4OPKA

Bh-rnaseh:2'-sme-dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
133
structure length
133
Chain Sequence
b'EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
molecule tags Hydrolase/dna
source organism Bacillus halodurans
publication title Generating Crystallographic Models of DNA Dodecamers from Structures of RNase H:DNA Complexes.
pubmed doi rcsb
total genus 38
structure length 133
sequence length 133
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2014-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4opkA00
4C8OA 1T03A 1EXQA 3DI6A 2HB5A 5FRMA 4DTUA 4J2DA 4B3OA 2DFHA 3QO9A 4PY5A 4KB0A 3DLEA 4F3TA 1VSKA 1Y97A 4OPJA 3DOLA 4ZTFA 3ZT4A 1VSHA 3QNNA 4KB1A 1QTMA 2Z1IA 5CY4A 2EHGA 3DRRA 1IKXA 4CJLA 1QE1A 4CGDA 4B9SA 1X9WA 4ELUA 1L3SA 4E7HA 2D0AA 4KREA 1YT3A 4KHWA 2VG7A 5C25A 4CHQA 1J54A 3SCXA 3NF9A 4O5BA 1BQMA 1ITGA 3ZSOA 4CEBA 3LZJA 2G8KA 4E0DA 4HCBA 4BWJA 4DTNA 1FKPA 4K8XA 3C95A 3DYAA 4YNQA 4FCYA 3U3GA 3AVBA 3OYEA 4FLUA 1S1XA 3DLHA 1SUQA 4B9NA 4J2AA 3QINA 1BIUA 3DRPA 2PYLA 4DSKA 4RW6A 4IFVA 1HQUA 3LDSA 4Z4HA 1HJRA 3BGRA 4C8NA 4W5NA 1VSLA 4IG3A 3VQ7A 1I3AA 2IC3A 4Z4EA 2HNDA 3CM5A 3JYTA 1LW0A 3VA3A 3NH0A 1NJYA 3LP3A 2B5JA 3K2PA 3ZSZA 1C1AA 4GMJB 3OYHA 1NKEA 4EZ6A 3NDKA 3G0ZA 1BL3A 4FW1A 3EZ5A 5C24A 3D0PA 4JS4A 3ZCMA 4J2EA 2KZZA 3MEGA 1RDCA 3QESA 4E7JA 1KVCA 3L2QA 3PUFA 3L2WA 3AV9A 3ZSRA 4CHNA 5J2QA 5DMRA 1CLQA 4FLTA 4BE0A 1WSHA 2FBVA 2GBZA 1JLBA 2ETJA 3LPUA 3P1GA 4KHYA 3VQ4A 2D5RA 3ZT1A 2XY7A 4LSLA 1ZBUA 3SV3A 1U49A 1REVA 3AA5X 4GVMA 1RDAA 3V9ZA 1O1WA 1S1VA 3SPZA 1BCOA 3QETA 3UIQA 4KO0A 1C1BA 1TK5A 1L3TA 3AO2A 4E19A 1J9AA 3PX6A 1NK0A 4FZXC 2EX3A 1T8EA 4H4OA 3HJFA 4OGCA 3VQBA 1CZ9A 1UA1A 2YNGA 1KFSA 4LH5A 1XHZA 3LAMA 1EX4A 1U48A 4QOZB 3K58A 4OJRA 4RW4A 1VSFA 3RMCA 1TV6A 5KRTA 2G8FA 1RT6A 2QK9A 1GOAA 2HVHA 1MU2A 4Y1CA 3SZ2A 3L2UA 4DFPA 4E1MA 1TVRA 3PV8A 4CF8A 3TAMA 2G8IA 4AILC 2YKNA 1SKRA 2P51A 4AHTA 4O55A 4M3UA 1JL2A 4CIFA 1HPZA 1YTUA 4CHYA 2ZE2A 1TAUA 1IKYA 3DMJA 1NJZA 2E6LA 1EP4A 2OPSA 4M3RA 3WNHA 4CJ4A 3JSMA 3M8PA 4DF8A 3C6TA 3QERA 3AO4A 2PYJA 4FJLA 1RBRA 1HYZA 3SV4A 1KVBA 1WSIA 4DTOA 1RT7A 5T7BA 4E7IA 2BGGA 3HL8A 3WNEA 1SL1A 3LPTA 1VSIA 1ZBFA 1BISA 1NK5A 3H08A 3OYFA 3TR8A 1I39A 3LANA 1RTIA 1Q9YA 4CGJA 2B6AA 3OYLA 4KI6A 3MXMA 4CJQA 1RBSA 3VN5A 4M3YA 4FJHA 2FBXA 5CYMA 1NK8A 4HUEA 3C94A 4Q5VA 4KI4A 1NOYA 5J2NA 1QS4A 1QSYA 3KKRA 1JLQA 4O4GA 4CESA 3VA0A 1UAXA 3OYDA 4N41A 3CFOA 2KW4A 4MFBA 4CJWA 2Y1JA 3AA4A 1IKWA 2RPIA 3LAKA 4M41A 4KRFA 2Y1IA 3ZSVA 4CF1A 4N5SA 4IG0A 1HYVA 4KHUA 3DRSA 4CCHA 2A1SA 1C0TA 3F73A 3SNNA 4CERA 4LH4A 4FJXA 4CF2A 4FLVA 3CFPA 2BDPA 1LAWA 4N47A 3TWHA 3KK3A 3EY1A 1CXUA 2Z1GA 1SKSA 2HNZA 1IKVA 3AVMA 