  3MWP A;  3E9L A;  2QXL A;  4CGH A;  3UKR B;  3KKR A;  3QES A;  2F4V K;  5AQT A;  3LDL A;  4K41 A;  4E7K A;  4DF8 A;  2BDP A;  2QK9 A;  4KHQ A;  1ZBL A;  4HVJ A;  2E5L K;  3ZX3 A;  1T44 A;  4H4O A;  3AVF A;  1QZ6 A;  2UUB K;  1BO5 O;  4Y0W A;  2F8S A;  4DSI A;  2HVH A;  4CJE A;  3TAG A;  4LF5 K;  3TWH A;  4EP4 A;  4LF8 K;  4B9U A;  2QWR A;  5HRR A;  1HNZ K;  4BRE A;  3CCJ N;  4F3O A;  2O4I A;  2R7Y A;  1E4G T;  4DR6 K;  3TI0 A;  1YAG A;  3VTH A;  4J2A A;  3QFP A;  3KVG A;  5C24 A;  4BGB A;  3PV8 A;  4HUG A;  1NGB A;  1VQO N;  4FWM A;  3LP1 A;  3A5L C;  4KH5 A;  2EX3 A;  2F9W A;  3CC2 N;  3AAP A;  2HMP A;  4BRK A;  3OW2 M;  4GKK K;  3FZK A;  3U8X A;  2FSN A;  3VGL A;  4AHU A;  1QZ5 A;  3THX B;  4DTJ A;  3CM5 A;  5A2Q O;  1TK8 A;  4HUF A;  1Z05 A;  4LFB K;  5TKW A;  1YJN N;  2KZM A;  2VWJ A;  1XNQ K;  3KD5 E;  4GKJ K;  3J81 O;  2FBV A;  3NFA A;  1HQU A;  4DV5 K;  1W9H A;  3AVC A;  1RTD A;  1BIZ A;  1NM1 A;  2PBD A;  1BDG A;  2HHT A;  3HXM A;  3BGR A;  3SMS A;  1M90 O;  3CFP A;  3THW A;  4OX9 K;  3AVL A;  3CCU N;  4O44 A;  1D8Y A;  4CEE A;  5IWA K;  3T1A A;  3OJU A;  3QET A;  3PLA A;  5CZ2 A;  4W5N A;  4KTZ A;  1KFD A;  2G8H A;  1R0A A;  1EXQ A;  2HBL A;  3MDQ A;  2ZD1 A;  1KRP A;  3FZL A;  3P39 A;  4CHO A;  4FYD A;  3WXJ A;  4M63 C;  3CJC A;  4H8K A;  1BUP A;  5C10 A;  3MMV A;  1NLV A;  1QQC A;  3CCM N;  5KRT A;  4CEA A;  1EX4 A;  3P31 A;  3EY1 A;  3QBW A;  1WSI A;  3ZSZ A;  3CJ7 A;  4PY5 A;  3SUQ A;  5EVZ A;  2G8V A;  3CC4 N;  4BR4 A;  3VQD A;  2ITG A;  5BRH A;  3QEP A;  1RDB A;  4BWM A;  2OZS A;  3CIP A;  2E88 A;  3DYA A;  4FK0 A;  2HOE A;  1J9A A;  5M1N A;  4CZJ A;  2JWK A;  3D2F B;  3S9H A;  2HHQ A;  4OPA A;  3AVB A;  3V9Z A;  4X64 K;  1YHQ N;  4PUO A;  4B3R K;  3QEW A;  3KKS A;  4BQZ A;  3I0R A;  3QEX A;  4R79 A;  3ZX0 A;  2X6S A;  1ZBU A;  4CEO A;  5EXW A;  4AIL C;  3HK2 A;  3RVC A;  1VSH A;  2A42 A;  3QDK A;  3PO5 A;  4JI3 K;  3H1V X;  1VSD A;  2NRV A;  2YHX A;  1WSH A;  1LOT B;  4CE9 A;  4FOI A;  3ENH A;  1QSS A;  1NJI O;  4B1U B;  5H1S Q;  4FW2 A;  4CEC A;  2OPQ A;  4DB3 A;  1LWE A;  2X78 A;  1Q8I A;  1HJO A;  3HP6 A;  1IV0 A;  3RR7 A;  4M3T A;  4KHN A;  1ILY A;  3TU5 A;  4OO1 J;  3K0S A;  4BGA A;  5GAD P;  4FJ8 A;  1KCF A;  4BR7 A;  1K73 O;  1VQ7 N;  1DTT A;  3HO1 A;  4EHT A;  4NYF A;  3BF1 A;  3BF3 A;  3OYM A;  3Q7C A;  1ZBH A;  2KFN A;  2P1J A;  1N5Y A;  4HCC A;  1N32 K;  2CH6 A;  1D9F A;  4YNQ A;  3VN5 A;  3B6O A;  2ASM A;  3SCX A;  4J2D A;  5HRP A;  3H3N O;  4OGE A;  3MXI A;  3FLC O;  5JLF A;  3F9M A;  4C1N K;  4M41 A;  2NZT A;  2A41 A;  4RTF D;  2NRT A;  3JYT A;  5JMV A;  1S3X A;  3L3U A;  4H5V A;  4Z4C A;  2ZF5 O;  2YKN A;  1SZ2 A;  2FF3 B;  3DRR A;  4DSJ A;  5E41 A;  1FKO A;  3N4Q A;  1U2V A;  2GWK A;  5KGX A;  3T1H K;  4FVM A;  3VA0 A;  5KPT A;  3ZT1 A;  4JS5 A;  3CCV N;  3G6E N;  3DLR A;  3MK6 A;  4AHT A;  3MN5 A;  4Z0U A;  3V4I A;  5BPM A;  1NGJ A;  5AZI A;  1NK0 A;  2CGJ A;  4Z4G A;  2O4G A;  1ATN A;  4B1Y B;  3E66 A;  3VEW A;  4M3W A;  2YHA A;  3MXJ A;  3G4S N;  4JK8 A;  1XHZ A;  1GOA A;  5AQY A;  1MWM A;  2F8T A;  1S22 A;  4XEI A;  3SPY A;  2P5O A;  1RBR A;  2HHS A;  1VHX A;  