4OPKA

Bh-rnaseh:2'-sme-dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
133
structure length
133
Chain Sequence
b'EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Generating Crystallographic Models of DNA Dodecamers from Structures of RNase H:DNA Complexes.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 38
structure length 133
sequence length 133
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2014-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4opkA00
3HPOA 1QTMA 3KLIA 2HMIA 5HBMA 1Q9XA 2QXFA 4B08A 4DTSA 1NKBA 1I3AA 3PV8A 4J2DA 4FLXA 3AVKA 3HPHA 4CJPA 3K58A 1S1XA 3NGZA 2XO7A 1VRTA 1G15A 3VQ5A 2HHWA 1TAUA 4NCAA 2X6SA 4CK3A 3QERA 2D0BA 4FJHA 4W5QA 4W5OA 4UQGA 3V1RA 4DSFA 2Z1HA 1X9WA 4CHOA 4AHCA 4DTMA 1SL1A 4OLBA 4E7IA 3BGRA 3RWUA 3DRRA 3SQ4A 3D45A 3DI6A 1S1TA 4CJ3A 4M3YA 3NGYA 3C94A 3VQCA 1JLGA 3TANA 1VSIA 1RT2A 4CIFA 4E7KA 1RDCA 4DTUA 1Q8IA 4Y1DA 4EP5A 1KTQA 2YHBA 5J2PA 3HO1A 4CFBA 2HHSA 1JLFA 3PX4A 5FROA 1KFSA 5CZ1A 1D5AA 1HQUA 1S6QA 1ZBUA 1Z26A 5C42A 2KZZA 1VK0A 4CE9A 4DLEA 4HUFA 2FBXA 4DTOA 1TKZA 3LAKA 1C1AA 2Z1GA 4CK2A 4DSEA 5KRTA 1F21A 1T8EA 2PYLA 4KHYA 3HK2A 3AVBA 3DLRA 2KTQA 3E01A 3MEEA 4BWJA 3BDPA 1JLEA 4O44A 1C0MA 1HNIA 1LAVA 2XRIA 4F2RA 4MFBA 1RDDA 4FJMA 3QNOA 2FBYA 4N5SA 1J9AA 2B6AA 2DFHA 3ZT0A 2F8SA 4KKOA 1RT5A 3HP9A 3T1AA 3ZT2A 3JYTA 3DOLA 4CGDA 2DTUA 1EETA 3L3UA 3MXIA 1B9DA 4DSIA 4H4OA 1BQNA 1TL3A 4DFJA 1JL2A 1L3SA 1DTQA 4OLAA 1WAFA 4I7FA 1T05A 2D0AA 1IKYA 5SWMA 3V81A 4FJ8A 1C0UA 4CGFA 4DU3A 1SUQA 3TAGA 3FFIA 2G8VA 2KFNA 1R0AA 3HSTB 4ICLA 1C0TA 5CYMA 3QEVA 1U4BA 1NJYA 3IAYA 4Z4GA 1TV6A 3CFOA 3K2PA 4JLHA 2IDOA 3QNNA 3TAPA 3AO1A 1NKEA 4KHQA 1EX4A 2KQ2A 5E41A 3OYAA 1XHZA 4DSKA 2HHQA 3OJUA 2RKIA 3I0SA 4E7JA 3PO4A 4QOZB 1WNSA 4HTUA 2JGUA 1LWFA 3CM5A 2XY7A 3I0RA 4KV8A 1RTHA 3D0PA 4PY5A 4LD0A 3AVNA 5J2QA 1KSPA 3HJFA 1GOBA 4WE1A 2VWJA 2X6NA 4CJRA 4CF0A 1NK8A 4FLTA 4FJJA 3SPYA 2HW3A 3ZSRA 1X1PA 4IFYA 2E6LA 2KW4A 2YKMA 3KK1A 4DS5A 4KFBA 3RMCA 4FJ7A 1KCFA 4KPYA 3LZIA 3KLEA 2A1SA 5I42A 4GMJB 1JL1A 2B4JA 4ID5A 1CZ9A 4CIGA 1GOAA 4AHSA 4FCYA 2ZE2A 4ZTFA 2W42A 4B9LA 4M3UA 2XHBA 1BGXT 5K14A 1JLAA 4DTNA 3B6OA 3LWMA 4KHSA 1WSIA 3DLEA 4DQIA 1D8YA 4CF8A 4JS5A 1ASVA 1RTJA 3V9SA 4FJGA 4CJLA 2YNGA 2DFEA 2XY8A 1L5UA 3RTVA 4NCGA 4DFKA 4ELTA 4FYDA 3QLHA 5HRSA 4OPJA 2I5JA 3RMBA 2G8KA 4FM2A 1NJXA 5FRMA 1ZBHA 2QK9A 1W0HA 4PA1A 2A1RA 3KD5E 1VSKA 4CJWA 4FZYA 1RBVA 2YV0X 3LP0A 4B8CA 1HRHA 2QKKA 4FLUA 1FK9A 1N6QA 2E6MA 4IFVA 2GBZA 3OYKA 5I3UA 3KLGA 1TVRA 1EKEA 3NFAA 4CJEA 1ZBIA 4RW7A 4EZ9A 3SYZA 4HCBA 3NAEA 4KI4A 4DU4A 4F8RA 4BACA 2IGIA 4FLWA 4OPKA 5J2MA 1FKOA 1S9GA 3WNEA 3AVIA 3ZSVA 4AHTA 4CHZA 4FXDA 3AVAA 4HHTA 3ZSOA 3LALA 1LAWA 4DSLA 5SZTA 1NK9A 4C8NA 3AA2A 5HRRA 4DQQA 3O3FA 2R7YA 3HM9A 1VSDA 1T7PA 3RR7A 4IKFA 2OPQA 3NCIA 4KB0A 1ITGA 3DM2A 3EZ5A 5KRSA 1BI4B 1HMVA 2IC3A 3T3FA 2GV9A 1FKPA 4F3TA 3KKSA 2FBTA 4J2EA 4Z4IA 4LSLA 3L2VA 4L8RB 4CHNA 4KO0A 1DTTA 5KTQA 3WNGA 2OZSA 3ALYA 3AA3A 5CY4A 1K6YA 5CYQA 1RT4A 4CF1A 4DMNA 4E89A 1HJRA 3AA4A 1LWCA 2D5RA 2HHUA 4GW6A 4CFCA 3TI0A 3TWHA 3P83D 4CFDA 4RG8A 4JS4A 3RR8A 3K5LA 4OGCA 4B9MA 2P5GA 2BANA 4CHPA 1X9MA 3VQQA 2Y1JA 1L3TA 1IH7A 4B9NA 3DRSA 4CERA 2BE2A 3VA3A 1J54A 4ZTJA 4B3OA 4LSNA 1ZBFA 1BIUA 5EU7A 3LDSA 4N41A 3LP3A 2F96A 3QIOA 2Y1IA 4FZZA 5JS2A 4M3RA 4GVMA 4CK1A 3U3GA 4B9TA 3V4IA 3ZSXA 1WSHA 3DLHA 3ASMA 3G0ZA 4HUGA 4Z4FA 2Z1IA 1NOZA 1UOCA 1VSMA 4EZ6A 5CZ2A 3ZT4A 2F8TA 4E7LA 2RPIA 4K8XA 1HYSA 4DTJA 1LW0A 5J2NA 4FK4A 1S1UA 4PUOA 1C6VA 3AA5X 3HT3A 1LW2A 4Q0BA 1Z25A 4DFMA 4CJSA 2OPSA 1KRPA 5FRNA 4KI6A 1TGOA 2YNFA 4C8LA 1LWEA 3WNHA 4O0IA 3AVHA 1RILA 4IDKA 2D0CA 1SKSA 3PY8A 3MECA 1T03A 3VQPA 4HVJA 4CJ4A 3AVMA 3LANA 3VQ9A 1VSJA 3TARA 4DQRA 1YTAA 3P1GA 2G8HA 4FVMA 3S3MA 3QEWA 1C1BA 2VWKA 2VG5A 3SNNA 4H4MA 1UA0A 3OS1A 4CEZA 1VSEA 2X74A 4C8MA 1TKTA 3OJSA 2G8WA 4MQ3A 4BE2A 1CLQA 5D3GA 2Z1JA 2XY5A 3ZSYA 1CXQA 1KVBA 1RNHA 3VQEA 3THVA 3QO9A 1IKVA 5HRNA 3ZSZA 1SKWA 3VQ7A 1XI1A 1TKDA 3O3GA 1NK6A 4CEBA 1S1WA 2RN2A 3KK3A 4HCCA 1WAJA 3IG1A 2G8IA 2IAJA 4G1QA 3PX6A 4NCBA 1RDAA 1JKHA 4FM0A 2QKBA 3TAMA 1BHLA 3V9XA 3AV9A 4I9LA 2PZSA 2FBVA 4AHVA 3C6UA 3OYIA 3HXMA 4DTXA 1ZYQA 3MXMA 1J5OA 2G8FA 1RBUA 4W5RA 3S9HA 4Z4HA 3ZCMA 1WSFA 1B9FA 4E19A 1RBTA 5KI6A 3OY9A 3ZSQA 3SUPA 1A5XA 4KTWA 4B8AB 3QEIA 4F3OA 3I8DA 3V9UA 3LAMA 3OVNA 4XIUA 3LWLA 1JLQA 4DLGA 1XHXA 3TAEA 2P1JA 4PWDA 4ID1A 3TAQA 4KTQA 4ZHRA 4DF8A 3F73A 2YNHA 4FW2A 1YT3A 3TAFA 2ATQA 3OYEA 4N76A 3M8QA 4YNQA 2YNIA 2EX3A 4I2PA 1KVCA 3WNFA 3OYGA 3V1QA 4M41A 1KLMA 3OYMA 1GOCA 1S5JA 4FJLA 2X78A 3CFPA 1ASWA 3C95A 4CFAA 4CJQA 1WSEA 3PUFA 4RW6A 4CEQA 4BE0A 3RMDA 4FK0A 4C8OA 4BE1A 3M8SA 3VQ6A 3MEDA 2JLEA 2VG7A 2HNDA 3NF6A 3K5NA 3L8BA 1BI4A 1TKXA 1JLCA 4O4GA 3SQ1A 4M42A 1CZBA 4FM1A 3CM6A 3LPUA 4FJKA 4CJUA 5DK5A 4LH4A 3SQ0A 1TK8A 4DQSA 2OYQA 4LY7A 3SUQA 4M3ZA 3EY1A 3V6DA 3OYJA 4BWMA 4CEOA 2ITGA 3HYFA 4KHUA 1C1CA 4CGGA 2HHTA 2KZMA 1HQEA 4NYFA 4OKJA 2HHVA 2IOCA 4Z0UA 1RT6A 4ELUA 3SPZA 3ULDA 5JS1A 4CGIA 1B92A 4RW8A 4JRQA 4FLYA 1U47A 3CQ8A 1HNVA 4DG1A 1TK0A 3AO5A 1LV5A 1ASUA 3SZ2A 1VSLA 3DYAA 5J1EA 3KIOA 1IG9A 3OYFA 4DQPA 3OYDA 3MAQA 1TK5A 4IG0A 1VSHA 3NH0A 3NE6A 4CIEA 1IKWA 2OPRA 2PYJA 3RRGA 1WSJA 3AVGA 4NYNA 4CCHA 3DLKA 1EXQA 2EHGA 3L3VA 3SCXA 4FW1A 4AHRA 2ZQBA 2WONA 5KGXA 1I39A 1QE1A 1S6PA 5T7BA 3VQ4A 3M8RA 3OS2A 4DTRA 4KB1A 4J2BA 3IRXA 3VA0A 4RW4A 4I9QA 4OKEA 3G10A 2ZD1A 3IS9A 3NF8A 4CEEA 4QAGA 2B5JA 3CFRA 3LZJA 3RRHA 1X9SA 4F4KA 1BL3A 1VSFA 3ISNC 4CJKA 3DOKA 1KFDA 5HROA 4J2AA 3L2WA 1U45A 2VG6A 1UA1A 3ZT3A 3S3OA 3HVRA 4JRPA 4Q5VA 1ZBLA 1TL1A 3HVTA 5HRPA 4AH9A 3O4QA 3QESA 3DLGA 2KFZA 4CJTA 4CEDA 1RTDA 1BCMA 1YVUA 4CHQA 4KAZA 1BCOA 4KHWA 3VQAA 3M8PA 4DWIA 3P5JA 1UWBA 5FDLA 4M3TA 1QQCA 3MEGA 5C25A 3B6PA 2HB5A 1MU2A 3NBPA 4OGEA 4E7HA 4CF2A 3OS0A 1NJWA 4E1MA 1N5YA 2WOMA 2XY6A 3SUOA 1NKCA 1QSSA 1WLJA 1SL2A 4FLVA 3PO5A 1CXUA 2FC0A 4BDPA 3PX0A 3S3NA 4H8KA 1BIZA 1JXEA 3SI6A 4ELVA 4W5TA 1L3VA 2AJQA 4OJRA 4BDZA 4CECA 3AVJA 3KTQA 4O5BA 3DRPA 1WN7A 4CEFA 5HLFA 4KTZA 2RF2A 2Q3SA 1RBRA 3QINA 3HPGA 3KLFA 1QS4A 3K57A 1J53A 3NGIA 3QEPA 1U48A 3KLHA 4KRFA 3VQ8A 1RBSA 2DY4A 3C6TA 3CYMA 4LH5A 4CJFA 1HYZA 3JSMA 2NUBA 3NH2A 1IKXA 3V1OA 3V9ZA 1Q9YA 4CF9A 3VQDA 4DFPA 3F9KA 3HL8A 3U6FA 3VQBA 4CESA 1NK0A 3NH1A 4DS4A 4CJVA 4QCLA 4Y1CA 2O4GA 4R5PA 3SUNA 4N56A 2BGGA 4K8ZA 3QIPA 4O0JA 3ZT1A 4E0DA 3ITHA 3NF9A 3T19A 4IG3A 1RTIA 3L2QA 1KLNA 4W5NA 1D9DA 4PQUA 2ETJA 4M45A 1NK7A 3KK2A 3TABA 4FK2A 3LP1A 1U49A 2HVHA 1A5VA 1HYVA 1NK5A 3KKRA 3VN5A 3OYLA 3L2UA 3SV4A 3DLBA 2DFFA 4N47A 1NJZA 4M3XA 2BDPA 3K5OA 3NHGA 1U04A 4IBNA 1DLOA 2P51A 3QETA 1YTUA 3U3YA 4DSJA 1RDBA 3K5MA 3LPTA 4FJNA 4FJIA 4F2SA 1FXXA 4BDYA 2OPPA 4FJ5A 3QEXA 2OA8A 1HPZA 4Z4EA 3MXJA 1RT3A 3EYZA 3SV3A 1JLBA 1BISA 2LSNA 3O4NA 2HNYA 4E3SA 1L3UA 1S9EA 1IO2A 1D9FA 3L2RA 4CEAA 4HUEA 4OVLA 2YHAA 3OYBA 3HP6A 3KJVA 3AVCA 3NF7A 2P5OA 1RT7A 2IS3A 5KGWA 1UAXA 1SKRA 3K59A 2HHXA 1W9HA 4EP4A 3AVFA 4CGHA 4C8KA 4M3WA 1XWLA 3AO3A 1RT1A 1REVA 3NDKA 3SQ2A 5HP1A 4B9VA 1NK4A 1KVAA 3AVLA 3LP2A 5C24A 4DU1A 4DF4A 3AO2A 4CJ5A 4B9UA 3A2FA 4FJXA 4CGJA 1EP4A 2OZMA 4AHUA 4CHYA 1O1WA 2PY5A 2HVIA 4FZXC 2O4IA 4YFUA 1WSGA 4AILC 1TAQA 4Z4CA 3OYCA 1QHTA 2GUIA 4I2QA 2E4LA 1Y97A 4DTPA 1RCHA 1QSLA 4FLZA 1XC9A 3O3HA 3H08A 4TSXA 4FJ9A 2HNZA 3OYNA 1VRUA 1SV5A 3KD1E 3AO4A 1NOYA 2G8UA 3TR8A 3SJJA 4OKKA 3V9WA 2YKNA 3RMAA 1SL0A 1BQMA 1S1VA 5DMRA 4E1NA 1A5WA 3CG7A 1QSYA 3UIQA 4RW9A 3OYHA 4B9SA 1JXBA 4KREA 4O55A 3ZSWA 4KHNA 3DMJA
chains in the Genus database with same CATH superfamily