4DMNA 2GUIA 2YNFA 2YHAA 3AVKA 1HMVA 4I2QA 4FJGA 2IOCA 3KLGA 4WE1A 4HVJA 3O3HA 1VSEA 4IDKA 2X74A 4W5RA 4C8LA 4CHZA 2YNHA 4B9MA 1Q8IA 3OY9A 4E7KA 1RT5A 4JLHA 4DLEA 3S3OA 1JXBA 3B6OA 4CEOA 4HHTA 3VQ9A 4AHVA 1T05A 4NCGA 4DTMA 4FXDA 1VSMA 1EETA 2X78A 3IS9A 4CEEA 3HYFA 3AVHA 3TAEA 3PX0A 1HRHA 5SZTA 1UA0A 4HUFA 4CGHA 2YNIA 4K8ZA 4ELTA 1JLGA 3DLBA 2HHQA 1RTHA 1SV5A 4NCBA 3NFAA 4CK3A 1K6YA 3TABA 1A5WA 2NUBA 4CJSA 5HP1A 1DTQA 3VQ6A 1RBVA 3U6FA 3HSTB 1NKCA 3LWLA 4E3SA 4FJJA 1NK9A 1BCMA 1ASVA 2DFEA 4LY7A 4MQ3A 2ITGA 1C0UA 4B9VA 1R0AA 4FJIA 1JXEA 1YTAA 1KCFA 1Z26A 3B6PA 1S6QA 1D9FA 3QEVA 4C8MA 4EZ9A 4OKKA 1D5AA 4DTRA 4DQPA 4ICLA 1JL1A 3OVNA 3HP6A 5EU7A 2VG5A 4CF9A 3NH1A 4DQQA 4DSEA 1TL3A 4AH9A 4M3WA 4ID5A 2OPQA 1C1CA 1TGOA 4W5OA 5J2MA 1WSGA 1S1UA 3KKSA 4FYDA 3HO1A 2IS3A 1WSFA 1WAJA 4CGGA 4FJ7A 4FK4A 4O44A 1SKWA 2ZQBA 3KIOA 1S1TA 4TSXA 4AHCA 3IAYA 1F21A 4BACA 4OLAA 3VQ8A 5HRSA 2ZD1A 1RDDA 3TAFA 1QQCA 2JLEA 4JS5A 3TAQA 2KFNA 3WNGA 4Y1DA 4FM2A 4AHSA 3KLFA 3THVA 1LWCA 3LP2A 3MEEA 3SI6A 3NH2A 1X9MA 3PY8A 3S3MA 1S5JA 3G10A 5C42A 3MEDA 4LD0A 3L8BA 1LW2A 1TAQA 4ZHRA 3LWMA 4KTWA 3C6UA 1RBUA 4M42A 3HVTA 4M3XA 1RNHA 5KGXA 4DG1A 4DQSA 1J5OA 3ZSYA 5HBMA 1C6VA 1KTQA 2OZMA 2OPPA 4F3OA 4KHSA 3HT3A 4DS5A 1SL0A 3VQCA 3HXMA 4M3ZA 4FJ9A 5DK5A 1TKDA 4E89A 4KPYA 1GOBA 1WAFA 3OYBA 1NK6A 5D3GA 1KVAA 3CYMA 2E4LA 4B9TA 2HW3A 1QSSA 3NGYA 3RMDA 4DQRA 3O3FA 1L3VA 4J2BA 1RT2A 1NK7A 4GW6A 1RT3A 2IAJA 4DTJA 4RW8A 3ZT3A 1JLAA 3NF7A 4CFDA 4EP4A 3L2RA 1VSJA 3K5NA 3RMBA 3SUPA 5I3UA 4IFYA 3AVGA 5SWMA 3OYMA 4DTXA 2F8SA 3VQDA 4KFBA 1XC9A 4Z4IA 1UOCA 3DLRA 1FKOA 3NGZA 3VQPA 4QAGA 2PZSA 1WSJA 1RT4A 3LALA 4CGIA 1LV5A 1XHXA 2Z1HA 2XY8A 2DFFA 3SQ2A 2LSNA 3QEIA 3K59A 4BDPA 3AO5A 3AVFA 1BGXT 1HNIA 3VQEA 2P5GA 3EYZA 3LP0A 4AHUA 4BWMA 3OYKA 3KLHA 3DOKA 5CYQA 3O3GA 1ZBHA 4QCLA 4RW7A 4NYFA 4B9UA 1RCHA 1JLFA 4CJRA 1ASUA 1C0MA 4M45A 3KD1E 4ZTJA 3V81A 4FVMA 4DLGA 2G8WA 4CK1A 1KRPA 1RDBA 4CJVA 4IKFA 2OA8A 3L3UA 4HCCA 2HHSA 2BE2A 4CF0A 4CGFA 4UQGA 2HNYA 3ZT2A 4NYNA 2A1RA 4OLBA 4DTSA 2KTQA 4CJTA 4CJUA 4RG8A 4DQIA 2W42A 1WLJA 4FZYA 1VRUA 3OYNA 5CZ1A 3RMAA 1YVUA 4XIUA 3NGIA 3AA2A 1WN7A 1RT1A 5JS1A 4DFMA 5E41A 4HUGA 4LSNA 1B92A 1HQEA 1CXQA 1TL1A 5FRNA 3ULDA 4CE9A 3HP9A 3T1AA 2R7YA 5KRSA 4W5TA 1Z25A 2GV9A 1FK9A 3K5LA 3KTQA 3SQ0A 3MECA 3PO4A 4FJ8A 4ELVA 3LP1A 4I9QA 1CZBA 1RILA 2KQ2A 4EP5A 5CZ2A 1WNSA 1S6PA 3P5JA 2O4IA 3T19A 2VWKA 4FLWA 1D9DA 1KSPA 3M8RA 4CEAA 1TK8A 5J2PA 2XO7A 1LWFA 3QEXA 4I2PA 3OYJA 3ASMA 1BQNA 3ZT0A 3NCIA 4DSIA 3DLGA 4ID1A 1XWLA 4CIEA 5FDLA 3QLHA 1W0HA 1EKEA 4AHRA 1HYSA 5HROA 4CJEA 3AA3A 1S9GA 3NBPA 3WNFA 4O0JA 4C8KA 2D0BA 3ITHA 1D8YA 4FJNA 1T7PA 1ZBIA 3A2FA 2XRIA 3I8DA 4CECA 1TKTA 1IG9A 3QIPA 