3SAG A;  3F73 A;  3AA5 X;  3NAE A;  4CES A;  4WQ4 C;  3W3D A;  3TAB A;  4M3U A;  1RDU A;  2PYJ A;  4M3R A;  1YUW A;  4ID5 A;  4K42 A;  5BR9 A;  4JI6 K;  2Q0R A;  3J7A P;  3VET A;  3KLG A;  2P9P A;  3U6F A;  4FPB A;  3VQC A;  3QML A;  4JK7 A;  2W40 A;  3CET A;  3KWG A;  3EYZ A;  1E4F T;  5FPM A;  1XQS C;  2QI2 A;  1Q86 O;  4B9S A;  4LSL A;  2YX6 A;  4X65 K;  1I3A A;  4IKF A;  1TAQ A;  5HLF A;  3A5O C;  1U49 A;  3D2E A;  2V51 B;  3EL2 A;  1JCE A;  2RKI A;  3UB5 A;  2O8B B;  2PZS A;  1CXQ A;  5BRD A;  5AQK A;  1NNE A;  1LWF A;  3JSM A;  1W0H A;  3WNG A;  5JVH L;  4I6M A;  1K8K B;  1XHX A;  4I9L A;  1TYQ B;  4PHT X;  3R3L A;  5JS2 A;  1JL2 A;  3NCI A;  4AQY K;  3W0L A;  2XO7 A;  5FRN A;  3OBY A;  1NGI A;  2D4W A;  3LM9 A;  1IG8 A;  3ZSQ A;  2XY7 A;  3NH2 A;  2YKM A;  3OA9 A;  3SQ0 A;  2BAN A;  4E7J A;  4Y1D A;  3SZ2 A;  1TKT A;  4FLY A;  4RW7 A;  4X66 K;  4HTU A;  4BQL A;  4MO4 A;  4DV3 K;  1WBD A;  3K5M A;  4C8L A;  1FXX A;  1C0U A;  2W42 A;  5CR4 A;  2VCP A;  2NRH A;  3E01 A;  3HT3 A;  4A5A A;  1QVF M;  2Z1J A;  3ENO A;  2QWM A;  1KC8 O;  4BR2 A;  5DM6 L;  1LW0 A;  1EP4 A;  4PKI A;  4FZY A;  3SBT A;  4DQQ A;  1XMO K;  2YI1 A;  3NH0 A;  2A5X A;  2IVO A;  4CFD A;  3VQA A;  2RHK A;  3M8Q A;  4BDP A;  1FKP A;  1RDW X;  5AQX A;  4BRN A;  3M1F A;  1BHL A;  4CD3 A;  4CZG A;  1UA0 A;  3ZLJ A;  4PL7 A;  4QAG A;  4NYN A;  4OVL A;  1JJ2 M;  3GG4 A;  1S1X A;  3MAQ A;  3WEE A;  4O0I A;  4FVU A;  1NKB A;  2VQE K;  1RT2 A;  3THW B;  3HRG A;  3EZ5 A;  3T69 A;  4KAZ A;  1GLE G;  2FF6 A;  3ZCM A;  4CIF A;  3HBT A;  2P9I A;  3OYB A;  4DUZ K;  4CD1 A;  3SUO A;  3QFU A;  3FZH A;  4BE1 A;  4H5R A;  1NJZ A;  3HVR A;  3I0S A;  4DLE A;  2P9U B;  4IJA A;  2GEL A;  3GE1 A;  3HPH A;  4Q5V A;  1QQN A;  4LF9 K;  5HRS A;  3SI6 A;  2XHB A;  3HSC A;  3ENB A;  4IDH A;  3L2R A;  4NLB A;  3OYG A;  5M1F A;  3E9O A;  4FZZ A;  4LFA K;  2HMI A;  4MDB A;  4CZK A;  3ALY A;  3C95 A;  4IJN A;  1KSP A;  3TAF A;  2FBT A;  5C12 A;  4DV1 K;  1FW6 A;  3VQ7 A;  4ELU A;  1F21 A;  4BRC A;  1R59 O;  3K2P A;  3L4Q A;  4O5B A;  3AO4 A;  2QM1 A;  1FJG K;  2ZGZ A;  1KVB A;  1Y64 A;  4FJH A;  5FLX O;  1QSL A;  1KVC A;  3OHR A;  3A8Y A;  3I33 A;  2PFU A;  5M1Q A;  5CY4 A;  5HL7 L;  4JI1 K;  5EX5 A;  4FJJ A;  5LMU K;  4FO0 A;  1WSE A;  5KPR A;  4CHN A;  3U3G A;  3QNO A;  4U7B A;  3SNN A;  3HPO A;  4YDU A;  4CJR A;  2Z1I A;  1BQN A;  2D0P A;  4FJL A;  1DEJ A;  2O8C B;  2YCH A;  4WFA L;  3QER A;  4CJS A;  1T8E A;  1N34 K;  1C6V A;  4Z4E A;  4O55 A;  3L0Q A;  1GLC G;  1NGA A;  4K25 A;  4BE2 A;  5EOY A;  3WXM B;  1DKG D;  3QIN A;  4DFP A;  1IKY A;  4Z94 A;  1RTJ A;  3NGZ A;  1IKX A;  2X6N A;  4DR4 K;  2P9K B;  4BAC A;  1J54 A;  2QWP A;  2E2O A;  4E0D A;  3ULD A;  3L2W A;  3VMF B;  3O5B A;  3D6R A;  1Q9Y A;  1HKC A;  1BGX T;  4JV5 K;  1IBL K;  4A62 A;  4BR9 A;  1OH5 A;  5FDL A;  4J2B A;  1U48 A;  5AQG A;  1S1V A;  3VGK A;  1JCF A;  1VQN N;  3RTV A;  4FJ5 A;  5BN9 A;  4ISE A;  3DAW A;  3CQX A;  1RGI A;  4W5R A;  1T7P A;  4DUY K;  4JLH A;  3NH1 A;  3NF6 A;  5FPE A;  2XY5 A;  1RCH A;  3WUH A;  4CF9 A;  1B9F A;  4MO5 A;  3O9S A;  1O1W A;  1IKW A;  3L2U A;  1CZ9 A;  