2JWLA 3KLIA 2QXFA 4I6MB 1NKBA 3T1HK 4FLXA 3AVKA 3LDLA 3HPHA 2QWOA 2XO7A 1TAUA 1G15A 3VQ5A 4IOAL 2X6SA 3U9ZA 4FJHA 1XUPO 4DR6K 5AQRA 2WFBA 2E2NA 4OLBA 1Q86O 3DRRA 4GV3A 3D45A 4CJ3A 5M1OA 3VQCA 1RT2A 3WQTA 3MDQA 4DTUA 3T69A 2VQFK 5J2PA 2HHSA 4CFBA 1ATSA 5FROA 5CZ1A 4JI5K 3OW2M 1VK0A 2UU9K 4L3QA 2Z1GA 4DSEA 1RGIA 3BZKA 3DLRA 3TTFA 1JLEA 2UXBK 5AZJB 1HNIA 2QWMA 1QZ6A 2V7YA 3ENHA 3MWTA 3ZT0A 3T1AA 4M7YA 3DOLA 2DTUA 4H4OA 4NLCA 4KH6A 3ZLJA 2ZJPL 3AAPA 3TSPA 2HOEA 1T05A 2D0AA 1IKYA 4KBOA 3F2KA 3V81A 1C0UA 1SUQA 3TAGA 3FFIA 2NLXA 3IAYA 4WQ5A 2Q31A 4BRQA 1BWFO 1NKEA 1EX4A 1K9MO 3OYAA 5KPTA 2JGUA 3DXMB 3I0RA 5J2QA 3EEQA 4YOYA 3C65A 1KSPA 3HJFA 1BUPA 2X6NA 4BR4A 4CF0A 4FLTA 3MCAB 4FWNA 1JCFA 3U4LA 2E6LA 1TYQB 4DS5A 3KWIA 3THXB 4LF6K 3VEVA 2A1SA 5CE3A 4ID5A 4M3UA 3C0BA 4DR4K 1BGXT 2H3GX 4MDBA 3ZYYX 3T7ZA 1WSIA 4DQIA 4JS5A 2P9PB 2O8EA 3H3OB 4FL9A 4FJGA 2YNGA 2DFEA 2XY8A 3RTVA 4DFKA 5AFUA 3GBTA 5FPEA 4QS7A 4OPJA 3RMBA 2QK9A 1VSKA 2YV0X 2QKKA 1FK9A 1N6QA 4IFVA 3KLGA 4CJEA 2GTDA 4JK8A 4DU4A 2IGIA 5M1NA 4LFCK 5J2MA 1FKOA 1S9GA 3A5MC 1NBWA 4CZGA 3ZSVA 4AHTA 4HHTA 2P9KB 3FZFA 5KQDA 3AA2A 2F7TA 5M1QA 1HKCA 4GNIA 4O8UA 4KB0A 1ITGA 2ITMA 3DM2A 3EZ5A 3SMPA 1BI4B 1HMVA 4LFBK 1RDUA 4A2AA 3WXLA 5LMUK 4DHYA 1XNQK 2FBTA 3SLCA 4LSLA 1XNRK 4L8RB 4CHNA 3ZEUB 4FWQA 1K8AO 2OZSA 5CY4A 2NRTA 3AA4A 5EVZA 4IJAA 2D5RA 5GAEP 2HHUA 4CFCA 3EL2A 3P83D 3E1YA 3ENOA 4RG8A 3UKRB 2BANA 3WUHA 4CHPA 3VQQA 2Y1JA 4IJNA 1IH7A 4WQ4A 4DUYK 4CERA 2FSKA 3VA3A 1J54A 4B3OA 1ZBFA 1BIUA 1N32K 3GE1A 3DLLL 3LDSA 3QIOA 4CK1A 4B9TA 4GVMA 3O80A 3VOVA 3ZSXA 4WFAL 3G0ZA 4HUGA 4DUZK 2AA4A 4Z4FA 1VSMA 4EZ6A 4JKBA 1V4SA 3ID6A 5AQHA 1ATRA 5GADP 2UUBK 4R79A 1LW2A 4DFMA 3A0IX 5C15A 2O8BA 3TSUA 5H1SQ 3C6HA 4C8LA 3VESA 3AVHA 1P8ZA 3BF1A 4IDKA 3VF6A 4BVOA 3MECA 1T03A 1SS6A 4CI6A 4RTFD 3TARA 1VQ9N 3CHWA 3P1GA 1D4XA 3L4IA 3O4WA 2GUPA 2VWKA 3OTOK 1HR0K 3I8BA 1VSEA 4C8MA 4CZMA 4JI7K 5KPZA 2DPNA 1NNEA 3ZSYA 3OHRA 1RNHA 5AQZA 4FPBA 2GELA 3O3GA 5AQYA 4C23A 4CEBA 5BRDA 4WFBL 4HCCA 3IG1A 3CCUN 3TAMA 5I9EB 4I9LA 3P39A 4AHVA 2G8FA 1J5OA 3R3LA 4Z4HA 1WSFA 3SUPA 1RBTA 4F3OA 3CCLN 3LAMA 1JLQA 1XHXA 5KPRA 4ID1A 3EE8A 4KTQA 5JVHL 2O8CA 3SBGA 3F73A 1OKJA 1HNWK 1NMDA 3CJCA 4N76A 3M8QA 4YNQA 1HX1A 1KVCA 1QQNA 4M41A 1KLMA 4EIAA 1GOCA 4IFEA 3CFPA 3PSFA 4CFAA 4CJQA 3ZETA 4BE0A 4FK0A 4C8OA 5AQWA 3BUZB 1VAZA 5BPNA 4CBXA 2HNDA 3K5NA 3T1YK 4O4GA 2O8FA 1CZBA 4BRFA 4FM1A 4B3SK 1TK8A 4DQSA 2HF4A 4YOVA 4M3ZA 3EY1A 4BWMA 3RSEA 1C1CA 4OKJA 4DB3A 3SPZA 1YHQN 3FGUA 1RDWX 1WOQA 4DG1A 4BRLA 3J7AP 1OH7A 1IG9A 3OYFA 5EY4A 3MAQA 1NGGA 4JKCA 1TK5A 1VSHA 2OPRA 1WSJA 3DLKA 2EHGA 3I33A 3L3VA 2WONA 4KB1A 4IOXA 3IRXA 4RW4A 4C1NK 4OKEA 2O8DB 3CETA 3LZJA 1X9SA 1V4TA 2YJEA 5BN9A 4CJKA 4JAXA 1KFDA 5HROA 2IIRA 4J2AA 4LFAK 3ZX3A 3MN9A 4JRPA 5CR4A 1IBMK 1YVUA 4XEIA 1NGIA 3VQAA 5E26A 3LDQA 1O13A 1MU2A 2ZGZA 4E7HA 2NRXA 1NJWA 5BRFA 1QSSA 5HL7L 1WLJA 3EE9A 4EHTA 4FLVA 5AQNA 2V7ZA 4DQ8A 3CCRN 3BEXA 2PBDA 3O5BA 5HLFA 2E2PA 2V52B 1J53A 4KRFA 5LY3A 3KLHA 1RBSA 3CYMA 1HYZA 2NUBA 4WYBA 1EWQA 3WXIA 4A57A 3F9KA 3VQBA 4AM7A 4DS4A 1YIJN 3QIPA 2ASPA 3O1WA 4E0DA 3NF9A 4IG3A 2JWKA 1D9DA 1WB9A 2ETJA 4M45A 2UYTA 5AQVA 1U49A 2CGLA 1HYVA 4A5BA 3KKRA 5AQQA 3VN5A 3OYLA 3SV4A 1NJZA 1NGHA 4DCHA 4M3XA 2BDPA 4JI0K 3JXUA 3KVGA 4B3RK 2E2QA 1EO1A 4BDYA 4FJ5A 2FSJA 2PAVA 4ISGA 1RT3A 3SV3A 1BISA 4E3SA 2HNYA 3ZX0A 1IO2A 1D9FA 2EWSA 4HUEA 2YHAA 4ISFA 1RT7A 5KGWA 3K59A 2OTLN 4M3WA 1XWLA 3AO3A 1RT1A 3F9MA 2W6KA 4M7XA 4DV3K 1NK4A 3AVLA 4JI6K 3LP2A 3PIPL 1I94K 3AO2A 3A2FA 4KHPK 1EP4A 3CCSN 5AQKA 3N4PA 2O4IA 3WEEB 4YFUA 5AQJA 3DWLA 4GV6A 1TAQA 2O8CB 1QHTA 4I2QA 2E4LA 1QSLA 3O3HA 4K41A 3E9PA 4BC5A 5M1FA 4FJ9A 1OH6A 2HNZA 1FJGK 4H0PA 2G8UA 4JD2B 3V9WA 4WCEL 5ELZA 3UIQA 3ZETB 4O55A 4FZYA 4FVUA 2OTJN 2HMIA 4FWLA 3G25A 3CCJN 1BG3A 5EXWA 3NGZA 1VRTA 3O9UA 4NCAA 3QERA 3CPEA 2D0BA 2KKZA 4W5QA 3RSEB 4DSFA 1VQ5N 1SL1A 2WBNA 3BGRA 3RWUA 2P9IA 2HF3A 3C94A 1JLGA 4CIFA 4E7KA 4O5FA 1Q8IA 3HO1A 3D2EA 2BUPA 3CC7N 3A5OC 3PX4A 1KAXA 1KFSA 1Z26A 3F5TA 5C42A 3H45C 2QW9A 1TKZA 4CK2A 1LCUA 4KHYA 5KRTA 2FF3B 3FFKB 3MWPA 1J6ZA 2KTQA 3BDPA 5FPNA 1LAVA 4F2RA 4MFBA 1RDDA 2J4RA 4GV9A 2P9LA 2FBYA 4N5SA 3HP9A 2Q0RA 1XQSC 4CGDA 4QS8A 1EETA 3CJ1A 3L3UA 3MCPA 1XMQK 1B9DA 1TL3A 5KQ8A 1L3SA 1ATNA 4OLAA 4I7FA 2QTDA 4FJ8A 3QDKA 4DU3A 4CZKA 4ICLA 5CYMA 4JHDA 1TV6A 3AO1A 4DSKA 4JKHA 3VMFB 4H03B 3I0SA 1WNSA 3QMLA 4KV8A 4PY5A 4LD0A 4HTLA 3WXJA 1GOBA 2VWJA 5GINA 1NK8A 4E1JA 4IEEA 3HBTA 3QB0A 1X1PA 2P9NA 2KW4A 3LZIA 3KLEA 5I42A 3EN9A 2ASMA 3FLCO 4ZTFA 5AR0A 2ZE2A 1KD1O 1IBLK 1DEJA 2XHBA 4DTNA 3B6OA 1D8YA 2OANA 4CJLA 4ILHA 1L5UA 5IT9O 3VGMA 3CCVN 3QLHA 5HRSA 2F9TA 2OCEA 2G8KA 3DAWA 4PA1A 2A1RA 4B8CA 1FW6A 1T6DA 1NLVA 2E6MA 2QWRA 5AQFA 1X3MA 3SYZA 1K8KB 4PHTX 3G71N 4BC3A 4F8RA 4BACA 4OPKA 3WNEA 4CHZA 4FXDA 3HSCA 3AVAA 1VQPN 3ZSOA 4DSLA 2A3ZA 2Q0UA 4MO4A 1T7PA 5AZIA 3HM9A 4IKFA 4YDUC 1ZBSA 1ESVA 2YX6A 4MLHA 3VEXA 4DV7K 3T3FA 5A2QO 1FKPA 3KKSA 1QHAA 3L2VA 5KTQA 3CCMN 1VQKN 3WNGA 3ALYA 5CYQA 1K6YA 1RT4A 1W97L 1LWCA 3IKMA 2W6LA 1GLBG 1DT9A 5LMNK 4JS4A 3RR8A 2P5GA 1GLDG 3VGKA 2E5LK 3SAFA 1N8RO 3DRSA 2BE2A 3CIPA 4NO7A 3TTDA 1BO5O 1TUYA 1OH5A 1QZ5A 3LP3A 4H5VA 4FZZA 4M3RA 3U3GA 3V4IA 4JK9A 1WSHA 3L0QA 5AQSA 1QQOA 4JKAA 2A42A 1NOZA 4ISEA 4DV6K 3M5RA 5CZ2A 3SK3A 4IOCL 2E88A 3A8YA 1HYSA 5J2NA 4FK4A 1S1UA 3HT3A 2OPSA 2YNFA 1YJ9N 1LWEA 4O0IA 1NGDA 1U2VB 4CJ4A 5JLHA 3D2EB 3SMSA 2VG5A 3OS1A 4CBWA 1GLEG 5D3GA 2QWQA 2Z1JA 2XY5A 1N34K 1KVBA 3THVA 1SAZA 2P9LB 1TKDA 1XI1A 2RN2A 4NCBA 1RDAA 3V9XA 3AV9A 5AQTA 2FBVA 1YVNA 1ZYQA 3OYIA 5BN8A 3JAMO 3S9HA 3ZX2A 4IO8A 3RMAA 4E19A 5KI6A 3OY9A 1A5XA 3H3NO 3QEIA 3SAHA 3V9UA 3SAGA 3OVNA 3LWLA 4DLGA 5F0XA 2P1JA 4BR5A 3S41A 1WBBA 4FW2A 2ATQA 3OYEA 2EX3A 5AQMA 1OVQA 3PSIA 3OYMA 1KC8O 1ASWA 4A59A 4BVPA 1WSEA 3D2FA 4BE1A 3MN7A 3MEDA 3L8BA 3SQ1A 1TKXA 3FZLA 1OVYA 4LY7A 3VTHA 3V6DA 3OYJA 4CEOA 2ITGA 3JS6A 2HHTA 3U8XA 1RT6A 4CZEA 1QVFM 1IBKK 1VQLN 5JS1A 1B92A 4RW8A 2F9WA 2NZTA 1QQMA 2YI1A 1LV5A 4K25A 1ASUA 2QM1A 4DQPA 3RRGA 2AP1A 4CIEA 4NYNA 4CCHA 4BRKA 4FW1A 3TPQA 2ZQBA 5T7BA 3VQ4A 4DR5K 4I9QA 4A61A 2QWPA 4CEEA 2F4VK 2P9SA 1BL3A 4YOTA 3DOKA 3UKUB 3CCEN 3L2WA 1U45A 2VG6A 1UA1A 4RWTA 3HVRA 4Q5VA 3O4QA 3QESA 4LF4K 2KFZA 4CEDA 1RTDA 2UUCK 5FDLA 3MEGA 4BRDA 5JVGL 3BF3A 4OGEA 4FWMA 4E1MA 2XY6A 1MA9B 3ULEA 1CXUA 4BDPA 3PX0A 4H8KA 4ELVA 3H6EA 4W5TA 3THWA 4BDZA 3AVJA 4O5BA 4CEFA 3FE1A 3FZKA 2RF2A 2Q3SA 4DQQA 3NGIA 1KQSM 3L4QA 3VENA 5FPDA 3G4SN 4DFPA 1SQKA 2GX9A 4CESA 4CJVA 3CMEN 4Y1CA 4R5PA 2E20A 3QBWA 4N56A 4QCLA 3HM8A 4K8ZA 5JMVA 3ZT1A 3T19A 4NXNK 1RTIA 2Q2RA 1KLNA 2Q1NA 4JV5K 1NK7A 3KK2A 3LP1A 4X64K 1A5VA 1Q82O 3L2UA 5ADXH 2Q97A 3KZBA 3O9QA 4YOUA 3NVKA 1DLOA 3QETA 3U3YA 3TSQA 3LPTA 3HRGA 5JICA 4FJIA 3WXMB 3P38A 1KAYA 4FWOA 1L3UA 4DV2K 1S9EA 3L6QA 3L2RA 4B3TK 5ADXA 3HP6A 4K43A 4DV5K 3NF7A 3ID8A 2ZWHA 4NLBA 4C8KA 3I55N 4QS9A 1REVA 4JK7A 1KVAA 5AQOA 4DF4A 4CZHA 4FWKA 4CGJA 3CJ7A 4AHUA 3CERA 4CHYA 2O8EB 2PY5A 3VEZA 3HZ6A 1Q81O 2P9UA 4Z4CA 4DTPA 2GUIA 1RCHA 3LDNA 1RFQA 4FLZA 4XH5A 4FWPA 4YDUA 1SV5A 5FPMA 4EHUA 1NOYA 4EAHD 4BC2A 1SL0A 1BQMA 5DMRA 4E1NA 3WXKA 5MLCQ 1JXBA 3AGKA 3A5LC 3KK7A 1QTMA 5HBMA 3GL1A 3K9JA 1Q9XA 4B08A 4DTSA 3PV8A 3G6EN 4DV4K 4OPAA 3K58A 4CJPA 2HHWA 4JNEA 3IDHA 1Z6RA 4B1VA 4CK3A 3WT0A 4UQGA 3V1RA 4B1XB 2VCPA 4CHOA 1X9WA 4DTMA 4E7IA 3DI6A 1S1TA 2A6AA 4BR0A 3TANA 1M90O 3BZCA 1RDCA 4KH5A 4PL7A 4LF9K 1KTQA 1ILYA 1T6CA 1JLFA 4BRNA 1D5AA 1HQUA 1S6QA 1ZBUA 4DLEA 4HUFA 2FBXA 3J7YP 1T8EA 3HK2A 1BOTO 3GOIA 4BWJA 1C0MA 4JI1K 4FJMA 3P4IA 4NXMK 4X66K 4H0XB 4KKOA 1RT5A 3ZT2A 1VQMN 5GIOA 5AQLA 4YOWA 3MXIA 4DSIA 3M3ZA 1BQNA 4DFJA 4BY9C 1WAFA 3W3DA 5SWMA 4CGFA 1NGFA 1R0AA 3HSTB 1C0TA 1U4BA 1VHXA 1NJYA 4Z4GA 3K2PA 3QNNA 1X3NA 2IDOA 3ULEB 3TAPA 2O8BB 4KHQA 5DM6L 2KQ2A 5E41A 2HBLA 3IUCA 2HHQA 1J5EK 3OJUA 4E7JA 3PO4A 3DXKA 2BTFA 3THWB 1LWFA 3CM5A 2VWBA 2XY7A 1RTHA 3MK6A 3D0PA 4IXCA 2ZJQL 4WE1A 4CJRA 4FJJA 2E8AA 3THYA 3SPYA 2HW3A 3ZSRA 5M1KA 2YKMA 4KFBA 4CZLA 1KCFA 1EWRA 1GLAG 1JL1A 4FCYA 4CIGA 1GOAA 4AHSA 2W42A 4FOEA 1OH8A 3LWMA 4KHSA 3DLEA 1NGAA 3EZWA 4PKIA 4CF8A 1DGKN 3CXCM 3H46O 1ASVA 1RTJA 3V9SA 2W41A 4ELTA 4NCGA 2QI2A 2FSNA 2I5JA 4FM2A 5FRMA 1ZBHA 1NWKA 5AQIA 1KXPA 4CJWA 3KD5E 3LP0A 4V19S 3MX5A 2UUAK 1TVRA 1ZBIA 3NFAA 1N36K 1HJOA 4RW7A 1VQNN 3NAEA 4KI4A 3VETA 1P90A 4X65K 3N4QA 1GLFO 1LAWA 5BR8K 1NK9A 4C8NA 5HRRA 1VQ4N 1HKGA 1VSDA 4IO9L 3NCIA 1VQ6N 2QWLA 2IC3A 3ENBA 2O8FB 2GV9A 4HWIA 4J2EA 1EQYA 3SJHA 4KO0A 4JYAK 1SZ2A 4BRHA 1JCGA 4DMNA 2W40A 2P9UB 3OA9A 3R1XA 3TI0A 2YCHA 3TWHA 1MWMA 4H5RA 5IWAK 2UXDK 1VQ8N 2GEMA 3O6WA 1BDGA 1HKBA 1L3TA 4B9NA 5GAHP 4ZTJA 4LSNA 1YUWA 3KHYA 5EU7A 4DKWA 4BRPA 1HNZK 4N41A 2Y1IA 3MX2A 5JS2A 3LM2A 3CJ9A 1N33K 3ASMA 1UOCA 3Q7BA 3ZT4A 1YXQA 3DJCA 4K8XA 4DTJA 4PUOA 3AA5X 4FWSA 1Z25A 4CJSA 1KRPA 4KI6A 1HNXK 4BRGA 2HHHK 3CPWM 4CZJA 3R9PA 3DXMA 4HVJA 3LANA 3J81O 3VQ9A 4DQRA 4BG9A 3S3MA 1S22A 3QEWA 5F2RA 1C1BA 4YY3K 3SNNA 3E66A 5LJVA 4H4MA 2YHWA 3THXA 3GG4A 1TKTA 4CJ7A 2VGNA 3FZHA 1CXQA 4X62K 2VQEK 5EOYA 3CC2N 3D7EO 3VQ7A 1NK6A 1DKGD 1S1WA 3KK3A 1WAJA 5BRHA 4G1QA 2NRWA 3PX6A 2P9PA 1JKHA 2ZM6K 4FM0A 4H0YB 3B8AX 2PZSA 3PY8A 3C6UA 4BRCA 4W5RA 3ZCMA 3GDQA 3ZSQA 4KTWA 4B8AB 5AQPA 4JKGA 2FF6A 3TAEA 4PWDA 3PIOL 2YNHA 1YT3A 3DXKB 2QEXN 3FZMA 3OYGA 5AQXA 2X78A 2P9KA 2NRHA 3THYB 3A5NC 3PUFA 4RW6A 3RMDA 4AM6A 1M1KO 2HBJA 4CZIA 1Y64A 4IWVA 1BI4A 4M42A 1JLCA 4JKEA 4CVNE 3CM6A 3LPUA 4FJKA 4LH4A 3SQ0A 4YOXA 1HLUA 2OYQA 1T44A 2CGKA 3SUQA 3ZEUA 4LF7K 3HYFA 4KHUA 4Z0UA 4GY2B 4XH4A 3CQ8A 1HNVA 3ATUA 1TK0A 4K42A 3SZ2A 3DYAA 5J1EA 3EKSA 4JEPA 4OO1J 2BH1A 3OYDA 1C0FA 2GWJA 4JI3K 3NH0A 3CI5A 2PYJA 4H0OA 2F8SA 3M8RA 4B1YB 2QXLA 1S6PA 1QE1A 3OS2A 4J2BA 1VQON 3VA0A 1XMOK 3CFRA 4DR3K 4QAGA 2B5JA 4F4KA 4JI4K 1XC3A 3H1QA 3ISNC 4BQZA 4PL8A 3S3OA 2VGMA 4H5NA 1TL1A 3HVTA 5HRPA 4AH9A 3DLGA 2RE2A 2KHOA 5LJWA 4KHWA 3P5JA 1UWBA 1QQCA 2HB5A 3NBPA 5JLFA 4PKGA 2D0PA 3QFUA 1N5YA 2WOMA 4MLEA 2IVNA 3SUOA 1SL2A 3PO5A 2P9IB 3SI6A 4XH1A 1MWKA 3MN6A 4CD1A 1L3VA 2AJQA 4CECA 3KTQA 1S72N 3UE5A 1RBRA 3QINA 3KLFA 4AQYK 1QS4A 3K57A 3QEPA 3DLBA 3O1BA 5LL6Z 3C6TA 3JSMA 3O8MA 3NH2A 3VQDA 4B9QA 3CJBA 1NJIO 