3RTVA 2ATQA 2D0CA 4FM1A 1U47A 4CHPA 2G8VA 3S9HA 2WONA 3CQ8A 3M8SA 3SYZA 1U04A 2QXFA 3RR7A 2KFZA 3MAQA 2OZSA 4FK2A 2IGIA 1QHTA 1ZYQA 1BI4A 4Z4CA 4CJPA 4DWIA 3ZSXA 1KFDA 3AO1A 4F4KA 2RKIA 3M8QA 3KLIA 1L5UA 1DLOA 1RTJA 4KTQA 4CJ3A 3KK2A 4YFUA 2YKMA 2JGUA 5HRPA 3NE6A 3SQ1A 2G8HA 3SQ4A 3MXIA 4F2SA 4Q0BA 4OVLA 4FK0A 2XY6A 2OPRA 2YV0X 5KGWA 4CFAA 4HTUA 4OKEA 1ZBLA 4B8CA 2YHBA 3HPGA 3NF6A 3V1QA 4DFJA 4BDYA 4DTPA 2QKKA 1G15A 2FBYA 1ASWA 3AVIA 4B9LA 3IG1A 3K5OA 5HRNA 3V4IA 3O4NA 5JS2A 4W5QA 4DS4A 3V9WA 1IO2A 1KLNA 2I5JA 4NCAA 3V9UA 4OKJA 3AO3A 4CJ5A 3HVRA 4FJKA 2XHBA 1WSEA 4CIGA 3QNOA 2RF2A 3OS1A 1HNVA 2G8UA 3NAEA 4KV8A 3SUNA 3AVAA 4CFBA 3LZIA 3HK2A 4BDZA 4PUOA 1NKBA 4N56A 2PY5A 1X9SA 4FLYA 1VK0A 4KHNA 1LAVA 3OJUA 1NK4A 2X6NA 4CFCA 4CEQA 3S3NA 1RTDA 2KZMA 3VQQA 3HPOA 2OYQA 4L8RB 3SUOA 2HHWA 3KK1A 3V1OA 1A5VA 3IRXA 4JRPA 2FC0A 1JLEA 3V1RA 2F96A 3TAGA 4FZZA 4I7FA 1NOZA 3AVLA 3U3YA 1BIZA 2VWJA 3I0RA 3RRHA 3HPHA 3QEPA 4KAZA 3KJVA 4DU4A 2BANA 3KD5E 3FFIA 3AVCA 1BHLA 1RBTA 4OGEA 4OPKA 3P83D 3KLEA 2Q3SA 1VRTA 5FROA 3V9XA 4O0IA 2HMIA 3QIOA 2VG6A 3OYIA 1KLMA 3ISNC 3AVJA 1U45A 4JRQA 4N76A 1Q9XA 4H8KA 4PWDA 2HHXA 2E6MA 4FW2A 4Z0UA 4KKOA 4FM0A 4M3TA 4DSLA 4BE2A 3I0SA 3TARA 3T3FA 1XI1A 4KTZA 4CJKA 5K14A 5J1EA 3OJSA 1BI4B 3K57A 4F2RA 4PQUA 5I42A 2QKBA 1GOCA 5KTQA 4DU3A 3E01A 1B9DA 3RWUA 5KI6A 2P1JA 3DM2A 3F9KA 2FBTA 3OS0A 4DU1A 4DFKA 2B4JA 5HLFA 1N6QA 3PO5A 3SJJA 1L3UA 1NJXA 3NHGA 3BDPA 2O4GA 4CK2A 3RRGA 2HVIA 3CM6A 3QEWA 3OYAA 2RN2A 1J53A 3OS2A 4DSJA 3DLKA 3VQAA 2IDOA 4BE1A 4B08A 4G1QA 1DTTA 3V9SA 3D45A 1TKZA 2WOMA 4RW9A 4DSFA 2XY5A 1N5YA 1S9EA 1U4BA 3L3VA 3PX4A 4FLZA 4R5PA 4FLXA 1QSLA 4F8RA 3OYCA 3HM9A 1UWBA 3CFRA 5HRRA 1B9FA 3VQ5A 4DF4A 1SL2A 2HHUA 4Z4FA 3TAPA 3NF8A 3TANA 2X6SA 2HHVA 4KHQA 2AJQA 4CEFA 3AVNA 1JKHA 1S1WA 2DTUA 3OYGA 1IH7A 1TKXA 1VSDA 3RR8A 3MXJA 4I9LA 3SPYA 4CEDA 3V6DA 1A5XA 1NJWA 1X1PA 2F8TA 1JLCA 4FJMA 3L2VA 3CG7A 4E1NA 4E7LA 3TI0A 4PA1A 2Z1JA 3SUQA 4CHOA 4H4MA 4CJFA 2P5OA 2DY4A 3K5MA 1W9HA 1LWEA 4CEZA 3ALYA 3ZSQA 3ZSWA 4B8AB 1TK0A 4Z4GA 3O4QA 4FJ5A 2HHTA 1FXXA 4IBNA
chains in the Genus database with same CATH superfamily
1VQ7N 1T03A 2A3ZA 1EXQA 3FZFA 3CC7N 4DTUA 3QO9A 4K41A 3DLEA 4A59A 4OPJA 3SAHA 5TKYA 4AM7A 3ZT4A 3QNNA 2Z1IA 3J8AA 5CY4A 3DRRA 1NMNA 4ELUA 2E20A 2D0AA 3KK7A 2VG7A 4YHHK 4CHQA 5AQVA 4DUYK 3NF9A 2G8KA 1BQMA 4CEBA 4YOUA 5C10A 4HCBA 2JWLA 4YNQA 3AVBA 3DLHA 1V4SA 3FGUA 4LF6K 4H0YB 1BIUA 1W2BM 4DSKA 4RW6A 4IFVA 5M1OA 3H46O 3BGRA 4C8NA 2IC3A 4LF8K 1LW0A 4NXNK 3NH0A 3LP3A 3K2PA 3OYHA 5AQKA 5C24A 3MCAB 3UKUB 3MEGA 1RDCA 3TSQA 4DB3A 4BRIA 4YDUA 1WOQA 1OVYA 1KXPA 4FLTA 3CJBA 4JAXA 4C1NI 4H0VB 3G6EN 2D5RA 3GE1A 4LSLA 4BGAA 1U49A 1NJIO 4JD2B 