1IO2 A;  2ZJR L;  1N33 K;  5AQJ A;  1HMV A;  4QS8 A;  4KPY A;  3BUZ B;  1SAZ A;  4CZL A;  4JKG A;  3V1O A;  2VGM A;  4XH5 A;  3E9P A;  4HUE A;  1RIL A;  4BC4 A;  3ULE A;  1U2V B;  4BDY A;  1EO1 A;  4CBX A;  1NK8 A;  1SKS A;  1C1C A;  3AA2 A;  3ATV A;  1KD1 O;  3PSI A;  3V9W A;  1HQE A;  5AQN A;  2P9S B;  2P5G A;  1TK0 A;  1RT4 A;  4LY7 A;  1YJ9 N;  1VK0 A;  4CI6 A;  4C8K A;  4JKA A;  2P9L A;  4KI6 A;  4H5W A;  3VOV A;  3AO5 A;  4WQ4 A;  3DLK A;  4IG0 A;  4FCY A;  4Z4I A;  3TAQ A;  3CCL N;  4O5F A;  4FLV A;  4DQS A;  2KQ2 A;  3CPE A;  1XC9 A;  3O9U A;  4A61 A;  4B8A B;  3SUN A;  2BE2 A;  2GX9 A;  5MLC Q;  3HP9 A;  4DTN A;  1ZBI A;  4DR7 K;  3KK2 A;  4B1Z A;  3ZEU B;  3MWT A;  1YF5 L;  2I5J A;  1U47 A;  1MA9 B;  2GTD A;  2NRZ A;  5JIC A;  1RDC A;  4OPJ A;  4IDK A;  3DJC A;  3S41 A;  2NRX A;  4M42 A;  5IT9 O;  3DXK A;  1RFQ A;  3F2K A;  4JI4 K;  4CZH A;  3VQ4 A;  1UA1 A;  5AQI A;  3WXI A;  3PX0 A;  3J8A A;  4N56 A;  5JLH A;  3VTI A;  4IWV A;  4K8Z A;  3CD6 N;  1SV5 A;  4IOA L;  2UXC K;  4FJG A;  5AQF A;  1JXB A;  4K43 A;  2KTQ A;  3SMP A;  2XRI A;  4KHW A;  4NCA A;  4GY2 B;  3IAY A;  3O3G A;  4B3O A;  3AV9 A;  4I6M B;  2YJE A;  4E1J A;  3H08 A;  2O8E B;  3LDO A;  3SPZ A;  4KTQ A;  1LCU A;  2OPP A;  4FLU A;  3T1Y K;  4ILG B;  4WQ5 C;  4FM2 A;  2PY5 A;  4DQP A;  1CZA N;  1VQP N;  4OLB A;  2QWQ A;  5I42 A;  5F0X A;  4CJK A;  4FZX C;  5HRN A;  4L3Q A;  3QEI A;  4I7F A;  2D0B A;  2ZJP L;  4CEQ A;  1ASV A;  5BPN A;  5KQD A;  2OZM A;  1SS6 A;  4H0V B;  1WSJ A;  3QB0 A;  3BZC A;  3VF2 A;  4Q0B A;  4CHP A;  3K5L A;  1QTM A;  4CHY A;  1ATR A;  1EQY A;  3SBG A;  3CJA A;  4WF9 L;  4DHY A;  5KI6 A;  4HCB A;  4N41 A;  4M3Y A;  4DTO A;  3TR8 A;  2XY8 A;  3B8A X;  1BU6 O;  3A5N C;  2P9N B;  3R1X A;  1NBW A;  3TTC A;  4CZF A;  4V19 S;  2QKB A;  3IUC A;  4DU3 A;  3L6Q A;  4H0Y B;  4MDA A;  2O8F A;  2GEM A;  3PUF A;  3NBP A;  4KTW A;  1TAU A;  1Q82 O;  1N6Q A;  3F5T A;  4OKJ A;  3H1Q A;  4PA1 A;  4ZTJ A;  4KFB A;  4L8R B;  3GBT A;  1NJX A;  1K6Y A;  2D0O A;  1KXP A;  2P9I B;  2B5J A;  4OPK A;  3V81 A;  1I94 K;  2KKZ A;  4JKE A;  2F9T A;  4O4G A;  4W5O A;  2GV9 A;  4JI2 K;  3THY A;  1NK7 A;  4DV4 K;  4DR2 K;  1XUP O;  2WOM A;  1BI4 B;  3IG1 A;  3O4Q A;  4NB4 A;  4DV2 K;  3CFR A;  1JLQ A;  3DLG A;  4ELT A;  2CH5 A;  2GUP A;  1YVU A;  2FSJ A;  4Z4H A;  3K9K A;  5C2D A;  4LF6 K;  1SKW A;  2O8D B;  1BIU A;  3L8B A;  5AJ3 K;  3WXK A;  3SQ2 A;  3CF5 L;  4RW8 A;  1C0T A;  1REV A;  1DTQ A;  2IGI A;  4CJ3 A;  3TAE A;  3G71 N;  1TGO A;  2Y1I A;  2HBM A;  4H03 B;  5T7B A;  3OYJ A;  2VG5 A;  3EE9 A;  4AM6 A;  4CBU A;  2YNI A;  4IG3 A;  3MXM A;  2QWN A;  3SK3 A;  1L3V A;  3WQT A;  4KRE A;  1KAZ A;  5GAH P;  3V9X A;  1D5A A;  2QW9 A;  4DR1 K;  3KLE A;  1T6C A;  2A1S A;  1RT7 A;  2PYL A;  3HST B;  2ETJ A;  1WOQ A;  1T03 A;  4JEP A;  4LD0 A;  3UKU A;  4BRO A;  3C7N B;  1RT3 A;  1RDA A;  2CGK A;  1RTH A;  4M7X A;  3VQP A;  1W7A A;  2PAV A;  3VQE A;  2GWJ A;  2WON A;  2WBN A;  3NGY A;  3RSE A;  2EHG A;  5CZ1 A;  2NNW A;  1BWF O;  3JAM O;  5K14 A;  5B8H A;  1IKV A;  3PIO L;  5AQP A;  3OYI A;  4GV6 A;  4F2S A;  1L3T A;  1ASW A;  4DS5 A;  