4IDHA 1E4GT 1NK0A 3NH1A 2ASOA 4MDAA 2HBMA 4FWRA 4BR9A 1Q7YO 1BA1A 4W5NA 2WUSA 4PQUA 1R59O 3PLAA 2HVHA 5F1XA 3HOTA 5M1PA 3HTVA 1S3XA 3I56N 5C2FA 4N47A 3VEYA 4IZ9A 4A62A 1U04A 1BA0A 2WC9A 4JHDB 3EKUA 1YTUA 1Q18A 1YAGA 5AFUH 5BREA 4FJNA 2E1YA 3MXJA 3EYZA 3ATVA 2LSNA 4GKJK 3O4NA 1TUUA 2FXUA 4CEAA 4OVLA 1W2BM 2NRRA 3AVCA 2I7NA 2P9NB 5C12A 2P5OA 1UAXA 2HHXA 4EP4A 3AVFA 4CGHA 4RCHA 3R6MA 3C7NA 5TKWA 3SQ2A 5HP1A 4DU1A 3LM9A 4FSVA 4CJ5A 5BPMA 4B9UA 1NGCA 5C2DA 2NRVA 3NMUA 2D0OA 4JKGB 5B8HA 4AILC 3OYCA 1Y97A 1E4FT 1NMNA 4NB4A 1XC9A 1KAZA 4BR7A 4TSXA 4G9ZA 3OYNA 1U6ZA 4M63C 2O8DA 2YKNA 3K0SA 1X9JA 1S1VA 1A5WA 3CG7A 1QSYA 3QFPA 4B9SA 1E3MA 4KHNA 3AAQA 3HPOA 2CH6A 4BREA 3IFRA 4PKHA 1I3AA 4J2DA 3VF4A 1NU0A 3O9SA 1S1XA 4Y0WA 4A5AA 4DR1K 5AZIB 4W5OA 5GAGP 2Z1HA 1H1VA 5BPLA 4AHCA 4H0TB 4B1WB 1GLJO 3SQ4A 4CZFA 1GLLO 4M3YA 3NGYA 1BU6O 1VSIA 3LDOA 4LF5K 4EP5A 4Y1DA 3CJAA 2YHBA 5FLXO 2KZZA 2HMPA 4CE9A 4DTOA 3LAKA 1C1AA 4GVEA 5AQGA 1F21A 5CHIA 2PYLA 3AVBA 3E01A 3MEEA 5TKYA 4O44A 2XRIA 3OBYA 3LL3A 3QNOA 3CCQN 1J9AA 2B6AA 2DFHA 3O08A 3JYTA 3J7ZO 2KLAA 3VEOA 2I7PA 1JL2A 2FLOA 1DTQA 2G8VA 4CBUA 2KFNA 4DR2K 3VGLA 3QEVA 3CFOA 4JLHA 2Q36A 1NGEA 1XHZA 2RKIA 4QOZB 4HTUA 4C1NI 4LC9B 4F9OA 2QA4N 3AVNA 4AF1A 3D6RA 4IFYA 4JKDA 1IG8A 3KK1A 5C0YA 3RMCA 4FJ7A 4KPYA 4GMJB 2B4JA 1NG9A 1CZ9A 4H5TA 4B9LA 4DV0K 5K14A 1JLAA 5AJ3K 1WUAA 3WEEA 4FYDA 2NNWA 1NJXA 4CD3A 3O9RA 1W0HA 3HI0A 1RBVA 5DM7L 3O9TA 1HRHA 4FLUA 4JD2A 5HOOA 2GBZA 3OYKA 5I3UA 4YORA 4BRMA 1EKEA 4EZ9A 4HCBA 3MMVA 2A41A 4FLWA 4B3MK 4EFHA 1T3VA 3WQUA 3AVIA 1NGJA 3LALA 5SZTA 3D2FB 3O3FA 3J80O 2R7YA 3RR7A 2OPQA 3M1FA 3C7NB 5KRSA 4H0VB 4F3TA 2YJFA 4Z4IA 1K73O 4B1UB 1DTTA 2D4WA 4E89A 3AA3A 4CF1A 1HJRA 4GW6A 2ZF5O 4IEIA 4CFDA 3K5LA 2YHYA 4OGCA 4B9MA 4JI8K 1X9MA 4BRIA 4BQLA 2VYPA 3RVCA 2F96A 3QICA 3DLHA 2P9SB 2Z1IA 4J8FA 2F8TA 1HPMA 4E7LA 2RPIA 4ILJA 1LW0A 1C6VA 4Q0BA 2A40A 1QVGM 3CF5L 2A5XA 5FRNA 2RHKA 3R8EA 1TGOA 4BGBA 3WNHA 1SKSA 1RILA 2D0CA 3VQPA 4BC4A 1GLCG 3AVMA 1VSJA 1YTAA 2G8HA 4FVMA 1YJNN 1HUXA 4CW7B 3Q7CA 2D1KA 2NRZA 1UA0A 4H5WA 4CEZA 2X74A 3U9DA 3OJSA 2G8WA 4MQ3A 4BE2A 5E84A 1JCEA 1CLQA 4WQ5C 4JKFA 3CQYA 3VQEA 3QO9A 1IKVA 5HRNA 1NGBA 3ZSZA 1SKWA 4JI2K 2G8IA 2IAJA 2QKBA 3CMAN 1BHLA 2WTUA 3HXMA 4DTXA 3MXMA 1RBUA 2E1ZA 4KH4A 4FO0A 1B9FA 4DV1K 5AQUA 3I8DA 1YITN 4XIUA 4U7BA 3TAQA 4ZHRA 4DF8A 4WF9L 3TAFA 4BR2A 1K8KA 2YNIA 4I2PA 3WNFA 1YI2N 3LDPA 3V1QA 1S5JA 3VERA 4FJLA 3C95A 5BR9A 4CEQA 1NM1A 4Z94A 4BGAA 3M8SA 3VQ6A 5GIPA 2JLEA 4I6MA 1CZAN 2VG7A 3NF6A 2CGJA 3EO3A 3TTCA 1ZC6A 4CJUA 4OPHA 5DK5A 4U67L 1W7AA 2IVPA 4CGGA 2KZMA 1HQEA 4NYFA 2HHVA 2IOCA 4ELUA 3ULDA 4BRAA 4CGIA 4JRQA 4FLYA 1U47A 3NVMA 4B1ZA 4O8KA 3AO5A 2E2OA 1VSLA 3SBTA 3KIOA 2HSTA 3BY5A 1YF5L 2YHXA 4IG0A 3NE6A 1IKWA 3AVGA 5C10A 1EXQA 3SCXA 4AHRA 5KGXA 1I39A 3E9LA 4BROA 3CQXA 4DTRA 3G10A 2ZD1A 3IS9A 3NF8A 1ZXOA 3E9OA 5AZJA 3RRHA 1VSFA 3K9KA 5EX5A 4GKKK 4YHHK 3ZT3A 3H1VX 1ZBLA 3C6AA 4WQ4C 4CJTA 1IJJA 2PFUA 1BCMA 4CHQA 4KAZA 1BCOA 4DWIA 3M8PA 1U2VA 4M3TA 5C25A 3B6PA 4BG8A 4CF2A 4WFNL 3OS0A 1NKCA 4A2BA 2FC0A 1VQ7N 3S3NA 1BIZA 1JXEA 3IMXA 4OJRA 4MO5A 3DRPA 1WN7A 1Z05A 4KTZA 3P31A 3HPGA 3AY9A 1U48A 3VQ8A 2DY4A 4LH5A 4CJFA 3FR0A 3V9ZA 1TYQA 1IKXA 3V1OA 1Q9YA 4CF9A 3HL8A 3U6FA 2ZJRL 3SUNA 2O4GA 2IVOA 2BGGA 4O0JA 3ITHA 3KWGA 3L2QA 2CH5A 2ZGYA 2GWKA 1MDUB 3TABA 4FK2A 4FPAA 1NK5A 2UXCK 3J8AA 2QWNA 2DFFA 3MN5A 3K5OA 3NHGA 4IBNA 3AARA 2P51A 3HOSA 4DSJA 1RDBA 3K5MA 3VEWA 4UY8O 4F2SA 1FXXA 2OPPA 3AGRA 3QEXA 2OA8A 1HPZA 3CC4N 4Z4EA 1JLBA 3CD6N 2HBKA 3M6GA 3OYBA 3KJVA 2IS3A 3W0LA 1SKRA 2V51B 1W9HA 4OX9K 1LOTB 3BP8A 4JN4A 3VPZA 3NDKA 1G99A 4B9VA 4DR7K 5C24A 3UB5A 4FJXA 3TU5A 2OZMA 1WBDA 3VF2A 1O1WA 1YJWN 4LF8K 2HVIA 4FZXC 1C0GA 1WSGA 4ILGB 3UKRA 3H08A 3QBXA 3KD1E 1VRUA 1JJ2M 1IV0A 4K0KK 3AO4A 4FOIA 3TR8A 3SJJA 4OKKA 3VTIA 3OBWA 4RW9A 3UKUA 3OYHA 4KREA 3ZSWA 3DMJA
chains in the Genus database with same CATH topology
3HPOA 1QTMA 3KLIA 2HMIA 5HBMA 1Q9XA 2QXFA 4B08A 4DTSA 1NKBA 1I3AA 3PV8A 4J2DA 4FLXA 3AVKA 3HPHA 4CJPA 3K58A 1S1XA 3NGZA 2XO7A 1VRTA 1G15A 3VQ5A 2HHWA 1TAUA 4NCAA 2X6SA 4CK3A 3QERA 2D0BA 4FJHA 4W5QA 4W5OA 4UQGA 3V1RA 4DSFA 2Z1HA 1X9WA 4CHOA 4AHCA 4DTMA 1SL1A 4OLBA 4E7IA 3BGRA 3RWUA 3DRRA 3SQ4A 3D45A 3DI6A 1S1TA 4CJ3A 4M3YA 3NGYA 3C94A 3VQCA 1JLGA 3TANA 1VSIA 1RT2A 4CIFA 4E7KA 1RDCA 4DTUA 1Q8IA 4Y1DA 4EP5A 1KTQA 2YHBA 5J2PA 3HO1A 4CFBA 2HHSA 1JLFA 3PX4A 5FROA 1KFSA 5CZ1A 1D5AA 1HQUA 1S6QA 1ZBUA 1Z26A 5C42A 2KZZA 1VK0A 4CE9A 4DLEA 4HUFA 2FBXA 4DTOA 1TKZA 3LAKA 1C1AA 2Z1GA 4CK2A 4DSEA 5KRTA 1F21A 1T8EA 2PYLA 4KHYA 3HK2A 3AVBA 3DLRA 2KTQA 3E01A 3MEEA 4BWJA 3BDPA 1JLEA 4O44A 1C0MA 1HNIA 1LAVA 2XRIA 4F2RA 4MFBA 1RDDA 4FJMA 3QNOA 2FBYA 4N5SA 1J9AA 2B6AA 2DFHA 3ZT0A 2F8SA 4KKOA 1RT5A 3HP9A 3T1AA 3ZT2A 3JYTA 3DOLA 4CGDA 2DTUA 1EETA 3L3UA 3MXIA 1B9DA 4DSIA 4H4OA 1BQNA 1TL3A 4DFJA 1JL2A 1L3SA 1DTQA 4OLAA 1WAFA 4I7FA 1T05A 2D0AA 1IKYA 5SWMA 3V81A 4FJ8A 1C0UA 4CGFA 4DU3A 1SUQA 3TAGA 3FFIA 2G8VA 2KFNA 1R0AA 3HSTB 4ICLA 1C0TA 5CYMA 3QEVA 1U4BA 1NJYA 3IAYA 4Z4GA 1TV6A 3CFOA 3K2PA 4JLHA 2IDOA 3QNNA 3TAPA 3AO1A 1NKEA 4KHQA 1EX4A 2KQ2A 5E41A 3OYAA 1XHZA 4DSKA 2HHQA 3OJUA 2RKIA 3I0SA 4E7JA 3PO4A 4QOZB 1WNSA 4HTUA 2JGUA 1LWFA 3CM5A 2XY7A 3I0RA 4KV8A 1RTHA 3D0PA 4PY5A 4LD0A 3AVNA 5J2QA 1KSPA 3HJFA 1GOBA 4WE1A 2VWJA 2X6NA 4CJRA 4CF0A 1NK8A 4FLTA 4FJJA 3SPYA 2HW3A 3ZSRA 1X1PA 4IFYA 2E6LA 2KW4A 2YKMA 3KK1A 4DS5A 4KFBA 3RMCA 4FJ7A 1KCFA 4KPYA 3LZIA 3KLEA 2A1SA 5I42A 4GMJB 1JL1A 2B4JA 4ID5A 1CZ9A 4CIGA 1GOAA 4AHSA 4FCYA 2ZE2A 4ZTFA 2W42A 4B9LA 4M3UA 2XHBA 1BGXT 5K14A 1JLAA 4DTNA 3B6OA 3LWMA 4KHSA 1WSIA 3DLEA 4DQIA 1D8YA 4CF8A 4JS5A 1ASVA 1RTJA 3V9SA 4FJGA 4CJLA 2YNGA 2DFEA 2XY8A 1L5UA 3RTVA 4NCGA 4DFKA 4ELTA 4FYDA 3QLHA 5HRSA 4OPJA 2I5JA 3RMBA 2G8KA 4FM2A 1NJXA 5FRMA 1ZBHA 2QK9A 1W0HA 4PA1A 2A1RA 3KD5E 1VSKA 4CJWA 4FZYA 1RBVA 2YV0X 3LP0A 4B8CA 1HRHA 2QKKA 4FLUA 1FK9A 1N6QA 2E6MA 4IFVA 2GBZA 3OYKA 5I3UA 3KLGA 1TVRA 1EKEA 3NFAA 4CJEA 1ZBIA 4RW7A 4EZ9A 3SYZA 4HCBA 3NAEA 4KI4A 4DU4A 4F8RA 4BACA 2IGIA 4FLWA 4OPKA 5J2MA 1FKOA 1S9GA 3WNEA 3AVIA 3ZSVA 4AHTA 4CHZA 4FXDA 3AVAA 4HHTA 3ZSOA 3LALA 1LAWA 4DSLA 5SZTA 1NK9A 4C8NA 3AA2A 5HRRA 4DQQA 3O3FA 2R7YA 3HM9A 1VSDA 1T7PA 3RR7A 4IKFA 2OPQA 3NCIA 4KB0A 1ITGA 3DM2A 3EZ5A 5KRSA 1BI4B 1HMVA 2IC3A 3T3FA 2GV9A 1FKPA 4F3TA 3KKSA 2FBTA 4J2EA 4Z4IA 4LSLA 3L2VA 4L8RB 4CHNA 4KO0A 1DTTA 5KTQA 3WNGA 2OZSA 3ALYA 3AA3A 5CY4A 1K6YA 5CYQA 1RT4A 4CF1A 4DMNA 4E89A 1HJRA 3AA4A 1LWCA 2D5RA 2HHUA 4GW6A 4CFCA 3TI0A 3TWHA 3P83D 4CFDA 4RG8A 4JS4A 3RR8A 3K5LA 4OGCA 4B9MA 2P5GA 2BANA 4CHPA 1X9MA 3VQQA 2Y1JA 1L3TA 1IH7A 4B9NA 3DRSA 4CERA 2BE2A 3VA3A 1J54A 4ZTJA 4B3OA 4LSNA 1ZBFA 1BIUA 5EU7A 3LDSA 4N41A 3LP3A 2F96A 3QIOA 2Y1IA 4FZZA 5JS2A 4M3RA 4GVMA 4CK1A 3U3GA 4B9TA 3V4IA 3ZSXA 1WSHA 3DLHA 3ASMA 3G0ZA 4HUGA 4Z4FA 2Z1IA 1NOZA 1UOCA 1VSMA 4EZ6A 5CZ2A 3ZT4A 2F8TA 4E7LA 2RPIA 4K8XA 1HYSA 4DTJA 1LW0A 5J2NA 4FK4A 1S1UA 4PUOA 1C6VA 3AA5X 3HT3A 1LW2A 4Q0BA 1Z25A 4DFMA 4CJSA 2OPSA 1KRPA 5FRNA 4KI6A 1TGOA 2YNFA 4C8LA 1LWEA 3WNHA 4O0IA 3AVHA 1RILA 4IDKA 2D0CA 1SKSA 3PY8A 3MECA 1T03A 3VQPA 4HVJA 4CJ4A 3AVMA 3LANA 3VQ9A 1VSJA 3TARA 4DQRA 1YTAA 3P1GA 2G8HA 4FVMA 3S3MA 3QEWA 1C1BA 2VWKA 2VG5A 3SNNA 4H4MA 1UA0A 3OS1A 4CEZA 1VSEA 2X74A 4C8MA 1TKTA 3OJSA 2G8WA 4MQ3A 4BE2A 1CLQA 5D3GA 2Z1JA 2XY5A 3ZSYA 1CXQA 1KVBA 1RNHA 3VQEA 3THVA 3QO9A 1IKVA 5HRNA 3ZSZA 1SKWA 3VQ7A 1XI1A 1TKDA 3O3GA 1NK6A 4CEBA 1S1WA 2RN2A 3KK3A 4HCCA 1WAJA 3IG1A 2G8IA 2IAJA 4G1QA 3PX6A 4NCBA 1RDAA 1JKHA 4FM0A 2QKBA 3TAMA 1BHLA 3V9XA 3AV9A 4I9LA 2PZSA 2FBVA 4AHVA 3C6UA 3OYIA 3HXMA 4DTXA 1ZYQA 3MXMA 1J5OA 2G8FA 1RBUA 4W5RA 3S9HA 4Z4HA 3ZCMA 1WSFA 1B9FA 4E19A 1RBTA 5KI6A 3OY9A 3ZSQA 3SUPA 1A5XA 4KTWA 4B8AB 3QEIA 4F3OA 3I8DA 3V9UA 3LAMA 3OVNA 4XIUA 3LWLA 1JLQA 4DLGA 1XHXA 3TAEA 2P1JA 4PWDA 4ID1A 3TAQA 4KTQA 4ZHRA 4DF8A 3F73A 2YNHA 4FW2A 1YT3A 3TAFA 2ATQA 3OYEA 4N76A 3M8QA 4YNQA 2YNIA 2EX3A 4I2PA 1KVCA 3WNFA 3OYGA 3V1QA 4M41A 1KLMA 3OYMA 1GOCA 1S5JA 4FJLA 2X78A 3CFPA 1ASWA 3C95A 4CFAA 4CJQA 1WSEA 3PUFA 4RW6A 4CEQA 4BE0A 3RMDA 4FK0A 4C8OA 4BE1A 3M8SA 3VQ6A 3MEDA 2JLEA 2VG7A 2HNDA 3NF6A 3K5NA 3L8BA 1BI4A 1TKXA 1JLCA 4O4GA 3SQ1A 4M42A 1CZBA 4FM1A 3CM6A 3LPUA 4FJKA 4CJUA 5DK5A 4LH4A 3SQ0A 1TK8A 4DQSA 2OYQA 4LY7A 3SUQA 4M3ZA 3EY1A 3V6DA 3OYJA 4BWMA 4CEOA 2ITGA 3HYFA 4KHUA 1C1CA 4CGGA 2HHTA 2KZMA 1HQEA 4NYFA 4OKJA 2HHVA 2IOCA 4Z0UA 1RT6A 4ELUA 3SPZA 3ULDA 5JS1A 4CGIA 1B92A 4RW8A 4JRQA 4FLYA 1U47A 3CQ8A 1HNVA 4DG1A 1TK0A 3AO5A 1LV5A 1ASUA 3SZ2A 1VSLA 3DYAA 5J1EA 3KIOA 1IG9A 3OYFA 4DQPA 3OYDA 3MAQA 1TK5A 4IG0A 1VSHA 3NH0A 3NE6A 4CIEA 1IKWA 2OPRA 2PYJA 3RRGA 1WSJA 3AVGA 4NYNA 4CCHA 3DLKA 1EXQA 2EHGA 3L3VA 3SCXA 4FW1A 4AHRA 2ZQBA 2WONA 5KGXA 1I39A 1QE1A 1S6PA 5T7BA 3VQ4A 3M8RA 3OS2A 4DTRA 4KB1A 4J2BA 3IRXA 3VA0A 4RW4A 4I9QA 4OKEA 3G10A 2ZD1A 3IS9A 3NF8A 4CEEA 