4GVMA 1D4XA 1O1WA 1IBMK 1BCOA 3QETA 3UIQA 3E9OA 1C1BA 4B3TK 1BOTO 1TUUA 4CZLA 4E19A 2VYPA 4JKGB 4H4OA 2Q2RA 1Z6RA 1XHZA 1U48A 1TYQA 2FSNA 3WQTA 4F9OA 1TV6A 1GOAA 2OANA 2P9KA 3L2UA 1J5EK 3BEXA 4BR7A 1JL2A 4WFBL 1HPZA 1YTUA 2ZE2A 1TAUA 1IKYA 4NLCA 2WUSA 3T69A 3O9QA 1NGAA 2YJEA 3UKRA 1BISA 5IWAK 3LANA 5C2DA 4CGJA 2B6AA 3OYLA 4KI6A 3MXMA 4JI6K 1RBSA 4FJHA 2FBXA 1YF5L 1JJ2M 3KKRA 4PL8A 1OKJA 4N41A 2KW4A 4MFBA 4CJWA 2Y1JA 3SJHA 4KRFA 4CF1A 4FWOA 4CCHA 2A1SA 1U2VA 3F73A 1NGCA 4FJXA 3SBTA 4FLVA 3CFPA 2BDPA 1LAWA 4N47A 2Z1GA 2H3GX 2GUIA 4M63C 4I2QA 4HVJA 2PAVA 4H0TB 1Q8IA 3OY9A 1HNXK 2ZM6K 3CQXA 3B6OA 3VQ9A 4AHVA 4NCGA 5EY4A 1VSMA 1EETA 2X78A 5BR8K 2O8CA 3HYFA 3PX0A 4CGHA 1JLGA 5M1NA 3NFAA 1C0GA 3LDOA 3WQUA 4V19S 1A5WA 2NUBA 5HP1A 3E9PA 5F2RA 3HSTB 1YVNA 4R79A 4LF7K 4E3SA 3CPWM 3M6GA 1N34K 4MO5A 2DFEA 2VCPA 1SQKA 2V51B 4NLBA 1JXEA 1Z26A 3J80O 1LOTB 1D9FA 4C8MA 4WFAL 4DQPA 4ISGA 3OVNA 4DSEA 3QB0A 4AH9A 4ID5A 4NB4A 1C1CA 3RSEB 1WSGA 3KKSA 3HO1A 4FJ7A 1V4TA 1SKWA 3C6AA 2ZQBA 4TSXA 4WFNL 1F21A 4BACA 4OLAA 2EWSA 3G71N 5BRHA 3TAFA 3A0IX 3UKUA 1K8KB 4Y1DA 4FM2A 5AQMA 4B3RK 1X9MA 1LWCA 3LP2A 3MEEA 1S5JA 5C42A 4BRCA 1LW2A 3VETA 3LWMA 4EHTA 5KGXA 4DG1A 3ZSYA 4L3QA 3HT3A 1RFQA 1MWKA 4FJ9A 5DK5A 5M1PA 2QXLA 1KVAA 1XUPO 2E4LA 4GKKK 2CH6A 4DQRA 1BO5O 3O3FA 4J2BA 1RT2A 4DTJA 1RT3A 4MDAA 3RMBA 4CFDA 3K5NA 5I3UA 3R9PA 5SWMA 3AVGA 3THXA 2F8SA 1QVGM 2QA4N 1IJJA 4CBWA 1FKOA 4BRGA 1OH8A 3DXMA 4CGIA 1LV5A 3ZETB 2Z1HA 1YUWA 4A57A 5AQTA 4JKEA 1QZ6A 2P5GA 5EX5A 4BWMA 4QCLA 3THYA 2NNWA 4RW7A 4B9UA 1ASUA 2HVIA 3V81A 3MN7A 1RDBA 2OA8A 3L3UA 3CCRN 4HCCA 2ASMA 4KH4A 4A5BA 4CF0A 1KD1O 3ZT2A 2ASPA 4DTSA 4FOIA 2YJFA 2OCEA 4DQIA 1XMOK 3AA2A 5AQXA 3DWLA 3VPZA 4IDHA 3U9ZA 3CERA 2YHWA 3TTCA 1CXQA 1TL1A 1HUXA 2GV9A 4I6MA 4K25A 1DEJA 2IVOA 3MECA 3KTQA 2A40A 3LP1A 3M3ZA 4CJ7A 2YCHA 1FJGK 1WNSA 1BU6O 2O4IA 1G99A 4KH5A 2O8CB 3CC2N 3R1XA 4CEAA 1TK8A 5J2PA 3Q7BA 4LC9B 5FPEA 3ASMA 3NCIA 5HL7L 2OTJN 5FDLA 1WBBA 4AHRA 3NBPA 4C8KA 2D0BA 3ITHA 2XRIA 1U6ZA 2W6KA 3O08A 4DV2K 4XH1A 1YJ9N 3CHWA 2A5XA 3M5RA 3RR7A 2WONA 3CQ8A 3SYZA 3H3NO 2WTUA 3MAQA 3CCLN 3RSEA 3J81O 3ZSXA 1KFDA 4JHDB 5CHIA 5IT9O 1DLOA 1RTJA 3THWA 3NE6A 3SQ4A 4OVLA 2YV0X 3R8EA 4BRLA 1ZBLA 1ASWA 3IG1A 3VOVA 3V9WA 2PBDA 4FO0A 4CIGA 3QNOA 5C12A 3P39A 4KV8A 3AVAA 3LZIA 4BDZA 4IEIA 5CE3A 4UY8O 4X62K 4N56A 2HF4A 4FLYA 1Q86O 4KHNA 4PKIA 3S3NA 1YI2N 1RTDA 3VQQA 2HHWA 5GAHP 3V1OA 3FZHA 4AF1A 3TAGA 1NOZA 3HSCA 2NRXA 1HJOA 2D0PA 4DU4A 1BHLA 5JVGL 2Q36A 3P83D 2Q0UA 5FROA 3TSUA 3O9UA 5KPZA 2P9LA 1E4FT 2VG6A 3ISNC 3OYIA 4JRQA 2Q31A 4Z0UA 4M3TA 4BE2A 2YI1A 3ZX2A 3EN9A 5K14A 4GV6A 2QKBA 5KTQA 3BP8A 4IO8A 4DFKA 3ULEB 4HTLA 4CK2A 5E84A 1J53A 1Q18A 4DSJA 