3VEO A;  4FLZ A;  3H3O B;  3H45 C;  5E84 A;  4BG9 A;  3P1G A;  4H0X B;  3ID8 A;  2Q97 A;  3R9P A;  1X9W A;  4DV7 K;  3M5R A;  3IDH A;  4LFC K;  3SV3 A;  2YV0 X;  4XH1 A;  4JI7 K;  3TTD A;  2IDO A;  2BH1 A;  4DLG A;  4C8O A;  1LWC A;  2W6K A;  3O4W A;  4EP5 A;  4N5S A;  2W6L A;  3ULE B;  1VQ8 N;  3OY9 A;  3LP3 A;  5J2N A;  1GLA G;  3OTO K;  4CF2 A;  1X9S A;  3ZET A;  5CHI A;  2VGN A;  1HKG A;  4DS4 A;  3WQU A;  3MX2 A;  1X9M A;  4RG8 A;  2BUP A;  1HLU A;  2E1Z A;  5ADX H;  2P9L B;  4CZE A;  2HHX A;  1BOT O;  3VQ8 A;  4RW4 A;  4N47 A;  3NE6 A;  4FJK A;  5BR8 K;  4E89 A;  2IOC A;  2RPI A;  3LPU A;  3P38 A;  4JKF A;  5D3G A;  2WC9 A;  3WNE A;  5SWM A;  1KAY A;  1WLJ A;  3HJF A;  3O1B A;  3O9T A;  1H1V A;  2NRR A;  1MDU B;  3K58 A;  3V9U A;  3AA4 A;  4GNI A;  2LSN A;  3TAM A;  3C6T A;  5BRF A;  2IC3 A;  4CCH A;  1JLC A;  1V4T A;  3UKR A;  4IEI A;  1S6Q A;  4CJ5 A;  1WSF A;  4C8M A;  5AQL A;  4J2E A;  5AFU A;  2FSK A;  2JWL A;  1NK5 A;  4O8U A;  3C6U A;  3DXK B;  2RN2 A;  3ISN C;  5KGW A;  1VQM N;  4DR3 K;  4AM7 A;  2UXB K;  4AF1 A;  4W5Q A;  4CGG A;  3OYC A;  3FR0 A;  3VA3 A;  4KI4 A;  2DPN A;  3FFK B;  4JKD A;  4FLT A;  2E20 A;  4CW7 B;  4FPA A;  1NKE A;  1OH6 A;  3O08 A;  4BC2 A;  1BIS A;  1HNI A;  4DMN A;  3WXL A;  4NCG A;  4GVM A;  3M8P A;  3SAF A;  4OJR A;  1WUA A;  2VWB A;  4O8K A;  5FPD A;  4A2A A;  3V6D A;  1W2B M;  3SJH A;  3KHY A;  4FJN A;  1SL1 A;  1P8Z A;  3S3O A;  1BA1 A;  3AVK A;  1RT6 A;  4DG1 A;  2GBZ A;  2YNH A;  3O6W A;  3ZSV A;  3AY9 A;  3THX A;  2CGL A;  3D7E O;  3ZSW A;  4YOX A;  4FL9 A;  4ELV A;  2FBX A;  4EHU A;  2DFE A;  3HTV A;  4FWP A;  2W41 A;  3KK3 A;  4KKO A;  4KHU A;  3EO3 A;  4IOX A;  4E7I A;  3VQ6 A;  3WNF A;  5J2Q A;  4AH9 A;  1SUQ A;  2YJF A;  3LWM A;  5F1X A;  1GLB G;  5M1O A;  1BL3 A;  5M1P A;  3SAH A;  1C0F A;  3ZSY A;  4M3X A;  1QVG M;  2HNY A;  1VSL A;  4ILH A;  3CMA N;  3T7Z A;  3M3Z A;  1RBV A;  2ZWH A;  3I8D A;  4CJP A;  1HYZ A;  4IFV A;  4KHS A;  2IS3 A;  3CYM A;  2YHY A;  4JN4 A;  1LW2 A;  3CCR N;  4WE1 A;  4CJU A;  4I2P A;  1K9M O;  4CHZ A;  1A5X A;  2Y1J A;  3JXU A;  1A5W A;  2X74 A;  1CXU A;  1NJY A;  3Q7B A;  2NLX A;  1JXE A;  1Z25 A;  2VG7 A;  3DXM A;  2D1K A;  2O8F B;  4BC3 A;  4TSX A;  5CYQ A;  4JI8 K;  3EKS A;  1Q81 O;  3VEY A;  4CBW A;  2G8W A;  1YT3 A;  4LF7 K;  2I7P A;  3AO1 A;  3KLH A;  1BG3 A;  4DTU A;  3N4P A;  4KHY A;  4K8X A;  4BRI A;  5J2M A;  1L3U A;  3HOS A;  1A5V A;  3ZT4 A;  5GAE P;  1OVY A;  3EEQ A;  5FPN A;  4CGJ A;  2AA4 A;  3THY B;  4JD2 A;  1OH7 A;  3T3F A;  1C1A A;  2WUS A;  3EN9 A;  4KB1 A;  4F8R A;  3RMB A;  4CGF A;  1ZC6 A;  4JNE A;  1K8A O;  4FJ7 A;  3ASM A;  1KTQ A;  5BPL A;  3M6G A;  1NMD A;  2VYP A;  1U45 A;  4YOU A;  3G0Z A;  4DFJ A;  4F9O A;  3RMC A;  1TVR A;  1GOC A;  1RBS A;  2AJQ A;  1S1W A;  1NK6 A;  3O9Q A;  1TV6 A;  4DSL A;  3NF9 A;  3DOL A;  2DY4 A;  3KIO A;  3WNH A;  3RRH A;  4OKK A;  4CZM A;  4OPH A;  1YXQ A;  3AVH A;  1U04 A;  5GIN A;  1RT5 A;  1RDD A;  3J7Y P;  2NRW A;  4EAH D;  2E6M A;  4OGC A;  1WSG A;  1BQM A;  1YTU A;  1S9E A;  3TAN A;  5AQR A;  3LZI A;  2Z1H A;  4JHD A;  3P5J A;  4FWL A;  1YTA A;  5KRS A;  