4QAGA 2B5JA 3CFRA 3LZJA 3RRHA 1X9SA 4F4KA 1BL3A 1VSFA 3ISNC 4CJKA 3DOKA 1KFDA 5HROA 4J2AA 3L2WA 1U45A 2VG6A 1UA1A 3ZT3A 3S3OA 3HVRA 4JRPA 4Q5VA 1ZBLA 1TL1A 3HVTA 5HRPA 4AH9A 3O4QA 3QESA 3DLGA 2KFZA 4CJTA 4CEDA 1RTDA 1BCMA 1YVUA 4CHQA 4KAZA 1BCOA 4KHWA 3VQAA 3M8PA 4DWIA 3P5JA 1UWBA 5FDLA 4M3TA 1QQCA 3MEGA 5C25A 3B6PA 2HB5A 1MU2A 3NBPA 4OGEA 4E7HA 4CF2A 3OS0A 1NJWA 4E1MA 1N5YA 2WOMA 2XY6A 3SUOA 1NKCA 1QSSA 1WLJA 1SL2A 4FLVA 3PO5A 1CXUA 2FC0A 4BDPA 3PX0A 3S3NA 4H8KA 1BIZA 1JXEA 3SI6A 4ELVA 4W5TA 1L3VA 2AJQA 4OJRA 4BDZA 4CECA 3AVJA 3KTQA 4O5BA 3DRPA 1WN7A 4CEFA 5HLFA 4KTZA 2RF2A 2Q3SA 1RBRA 3QINA 3HPGA 3KLFA 1QS4A 3K57A 1J53A 3NGIA 3QEPA 1U48A 3KLHA 4KRFA 3VQ8A 1RBSA 2DY4A 3C6TA 3CYMA 4LH5A 4CJFA 1HYZA 3JSMA 2NUBA 3NH2A 1IKXA 3V1OA 3V9ZA 1Q9YA 4CF9A 3VQDA 4DFPA 3F9KA 3HL8A 3U6FA 3VQBA 4CESA 1NK0A 3NH1A 4DS4A 4CJVA 4QCLA 4Y1CA 2O4GA 4R5PA 3SUNA 4N56A 2BGGA 4K8ZA 3QIPA 4O0JA 3ZT1A 4E0DA 3ITHA 3NF9A 3T19A 4IG3A 1RTIA 3L2QA 1KLNA 4W5NA 1D9DA 4PQUA 2ETJA 4M45A 1NK7A 3KK2A 3TABA 4FK2A 3LP1A 1U49A 2HVHA 1A5VA 1HYVA 1NK5A 3KKRA 3VN5A 3OYLA 3L2UA 3SV4A 3DLBA 2DFFA 4N47A 1NJZA 4M3XA 2BDPA 3K5OA 3NHGA 1U04A 4IBNA 1DLOA 2P51A 3QETA 1YTUA 3U3YA 4DSJA 1RDBA 3K5MA 3LPTA 4FJNA 4FJIA 4F2SA 1FXXA 4BDYA 2OPPA 4FJ5A 3QEXA 2OA8A 1HPZA 4Z4EA 3MXJA 1RT3A 3EYZA 3SV3A 1JLBA 1BISA 2LSNA 3O4NA 2HNYA 4E3SA 1L3UA 1S9EA 1IO2A 1D9FA 3L2RA 4CEAA 4HUEA 4OVLA 2YHAA 3OYBA 3HP6A 3KJVA 3AVCA 3NF7A 2P5OA 1RT7A 2IS3A 5KGWA 1UAXA 1SKRA 3K59A 2HHXA 1W9HA 4EP4A 3AVFA 4CGHA 4C8KA 4M3WA 1XWLA 3AO3A 1RT1A 1REVA 3NDKA 3SQ2A 5HP1A 4B9VA 1NK4A 1KVAA 3AVLA 3LP2A 5C24A 4DU1A 4DF4A 3AO2A 4CJ5A 4B9UA 3A2FA 4FJXA 4CGJA 1EP4A 2OZMA 4AHUA 4CHYA 1O1WA 2PY5A 2HVIA 4FZXC 2O4IA 4YFUA 1WSGA 4AILC 1TAQA 4Z4CA 3OYCA 1QHTA 2GUIA 4I2QA 2E4LA 1Y97A 4DTPA 1RCHA 1QSLA 4FLZA 1XC9A 3O3HA 3H08A 4TSXA 4FJ9A 2HNZA 3OYNA 1VRUA 1SV5A 3KD1E 3AO4A 1NOYA 2G8UA 3TR8A 3SJJA 4OKKA 3V9WA 2YKNA 3RMAA 1SL0A 1BQMA 1S1VA 5DMRA 4E1NA 1A5WA 3CG7A 1QSYA 3UIQA 4RW9A 3OYHA 4B9SA 1JXBA 4KREA 4O55A 3ZSWA 4KHNA 3DMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPO A;  1QTM A;  3KLI A;  2HMI A;  5HBM A;  1Q9X A;  2QXF A;  4B08 A;  4DTS A;  1NKB A;  1I3A A;  3PV8 A;  4J2D A;  4FLX A;  3AVK A;  3HPH A;  4CJP A;  3K58 A;  1S1X A;  3NGZ A;  2XO7 A;  1VRT A;  1G15 A;  3VQ5 A;  2HHW A;  1TAU A;  4NCA A;  2X6S A;  4CK3 A;  3QER A;  2D0B A;  4FJH A;  4W5Q A;  4W5O A;  4UQG A;  3V1R A;  4DSF A;  2Z1H A;  1X9W A;  4CHO A;  4AHC A;  4DTM A;  1SL1 A;  4OLB A;  4E7I A;  3BGR A;  3RWU A;  3DRR A;  3SQ4 A;  3D45 A;  3DI6 A;  1S1T A;  4CJ3 A;  4M3Y A;  3NGY A;  3C94 A;  3VQC A;  1JLG A;  3TAN A;  1VSI A;  1RT2 A;  4CIF A;  4E7K A;  1RDC A;  4DTU A;  1Q8I A;  4Y1D A;  4EP5 A;  1KTQ A;  2YHB A;  5J2P A;  3HO1 A;  4CFB A;  2HHS A;  1JLF A;  3PX4 A;  5FRO A;  1KFS A;  5CZ1 A;  1D5A A;  1HQU A;  1S6Q A;  1ZBU A;  1Z26 A;  5C42 A;  2KZZ A;  1VK0 A;  4CE9 A;  4DLE A;  4HUF A;  2FBX A;  4DTO A;  1TKZ A;  3LAK A;  1C1A A;  2Z1G A;  4CK2 A;  4DSE A;  5KRT A;  1F21 A;  1T8E A;  2PYL A;  4KHY A;  3HK2 A;  3AVB A;  3DLR A;  2KTQ A;  3E01 A;  3MEE A;  4BWJ A;  3BDP A;  1JLE A;  4O44 A;  1C0M A;  1HNI A;  1LAV A;  2XRI A;  4F2R A;  4MFB A;  1RDD A;  4FJM A;  3QNO A;  2FBY A;  4N5S A;  1J9A A;  2B6A A;  2DFH A;  3ZT0 A;  2F8S A;  4KKO A;  1RT5 A;  3HP9 A;  3T1A A;  3ZT2 A;  3JYT A;  3DOL A;  4CGD A;  2DTU A;  1EET A;  3L3U A;  3MXI A;  1B9D A;  4DSI A;  4H4O A;  1BQN A;  1TL3 A;  4DFJ A;  1JL2 A;  1L3S A;  1DTQ A;  4OLA A;  1WAF A;  4I7F A;  1T05 A;  2D0A A;  1IKY A;  5SWM A;  3V81 A;  4FJ8 A;  1C0U A;  4CGF A;  4DU3 A;  1SUQ A;  3TAG A;  3FFI A;  2G8V A;  2KFN A;  1R0A A;  3HST B;  4ICL A;  1C0T A;  5CYM A;  3QEV A;  1U4B A;  1NJY A;  3IAY A;  4Z4G A;  1TV6 A;  3CFO A;  3K2P A;  4JLH A;  2IDO A;  3QNN A;  3TAP A;  3AO1 A;  1NKE A;  4KHQ A;  1EX4 A;  2KQ2 A;  5E41 A;  3OYA A;  1XHZ A;  4DSK A;  2HHQ A;  3OJU A;  2RKI A;  3I0S A;  4E7J A;  3PO4 A;  4QOZ B;  1WNS A;  4HTU A;  2JGU A;  1LWF A;  3CM5 A;  2XY7 A;  3I0R A;  4KV8 A;  1RTH A;  3D0P A;  4PY5 A;  4LD0 A;  3AVN A;  5J2Q A;  1KSP A;  3HJF A;  1GOB A;  4WE1 A;  2VWJ A;  2X6N A;  4CJR A;  4CF0 A;  1NK8 A;  4FLT A;  4FJJ A;  3SPY A;  2HW3 A;  3ZSR A;  1X1P A;  4IFY A;  2E6L A;  2KW4 A;  2YKM A;  3KK1 A;  4DS5 A;  4KFB A;  3RMC A;  4FJ7 A;  1KCF A;  4KPY A;  3LZI A;  3KLE A;  2A1S A;  5I42 A;  4GMJ B;  1JL1 A;  2B4J A;  4ID5 A;  1CZ9 A;  4CIG A;  1GOA A;  4AHS A;  4FCY A;  2ZE2 A;  4ZTF A;  2W42 A;  4B9L A;  4M3U A;  2XHB A;  1BGX T;  5K14 A;  1JLA A;  4DTN A;  3B6O A;  3LWM A;  4KHS A;  1WSI A;  3DLE A;  4DQI A;  1D8Y A;  4CF8 A;  4JS5 A;  1ASV A;  1RTJ A;  3V9S A;  4FJG A;  4CJL A;  2YNG A;  2DFE A;  2XY8 A;  1L5U A;  3RTV A;  4NCG A;  4DFK A;  4ELT A;  4FYD A;  3QLH A;  5HRS A;  4OPJ A;  2I5J A;  3RMB A;  2G8K A;  4FM2 A;  1NJX A;  5FRM A;  1ZBH A;  2QK9 A;  1W0H A;  4PA1 A;  2A1R A;  3KD5 E;  1VSK A;  4CJW A;  4FZY A;  1RBV A;  2YV0 X;  3LP0 A;  4B8C A;  1HRH A;  2QKK A;  4FLU A;  1FK9 A;  1N6Q A;  2E6M A;  4IFV A;  2GBZ A;  3OYK A;  5I3U A;  3KLG A;  1TVR A;  1EKE A;  3NFA A;  4CJE A;  1ZBI A;  4RW7 A;  4EZ9 A;  3SYZ A;  4HCB A;  3NAE A;  4KI4 A;  4DU4 A;  4F8R A;  4BAC A;  2IGI A;  4FLW A;  4OPK A;  5J2M A;  1FKO A;  1S9G A;  3WNE A;  3AVI A;  3ZSV A;  4AHT A;  4CHZ A;  4FXD A;  3AVA A;  4HHT A;  3ZSO A;  3LAL A;  1LAW A;  4DSL A;  5SZT A;  1NK9 A;  4C8N A;  3AA2 A;  5HRR A;  4DQQ A;  3O3F A;  2R7Y A;  3HM9 A;  1VSD A;  1T7P A;  3RR7 A;  4IKF A;  2OPQ A;  3NCI A;  4KB0 A;  1ITG A;  3DM2 A;  3EZ5 A;  5KRS A;  1BI4 B;  1HMV A;  2IC3 A;  3T3F A;  2GV9 A;  1FKP A;  4F3T A;  3KKS A;  2FBT A;  4J2E A;  4Z4I A;  4LSL A;  3L2V A;  4L8R B;  4CHN A;  4KO0 A;  1DTT A;  5KTQ A;  3WNG A;  2OZS A;  3ALY A;  3AA3 A;  5CY4 A;  1K6Y A;  5CYQ A;  1RT4 A;  4CF1 A;  4DMN A;  4E89 A;  1HJR A;  3AA4 A;  1LWC A;  2D5R A;  2HHU A;  4GW6 A;  4CFC A;  3TI0 A;  3TWH A;  3P83 D;  4CFD A;  4RG8 A;  4JS4 A;  3RR8 A;  3K5L A;  4OGC A;  4B9M A;  2P5G A;  2BAN A;  4CHP A;  1X9M A;  3VQQ A;  2Y1J A;  1L3T A;  1IH7 A;  4B9N A;  3DRS A;  4CER A;  2BE2 A;  3VA3 A;  1J54 A;  4ZTJ A;  4B3O A;  4LSN A;  1ZBF A;  1BIU A;  5EU7 A;  3LDS A;  4N41 A;  3LP3 A;  2F96 A;  3QIO A;  2Y1I A;  4FZZ A;  5JS2 A;  4M3R A;  4GVM A;  4CK1 A;  3U3G A;  4B9T A;  3V4I A;  3ZSX A;  1WSH A;  3DLH A;  3ASM A;  3G0Z A;  4HUG A;  4Z4F A;  2Z1I A;  1NOZ A;  1UOC A;  1VSM A;  4EZ6 A;  5CZ2 A;  3ZT4 A;  2F8T A;  4E7L A;  2RPI A;  4K8X A;  1HYS A;  4DTJ A;  1LW0 A;  5J2N A;  4FK4 A;  1S1U A;  4PUO A;  1C6V A;  3AA5 X;  3HT3 A;  1LW2 A;  4Q0B A;  1Z25 A;  4DFM A;  4CJS A;  2OPS A;  1KRP A;  5FRN A;  4KI6 A;  1TGO A;  2YNF A;  4C8L A;  1LWE A;  3WNH A;  4O0I A;  3AVH A;  1RIL A;  4IDK A;  2D0C A;  1SKS A;  3PY8 A;  3MEC A;  1T03 A;  3VQP A;  4HVJ A;  4CJ4 A;  3AVM A;  3LAN A;  3VQ9 A;  1VSJ A;  3TAR A;  4DQR A;  1YTA A;  3P1G A;  2G8H A;  4FVM A;  3S3M A;  3QEW A;  1C1B A;  2VWK A;  2VG5 A;  3SNN A;  4H4M A;  1UA0 A;  3OS1 A;  4CEZ A;  1VSE A;  2X74 A;  4C8M A;  1TKT A;  3OJS A;  2G8W A;  4MQ3 A;  4BE2 A;  1CLQ A;  5D3G A;  2Z1J A;  2XY5 A;  3ZSY A;  1CXQ A;  1KVB A;  1RNH A;  3VQE A;  3THV A;  3QO9 A;  1IKV A;  5HRN A;  3ZSZ A;  1SKW A;  3VQ7 A;  1XI1 A;  1TKD A;  3O3G A;  1NK6 A;  4CEB A;  1S1W A;  2RN2 A;  3KK3 A;  4HCC A;  1WAJ A;  3IG1 A;  2G8I A;  2IAJ A;  4G1Q A;  3PX6 A;  4NCB A;  1RDA A;  1JKH A;  4FM0 A;  2QKB A;  3TAM A;  1BHL A;  3V9X A;  3AV9 A;  4I9L A;  2PZS A;  2FBV A;  4AHV A;  3C6U A;  3OYI A;  3HXM A;  4DTX A;  1ZYQ A;  3MXM A;  1J5O A;  2G8F A;  1RBU A;  4W5R A;  3S9H A;  4Z4H A;  3ZCM A;  1WSF A;  1B9F A;  4E19 A;  1RBT A;  5KI6 A;  3OY9 A;  3ZSQ A;  3SUP A;  1A5X A;  4KTW A;  4B8A B;  3QEI A;  4F3O A;  3I8D A;  3V9U A;  3LAM A;  3OVN A;  4XIU A;  3LWL A;  1JLQ A;  4DLG A;  1XHX A;  3TAE A;  2P1J A;  4PWD A;  4ID1 A;  3TAQ A;  4KTQ A;  4ZHR A;  4DF8 A;  3F73 A;  2YNH A;  4FW2 A;  1YT3 A;  3TAF A;  2ATQ A;  3OYE A;  4N76 A;  3M8Q A;  4YNQ A;  2YNI A;  2EX3 A;  4I2P A;  1KVC A;  3WNF A;  3OYG A;  3V1Q A;  4M41 A;  1KLM A;  3OYM A;  1GOC A;  1S5J A;  4FJL A;  2X78 A;  3CFP A;  1ASW A;  3C95 A;  4CFA A;  4CJQ A;  1WSE A;  3PUF A;  4RW6 A;  4CEQ A;  4BE0 A;  3RMD A;  4FK0 A;  4C8O A;  4BE1 A;  3M8S A;  3VQ6 A;  3MED A;  2JLE A;  2VG7 A;  2HND A;  3NF6 A;  3K5N A;  3L8B A;  1BI4 A;  1TKX A;  1JLC A;  4O4G A;  3SQ1 A;  4M42 A;  1CZB A;  4FM1 A;  3CM6 A;  3LPU A;  4FJK A;  4CJU A;  5DK5 A;  4LH4 A;  3SQ0 A;  1TK8 A;  4DQS A;  2OYQ A;  4LY7 A;  3SUQ A;  4M3Z A;  3EY1 A;  3V6D A;  3OYJ A;  4BWM A;  4CEO A;  2ITG A;  3HYF A;  4KHU A;  1C1C A;  4CGG A;  2HHT A;  2KZM A;  1HQE A;  4NYF A;  4OKJ A;  2HHV A;  2IOC A;  4Z0U A;  1RT6 A;  4ELU A;  3SPZ A;  3ULD A;  5JS1 A;  4CGI A;  