4DUZK 1HNWK 5F0XA 1DTTA 4RW9A 2VWBA 4DSFA 1QZ5A 2NRVA 4JK7A 3NMUA 1ILYA 2E2OA 1QSLA 4A5AA 3HM9A 1UWBA 5HRRA 4DF4A 3EO3A 4BR5A 2X6SA 4CBUA 2NRRA 3DXKB 3AVNA 4XEIA 2P9IA 3RR8A 4DR5K 1NJWA 1QVFM 4JKGA 4NXMK 4FJMA 2E2NA 4E1NA 4E7LA 3TI0A 1K9MO 4PA1A 2Z1JA 4CHOA 2P5OA 1IG8A 5AFUH 3O4QA 1VHXA 4FJ5A 1FXXA 3L0QA 2QWLA 5AQIA 4F3TA 4ZTFA 5GADP 3WEEB 2EHGA 3BF3A 3CCJN 4BC3A 5C25A 1J54A 4DHYA 3SCXA 2O8DA 1HKCA 4FOEA 1WB9A 3ZSOA 3VEXA 4E0DA 4DTNA 3OA9A 3C95A 1GLCG 3DYAA 4IO9L 4FLUA 5AQZA 4B9NA 4IZ9A 4A2BA 3QINA 2PYLA 3THWB 1HQUA 3LDSA 1VSLA 3VQ7A 1I3AA 3KVGA 4Z4EA 2ZJQL 3O6WA 2B5JA 4EZ6A 3NDKA 4IWVA 3EZ5A 3D0PA 3ZCMA 1KAYA 1OVQA 3QESA 1KVCA 3L2QA 3PUFA 5AQFA 1CLQA 4CHNA 3LDPA 3VERA 5DMRA 4BE0A 2O8EB 1WSHA 2Q0RA 5AQHA 3LPUA 3L4IA 5KQDA 3WXIA 2XY7A 3MX2A 4OPAA 3SV3A 1S1VA 3SPZA 4KO0A 4FZXC 1NK0A 2EX3A 1T8EA 1SAZA 4OGCA 3VQBA 1UA1A 1KFSA 3LAMA 1M1KO 3K58A 4OJRA 4H5VA 3RMCA 2G8FA 1MU2A 4DKWA 3CJ9A 1TVRA 4BC2A 4BRDA 2YKNA 4AHTA 4M3UA 1HNZK 4Z94A 1EP4A 4CJ4A 4DF8A 3QERA 2PYJA 3A5LC 3C6HA 3O4WA 3P31A 1KVBA 1WSIA 4DTOA 4JV5K 4E7IA 3HL8A 3WNEA 3LPTA 2JWKA 1NK5A 3OBWA 1RTIA 3VN5A 1QS4A 1JLQA 3VEYA 1UAXA 1BG3A 3CFOA 1MDUB 1QQOA 2P9SA 4DV1K 3AA4A 1IKWA 4DR7K 1XQSC 2BTFA 3ZSVA 2Y1IA 4KHUA 3BY5A 4CZFA 5ADXH 4CF2A 3AAQA 3VMFB 3CCMN 4LFBK 2P9PA 3KK3A 3EY1A 1CXUA 3DXKA 3AVMA 2YNFA 2VGMA 4QS8A 2YHAA 4FVUA 3ZX3A 2ZWHA 1HMVA 4O8KA 4FJGA 2F9WA 3O3HA 2YNHA 4B9MA 1OH7A 4E7KA 1BUPA 1RT5A 5H1SQ 4JLHA 3EE9A 5BPMA 4DLEA 3GL1A 4HHTA 3CJ1A 4JKHA 1GLLO 3TAEA 2ITMA 3CQYA 2YNIA 4EFHA 1Q81O 1HX1A 4NCBA 4CJSA 1RDUA 1RBVA 1NKCA 4RWTA 2V7ZA 3AGKA 1BCMA 1ASVA 2F7TA 2FSJA 4MQ3A 4K42A 2Q97A 1C0UA 1YTAA 1KCFA 3RVCA 3FZKA 4OKKA 3ZEUB 1RGIA 4DTRA 4ICLA 2UUAK 1BA1A 2UXDK 5EXWA 2HOEA 3UKRB 4DCHA 1NGDA 1TGOA 2CGJA 4B1YB 2D4WA 4O44A 5GAGP 1P8ZA 3VQ8A 4BR2A 1RDDA 3TAQA 4BVOA 3THVA 3PY8A 3O1BA 1NBWA 5BN8A 4ZHRA 2O8BB 4KTWA 3C6UA 3VF6A 4I6MB 3HVTA 4M42A 1J5OA 4JKDA 5HBMA 1KTQA 2OZMA 2QWOA 1ATSA 4DS5A 2V7YA 1TKDA 3OYBA 5FPDA 5JLHA 5D3GA 5LL6Z 5CR4A 3NGYA 1NK7A 2IAJA 4RW8A 3NF7A 1VSJA 4FL9A 3F9MA 3SAGA 3OYMA 2O8FA 5BPNA 4JKFA 3A5MC 3E9LA 1N8RO 1LCUA 3DLRA 1YIJN 2FXUA 1WSJA 3LALA 4JYAK 3DJCA 1E3MA 2DFFA 3SQ2A 1JCGA 4BR0A 4ILHA 4BDPA 5AQQA 3BZCA 1HNIA 3VQEA 3EYZA 3LP0A 1DT9A 4NYFA 1RCHA 4CJRA 4JHDA 2NRWA 3KD1E 3D2EB 1KRPA 4CK1A 1E4GT 3QBXA 2HHSA 4GY2B 4B3SK 4UQGA 2A1RA 4H5TA 4MO4A 4GNIA 4RG8A 4H0XB 4DR1K 4LFCK 4FZYA 1VRUA 1NWKA 3RMAA 4XIUA 1WN7A 3PLAA 1RT1A 2PFUA 5E41A 4DV5K 5KRSA 4W5TA 3NVMA 2I7NA 4BRAA 3ENHA 4ELVA 2NRTA 4I9QA 1CZBA 1RILA 2KQ2A 4HWIA 4EP5A 1NGFA 3IKMA 4K43A 5AZJA 3VEVA 3T19A 1D9DA 1KSPA 3M8RA 4ISFA 4CZIA 4DV6K 3QEXA 4CZMA 3ZT0A 2VGNA 3DLGA 2ASOA 1XWLA 2HSTA 5AFUA 1GLEG 1D8YA 1ZBIA 