4B3M K;  1TKX A;  4YOW A;  3A0I X;  3AA3 A;  3R8E A;  1MU2 A;  1BCM A;  1ASU A;  4AHC A;  1HNX K;  4BVP A;  2HF4 A;  3RMD A;  3VQ9 A;  3T19 A;  3CCS N;  3AVM A;  3C94 A;  3LM2 A;  4YFU A;  3D0P A;  2UXD K;  3VEN A;  1D9D A;  4HHT A;  1HUX A;  3RSE B;  2BGG A;  4CJW A;  4FM0 A;  2AP1 A;  3IMX A;  1EWQ A;  5C15 A;  2Q31 A;  4E1M A;  1Y97 A;  1Q7Y O;  1LAW A;  5ELZ A;  1IH7 A;  5C42 A;  3DLH A;  4M7Y A;  4DQ8 A;  1JLE A;  2IVP A;  4BDZ A;  3TAP A;  4C1N I;  3I56 N;  1UWB A;  4W5T A;  4KHP K;  2D5R A;  4BR0 A;  5KQ8 A;  3VEV A;  1RBU A;  4ISG A;  3RWU A;  4WCE L;  4DR5 K;  4DF4 A;  5AZI B;  2JLE A;  3MED A;  2HHU A;  4FJ9 A;  2ZQB A;  2OAN A;  4IFY A;  3TSQ A;  3SQ4 A;  4CIE A;  1VQ4 N;  2J4R A;  3NDK A;  3KLI A;  3CQ8 A;  2YHB A;  3G25 A;  2E4L A;  4GW6 A;  5CE3 A;  3PX4 A;  1KAX A;  5HRO A;  1GLF O;  1HNW K;  3CI5 A;  4B1W B;  1Z26 A;  3B6P A;  4BR5 A;  3O3H A;  4ICL A;  1QQM A;  3V1R A;  3KJV A;  4FK4 A;  2Q3S A;  3BP8 A;  5ADX A;  1S72 N;  3HM9 A;  4RW9 A;  2QA4 N;  3KWI A;  1HNV A;  1EKE A;  2ATQ A;  2P9P B;  5LJW A;  2HNZ A;  3QNN A;  3CJ1 A;  3MEE A;  1OKJ A;  1JLF A;  3LAM A;  4YOY A;  5LL6 Z;  4ILJ A;  2RE2 A;  5AFU H;  2HF3 A;  3P4I A;  4CED A;  2HHH K;  4IOC L;  3J7Z O;  3TSU A;  2VWK A;  2ITM A;  1NU0 A;  3D2E B;  1S9G A;  4DCH A;  4DTM A;  4BVO A;  3OYE A;  3PY8 A;  1NG9 A;  4F2R A;  4E1N A;  3C0B A;  3AAR A;  4FLW A;  1VSK A;  3VQ5 A;  1J53 A;  2HHW A;  1K8K A;  1RBT A;  5GIP A;  1TUU A;  1TYQ A;  4B9L A;  4ISF A;  4CEB A;  1WNS A;  3TAR A;  2HVI A;  3OYK A;  2E6L A;  2Z1G A;  3JS6 A;  4O0J A;  2HW3 A;  2IVN A;  3ZT3 A;  4FWK A;  4CJ4 A;  4WYB A;  4CVN E;  2F96 A;  2HBJ A;  4DKW A;  2UUA K;  3K5O A;  4H5T A;  5I3U A;  2HST A;  2Q2R A;  3CJB A;  4E3S A;  3CPW M;  3LAL A;  1N8R O;  4DWI A;  3I55 N;  3SQ1 A;  2D0A A;  1GOB A;  1ATS A;  4AHR A;  1BCO A;  4YOT A;  1MWK A;  3VEZ A;  4NCB A;  3C6H A;  4LSN A;  4WFN L;  4JRP A;  3E1Y A;  3KD1 E;  3CM6 A;  2B4J A;  2E2N A;  1TKZ A;  3H6E A;  1HR0 K;  5DM7 L;  4KB0 A;  2XY6 A;  5AZJ A;  4XIU A;  1RTI A;  1XNR K;  4FXD A;  3D45 A;  4CJV A;  2YNG A;  5HBM A;  1HYV A;  4MLH A;  1VQL N;  2E2Q A;  4JK9 A;  4DTR A;  3THV A;  3ZYY X;  4NXN K;  2ASO A;  3M8R A;  2V7Y A;  1JL1 A;  3ATU A; 
#chains in the Genus database with same CATH homology
 4CFA A;  4FM1 A;  2JGU A;  3DOK A;  1X9W A;  1UA0 A;  3OVN A;  1SL0 A;  4QAG A;  1HPZ A;  4NYN A;  4OVL A;  5KTQ A;  5C25 A;  1HYS A;  2D0C A;  1I39 A;  1JLG A;  1VSI A;  3L2Q A;  3KLF A;  3SV3 A;  1S1X A;  1S6P A;  2YV0 X;  3MAQ A;  3AVA A;  3PO4 A;  4B8C A;  3AVN A;  4O0I A;  2IDO A;  4FJI A;  3PX6 A;  1NKB A;  1RT2 A;  3DLB A;  3EZ5 A;  4DFM A;  2G8K A;  1FK9 A;  4DLG A;  4C8O A;  3QIP A;  3VQQ A;  1NJW A;  4QOZ B;  1LWC A;  4KAZ A;  3V9S A;  2HHV A;  3S3N A;  1NKC A;  1VRT A;  3HPG A;  4LH4 A;  4GMJ B;  1RT1 A;  3ZCM A;  4EP5 A;  4CIF A;  4N5S A;  3OYN A;  4E7H A;  3LPT A;  3AVG A;  4JRQ A;  3OYB A;  3OY9 A;  3LP3 A;  5J2N A;  3SUO A;  4KV8 A;  3ZSO A;  2KZZ A;  4BE1 A;  2B6A A;  3DM2 A;  4CF2 A;  1X9S A;  4I2Q A;  3OYD A;  1CLQ A;  3LP0 A;  1NJZ A;  3HVR A;  3I0S A;  4DLE A;  2QXF A;  4DS4 A;  1X9M A;  4Q5V A;  3HPH