1B92 A;  4RW8 A;  4JRQ A;  4FLY A;  1U47 A;  3CQ8 A;  1HNV A;  4DG1 A;  1TK0 A;  3AO5 A;  1LV5 A;  1ASU A;  3SZ2 A;  1VSL A;  3DYA A;  5J1E A;  3KIO A;  1IG9 A;  3OYF A;  4DQP A;  3OYD A;  3MAQ A;  1TK5 A;  4IG0 A;  1VSH A;  3NH0 A;  3NE6 A;  4CIE A;  1IKW A;  2OPR A;  2PYJ A;  3RRG A;  1WSJ A;  3AVG A;  4NYN A;  4CCH A;  3DLK A;  1EXQ A;  2EHG A;  3L3V A;  3SCX A;  4FW1 A;  4AHR A;  2ZQB A;  2WON A;  5KGX A;  1I39 A;  1QE1 A;  1S6P A;  5T7B A;  3VQ4 A;  3M8R A;  3OS2 A;  4DTR A;  4KB1 A;  4J2B A;  3IRX A;  3VA0 A;  4RW4 A;  4I9Q A;  4OKE A;  3G10 A;  2ZD1 A;  3IS9 A;  3NF8 A;  4CEE A;  4QAG A;  2B5J A;  3CFR A;  3LZJ A;  3RRH A;  1X9S A;  4F4K A;  1BL3 A;  1VSF A;  3ISN C;  4CJK A;  3DOK A;  1KFD A;  5HRO A;  4J2A A;  3L2W A;  1U45 A;  2VG6 A;  1UA1 A;  3ZT3 A;  3S3O A;  3HVR A;  4JRP A;  4Q5V A;  1ZBL A;  1TL1 A;  3HVT A;  5HRP A;  4AH9 A;  3O4Q A;  3QES A;  3DLG A;  2KFZ A;  4CJT A;  4CED A;  1RTD A;  1BCM A;  1YVU A;  4CHQ A;  4KAZ A;  1BCO A;  4KHW A;  3VQA A;  3M8P A;  4DWI A;  3P5J A;  1UWB A;  5FDL A;  4M3T A;  1QQC A;  3MEG A;  5C25 A;  3B6P A;  2HB5 A;  1MU2 A;  3NBP A;  4OGE A;  4E7H A;  4CF2 A;  3OS0 A;  1NJW A;  4E1M A;  1N5Y A;  2WOM A;  2XY6 A;  3SUO A;  1NKC A;  1QSS A;  1WLJ A;  1SL2 A;  4FLV A;  3PO5 A;  1CXU A;  2FC0 A;  4BDP A;  3PX0 A;  3S3N A;  4H8K A;  1BIZ A;  1JXE A;  3SI6 A;  4ELV A;  4W5T A;  1L3V A;  2AJQ A;  4OJR A;  4BDZ A;  4CEC A;  3AVJ A;  3KTQ A;  4O5B A;  3DRP A;  1WN7 A;  4CEF A;  5HLF A;  4KTZ A;  2RF2 A;  2Q3S A;  1RBR A;  3QIN A;  3HPG A;  3KLF A;  1QS4 A;  3K57 A;  1J53 A;  3NGI A;  3QEP A;  1U48 A;  3KLH A;  4KRF A;  3VQ8 A;  1RBS A;  2DY4 A;  3C6T A;  3CYM A;  4LH5 A;  4CJF A;  1HYZ A;  3JSM A;  2NUB A;  3NH2 A;  1IKX A;  3V1O A;  3V9Z A;  1Q9Y A;  4CF9 A;  3VQD A;  4DFP A;  3F9K A;  3HL8 A;  3U6F A;  3VQB A;  4CES A;  1NK0 A;  3NH1 A;  4DS4 A;  4CJV A;  4QCL A;  4Y1C A;  2O4G A;  4R5P A;  3SUN A;  4N56 A;  2BGG A;  4K8Z A;  3QIP A;  4O0J A;  3ZT1 A;  4E0D A;  3ITH A;  3NF9 A;  3T19 A;  4IG3 A;  1RTI A;  3L2Q A;  1KLN A;  4W5N A;  1D9D A;  4PQU A;  2ETJ A;  4M45 A;  1NK7 A;  3KK2 A;  3TAB A;  4FK2 A;  3LP1 A;  1U49 A;  2HVH A;  1A5V A;  1HYV A;  1NK5 A;  3KKR A;  3VN5 A;  3OYL A;  3L2U A;  3SV4 A;  3DLB A;  2DFF A;  4N47 A;  1NJZ A;  4M3X A;  2BDP A;  3K5O A;  3NHG A;  1U04 A;  4IBN A;  1DLO A;  2P51 A;  3QET A;  1YTU A;  3U3Y A;  4DSJ A;  1RDB A;  3K5M A;  3LPT A;  4FJN A;  4FJI A;  4F2S A;  1FXX A;  4BDY A;  2OPP A;  4FJ5 A;  3QEX A;  2OA8 A;  1HPZ A;  4Z4E A;  3MXJ A;  1RT3 A;  3EYZ A;  3SV3 A;  1JLB A;  1BIS A;  2LSN A;  3O4N A;  2HNY A;  4E3S A;  1L3U A;  1S9E A;  1IO2 A;  1D9F A;  3L2R A;  4CEA A;  4HUE A;  4OVL A;  2YHA A;  3OYB A;  3HP6 A;  3KJV A;  3AVC A;  3NF7 A;  2P5O A;  1RT7 A;  2IS3 A;  5KGW A;  1UAX A;  1SKR A;  3K59 A;  2HHX A;  1W9H A;  4EP4 A;  3AVF A;  4CGH A;  4C8K A;  4M3W A;  1XWL A;  3AO3 A;  1RT1 A;  1REV A;  3NDK A;  3SQ2 A;  5HP1 A;  4B9V A;  1NK4 A;  1KVA A;  3AVL A;  3LP2 A;  5C24 A;  4DU1 A;  4DF4 A;  3AO2 A;  4CJ5 A;  4B9U A;  3A2F A;  4FJX A;  4CGJ A;  1EP4 A;  2OZM A;  4AHU A;  4CHY A;  1O1W A;  2PY5 A;  2HVI A;  4FZX C;  2O4I A;  4YFU A;  1WSG A;  4AIL C;  1TAQ A;  4Z4C A;  3OYC A;  1QHT A;  2GUI A;  4I2Q A;  2E4L A;  1Y97 A;  4DTP A;  1RCH A;  1QSL A;  4FLZ A;  1XC9 A;  3O3H A;  3H08 A;  4TSX A;  4FJ9 A;  2HNZ A;  3OYN A;  1VRU A;  1SV5 A;  3KD1 E;  3AO4 A;  1NOY A;  2G8U A;  3TR8 A;  3SJJ A;  4OKK A;  3V9W A;  2YKN A;  3RMA A;  1SL0 A;  1BQM A;  1S1V A;  5DMR A;  4E1N A;  1A5W A;  3CG7 A;  1QSY A;  3UIQ A;  4RW9 A;  3OYH A;  4B9S A;  1JXB A;  4KRE A;  4O55 A;  3ZSW A;  4KHN A;  3DMJ A; 
#chains in the Genus database with same CATH topology
 2JWL A;  3KLI A;  2QXF A;  4I6M B;  1NKB A;  3T1H K;  4FLX A;  3AVK A;  3LDL A;  3HPH A;  2QWO A;  2XO7 A;  1TAU A;  1G15 A;  3VQ5 A;  4IOA L;  2X6S A;  3U9Z A;  4FJH A;  1XUP O;  4DR6 K;  5AQR A;  2WFB A;  2E2N A;  4OLB A;  1Q86 O;  3DRR A;  4GV3 A;  3D45 A;  4CJ3 A;  5M1O A;  3VQC A;  1RT2 A;  3WQT A;  3MDQ A;  4DTU A;  3T69 A;  2VQF K;  5J2P A;  2HHS A;  4CFB A;  1ATS A;  5FRO A;  5CZ1 A;  4JI5 K;  3OW2 M;  1VK0 A;  2UU9 K;  4L3Q A;  2Z1G A;  4DSE A;  1RGI A;  3BZK A;  3DLR A;  3TTF A;  1JLE A;  2UXB K;  5AZJ B;  1HNI A;  2QWM A;  1QZ6 A;  2V7Y A;  3ENH A;  3MWT A;  3ZT0 A;  3T1A A;  4M7Y A;  3DOL A;  2DTU A;  4H4O A;  4NLC A;  4KH6 A;  3ZLJ A;  2ZJP L;  3AAP A;  3TSP A;  2HOE A;  1T05 A;  2D0A A;  1IKY A;  4KBO A;  3F2K A;  3V81 A;  1C0U A;  1SUQ A;  3TAG A;  3FFI A;  2NLX A;  3IAY A;  4WQ5 A;  2Q31 A;  4BRQ A;  1BWF O;  1NKE A;  1EX4 A;  1K9M O;  3OYA A;  5KPT A;  2JGU A;  3DXM B;  3I0R A;  5J2Q A;  3EEQ A;  4YOY A;  3C65 A;  1KSP A;  3HJF A;  1BUP A;  2X6N A;  4BR4 A;  4CF0 A;  4FLT A;  3MCA B;  4FWN A;  1JCF A;  3U4L A;  2E6L A;  1TYQ B;  4DS5 A;  3KWI A;  3THX B;  4LF6 K;  3VEV A;  2A1S A;  5CE3 A;  4ID5 A;  4M3U A;  3C0B A;  4DR4 K;  1BGX T;  2H3G X;  4MDB A;  3ZYY X;  3T7Z A;  1WSI A;  4DQI A;  4JS5 A;  2P9P B;  2O8E A;  3H3O B;  4FL9 A;  4FJG A;  2YNG A;  2DFE A;  2XY8 A;  3RTV A;  4DFK A;  5AFU A;  3GBT A;  5FPE A;  4QS7 A;  4OPJ A;  3RMB A;  2QK9 A;  1VSK A;  2YV0 X;  2QKK A;  1FK9 A;  1N6Q A;  4IFV A;  3KLG A;  4CJE A;  2GTD A;  4JK8 A;  4DU4 A;  2IGI A;  5M1N A;  4LFC K;  5J2M A;  1FKO A;  1S9G A;  3A5M C;  1NBW A;  4CZG A;  3ZSV A;  4AHT A;  4HHT A;  2P9K B;  3FZF A;  5KQD A;  3AA2 A;  2F7T A;  5M1Q A;  1HKC A;  4GNI A;  4O8U A;  4KB0 A;  1ITG A;  2ITM A;  3DM2 A;  3EZ5 A;  3SMP A;  1BI4 B;  1HMV A;  4LFB K;  1RDU A;  4A2A A;  3WXL A;  5LMU K;  4DHY A;  1XNQ K;  2FBT A;  3SLC A;  4LSL A;  1XNR K;  4L8R B;  4CHN A;  3ZEU B;  4FWQ A;  1K8A O;  2OZS A;  5CY4 A;  2NRT A;  3AA4 A;  5EVZ A;  4IJA A;  2D5R A;  5GAE P;  2HHU A;  4CFC A;  3EL2 A;  3P83 D;  3E1Y A;  3ENO A;  4RG8 A;  3UKR B;  2BAN A;  3WUH A;  4CHP A;  3VQQ A;  2Y1J A;  4IJN A;  1IH7 A;  4WQ4 A;  4DUY K;  4CER A;  2FSK A;  3VA3 A;  1J54 A;  4B3O A;  1ZBF A;  1BIU A;  1N32 K;  3GE1 A;  3DLL L;  3LDS A;  3QIO A;  4CK1 A;  4B9T A;  4GVM A;  3O80 A;  3VOV A;  3ZSX A;  4WFA L;  3G0Z A;  4HUG A;  4DUZ K;  2AA4 A;  4Z4F A;  1VSM A;  4EZ6 A;  4JKB A;  1V4S A;  3ID6 A;  5AQH A;  1ATR A;  5GAD P;  2UUB K;  4R79 A;  1LW2 A;  4DFM A;  3A0I X;  5C15 A;  2O8B A;  3TSU A;  5H1S Q;  3C6H A;  4C8L A;  3VES A;  3AVH A;  1P8Z A;  3BF1 A;  4IDK A;  3VF6 A;  4BVO A;  3MEC A;  1T03 A;  1SS6 A;  4CI6 A;  4RTF D;  3TAR A;  1VQ9 N;  3CHW A;  3P1G A;  1D4X A;  3L4I A;  3O4W A;  2GUP A;  2VWK A;  3OTO K;  1HR0 K;  3I8B A;  1VSE A;  4C8M A;  4CZM A;  4JI7 K;  5KPZ A;  2DPN A;  1NNE A;  3ZSY A;  3OHR A;  1RNH A;  5AQZ A;  4FPB A;  2GEL A;  3O3G A;  5AQY A;  4C23 A;  4CEB A;  5BRD A;  4WFB L;  4HCC A;  3IG1 A;  3CCU N;  3TAM A;  5I9E B;  4I9L A;  3P39 A;  4AHV A;  2G8F A;  1J5O A;  3R3L A;  4Z4H A;  1WSF A;  3SUP A;  1RBT A;  4F3O A;  3CCL N;  3LAM A;  1JLQ A;  1XHX A;  5KPR A;  4ID1 A;  3EE8 A;  4KTQ A;  5JVH L;  2O8C A;  3SBG A;  3F73 A;  1OKJ A;  1HNW K;  1NMD A;  3CJC A;  4N76 A;  3M8Q A;  4YNQ A;  1HX1 A;  1KVC A;  1QQN A;  4M41 A;  1KLM A;  4EIA A;  1GOC A;  4IFE A;  3CFP A;  3PSF A;  4CFA A;  4CJQ A;  3ZET A;  4BE0 A;  4FK0 A;  4C8O A;  5AQW A;  3BUZ B;  1VAZ A;  5BPN A;  4CBX A;  2HND A;  3K5N A;  3T1Y K;  4O4G A;  2O8F A;  1CZB A;  4BRF A;  4FM1 A;  4B3S K;  1TK8 A;  4DQS A;  2HF4 A;  4YOV A;  4M3Z A;  3EY1 A;  4BWM A;  3RSE A;  1C1C A;  4OKJ A;  4DB3 A;  3SPZ A;  1YHQ N;  3FGU A;  1RDW X;  1WOQ A;  4DG1 A;  4BRL A;  3J7A P;  1OH7 A;  1IG9 A;  3OYF A;  5EY4 A;  3MAQ A;  1NGG A;  4JKC A;  1TK5 A;  1VSH A;  2OPR A;  1WSJ A;  3DLK A;  2EHG A;  3I33 A;  3L3V A;  2WON A;  4KB1 A;  4IOX A;  3IRX A;  4RW4 A;  4C1N K;  4OKE A;  2O8D B;  3CET A;  3LZJ A;  1X9S A;  1V4T A;  2YJE A;  5BN9 A;  4CJK A;  4JAX A;  1KFD A;  5HRO A;  2IIR A;  4J2A A;  4LFA K;  3ZX3 A;  3MN9 A;  4JRP A;  5CR4 A;  1IBM K;  1YVU A;  4XEI A;  1NGI A;  3VQA A;  5E26 A;  3LDQ A;  1O13 A;  1MU2 A;  2ZGZ A;  4E7H A;  2NRX A;  1NJW A;  5BRF A;  1QSS A;  5HL7 L;  1WLJ A;  3EE9 A;  4EHT A;  4FLV A;  5AQN A;  2V7Z A;  4DQ8 A;  3CCR N;  3BEX A;  2PBD A;  3O5B A;  5HLF A;  2E2P A;  2V52 B;  1J53 A;  4KRF A;  5LY3 A;  3KLH A;  1RBS A;  3CYM A;  1HYZ A;  2NUB A;  4WYB A;  1EWQ A;  3WXI A;  4A57 A;  3F9K A;  3VQB A;  4AM7 A;  4DS4 A;  1YIJ N;  3QIP A;  2ASP A;  3O1W A;  4E0D A;  3NF9 A;  4IG3 A;  2JWK A;  1D9D A;  1WB9 A;  2ETJ A;  4M45 A;  2UYT A;  5AQV A;  1U49 A;  2CGL A;  1HYV A;  4A5B A;  3KKR A;  5AQQ A;  3VN5 A;  3OYL A;  3SV4 A;  1NJZ A;  1NGH A;  4DCH A;  4M3X A;  2BDP A;  4JI0 K;  3JXU A;  3KVG A;  4B3R K;  2E2Q A;  1EO1 A;  4BDY A;  4FJ5 A;  2FSJ A;  2PAV A;  4ISG A;  1RT3 A;  3SV3 A;  1BIS A;  4E3S A;  2HNY A;  3ZX0 A;  