4WQ5C 3I8DA 4CECA 3QIPA 3ZYYX 1YHQN 3ZETA 5AQUA 3AARA 1U47A 2ZGZA 1NGIA 5AR0A 2RHKA 1ZYQA 1BI4A 4DWIA 1XNQK 3THYB 5C0YA 3CXCM 2Q1NA 2WFBA 4OX9K 3MMVA 3EZWA 4CJ3A 4CZGA 5AQSA 2YKMA 4YFUA 2G8HA 4CW7B 3MXIA 4CFAA 3OW2M 2YHBA 3NF6A 5JS1A 3AVIA 3FR0A 3PIPL 5JS2A 4W5QA 1KLNA 1IO2A 1GLJO 4NCAA 2O8BA 1XC3A 4EIAA 4AQYK 2RF2A 1BA0A 2E1YA 1HNVA 2G8UA 3SUNA 4LF9K 2E2PA 4JKAA 1QQMA 2PY5A 1X9SA 3EL2A 1VK0A 1LAVA 1OH5A 4CFCA 3VTHA 1MWMA 2KZMA 3PSIA 1GLBG 3TTFA 3NVKA 4L8RB 3IFRA 4FSVA 1TYQB 4I7FA 2VWJA 3QEPA 2BANA 3AVCA 4OPKA 3HZ6A 3T7ZA 1VRTA 3V9XA 4O0IA 2HMIA 4FWPA 1EWQA 4N76A 1Q9XA 2V52B 4FW2A 4JI3K 4KKOA 4FM0A 4DSLA 3TARA 1XI1A 4CJKA 4PQUA 2HBMA 3E01A 3VGKA 3H3OB 5HLFA 3F9KA 3DM2A 1N6QA 4CZKA 2KHOA 2GWKA 1L3UA 3BDPA 3RRGA 5AQLA 2ZJPL 3OYAA 3B8AX 5EVZA 3DLKA 3I33A 4BE1A 4GVEA 3V9SA 2WOMA 1N5YA 4FLXA 3CD6N 4F8RA 3SMSA 1SL2A 1B9FA 3ENOA 2UU9K 3NF8A 1EO1A 1YITN 3OTOK 5ADXA 3T1HK 2AJQA 1GLFO 3MK6A 4CEFA 1JKHA 1KAZA 4PL7A 4DR3K 2RE2A 5AZJB 4CEDA 2HBKA 1X1PA 1JLCA 4YOWA 4U7BA 3J7ZO 2DY4A 4H4MA 1LWEA 4CEZA 3ALYA 3ZSQA 3ZSWA 4B8AB 5E26A 4Y1CA 4C8OA 3DI6A 4YORA 4E1JA 4B3OA 4PY5A 4KB0A 2AP1A 1Y97A 2E2QA 4CZEA 3DOLA 1VSHA 2W6LA 2W41A 4OPHA 4JN4A 1IKXA 4CGDA 4B9SA 3C7NB 4B1ZA 1NG9A 1YT3A 4KHWA 2GEMA 3QMLA 4BWJA 4EHUA 4FCYA 3U3GA 4JKBA 2NRHA 4FWLA 1Z05A 4IOCL 4Z4HA 1HJRA 4IG3A 4H5WA 1M90O 3VA3A 3HM8A 1NK6A 1VQ9N 3UE5A 4FW1A 4JS4A 1HKGA 4E7JA 3L2WA 3ZSRA 3P38A 4FWKA 3WXKA 2GBZA 4J8FA 3EEQA 1JLBA 2ETJA 3P1GA 5KPTA 4X64K 4KHYA 1REVA 3AA5X 1DGKN 4BG8A 2UUCK 1VQNN 3AO2A 3PX6A 3QICA 3HJFA 3GG4A 1NNEA 3O1WA 1CZ9A 4RCHA 1EX4A 3MDQA 2IVNA 4B3MK 1VSFA 1CZAN 5KRTA 2QK9A 1RT6A 3PV8A 4DFPA 4CF8A 1J6ZA 1X3MA 2NLXA 4CIFA 1MA9B 4CHYA 3CCQN 3DXMB 3DMJA 3WEEA 2E6LA 2OPSA 4M3RA 3JSMA 1VQMN 4RTFD 5EOYA 4FJLA 4JKCA 3AO4A 2A42A 3ZEUA 1VQ4N 2UYTA 1RBRA 4FWMA 4H5RA 1RT7A 5T7BA 4DV0K 1K8AO 1SL1A 1VSIA 1ZBFA 4WQ4C 2J4RA 3OYFA 3U8XA 1I39A 4CJQA 1VQ5N 5CYMA 1NK8A 4JI0K 4Q5VA 4KBOA 1QSYA 1YXQA 4CESA 3VA0A 3OYDA 2KLAA 2ZJRL 4M41A 1HYVA 3DRSA 3LDNA 4A2AA 3CIPA 3SNNA 4KHPK 4CERA 5LMNK 2GELA 3C65A 2FF6A 4BQLA 2HNZA 1IKVA 1KC8O 3TU5A 2F9TA 2IOCA 3KLGA 3N4PA 4IDKA 2X74A 2CH5A 4W5RA 4CHZA 1YJWN 3VEZA 1T05A 1SZ2A 3IS9A 3JAMO 4HUFA 1K73O 4K8ZA 2CGKA 2HHQA 1SV5A 3CJCA 4JI2K 3E66A 4CK3A 1K6YA 4BR9A 3AGRA 3VQ6A 1HLUA 3U6FA 2AA4A 1NK9A 3U9DA 3KZBA 4BREA 1NMDA 2E1ZA 2BH1A 4LY7A 2WBNA 3CPEA 4B9VA 4FJIA 4AM6A 3B6PA 4A62A 3O8MA 3QDKA 1D5AA 2NRZA 4ISEA 3HP6A 2VG5A 4CF9A 3NH1A 4DQQA 4WYBA 4M3WA 3K9KA 5AQYA 2IS3A 1VQKN 3IDHA 1S1TA 4AHCA 3BZKA 2YHXA 5HRSA 1NGHA 2ZD1A 4GKJK 1VQPN 2P9SB 4G9ZA 1QQCA 4JS5A 2KFNA 3SBGA 3CCEN 3KLFA 3BF1A 3J7YP 4H5NA 3L8BA 4LD0A 3VENA 1TAQA 1C0FA 1ATRA 1NLVA 1C6VA 1NGJA 4F3OA 4KHSA 3EE8A 