A;  1CZB A;  4DSE A;  4RG8 A;  5HRS A;  3SI6 A;  4BWJ A;  1L3S A;  2XHB A;  3ITH A;  4MQ3 A;  4PQU A;  2HHX A;  2OPR A;  1JLA A;  3VQ8 A;  3L2R A;  4RW4 A;  4BE0 A;  3OYG A;  4CHQ A;  4N47 A;  3NE6 A;  4FJK A;  4FZZ A;  4E89 A;  2IOC A;  2RPI A;  2HMI A;  3LPU A;  3ALY A;  3C95 A;  3ZT2 A;  1KSP A;  3TAF A;  5D3G A;  1NK4 A;  2FBT A;  3FFI A;  3WNE A;  5SWM A;  3LDS A;  4B9T A;  3VQ7 A;  1U4B A;  1F21 A;  1VSM A;  1WLJ A;  5EU7 A;  3V9U A;  4ELU A;  3HJF A;  4CIG A;  3K58 A;  3AA4 A;  3K2P A;  2LSN A;  3TAM A;  3CG7 A;  1B92 A;  3C6T A;  3MEC A;  4O5B A;  2IC3 A;  3OJS A;  4CCH A;  3AO4 A;  1JLC A;  1S6Q A;  1KVB A;  1WN7 A;  4CGH A;  1WSF A;  4C8M A;  3KKR A;  4CJ5 A;  1NOY A;  1QSL A;  2QKK A;  3QES A;  4FJH A;  1KVC A;  4J2E A;  2KFN A;  3DRS A;  5DK5 A;  5CY4 A;  1NK5 A;  2RF2 A;  4E7K A;  4DF8 A;  2BDP A;  2QK9 A;  3C6U A;  4KHQ A;  3HL8 A;  2RN2 A;  3ISN C;  5KGW A;  1ZBL A;  4HVJ A;  4FJJ A;  4DTX A;  1DLO A;  4H4O A;  1TL1 A;  1WSE A;  3AVF A;  4Z4F A;  4CHN A;  4W5Q A;  3U3G A;  3K59 A;  4MFB A;  4CGG A;  3ZSX A;  3OYC A;  3QNO A;  3RRG A;  3SNN A;  2F8S A;  1S1U A;  4AHV A;  3HPO A;  4DSI A;  2HVH A;  4CJE A;  3VA3 A;  4CJR A;  3TAG A;  2Z1I A;  4KI4 A;  4EZ6 A;  1BQN A;  3TWH A;  4FLT A;  4FJL A;  1NKE A;  4EP4 A;  3QER A;  4CJS A;  1T8E A;  4B9U A;  1BIS A;  5HRR A;  1HNI A;  3OYH A;  4DMN A;  1C6V A;  4UQG A;  5FRM A;  3AO2 A;  4Z4E A;  4O55 A;  1ITG A;  4NCG A;  4GVM A;  3M8P A;  4F3O A;  4DU1 A;  1SL2 A;  4BE2 A;  2O4I A;  4OJR A;  3QO9 A;  2R7Y A;  3OS0 A;  1NOZ A;  3QIN A;  3V6D A;  3TI0 A;  4DFP A;  4J2A A;  1IKY A;  4B9V A;  5C24 A;  1RTJ A;  3NGZ A;  4B9M A;  2GUI A;  3OS2 A;  5HP1 A;  3PV8 A;  3K57 A;  1EET A;  1NK9 A;  1IKX A;  4HUG A;  1T05 A;  4FJN A;  1SL1 A;  4CF1 A;  2DFH A;  2X6N A;  3S3O A;  3LP1 A;  4BAC A;  1J54 A;  2EX3 A;  3AVK A;  1RT6 A;  1HJR A;  4DG1 A;  3ULD A;  4Y1C A;  2GBZ A;  3L2V A;  4E0D A;  2YNH A;  4F3T A;  3ZSV A;  3M8S A;  3L2W A;  4AHU A;  1VRU A;  1Q9Y A;  1BGX T;  4I9Q A;  4DTJ A;  3ZSW A;  3CM5 A;  5FDL A;  4J2B A;  2G8I A;  3V1Q A;  1TK8 A;  4HUF A;  1U48 A;  4ELV A;  3LZJ A;  2FBX A;  1S1V A;  2DFE A;  4CF0 A;  5J2P A;  3LAN A;  2KZM A;  3RTV A;  2VWJ A;  1VSJ A;  3KK3 A;  4N76 A;  1KLM A;  4FJ5 A;  4KKO A;  4KHU A;  4E7I A;  5J2Q A;  1T7P A;  3VQ6 A;  3WNF A;  1ZBF A;  4W5R A;  4AH9 A;  1SUQ A;  3KD5 E;  2FBV A;  3NFA A;  1HQU A;  3LWM A;  4DTP A;  1BL3 A;  4JLH A;  1W9H A;  3AVC A;  4CJQ A;  1KFS A;  3NH1 A;  3NF6 A;  2XY5 A;  1RTD A;  1RCH A;  1BIZ A;  3ZSY A;  4M3X A;  2HNY A;  1VSL A;  4CF9 A;  1B9F A;  3QIO A;  4CFB A;  1O1W A;  1IKW A;  3HXM A;  2HHT A;  3L2U A;  1RBV A;  3BGR A;  3I8D A;  1CZ9 A;  1IO2 A;  3CFP A;  4CJP A;  1HMV A;  3AVL A;  1HYZ A;  4IFV A;  4O44 A;  4KHS A;  3DRP A;  2HW3 A;  2IS3 A;  3CYM A;  1D8Y A;  4CEE A;  4KPY A;  3T1A A;  3OJU A;  4FLX A;  3QET A;  1LW2 A;  4WE1 A;  3V1O A;  5CYM A;  5CZ2 A;  4W5N A;  4KTZ A;  1KFD A;  2G8H A;  1R0A A;  4CJU A;  4I2P A;  4HUE A;  4FK2 A;  1RIL A;  4CHZ A;  1A5X A;  1EXQ A;  4ZHR A;  4BDY A;  2ZD1 A;  1KRP A;  2Y1J A;  1NK8 A;  1SKS A;  1A5W A;  1C1C A;  3OYF A;  3AA2 A;  2X74 