1IO2 A;  1D9F A;  2EWS A;  4HUE A;  2YHA A;  4ISF A;  1RT7 A;  5KGW A;  3K59 A;  2OTL N;  4M3W A;  1XWL A;  3AO3 A;  1RT1 A;  3F9M A;  2W6K A;  4M7X A;  4DV3 K;  1NK4 A;  3AVL A;  4JI6 K;  3LP2 A;  3PIP L;  1I94 K;  3AO2 A;  3A2F A;  4KHP K;  1EP4 A;  3CCS N;  5AQK A;  3N4P A;  2O4I A;  3WEE B;  4YFU A;  5AQJ A;  3DWL A;  4GV6 A;  1TAQ A;  2O8C B;  1QHT A;  4I2Q A;  2E4L A;  1QSL A;  3O3H A;  4K41 A;  3E9P A;  4BC5 A;  5M1F A;  4FJ9 A;  1OH6 A;  2HNZ A;  1FJG K;  4H0P A;  2G8U A;  4JD2 B;  3V9W A;  4WCE L;  5ELZ A;  3UIQ A;  3ZET B;  4O55 A;  4FZY A;  4FVU A;  2OTJ N;  2HMI A;  4FWL A;  3G25 A;  3CCJ N;  1BG3 A;  5EXW A;  3NGZ A;  1VRT A;  3O9U A;  4NCA A;  3QER A;  3CPE A;  2D0B A;  2KKZ A;  4W5Q A;  3RSE B;  4DSF A;  1VQ5 N;  1SL1 A;  2WBN A;  3BGR A;  3RWU A;  2P9I A;  2HF3 A;  3C94 A;  1JLG A;  4CIF A;  4E7K A;  4O5F A;  1Q8I A;  3HO1 A;  3D2E A;  2BUP A;  3CC7 N;  3A5O C;  3PX4 A;  1KAX A;  1KFS A;  1Z26 A;  3F5T A;  5C42 A;  3H45 C;  2QW9 A;  1TKZ A;  4CK2 A;  1LCU A;  4KHY A;  5KRT A;  2FF3 B;  3FFK B;  3MWP A;  1J6Z A;  2KTQ A;  3BDP A;  5FPN A;  1LAV A;  4F2R A;  4MFB A;  1RDD A;  2J4R A;  4GV9 A;  2P9L A;  2FBY A;  4N5S A;  3HP9 A;  2Q0R A;  1XQS C;  4CGD A;  4QS8 A;  1EET A;  3CJ1 A;  3L3U A;  3MCP A;  1XMQ K;  1B9D A;  1TL3 A;  5KQ8 A;  1L3S A;  1ATN A;  4OLA A;  4I7F A;  2QTD A;  4FJ8 A;  3QDK A;  4DU3 A;  4CZK A;  4ICL A;  5CYM A;  4JHD A;  1TV6 A;  3AO1 A;  4DSK A;  4JKH A;  3VMF B;  4H03 B;  3I0S A;  1WNS A;  3QML A;  4KV8 A;  4PY5 A;  4LD0 A;  4HTL A;  3WXJ A;  1GOB A;  2VWJ A;  5GIN A;  1NK8 A;  4E1J A;  4IEE A;  3HBT A;  3QB0 A;  1X1P A;  2P9N A;  2KW4 A;  3LZI A;  3KLE A;  5I42 A;  3EN9 A;  2ASM A;  3FLC O;  4ZTF A;  5AR0 A;  2ZE2 A;  1KD1 O;  1IBL K;  1DEJ A;  2XHB A;  4DTN A;  3B6O A;  1D8Y A;  2OAN A;  4CJL A;  4ILH A;  1L5U A;  5IT9 O;  3VGM A;  3CCV N;  3QLH A;  5HRS A;  2F9T A;  2OCE A;  2G8K A;  3DAW A;  4PA1 A;  2A1R A;  4B8C A;  1FW6 A;  1T6D A;  1NLV A;  2E6M A;  2QWR A;  5AQF A;  1X3M A;  3SYZ A;  1K8K B;  4PHT X;  3G71 N;  4BC3 A;  4F8R A;  4BAC A;  4OPK A;  3WNE A;  4CHZ A;  4FXD A;  3HSC A;  3AVA A;  1VQP N;  3ZSO A;  4DSL A;  2A3Z A;  2Q0U A;  4MO4 A;  1T7P A;  5AZI A;  3HM9 A;  4IKF A;  4YDU C;  1ZBS A;  1ESV A;  2YX6 A;  4MLH A;  3VEX A;  4DV7 K;  3T3F A;  5A2Q O;  1FKP A;  3KKS A;  1QHA A;  3L2V A;  5KTQ A;  3CCM N;  1VQK N;  3WNG A;  3ALY A;  5CYQ A;  1K6Y A;  1RT4 A;  1W97 L;  1LWC A;  3IKM A;  2W6L A;  1GLB G;  1DT9 A;  5LMN K;  4JS4 A;  3RR8 A;  2P5G A;  1GLD G;  3VGK A;  2E5L K;  3SAF A;  1N8R O;  3DRS A;  2BE2 A;  3CIP A;  4NO7 A;  3TTD A;  1BO5 O;  1TUY A;  1OH5 A;  1QZ5 A;  3LP3 A;  4H5V A;  4FZZ A;  4M3R A;  3U3G A;  3V4I A;  4JK9 A;  1WSH A;  3L0Q A;  5AQS A;  1QQO A;  4JKA A;  2A42 A;  1NOZ A;  4ISE A;  4DV6 K;  3M5R A;  5CZ2 A;  3SK3 A;  4IOC L;  2E88 A;  3A8Y A;  1HYS A;  5J2N A;  4FK4 A;  1S1U A;  3HT3 A;  2OPS A;  2YNF A;  1YJ9 N;  1LWE A;  4O0I A;  1NGD A;  1U2V B;  4CJ4 A;  5JLH A;  3D2E B;  3SMS A;  2VG5 A;  3OS1 A;  4CBW A;  1GLE G;  5D3G A;  2QWQ A;  2Z1J A;  2XY5 A;  1N34 K;  1KVB A;  3THV A;  1SAZ A;  2P9L B;  1TKD A;  1XI1 A;  2RN2 A;  4NCB A;  1RDA A;  3V9X A;  3AV9 A;  5AQT A;  2FBV A;  1YVN A;  1ZYQ A;  3OYI A;  5BN8 A;  3JAM O;  3S9H A;  3ZX2 A;  4IO8 A;  3RMA A;  4E19 A;  5KI6 A;  3OY9 A;  1A5X A;  3H3N O;  3QEI A;  3SAH A;  3V9U A;  3SAG A;  3OVN A;  3LWL A;  4DLG A;  5F0X A;  2P1J A;  4BR5 A;  3S41 A;  1WBB A;  4FW2 A;  2ATQ A;  3OYE A;  2EX3 A;  5AQM A;  1OVQ A;  3PSI A;  3OYM A;  1KC8 O;  1ASW A;  4A59 A;  4BVP A;  1WSE A;  3D2F A;  4BE1 A;  3MN7 A;  3MED A;  3L8B A;  3SQ1 A;  1TKX A;  3FZL A;  1OVY A;  4LY7 A;  3VTH A;  3V6D A;  3OYJ A;  4CEO A;  2ITG A;  3JS6 A;  2HHT A;  3U8X A;  1RT6 A;  4CZE A;  1QVF M;  1IBK K;  1VQL N;  5JS1 A;  1B92 A;  4RW8 A;  2F9W A;  2NZT A;  1QQM A;  2YI1 A;  1LV5 A;  4K25 A;  1ASU A;  2QM1 A;  4DQP A;  3RRG A;  2AP1 A;  4CIE A;  4NYN A;  4CCH A;  4BRK A;  4FW1 A;  3TPQ A;  2ZQB A;  5T7B A;  3VQ4 A;  4DR5 K;  4I9Q A;  4A61 A;  2QWP A;  4CEE A;  2F4V K;  2P9S A;  1BL3 A;  4YOT A;  3DOK A;  3UKU B;  3CCE N;  3L2W A;  1U45 A;  2VG6 A;  1UA1 A;  4RWT A;  3HVR A;  4Q5V A;  3O4Q A;  3QES A;  4LF4 K;  2KFZ A;  4CED A;  1RTD A;  2UUC K;  5FDL A;  3MEG A;  4BRD A;  5JVG L;  3BF3 A;  4OGE A;  4FWM A;  4E1M A;  2XY6 A;  1MA9 B;  3ULE A;  1CXU A;  4BDP A;  3PX0 A;  4H8K A;  4ELV A;  3H6E A;  4W5T A;  3THW A;  4BDZ A;  3AVJ A;  4O5B A;  4CEF A;  3FE1 A;  3FZK A;  2RF2 A;  2Q3S A;  4DQQ A;  3NGI A;  1KQS M;  3L4Q A;  3VEN A;  5FPD A;  3G4S N;  4DFP A;  1SQK A;  2GX9 A;  4CES A;  4CJV A;  3CME N;  4Y1C A;  4R5P A;  2E20 A;  3QBW A;  4N56 A;  4QCL A;  3HM8 A;  4K8Z A;  5JMV A;  3ZT1 A;  3T19 A;  4NXN K;  1RTI A;  2Q2R A;  1KLN A;  2Q1N A;  4JV5 K;  1NK7 A;  3KK2 A;  3LP1 A;  4X64 K;  1A5V A;  1Q82 O;  3L2U A;  5ADX H;  2Q97 A;  3KZB A;  3O9Q A;  4YOU A;  3NVK A;  1DLO A;  3QET A;  3U3Y A;  3TSQ A;  3LPT A;  3HRG A;  5JIC A;  4FJI A;  3WXM B;  3P38 A;  1KAY A;  4FWO A;  1L3U A;  4DV2 K;  1S9E A;  3L6Q A;  3L2R A;  4B3T K;  5ADX A;  3HP6 A;  4K43 A;  4DV5 K;  3NF7 A;  3ID8 A;  2ZWH A;  4NLB A;  4C8K A;  3I55 N;  4QS9 A;  1REV A;  4JK7 A;  1KVA A;  5AQO A;  4DF4 A;  4CZH A;  4FWK A;  4CGJ A;  3CJ7 A;  4AHU A;  3CER A;  4CHY A;  2O8E B;  2PY5 A;  3VEZ A;  3HZ6 A;  1Q81 O;  2P9U A;  4Z4C A;  4DTP A;  2GUI A;  1RCH A;  3LDN A;  1RFQ A;  4FLZ A;  4XH5 A;  4FWP A;  4YDU A;  1SV5 A;  5FPM A;  4EHU A;  1NOY A;  4EAH D;  4BC2 A;  1SL0 A;  1BQM A;  5DMR A;  4E1N A;  3WXK A;  5MLC Q;  1JXB A;  3AGK A;  3A5L C;  3KK7 A;  1QTM A;  5HBM A;  3GL1 A;  3K9J A;  1Q9X A;  4B08 A;  4DTS A;  3PV8 A;  3G6E N;  4DV4 K;  4OPA A;  3K58 A;  4CJP A;  2HHW A;  4JNE A;  3IDH A;  1Z6R A;  4B1V A;  4CK3 A;  3WT0 A;  4UQG A;  3V1R A;  4B1X B;  2VCP A;  4CHO A;  1X9W A;  4DTM A;  4E7I A;  3DI6 A;  1S1T A;  2A6A A;  4BR0 A;  3TAN A;  1M90 O;  3BZC A;  1RDC A;  4KH5 A;  4PL7 A;  4LF9 K;  1KTQ A;  1ILY A;  1T6C A;  1JLF A;  4BRN A;  1D5A A;  1HQU A;  1S6Q A;  1ZBU A;  4DLE A;  4HUF A;  2FBX A;  3J7Y P;  1T8E A;  3HK2 A;  1BOT O;  3GOI A;  4BWJ A;  1C0M A;  4JI1 K;  4FJM A;  3P4I A;  4NXM K;  4X66 K;  4H0X B;  4KKO A;  1RT5 A;  3ZT2 A;  1VQM N;  5GIO A;  5AQL A;  4YOW A;  3MXI A;  4DSI A;  3M3Z A;  1BQN A;  4DFJ A;  4BY9 C;  1WAF A;  3W3D A;  5SWM A;  4CGF A;  1NGF A;  1R0A A;  3HST B;  1C0T A;  1U4B A;  1VHX A;  1NJY A;  4Z4G A;  3K2P A;  3QNN A;  1X3N A;  2IDO A;  3ULE B;  3TAP A;  2O8B B;  4KHQ A;  5DM6 L;  2KQ2 A;  5E41 A;  2HBL A;  3IUC A;  2HHQ A;  1J5E K;  3OJU A;  4E7J A;  3PO4 A;  3DXK A;  2BTF A;  3THW B;  1LWF A;  3CM5 A;  2VWB A;  2XY7 A;  1RTH A;  3MK6 A;  3D0P A;  4IXC A;  2ZJQ L;  4WE1 A;  4CJR A;  4FJJ A;  2E8A A;  3THY A;  3SPY A;  2HW3 A;  3ZSR A;  5M1K A;  2YKM A;  4KFB A;  4CZL A;  1KCF A;  1EWR A;  1GLA G;  1JL1 A;  4FCY A;  4CIG A;  1GOA A;  4AHS A;  2W42 A;  4FOE A;  1OH8 A;  3LWM A;  4KHS A;  3DLE A;  1NGA A;  3EZW A;  4PKI A;  4CF8 A;  1DGK N;  3CXC M;  3H46 O;  1ASV A;  1RTJ A;  3V9S A;  2W41 A;  4ELT A;  4NCG A;  2QI2 A;  2FSN A;  2I5J A;  4FM2 A;  5FRM A;  1ZBH A;  1NWK A;  5AQI A;  1KXP A;  4CJW A;  3KD5 E;  3LP0 A;  4V19 S;  3MX5 A;  2UUA K;  1TVR A;  1ZBI A;  3NFA A;  1N36 K;  1HJO A;  4RW7 A;  1VQN N;  3NAE A;  4KI4 A;  3VET A;  1P90 A;  4X65 K;  3N4Q A;  1GLF O;  1LAW A;  5BR8 K;  1NK9 A;  4C8N A;  5HRR A;  1VQ4 N;  1HKG A;  1VSD A;  4IO9 L;  3NCI A;  1VQ6 N;  2QWL A;  2IC3 A;  3ENB A;  2O8F B;  2GV9 A;  4HWI A;  4J2E A;  1EQY A;  3SJH A;  4KO0 A;  4JYA K;  1SZ2 A;  4BRH A;  1JCG A;  4DMN A;  2W40 A;  2P9U B;  3OA9 A;  3R1X A;  3TI0 A;  2YCH A;  3TWH A;  1MWM A;  4H5R A;  5IWA K;  2UXD K;  1VQ8 N;  2GEM A;  3O6W A;  1BDG A;  1HKB A;  1L3T A;  4B9N A;  5GAH P;  4ZTJ A;  4LSN A;  1YUW A;  3KHY A;  5EU7 A;  4DKW A;  4BRP A;  1HNZ K;  4N41 A;  2Y1I A;  3MX2 A;  5JS2 A;  3LM2 A;  3CJ9 A;  1N33 K;  3ASM A;  1UOC A;  3Q7B A;  3ZT4 A;  1YXQ A;  3DJC A;  4K8X A;  4DTJ A;  4PUO A;  3AA5 X;  4FWS A;  1Z25 A;  4CJS A;  1KRP A;  4KI6 A;  1HNX K;  4BRG A;  2HHH K;  3CPW M;  4CZJ A;  3R9P A;  3DXM A;  4HVJ A;  3LAN A;  3J81 O;  3VQ9 A;  4DQR A;  4BG9 A;  3S3M A;  1S22 A;  3QEW A;  5F2R A;  1C1B A;  4YY3 K;  3SNN A;  3E66 A;  5LJV A;  4H4M A;  2YHW A;  3THX A;  3GG4 A;  1TKT A;  4CJ7 A;  2VGN A;  3FZH A;  1CXQ A;  4X62 K;  2VQE K;  5EOY A;  3CC2 N;  3D7E O;  3VQ7 A;  1NK6 A;  1DKG D;  1S1W A;  3KK3 A;  1WAJ A;  5BRH A;  4G1Q A;  2NRW A;  3PX6 A;  2P9P A;  1JKH A;  2ZM6 K;  4FM0 A;  4H0Y B;  3B8A X;  2PZS A;  3PY8 A;  3C6U A;  4BRC A;  4W5R A;  3ZCM A;  3GDQ A;  3ZSQ A;  4KTW A;  4B8A B;  5AQP A;  4JKG A;  2FF6 A;  3TAE A;  4PWD A;  3PIO L;  2YNH A;  1YT3 A;  3DXK B;  2QEX N;  3FZM A;  3OYG