5JLFA 1NU0A 4X66K 3HXMA 4M3ZA 2FLOA 4BRHA 4KPYA 1WAFA 3SLCA 3CJ7A 1I94K 4EP4A 3L2RA 4DTXA 5C15A 4B9QA 1O13A 4Z4IA 1UOCA 3NGZA 3VEWA 3VQPA 4PHTX 4YOXA 4BGBA 2PZSA 4JK9A 1XHXA 2XY8A 2LSNA 3O9RA 2NZTA 3TSPA 3K59A 3AVFA 4GV3A 5AQRA 4AHUA 3ID6A 3OYKA 3DOKA 3O3GA 3CI5A 4FVMA 5JVHL 4IKFA 3MN6A 3SK3A 2D1KA 2BE2A 4CGFA 4O5FA 2HNYA 4NYNA 3HI0A 3LL3A 4KH6A 2KTQA 4CJTA 4CJUA 2W42A 1JCFA 3OYNA 1U2VB 1YVUA 3NGIA 4DFMA 4HUGA 4LSNA 1NGEA 1B92A 1HQEA 3A5NC 3HP9A 3T1AA 2R7YA 3CETA 1Z25A 3K5LA 4FJ8A 4CI6A 3PO4A 3K0SA 2P9NA 5CZ2A 1XMQK 3P5JA 3VTIA 1VQ6N 3EKSA 1ZC6A 4FLWA 1ZBSA 3VESA 2XO7A 1LWFA 4XH5A 4DV3K 3OYJA 2YHYA 4ID1A 4CIEA 1W0HA 1EKEA 5HROA 4CJEA 3AA3A 1S9GA 3EKUA 4O0JA 1T3VA 1IG9A 4QS9A 2QWNA 4FM1A 1N33K 3CJAA 3S9HA 3M8SA 2QXFA 2KFZA 4FK2A 1EQYA 2IGIA 3TTDA 3QFUA 4F4KA 3O9SA 3M8QA 1L5UA 4KTQA 5AQJA 2JGUA 2P9UB 2VQEK 1ZXOA 1IBLK 4FK0A 5KGWA 4HTUA 4B8CA 3HPGA 3LM2A 3V1QA 1EWRA 3LDQA 1N36K 2FBYA 4B9LA 5HRNA 3K5OA 3V4IA 3O4NA 4DS4A 2I5JA 1QQNA 4FJKA 5BN9A 3AO3A 4BR4A 1JCEA 3F5TA 3NAEA 4B1VA 5BRDA 4PUOA 3VGLA 4YOYA 1NKBA 3KWGA 5M1QA 3K9JA 1S22A 4BQZA 1NK4A 3MX5A 3VEOA 3BUZB 5GINA 4JK8A 2OYQA 4B1XB 3SUOA 3KK1A 4CBXA 1A5VA 3IRXA 4DV4K 4JRPA 1JLEA 3V1RA 3AVLA 3U3YA 1BIZA 3I0RA 3RRHA 4KAZA 4IJNA 4BRKA 3CMAN 3HTVA 3ATUA 3QIOA 2FSKA 2YX6A 4PWDA 2HBLA 2E6MA 4BROA 2WC9A 4KTZA 4CD1A 5BPLA 5J1EA 1BI4B 4F2RA 4BY9C 5I42A 1GOCA 5KI6A 3OS0A 3PO5A 2F4VK 2B4JA 4ILGB 1NJXA 3NHGA 2O4GA 3CM6A 2E5LK 2RN2A 2IDOA 4U67L 2IVPA 4DR2K 1YAGA 1WBDA 3D45A 1S9EA 4JI1K 4IXCA 3PX4A 4FLZA 4EAHD 4J2AA 3OYCA 3VQ5A 5GIOA 2HHUA 4Z4FA 3TANA 4JI8K 2HHVA 3OYGA 1IH7A 1VSDA 2QI2A 4QS7A 3SPYA 5GIPA 2IIRA 3V6DA 2F8TA 3L2VA 3SUQA 4CJFA 1W9HA 2HHTA 3O80A 1TK0A 4CZJA 4IBNA 4H0OA 2HB5A 5FRMA 3FLCO 4J2DA 2DFHA 2DPNA 2FF3B 3SMPA 1VSKA 4KB1A 3DAWA 1QTMA 2UUBK 3FZLA 4CJLA 1QE1A 1X9WA 1L3SA 4E7HA 4KREA 3HBTA 1GLDG 2ZGYA 3LZJA 4O5BA 1ITGA 4JI4K 4YOTA 1FKPA 2QWRA 4K8XA 3OYEA 5DM6L 1S1XA 1SUQA 2ZF5O 3ZX0A 3DRPA 2GTDA 4YOVA 1H1VA 2P9UA 1VQLN 4W5NA 3G4SN 3MWPA 2HNDA 1VQON 3CM5A 3JYTA 1NJYA 1NKEA 3ZSZA 1P90A 1C1AA 4GMJB 4BVPA 3G0ZA 1BL3A 5BREA 3CF5L 4J2EA 2KZZA 1YJNN 1S3XA 3AV9A 5J2QA 3JXUA 1VAZA 1W7AA 4H0PA 1SS6A 2FBVA 3D2FA 5LMUK 3VQ4A 3ZT1A 3R6MA 4LFAK 1ZBUA 3V9ZA 1RDAA 1T6DA 2A6AA 4A61A 1TK5A 1L3TA 4B1WB 1J9AA 5AQGA 3PIOL 2BUPA 2YNGA 2GWJA 4LH5A 4QOZB 4CVNE 4RW4A 3ENBA 2HVHA 3SZ2A 4E1MA 3TAMA 2G8IA 4AILC 1SKRA 2P51A 4O55A 2QWPA 2UXCK 1NJZA 1BDGA 3D7EO 3WNHA 1ATNA 3M8PA 3C6TA 3C7NA 3S41A 3SV4A 1HYZA 1ESVA 2BGGA 3JS6A 1NM1A 5FLXO 3H08A 1HKBA 3CCSN 3TR8A 1Q9YA 3L4QA 3OHRA 4M3YA 4HUEA 3C94A 3D2EA 4KI4A 1NOYA 5J2NA 2UXBK 3W0LA 4BC4A 1DKGD 4O4GA 1HPMA 3GDQA 5ELZA 2RPIA 3I55N 1K8KA 3LAKA 3GBTA 3QFPA 3G25A 4N5SA 4IG0A 