A;  4KO0 A;  4CHO A;  4FYD A;  1CXU A;  3V9W A;  1HQE A;  1NJY A;  3QEV A;  2P5G A;  4H8K A;  1JXE A;  1Z25 A;  2VG7 A;  1TK0 A;  1RT4 A;  4LY7 A;  1QQC A;  3CFO A;  1VK0 A;  5KRT A;  4CEA A;  1EX4 A;  4C8K A;  2ZE2 A;  3EY1 A;  4TSX A;  5CYQ A;  1WSI A;  3ZSZ A;  4KI6 A;  2G8W A;  4JS4 A;  1YT3 A;  3AO5 A;  3SUQ A;  4PY5 A;  3DLK A;  4IG0 A;  4FCY A;  4Z4I A;  3TAQ A;  1KVA A;  3AO1 A;  2G8V A;  3KLH A;  3SUP A;  4DTU A;  3VQD A;  2ITG A;  3SYZ A;  3QEP A;  4FLV A;  1RDB A;  4BWM A;  4DQS A;  2OZS A;  4K8X A;  4KHY A;  2KQ2 A;  3DYA A;  3L3V A;  1XC9 A;  4FK0 A;  1J9A A;  5J2M A;  1L3U A;  4B8A B;  3SUN A;  1A5V A;  3QLH A;  3ZT4 A;  2BE2 A;  3S9H A;  3HP9 A;  3AVI A;  4DTN A;  1ZBI A;  4DU4 A;  2HHQ A;  4EZ9 A;  3AVB A;  3KK2 A;  4CGJ A;  3K5N A;  3V9Z A;  4QCL A;  3T3F A;  4PUO A;  2I5J A;  1U47 A;  5JS1 A;  3QEW A;  1C1A A;  3KKS A;  1IG9 A;  3IS9 A;  1RDC A;  3DMJ A;  4OPJ A;  3RMB A;  4CGF A;  4F8R A;  4IDK A;  4KB1 A;  3I0R A;  3O3F A;  3RR8 A;  4FJ7 A;  4M42 A;  3QEX A;  3ASM A;  1KTQ A;  3VQ4 A;  1UA1 A;  2X6S A;  1ZBU A;  4CEO A;  3PX0 A;  4AIL C;  2G8F A;  4N56 A;  3HK2 A;  2KW4 A;  1VSH A;  4E19 A;  1Q9X A;  4DFK A;  3PO5 A;  4K8Z A;  1VSD A;  1XI1 A;  1SV5 A;  1U45 A;  1RNH A;  3G0Z A;  4DFJ A;  2OYQ A;  3RMC A;  2DFF A;  1TVR A;  1GOC A;  1WSH A;  1RBS A;  2AJQ A;  4CE9 A;  1S1W A;  1LV5 A;  4FJG A;  1NK6 A;  1QSS A;  1TV6 A;  1JLB A;  4CK2 A;  1UAX A;  1JXB A;  4DSL A;  2KTQ A;  4FW2 A;  3NF9 A;  3DOL A;  2OPQ A;  3MEG A;  4CEC A;  2XRI A;  2A1R A;  4NCA A;  4KHW A;  3LP2 A;  2DY4 A;  1LWE A;  3KIO A;  3O3G A;  2X78 A;  3WNH A;  4OKK A;  3RRH A;  3IAY A;  4B3O A;  3AV9 A;  1Q8I A;  4M45 A;  3HP6 A;  3KTQ A;  1QE1 A;  3RR7 A;  4KHN A;  4M3T A;  3AVH A;  3RMA A;  1U04 A;  1L5U A;  4DQI A;  3H08 A;  1RT5 A;  1RDD A;  1G15 A;  3SPZ A;  4KTQ A;  2OPP A;  4FLU A;  4FM2 A;  2E6M A;  2PY5 A;  4FJ8 A;  1KCF A;  4OGC A;  4DQP A;  1WSG A;  1DTT A;  1BQM A;  3G10 A;  3HO1 A;  1LAV A;  4NYF A;  4OLB A;  1YTU A;  1S9E A;  4CJL A;  3TAN A;  3LZI A;  2Z1H A;  3OYM A;  5I42 A;  3P5J A;  5KRS A;  1UOC A;  1YTA A;  2IAJ A;  4CFC A;  1TK5 A;  1TKX A;  1J5O A;  2P1J A;  4OKE A;  1N5Y A;  4CJK A;  4HCC A;  3U3Y A;  4FZX C;  3AA3 A;  5HRN A;  1D9F A;  4DSK A;  1MU2 A;  1BCM A;  3QEI A;  4I7F A;  1ASU A;  4CGI A;  4YNQ A;  4AHC A;  2D0B A;  3VN5 A;  3B6O A;  3A2F A;  4CEQ A;  1ASV A;  3RMD A;  3VQ9 A;  3SCX A;  4J2D A;  3T19 A;  3AVM A;  2OZM A;  5HRP A;  3C94 A;  4CK3 A;  4YFU A;  3D0P A;  3HVT A;  4PWD A;  5FRO A;  1D9D A;  4OGE A;  3MXI A;  1WSJ A;  4HHT A;  4Q0B A;  4CHP A;  3K5L A;  4M41 A;  4CHY A;  1QTM A;  1ZBH A;  2BGG A;  4CJW A;  4FM0 A;  3NGI A;  3JYT A;  4HCB A;  5KI6 A;  4FJX A;  4E1M A;  4N41 A;  3L3U A;  1Y97 A;  4M3Y A;  1LAW A;  4Z4C A;  4DTO A;  3TR8 A;  2YKN A;  1IH7 A;  3DRR A;  2XY8 A;  5C42 A;  4CJT A;  5E41 A;  3DLH A;  1KLN A;  4DSJ A;  1JLE A;  1FKO A;  4BDZ A;  3TAP A;  5KGX A;  1UWB A;  3OYA A;  4FVM A;  3VA0 A;  3LAK A;  3ZT1 A;  4W5T A;  4JS5 A;  4FW1 A;  5SZT A;  3DLR A;  4AHT A;  1C0M A;  2D5R A;  4G1Q A;  4Z0U A;  2QKB A;  3RWU A;  1RBU A;  3V4I A;  4DU3 A;  1NK0 A;  5J1E