A;  5AQX A;  2X78 A;  2P9K A;  2NRH A;  3THY B;  3A5N C;  3PUF A;  4RW6 A;  3RMD A;  4AM6 A;  1M1K O;  2HBJ A;  4CZI A;  1Y64 A;  4IWV A;  1BI4 A;  4M42 A;  1JLC A;  4JKE A;  4CVN E;  3CM6 A;  3LPU A;  4FJK A;  4LH4 A;  3SQ0 A;  4YOX A;  1HLU A;  2OYQ A;  1T44 A;  2CGK A;  3SUQ A;  3ZEU A;  4LF7 K;  3HYF A;  4KHU A;  4Z0U A;  4GY2 B;  4XH4 A;  3CQ8 A;  1HNV A;  3ATU A;  1TK0 A;  4K42 A;  3SZ2 A;  3DYA A;  5J1E A;  3EKS A;  4JEP A;  4OO1 J;  2BH1 A;  3OYD A;  1C0F A;  2GWJ A;  4JI3 K;  3NH0 A;  3CI5 A;  2PYJ A;  4H0O A;  2F8S A;  3M8R A;  4B1Y B;  2QXL A;  1S6P A;  1QE1 A;  3OS2 A;  4J2B A;  1VQO N;  3VA0 A;  1XMO K;  3CFR A;  4DR3 K;  4QAG A;  2B5J A;  4F4K A;  4JI4 K;  1XC3 A;  3H1Q A;  3ISN C;  4BQZ A;  4PL8 A;  3S3O A;  2VGM A;  4H5N A;  1TL1 A;  3HVT A;  5HRP A;  4AH9 A;  3DLG A;  2RE2 A;  2KHO A;  5LJW A;  4KHW A;  3P5J A;  1UWB A;  1QQC A;  2HB5 A;  3NBP A;  5JLF A;  4PKG A;  2D0P A;  3QFU A;  1N5Y A;  2WOM A;  4MLE A;  2IVN A;  3SUO A;  1SL2 A;  3PO5 A;  2P9I B;  3SI6 A;  4XH1 A;  1MWK A;  3MN6 A;  4CD1 A;  1L3V A;  2AJQ A;  4CEC A;  3KTQ A;  1S72 N;  3UE5 A;  1RBR A;  3QIN A;  3KLF A;  4AQY K;  1QS4 A;  3K57 A;  3QEP A;  3DLB A;  3O1B A;  5LL6 Z;  3C6T A;  3JSM A;  3O8M A;  3NH2 A;  3VQD A;  4B9Q A;  3CJB A;  1NJI O;  4IDH A;  1E4G T;  1NK0 A;  3NH1 A;  2ASO A;  4MDA A;  2HBM A;  4FWR A;  4BR9 A;  1Q7Y O;  1BA1 A;  4W5N A;  2WUS A;  4PQU A;  1R59 O;  3PLA A;  2HVH A;  5F1X A;  3HOT A;  5M1P A;  3HTV A;  1S3X A;  3I56 N;  5C2F A;  4N47 A;  3VEY A;  4IZ9 A;  4A62 A;  1U04 A;  1BA0 A;  2WC9 A;  4JHD B;  3EKU A;  1YTU A;  1Q18 A;  1YAG A;  5AFU H;  5BRE A;  4FJN A;  2E1Y A;  3MXJ A;  3EYZ A;  3ATV A;  2LSN A;  4GKJ K;  3O4N A;  1TUU A;  2FXU A;  4CEA A;  4OVL A;  1W2B M;  2NRR A;  3AVC A;  2I7N A;  2P9N B;  5C12 A;  2P5O A;  1UAX A;  2HHX A;  4EP4 A;  3AVF A;  4CGH A;  4RCH A;  3R6M A;  3C7N A;  5TKW A;  3SQ2 A;  5HP1 A;  4DU1 A;  3LM9 A;  4FSV A;  4CJ5 A;  5BPM A;  4B9U A;  1NGC A;  5C2D A;  2NRV A;  3NMU A;  2D0O A;  4JKG B;  5B8H A;  4AIL C;  3OYC A;  1Y97 A;  1E4F T;  1NMN A;  4NB4 A;  1XC9 A;  1KAZ A;  4BR7 A;  4TSX A;  4G9Z A;  3OYN A;  1U6Z A;  4M63 C;  2O8D A;  2YKN A;  3K0S A;  1X9J A;  1S1V A;  1A5W A;  3CG7 A;  1QSY A;  3QFP A;  4B9S A;  1E3M A;  4KHN A;  3AAQ A;  3HPO A;  2CH6 A;  4BRE A;  3IFR A;  4PKH A;  1I3A A;  4J2D A;  3VF4 A;  1NU0 A;  3O9S A;  1S1X A;  4Y0W A;  4A5A A;  4DR1 K;  5AZI B;  4W5O A;  5GAG P;  2Z1H A;  1H1V A;  5BPL A;  4AHC A;  4H0T B;  4B1W B;  1GLJ O;  3SQ4 A;  4CZF A;  1GLL O;  4M3Y A;  3NGY A;  1BU6 O;  1VSI A;  3LDO A;  4LF5 K;  4EP5 A;  4Y1D A;  3CJA A;  2YHB A;  5FLX O;  2KZZ A;  2HMP A;  4CE9 A;  4DTO A;  3LAK A;  1C1A A;  4GVE A;  5AQG A;  1F21 A;  5CHI A;  2PYL A;  3AVB A;  3E01 A;  3MEE A;  5TKY A;  4O44 A;  2XRI A;  3OBY A;  3LL3 A;  3QNO A;  3CCQ N;  1J9A A;  2B6A A;  2DFH A;  3O08 A;  3JYT A;  3J7Z O;  2KLA A;  3VEO A;  2I7P A;  1JL2 A;  2FLO A;  1DTQ A;  2G8V A;  4CBU A;  2KFN A;  4DR2 K;  3VGL A;  3QEV A;  3CFO A;  4JLH A;  2Q36 A;  1NGE A;  1XHZ A;  2RKI A;  4QOZ B;  4HTU A;  4C1N I;  4LC9 B;  4F9O A;  2QA4 N;  3AVN A;  4AF1 A;  3D6R A;  4IFY A;  4JKD A;  1IG8 A;  3KK1 A;  5C0Y A;  3RMC A;  4FJ7 A;  4KPY A;  4GMJ B;  2B4J A;  1NG9 A;  1CZ9 A;  4H5T A;  4B9L A;  4DV0 K;  5K14 A;  1JLA A;  5AJ3 K;  1WUA A;  3WEE A;  4FYD A;  2NNW A;  1NJX A;  4CD3 A;  3O9R A;  1W0H A;  3HI0 A;  1RBV A;  5DM7 L;  3O9T A;  1HRH A;  4FLU A;  4JD2 A;  5HOO A;  2GBZ A;  3OYK A;  5I3U A;  4YOR A;  4BRM A;  1EKE A;  4EZ9 A;  4HCB A;  3MMV A;  2A41 A;  4FLW A;  4B3M K;  4EFH A;  1T3V A;  3WQU A;  3AVI A;  1NGJ A;  3LAL A;  5SZT A;  3D2F B;  3O3F A;  3J80 O;  2R7Y A;  3RR7 A;  2OPQ A;  3M1F A;  3C7N B;  5KRS A;  4H0V B;  4F3T A;  2YJF A;  4Z4I A;  1K73 O;  4B1U B;  1DTT A;  2D4W A;  4E89 A;  3AA3 A;  4CF1 A;  1HJR A;  4GW6 A;  2ZF5 O;  4IEI A;  4CFD A;  3K5L A;  2YHY A;  4OGC A;  4B9M A;  4JI8 K;  1X9M A;  4BRI A;  4BQL A;  2VYP A;  3RVC A;  2F96 A;  3QIC A;  3DLH A;  2P9S B;  2Z1I A;  4J8F A;  2F8T A;  1HPM A;  4E7L A;  2RPI A;  4ILJ A;  1LW0 A;  1C6V A;  4Q0B A;  2A40 A;  1QVG M;  3CF5 L;  2A5X A;  5FRN A;  2RHK A;  3R8E A;  1TGO A;  4BGB A;  3WNH A;  1SKS A;  1RIL A;  2D0C A;  3VQP A;  4BC4 A;  1GLC G;  3AVM A;  1VSJ A;  1YTA A;  2G8H A;  4FVM A;  1YJN N;  1HUX A;  4CW7 B;  3Q7C A;  2D1K A;  2NRZ A;  1UA0 A;  4H5W A;  4CEZ A;  2X74 A;  3U9D A;  3OJS A;  2G8W A;  4MQ3 A;  4BE2 A;  5E84 A;  1JCE A;  1CLQ A;  4WQ5 C;  4JKF A;  3CQY A;  3VQE A;  3QO9 A;  1IKV A;  5HRN A;  1NGB A;  3ZSZ A;  1SKW A;  4JI2 K;  2G8I A;  2IAJ A;  2QKB A;  3CMA N;  1BHL A;  2WTU A;  3HXM A;  4DTX A;  3MXM A;  1RBU A;  2E1Z A;  4KH4 A;  4FO0 A;  1B9F A;  4DV1 K;  5AQU A;  3I8D A;  1YIT N;  4XIU A;  4U7B A;  3TAQ A;  4ZHR A;  4DF8 A;  4WF9 L;  3TAF A;  4BR2 A;  1K8K A;  2YNI A;  4I2P A;  3WNF A;  1YI2 N;  3LDP A;  3V1Q A;  1S5J A;  3VER A;  4FJL A;  3C95 A;  5BR9 A;  4CEQ A;  1NM1 A;  4Z94 A;  4BGA A;  3M8S A;  3VQ6 A;  5GIP A;  2JLE A;  4I6M A;  1CZA N;  2VG7 A;  3NF6 A;  2CGJ A;  3EO3 A;  3TTC A;  1ZC6 A;  4CJU A;  4OPH A;  5DK5 A;  4U67 L;  1W7A A;  2IVP A;  4CGG A;  2KZM A;  1HQE A;  4NYF A;  2HHV A;  2IOC A;  4ELU A;  3ULD A;  4BRA A;  4CGI A;  4JRQ A;  4FLY A;  1U47 A;  3NVM A;  4B1Z A;  4O8K A;  3AO5 A;  2E2O A;  1VSL A;  3SBT A;  3KIO A;  2HST A;  3BY5 A;  1YF5 L;  2YHX A;  4IG0 A;  3NE6 A;  1IKW A;  3AVG A;  5C10 A;  1EXQ A;  3SCX A;  4AHR A;  5KGX A;  1I39 A;  3E9L A;  4BRO A;  3CQX A;  4DTR A;  3G10 A;  2ZD1 A;  3IS9 A;  3NF8 A;  1ZXO A;  3E9O A;  5AZJ A;  3RRH A;  1VSF A;  3K9K A;  5EX5 A;  4GKK K;  4YHH K;  3ZT3 A;  3H1V X;  1ZBL A;  3C6A A;  4WQ4 C;  4CJT A;  1IJJ A;  2PFU A;  1BCM A;  4CHQ A;  4KAZ A;  1BCO A;  4DWI A;  3M8P A;  1U2V A;  4M3T A;  5C25 A;  3B6P A;  4BG8 A;  4CF2 A;  4WFN L;  3OS0 A;  1NKC A;  4A2B A;  2FC0 A;  1VQ7 N;  3S3N A;  1BIZ A;  1JXE A;  3IMX A;  4OJR A;  4MO5 A;  3DRP A;  1WN7 A;  1Z05 A;  4KTZ A;  3P31 A;  3HPG A;  3AY9 A;  1U48 A;  3VQ8 A;  2DY4 A;  4LH5 A;  4CJF A;  3FR0 A;  3V9Z A;  1TYQ A;  1IKX A;  3V1O A;  1Q9Y A;  4CF9 A;  3HL8 A;  3U6F A;  2ZJR L;  3SUN A;  2O4G A;  2IVO A;  2BGG A;  4O0J A;  3ITH A;  3KWG A;  3L2Q A;  2CH5 A;  2ZGY A;  2GWK A;  1MDU B;  3TAB A;  4FK2 A;  4FPA A;  1NK5 A;  2UXC K;  3J8A A;  2QWN A;  2DFF A;  3MN5 A;  3K5O A;  3NHG A;  4IBN A;  3AAR A;  2P51 A;  3HOS A;  4DSJ A;  1RDB A;  3K5M A;  3VEW A;  4UY8 O;  4F2S A;  1FXX A;  2OPP A;  3AGR A;  3QEX A;  2OA8 A;  1HPZ A;  3CC4 N;  4Z4E A;  1JLB A;  3CD6 N;  2HBK A;  3M6G A;  3OYB A;  3KJV A;  2IS3 A;  3W0L A;  1SKR A;  2V51 B;  1W9H A;  4OX9 K;  1LOT B;  3BP8 A;  4JN4 A;  3VPZ A;  3NDK A;  1G99 A;  4B9V A;  4DR7 K;  5C24 A;  3UB5 A;  4FJX A;  3TU5 A;  2OZM A;  1WBD A;  3VF2 A;  1O1W A;  1YJW N;  4LF8 K;  2HVI A;  4FZX C;  1C0G A;  1WSG A;  4ILG B;  3UKR A;  3H08 A;  3QBX A;  3KD1 E;  1VRU A;  1JJ2 M;  1IV0 A;  4K0K K;  3AO4 A;  4FOI A;  3TR8 A;  3SJJ A;  4OKK A;  3VTI A;  3OBW A;  4RW9 A;  3UKU A;  3OYH A;  4KRE A;  3ZSW A;  3DMJ A; 
#chains in the Genus database with same CATH homology
 3HPO A;  1QTM A;  3KLI A;  2HMI A;  5HBM A;  1Q9X A;  2QXF A;  4B08 A;  4DTS A;  1NKB A;  1I3A A;  3PV8 A;  4J2D A;  4FLX A;  3AVK A;  3HPH A;  4CJP A;  3K58 A;  1S1X A;  3NGZ A;  2XO7 A;  1VRT A;  1G15 A;  3VQ5 A;  2HHW A;  1TAU A;  4NCA A;  2X6S A;  4CK3 A;  3QER A;  2D0B A;  4FJH A;  4W5Q A;  4W5O A;  4UQG A;  3V1R A;  4DSF A;  2Z1H A;  1X9W A;  4CHO A;  4AHC A;  4DTM A;  1SL1 A;  4OLB A;  4E7I A;  3BGR A;  3RWU A;  3DRR A;  3SQ4 A;  3D45 A;  3DI6 A;  1S1T A;  4CJ3 A;  4M3Y A;  3NGY A;  3C94 A;  3VQC A;  1JLG A;  3TAN A;  1VSI A;  1RT2 A;  4CIF A;  4E7K A;  1RDC A;  4DTU A;  1Q8I A;  4Y1D A;  4EP5 A;  1KTQ A;  2YHB A;  5J2P A;  3HO1 A;  4CFB A;  2HHS A;  1JLF A;  3PX4 A;  5FRO A;  1KFS A;  5CZ1 A;  1D5A A;  1HQU A;  1S6Q A;  1ZBU A;  1Z26 A;  5C42 A;  2KZZ A;  1VK0 A;  4CE9 A;  4DLE A;  4HUF A;  2FBX A;  4DTO A;  1TKZ A;  3LAK A;  1C1A A;  2Z1G A;  4CK2 A;  4DSE A;  5KRT A;  1F21 A;  1T8E A;  2PYL A;  4KHY A;  3HK2 A;  3AVB A;  3DLR A;  2KTQ A;  3E01 A;  3MEE A;  4BWJ A;  3BDP A;  1JLE A;  4O44 A;  1C0M A;  1HNI A;  1LAV A;  2XRI A;  4F2R A;  4MFB A;  1RDD A;  4FJM A;  3QNO A;  2FBY A;  4N5S A;  1J9A A;  2B6A A;  2DFH A;  3ZT0 A;  2F8S A;  4KKO A;  1RT5 A;  3HP9 A;  3T1A A;  3ZT2 A;  3JYT A;  3DOL A;  4CGD A;  2DTU A;  1EET A;  3L3U A;  3MXI A;  1B9D A;  4DSI A;  4H4O A;  1BQN A;  1TL3 A;  4DFJ A;  1JL2 A;  1L3S A;  1DTQ A;  4OLA A;  1WAF A;  4I7F A;  1T05 A;  2D0A A;  1IKY A;  5SWM A;  3V81 A;  4FJ8 A;  1C0U A;  4CGF A;  4DU3 A;  1SUQ A;  3TAG A;  3FFI A;  2G8V A;  2KFN A;  1R0A A;  3HST B;  4ICL A;  1C0T A;  5CYM A;  3QEV A;  1U4B A;  1NJY A;  