A;  4Z4G A;  2O4G A;  4H4M A;  4ID1 A;  4DF4 A;  3S3M A;  1TL3 A;  2JLE A;  3MED A;  4M3W A;  4FJ9 A;  2HHU A;  2YHA A;  3MXJ A;  2ZQB A;  3NF8 A;  4IFY A;  3PUF A;  4CEF A;  4CIE A;  3SQ4 A;  1QS4 A;  4C8N A;  3NBP A;  3NDK A;  3BDP A;  4KTW A;  3KLI A;  4DQR A;  1XHZ A;  1N6Q A;  1TAU A;  1S1T A;  1GOA A;  3DI6 A;  1WAF A;  2YHB A;  4OKJ A;  3VQB A;  2E4L A;  4GW6 A;  3CQ8 A;  2F8T A;  4KRF A;  4PA1 A;  4ZTJ A;  1SKR A;  4KFB A;  1ZYQ A;  3PX4 A;  4L8R B;  4DTS A;  3SPY A;  1NJX A;  2P5O A;  5HRO A;  1K6Y A;  4ZTF A;  1RBR A;  2HHS A;  1Z26 A;  3F73 A;  2B5J A;  3B6P A;  3AA5 X;  3O3H A;  4LH5 A;  4OPK A;  4ICL A;  3NAE A;  3V81 A;  1WAJ A;  3V1R A;  3ZT0 A;  1JKH A;  2YNF A;  4CES A;  3KJV A;  3TAB A;  4M3U A;  4FK4 A;  2PYJ A;  4O4G A;  2Q3S A;  4M3R A;  4ID5 A;  2P51 A;  4W5O A;  1QHT A;  3SV4 A;  2GV9 A;  1B9D A;  4RW9 A;  3HM9 A;  1NK7 A;  1BI4 A;  3KLG A;  1HNV A;  1EKE A;  2WOM A;  1BI4 B;  2ATQ A;  3U6F A;  3IG1 A;  3VQC A;  2HNZ A;  3O4Q A;  3EYZ A;  3QNN A;  3MEE A;  3OYL A;  1JLF A;  3CFR A;  3LAM A;  4B9S A;  4RW6 A;  1JLQ A;  3DLG A;  4LSL A;  4ELT A;  1I3A A;  1YVU A;  4IKF A;  4CER A;  4CED A;  4Z4H A;  1VSE A;  4AHS A;  1TAQ A;  1SKW A;  4B9N A;  2OA8 A;  4DSF A;  1BIU A;  5HLF A;  1U49 A;  3L8B A;  2VWK A;  1QSY A;  2RKI A;  1S9G A;  4DTM A;  3AO3 A;  2PZS A;  1CXQ A;  3SQ2 A;  4OLA A;  3OYE A;  3PY8 A;  4F2R A;  3ZSR A;  4IBN A;  4E1N A;  1LWF A;  3JSM A;  1W0H A;  4RW8 A;  1C0T A;  4FLW A;  1VSK A;  2VG6 A;  3VQ5 A;  1REV A;  4CEZ A;  1DTQ A;  2IGI A;  3WNG A;  4FJM A;  1J53 A;  4CJ3 A;  2HHW A;  1RBT A;  3TAE A;  3NHG A;  3O4N A;  1XHX A;  1TGO A;  4B9L A;  2Y1I A;  4CEB A;  4I9L A;  1WNS A;  5T7B A;  3TAR A;  2HVI A;  3OYK A;  2E6L A;  2Z1G A;  4O0J A;  5JS2 A;  1JL2 A;  4CJF A;  3OS1 A;  2VG5 A;  3OYJ A;  3NCI A;  2XO7 A;  3F9K A;  5FRN A;  3ZT3 A;  2YNI A;  4IG3 A;  3MXM A;  5DMR A;  4CJ4 A;  3ZSQ A;  2XY7 A;  1L3V A;  3AVJ A;  4KRE A;  3HYF A;  3NH2 A;  3V9X A;  1D5A A;  2YKM A;  3SQ0 A;  2BAN A;  3KLE A;  4E7J A;  2F96 A;  4Y1D A;  3SZ2 A;  1TKT A;  4FLY A;  4RW7 A;  3K5O A;  1X1P A;  5I3U A;  2A1S A;  1RT7 A;  2PYL A;  1C1B A;  3HST B;  4HTU A;  3UIQ A;  4E3S A;  2ETJ A;  2HB5 A;  3LAL A;  1T03 A;  4DWI A;  4LD0 A;  3SQ1 A;  1VSF A;  3K5M A;  2D0A A;  4C8L A;  1GOB A;  1FXX A;  4AHR A;  2FBY A;  1C0U A;  1RT3 A;  1BCO A;  2W42 A;  3P83 D;  1RDA A;  3IRX A;  4E7L A;  2NUB A;  3E01 A;  3HT3 A;  1RTH A;  2Z1J A;  3LWL A;  4NCB A;  4LSN A;  3VQP A;  2G8U A;  4R5P A;  1TKD A;  3VQE A;  4M3Z A;  3DLE A;  4JRP A;  1LW0 A;  2WON A;  4CK1 A;  4CGD A;  1EP4 A;  3KD1 E;  3CM6 A;  3NGY A;  2B4J A;  2FC0 A;  1HRH A;  1TKZ A;  2EHG A;  5CZ1 A;  4FZY A;  2DTU A;  4DQQ A;  4KB0 A;  2XY6 A;  3SJJ A;  5K14 A;  1XWL A;  1IKV A;  4XIU A;  1S5J A;  1RTI A;  3NH0 A;  4FXD A;  3D45 A;  4CJV A;  4CFD A;  2YNG A;  2OPS A;  3VQA A;  4B08 A;  3M8Q A;  1HYV A;  3NF7 A;  5HBM A;  4CF8 A;  3OYI A;  4BDP A;  4F4K A;  1L3T A;  4F2S A;  1FKP A;  2KFZ A;  1ASW A;  4DS5 A;  4DTR A;  3THV A;  3KK1 A;  4FLZ A;  3P1G A;  1BHL A;  3M8R A;  1JL1 A;  2HND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...