3IAY A;  4Z4G A;  1TV6 A;  3CFO A;  3K2P A;  4JLH A;  2IDO A;  3QNN A;  3TAP A;  3AO1 A;  1NKE A;  4KHQ A;  1EX4 A;  2KQ2 A;  5E41 A;  3OYA A;  1XHZ A;  4DSK A;  2HHQ A;  3OJU A;  2RKI A;  3I0S A;  4E7J A;  3PO4 A;  4QOZ B;  1WNS A;  4HTU A;  2JGU A;  1LWF A;  3CM5 A;  2XY7 A;  3I0R A;  4KV8 A;  1RTH A;  3D0P A;  4PY5 A;  4LD0 A;  3AVN A;  5J2Q A;  1KSP A;  3HJF A;  1GOB A;  4WE1 A;  2VWJ A;  2X6N A;  4CJR A;  4CF0 A;  1NK8 A;  4FLT A;  4FJJ A;  3SPY A;  2HW3 A;  3ZSR A;  1X1P A;  4IFY A;  2E6L A;  2KW4 A;  2YKM A;  3KK1 A;  4DS5 A;  4KFB A;  3RMC A;  4FJ7 A;  1KCF A;  4KPY A;  3LZI A;  3KLE A;  2A1S A;  5I42 A;  4GMJ B;  1JL1 A;  2B4J A;  4ID5 A;  1CZ9 A;  4CIG A;  1GOA A;  4AHS A;  4FCY A;  2ZE2 A;  4ZTF A;  2W42 A;  4B9L A;  4M3U A;  2XHB A;  1BGX T;  5K14 A;  1JLA A;  4DTN A;  3B6O A;  3LWM A;  4KHS A;  1WSI A;  3DLE A;  4DQI A;  1D8Y A;  4CF8 A;  4JS5 A;  1ASV A;  1RTJ A;  3V9S A;  4FJG A;  4CJL A;  2YNG A;  2DFE A;  2XY8 A;  1L5U A;  3RTV A;  4NCG A;  4DFK A;  4ELT A;  4FYD A;  3QLH A;  5HRS A;  4OPJ A;  2I5J A;  3RMB A;  2G8K A;  4FM2 A;  1NJX A;  5FRM A;  1ZBH A;  2QK9 A;  1W0H A;  4PA1 A;  2A1R A;  3KD5 E;  1VSK A;  4CJW A;  4FZY A;  1RBV A;  2YV0 X;  3LP0 A;  4B8C A;  1HRH A;  2QKK A;  4FLU A;  1FK9 A;  1N6Q A;  2E6M A;  4IFV A;  2GBZ A;  3OYK A;  5I3U A;  3KLG A;  1TVR A;  1EKE A;  3NFA A;  4CJE A;  1ZBI A;  4RW7 A;  4EZ9 A;  3SYZ A;  4HCB A;  3NAE A;  4KI4 A;  4DU4 A;  4F8R A;  4BAC A;  2IGI A;  4FLW A;  4OPK A;  5J2M A;  1FKO A;  1S9G A;  3WNE A;  3AVI A;  3ZSV A;  4AHT A;  4CHZ A;  4FXD A;  3AVA A;  4HHT A;  3ZSO A;  3LAL A;  1LAW A;  4DSL A;  5SZT A;  1NK9 A;  4C8N A;  3AA2 A;  5HRR A;  4DQQ A;  3O3F A;  2R7Y A;  3HM9 A;  1VSD A;  1T7P A;  3RR7 A;  4IKF A;  2OPQ A;  3NCI A;  4KB0 A;  1ITG A;  3DM2 A;  3EZ5 A;  5KRS A;  1BI4 B;  1HMV A;  2IC3 A;  3T3F A;  2GV9 A;  1FKP A;  4F3T A;  3KKS A;  2FBT A;  4J2E A;  4Z4I A;  4LSL A;  3L2V A;  4L8R B;  4CHN A;  4KO0 A;  1DTT A;  5KTQ A;  3WNG A;  2OZS A;  3ALY A;  3AA3 A;  5CY4 A;  1K6Y A;  5CYQ A;  1RT4 A;  4CF1 A;  4DMN A;  4E89 A;  1HJR A;  3AA4 A;  1LWC A;  2D5R A;  2HHU A;  4GW6 A;  4CFC A;  3TI0 A;  3TWH A;  3P83 D;  4CFD A;  4RG8 A;  4JS4 A;  3RR8 A;  3K5L A;  4OGC A;  4B9M A;  2P5G A;  2BAN A;  4CHP A;  1X9M A;  3VQQ A;  2Y1J A;  1L3T A;  1IH7 A;  4B9N A;  3DRS A;  4CER A;  2BE2 A;  3VA3 A;  1J54 A;  4ZTJ A;  4B3O A;  4LSN A;  1ZBF A;  1BIU A;  5EU7 A;  3LDS A;  4N41 A;  3LP3 A;  2F96 A;  3QIO A;  2Y1I A;  4FZZ A;  5JS2 A;  4M3R A;  4GVM A;  4CK1 A;  3U3G A;  4B9T A;  3V4I A;  3ZSX A;  1WSH A;  3DLH A;  3ASM A;  3G0Z A;  4HUG A;  4Z4F A;  2Z1I A;  1NOZ A;  1UOC A;  1VSM A;  4EZ6 A;  5CZ2 A;  3ZT4 A;  2F8T A;  4E7L A;  2RPI A;  4K8X A;  1HYS A;  4DTJ A;  1LW0 A;  5J2N A;  4FK4 A;  1S1U A;  4PUO A;  1C6V A;  3AA5 X;  3HT3 A;  1LW2 A;  4Q0B A;  1Z25 A;  4DFM A;  4CJS A;  2OPS A;  1KRP A;  5FRN A;  4KI6 A;  1TGO A;  2YNF A;  4C8L A;  1LWE A;  3WNH A;  4O0I A;  3AVH A;  1RIL A;  4IDK A;  2D0C A;  1SKS A;  3PY8 A;  3MEC A;  1T03 A;  3VQP A;  4HVJ A;  4CJ4 A;  3AVM A;  3LAN A;  3VQ9 A;  1VSJ A;  3TAR A;  4DQR A;  1YTA A;  3P1G A;  2G8H A;  4FVM A;  3S3M A;  3QEW A;  1C1B A;  2VWK A;  2VG5 A;  3SNN A;  4H4M A;  1UA0 A;  3OS1 A;  4CEZ A;  1VSE A;  2X74 A;  4C8M A;  1TKT A;  3OJS A;  2G8W A;  4MQ3 A;  4BE2 A;  1CLQ A;  5D3G A;  2Z1J A;  2XY5 A;  3ZSY A;  1CXQ A;  1KVB A;  1RNH A;  3VQE A;  3THV A;  3QO9 A;  1IKV A;  5HRN A;  3ZSZ A;  1SKW A;  3VQ7 A;  1XI1 A;  1TKD A;  3O3G A;  1NK6 A;  4CEB A;  1S1W A;  2RN2 A;  3KK3 A;  4HCC A;  1WAJ A;  3IG1 A;  2G8I A;  2IAJ A;  4G1Q A;  3PX6 A;  4NCB A;  1RDA A;  1JKH A;  4FM0 A;  2QKB A;  3TAM A;  1BHL A;  3V9X A;  3AV9 A;  4I9L A;  2PZS A;  2FBV A;  4AHV A;  3C6U A;  3OYI A;  3HXM A;  4DTX A;  1ZYQ A;  3MXM A;  1J5O A;  2G8F A;  1RBU A;  4W5R A;  3S9H A;  4Z4H A;  3ZCM A;  1WSF A;  1B9F A;  4E19 A;  1RBT A;  5KI6 A;  3OY9 A;  3ZSQ A;  3SUP A;  1A5X A;  4KTW A;  4B8A B;  3QEI A;  4F3O A;  3I8D A;  3V9U A;  3LAM A;  3OVN A;  4XIU A;  3LWL A;  1JLQ A;  4DLG A;  1XHX A;  3TAE A;  2P1J A;  4PWD A;  4ID1 A;  3TAQ A;  4KTQ A;  4ZHR A;  4DF8 A;  3F73 A;  2YNH A;  4FW2 A;  1YT3 A;  3TAF A;  2ATQ A;  3OYE A;  4N76 A;  3M8Q A;  4YNQ A;  2YNI A;  2EX3 A;  4I2P A;  1KVC A;  3WNF A;  3OYG A;  3V1Q A;  4M41 A;  1KLM A;  3OYM A;  1GOC A;  1S5J A;  4FJL A;  2X78 A;  3CFP A;  1ASW A;  3C95 A;  4CFA A;  4CJQ A;  1WSE A;  3PUF A;  4RW6 A;  4CEQ A;  4BE0 A;  3RMD A;  4FK0 A;  4C8O A;  4BE1 A;  3M8S A;  3VQ6 A;  3MED A;  2JLE A;  2VG7 A;  2HND A;  3NF6 A;  3K5N A;  3L8B A;  1BI4 A;  1TKX A;  1JLC A;  4O4G A;  3SQ1 A;  4M42 A;  1CZB A;  4FM1 A;  3CM6 A;  3LPU A;  4FJK A;  4CJU A;  5DK5 A;  4LH4 A;  3SQ0 A;  1TK8 A;  4DQS A;  2OYQ A;  4LY7 A;  3SUQ A;  4M3Z A;  3EY1 A;  3V6D A;  3OYJ A;  4BWM A;  4CEO A;  2ITG A;  3HYF A;  4KHU A;  1C1C A;  4CGG A;  2HHT A;  2KZM A;  1HQE A;  4NYF A;  4OKJ A;  2HHV A;  2IOC A;  4Z0U A;  1RT6 A;  4ELU A;  3SPZ A;  3ULD A;  5JS1 A;  4CGI A;  1B92 A;  4RW8 A;  4JRQ A;  4FLY A;  1U47 A;  3CQ8 A;  1HNV A;  4DG1 A;  1TK0 A;  3AO5 A;  1LV5 A;  1ASU A;  3SZ2 A;  1VSL A;  3DYA A;  5J1E A;  3KIO A;  1IG9 A;  3OYF A;  4DQP A;  3OYD A;  3MAQ A;  1TK5 A;  4IG0 A;  1VSH A;  3NH0 A;  3NE6 A;  4CIE A;  1IKW A;  2OPR A;  2PYJ A;  3RRG A;  1WSJ A;  3AVG A;  4NYN A;  4CCH A;  3DLK A;  1EXQ A;  2EHG A;  3L3V A;  3SCX A;  4FW1 A;  4AHR A;  2ZQB A;  2WON A;  5KGX A;  1I39 A;  1QE1 A;  1S6P A;  5T7B A;  3VQ4 A;  3M8R A;  3OS2 A;  4DTR A;  4KB1 A;  4J2B A;  3IRX A;  3VA0 A;  4RW4 A;  4I9Q A;  4OKE A;  3G10 A;  2ZD1 A;  3IS9 A;  3NF8 A;  4CEE A;  4QAG A;  2B5J A;  3CFR A;  3LZJ A;  3RRH A;  1X9S A;  4F4K A;  1BL3 A;  1VSF A;  3ISN C;  4CJK A;  3DOK A;  1KFD A;  5HRO A;  4J2A A;  3L2W A;  1U45 A;  2VG6 A;  1UA1 A;  3ZT3 A;  3S3O A;  3HVR A;  4JRP A;  4Q5V A;  1ZBL A;  1TL1 A;  3HVT A;  5HRP A;  4AH9 A;  3O4Q A;  3QES A;  3DLG A;  2KFZ A;  4CJT A;  4CED A;  1RTD A;  1BCM A;  1YVU A;  4CHQ A;  4KAZ A;  1BCO A;  4KHW A;  3VQA A;  3M8P A;  4DWI A;  3P5J A;  1UWB A;  5FDL A;  4M3T A;  1QQC A;  3MEG A;  5C25 A;  3B6P A;  2HB5 A;  1MU2 A;  3NBP A;  4OGE A;  4E7H A;  4CF2 A;  3OS0 A;  1NJW A;  4E1M A;  1N5Y A;  2WOM A;  2XY6 A;  3SUO A;  1NKC A;  1QSS A;  1WLJ A;  1SL2 A;  4FLV A;  3PO5 A;  1CXU A;  2FC0 A;  4BDP A;  3PX0 A;  3S3N A;  4H8K A;  1BIZ A;  1JXE A;  3SI6 A;  4ELV A;  4W5T A;  1L3V A;  2AJQ A;  4OJR A;  4BDZ A;  4CEC A;  3AVJ A;  3KTQ A;  4O5B A;  3DRP A;  1WN7 A;  4CEF A;  5HLF A;  4KTZ A;  2RF2 A;  2Q3S A;  1RBR A;  3QIN A;  3HPG A;  3KLF A;  1QS4 A;  3K57 A;  1J53 A;  3NGI A;  3QEP A;  1U48 A;  3KLH A;  4KRF A;  3VQ8 A;  1RBS A;  2DY4 A;  3C6T A;  3CYM A;  4LH5 A;  4CJF A;  1HYZ A;  3JSM A;  2NUB A;  3NH2 A;  1IKX A;  3V1O A;  3V9Z A;  1Q9Y A;  4CF9 A;  3VQD A;  4DFP A;  3F9K A;  3HL8 A;  3U6F A;  3VQB A;  4CES A;  1NK0 A;  3NH1 A;  4DS4 A;  4CJV A;  4QCL A;  4Y1C A;  2O4G A;  4R5P A;  3SUN A;  4N56 A;  2BGG A;  4K8Z A;  3QIP A;  4O0J A;  3ZT1 A;  4E0D A;  3ITH A;  3NF9 A;  3T19 A;  4IG3 A;  1RTI A;  3L2Q A;  1KLN A;  4W5N A;  1D9D A;  4PQU A;  2ETJ A;  4M45 A;  1NK7 A;  3KK2 A;  3TAB A;  4FK2 A;  3LP1 A;  1U49 A;  2HVH A;  1A5V A;  1HYV A;  1NK5 A;  3KKR A;  3VN5 A;  3OYL A;  3L2U A;  3SV4 A;  3DLB A;  2DFF A;  4N47 A;  1NJZ A;  4M3X A;  2BDP A;  3K5O A;  3NHG A;  1U04 A;  4IBN A;  1DLO A;  2P51 A;  3QET A;  1YTU A;  3U3Y A;  4DSJ A;  1RDB A;  3K5M A;  3LPT A;  4FJN A;  4FJI A;  4F2S A;  1FXX A;  4BDY A;  2OPP A;  4FJ5 A;  3QEX A;  2OA8 A;  1HPZ A;  4Z4E A;  3MXJ A;  1RT3 A;  3EYZ A;  3SV3 A;  1JLB A;  1BIS A;  2LSN A;  3O4N A;  2HNY A;  4E3S A;  1L3U A;  1S9E A;  1IO2 A;  1D9F A;  3L2R A;  4CEA A;  4HUE A;  4OVL A;  2YHA A;  3OYB A;  3HP6 A;  3KJV A;  3AVC A;  3NF7 A;  2P5O A;  1RT7 A;  2IS3 A;  5KGW A;  1UAX A;  1SKR A;  3K59 A;  2HHX A;  1W9H A;  4EP4 A;  3AVF A;  4CGH A;  4C8K A;  4M3W A;  1XWL A;  3AO3 A;  1RT1 A;  1REV A;  3NDK A;  3SQ2 A;  5HP1 A;  4B9V A;  1NK4 A;  1KVA A;  3AVL A;  3LP2 A;  5C24 A;  4DU1 A;  4DF4 A;  3AO2 A;  4CJ5 A;  4B9U A;  3A2F A;  4FJX A;  4CGJ A;  1EP4 A;  2OZM A;  4AHU A;  4CHY A;  1O1W A;  2PY5 A;  2HVI A;  4FZX C;  2O4I A;  4YFU A;  1WSG A;  4AIL C;  1TAQ A;  4Z4C A;  3OYC A;  1QHT A;  2GUI A;  4I2Q A;  2E4L A;  1Y97 A;  4DTP A;  1RCH A;  1QSL A;  4FLZ A;  1XC9 A;  3O3H A;  3H08 A;  4TSX A;  4FJ9 A;  2HNZ A;  3OYN A;  1VRU A;  1SV5 A;  3KD1 E;  3AO4 A;  1NOY A;  2G8U A;  3TR8 A;  3SJJ A;  4OKK A;  3V9W A;  2YKN A;  3RMA A;  1SL0 A;  1BQM A;  1S1V A;  5DMR A;  4E1N A;  1A5W A;  3CG7 A;  1QSY A;  3UIQ A;  4RW9 A;  3OYH A;  4B9S A;  1JXB A;  4KRE A;  4O55 A;  3ZSW A;  4KHN A;  3DMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...