5KQ8A 3M1FA 1C0TA 3I8BA 4LH4A 4BRPA 3E1YA 5DM7L 3TWHA 4BRQA 1SKSA 4DMNA 1VQ8N 4MLHA 3CCUN 3AVKA 2A41A 2KKZA 4WE1A 1VSEA 4YDUC 4C8LA 4LF4K 4BRNA 4DQ8A 4JD2A 3HOSA 5LY3A 3S3OA 1JXBA 4CEOA 3VGMA 4DTMA 4FXDA 4CEEA 1TUYA 3A5OC 3AVHA 4M7YA 1UA0A 1HRHA 5SZTA 1BWFO 3N4QA 4WQ5A 4ELTA 3DLBA 1RTHA 2HMPA 4GV9A 2HHHK 3TABA 1FW6A 1DTQA 2P9KB 3H1QA 2VQFK 3LWLA 4FJJA 3L6QA 2HF3A 2ITGA 2QWQA 1R0AA 2O8DB 1S6QA 3QEVA 4EZ9A 5KPRA 4Y0WA 1JL1A 5I9EB 5EU7A 3IMXA 1TL3A 3IUCA 4M7XA 3ZLJA 2OPQA 4W5OA 5J2MA 4FYDA 1S1UA 1WSFA 1WAJA 3PSFA 5AZIB 4CGGA 3CMEN 2GX9A 1OH6A 4FK4A 3WXJA 3KIOA 3IAYA 3SAFA 2HBJA 3QBWA 4XH4A 5FPNA 2JLEA 4WCEL 3WNGA 4AHSA 3SI6A 3NH2A 3S3MA 1GLAG 5B8HA 3G10A 3FZMA 3MEDA 1RBUA 4M3XA 4FWQA 3ATVA 1RNHA 4DQSA 3OBYA 3T1YK 2OPPA 1SL0A 3VQCA 4NO7A 1IBKK 4E89A 1GOBA 2QM1A 3CYMA 3KWIA 4B9TA 2HW3A 1QSSA 3RMDA 4X65K 1L3VA 4GW6A 3Q7CA 2D0OA 3ZT3A 1JLAA 3SUPA 4IFYA 4LF5K 3R3LA 2OTLN 3VQDA 4KFBA 1S72N 5JICA 1XC9A 3H45C 5LJWA 4QAGA 1RT4A 5TKWA 4FWSA 1X3NA 5AQNA 3QEIA 3AO5A 1BGXT 3ID8A 3KLHA 4O8UA 1ZBHA 5CYQA 3I56N 1JLFA 5A2QO 1C0MA 4M45A 4ZTJA 2G8WA 3H1VX 4DLGA 3VF4A 4CJVA 1RDWX 1Y64A 3F2KA 4OLBA 4FPBA 1WLJA 3MN5A 4DR4K 5CZ1A 1Q82O 5M1KA 4YY3K 4BG9A 4OO1J 2W40A 4IOAL 2P9PB 3ULDA 3LM9A 4CE9A 2CGLA 3WT0A 5FPMA 4DR6K 4DV7K 3O5BA 1FK9A 5LJVA 3SQ0A 3KHYA 4FWRA 1N32K 1S6PA 1WUAA 2VWKA 2QWMA 4H03B 4IOXA 4I2PA 3FE1A 1BQNA 4DSIA 3QLHA 3GOIA 3THXB 1HYSA 1NGBA 3WNFA 4FJNA 4PKHA 1T7PA 3A2FA 1TKTA 4JEPA 3J7AP 2P9LB 3RTVA 2ATQA 1X9JA 4MDBA 3UB5A 2D0CA 4IEEA 1T6CA 4CHPA 2G8VA 3W3DA 1U04A 4PKGA 2OZSA 1QHTA 3HOTA 4Z4CA 4CJPA 3DLLL 5AZIA 3AO1A 4C1NK 1T44A 2RKIA 3CC4N 3KLIA 3ULEA 3KK2A 5HRPA 3SQ1A 4F2SA 2I7PA 4Q0BA 2XY6A 2OPRA 4OKEA 1XNRK 4DFJA 4BDYA 4DTPA 2QKKA 1G15A 2E88A 5AQPA 5GAEP 3V9UA 4OKJA 4IFEA 4CJ5A 3HVRA 5M1FA 5BR9A 1W97L 3MCPA 2XHBA 3TPQA 1WSEA 3OS1A 2P9IB 4CFBA 3O9TA 3HK2A 3A8YA 4JI5K 3D6RA 2P9NB 5AJ3K 3HRGA 3OJUA 4CZHA 2X6NA 4CEQA 1KQSM 3MN9A 3HPOA 3U4LA 2O8FB 2FC0A 2QW9A 2F96A 4FZZA 1IV0A 3WXMB 4BC5A 3HPHA 4WF9L 3KJVA 3KD5E 3FFIA 1RBTA 4OGEA 1HR0K 4BRMA 1QHAA 3KLEA 2Q3SA 4JI7K 4IJAA 1KLMA 3AVJA 1U45A 4C23A 2HHXA 4H8KA 5F1XA 3FFKB 5JMVA 2GUPA 3MWTA 3C0BA 3I0SA 4WQ4A 3T3FA 5AQWA 3VF2A 4BRFA 3OJSA 3K57A 4DU3A 3CCVN 1B9DA 4JNEA 5AQOA 4ILJA 3RWUA 5FRNA 2P1JA 2FBTA 4DU1A 4K0KK 5MLCQ 5HOOA 3SJJA 5C2FA 3QEWA 2E8AA 2QTDA 1NGGA 3OS2A 3VQAA 4B08A 4G1QA 1TKZA 3AAPA 2XY5A 3WXLA 1U4BA 3L3VA 2O8EA 4R5PA 4CD3A 5BRFA 3CFRA 3D2FB 3TAPA 3AY9A 4MLEA 1Q7YO 4KHQA 1S1WA 3H6EA 2DTUA 3WUHA 1TKXA 3MXJA 4I9LA 4B1UB 1A5XA 3LDLA 2QEXN 3CG7A 1R59O 1KAXA 4FWNA 4FPAA 3K5MA 4Z4GA 3P4IA
chains in the Genus database with same CATH topology
4C8OA 1T03A 1EXQA 3DI6A 2HB5A 5FRMA 4DTUA 4J2DA 4B3OA 2DFHA 3QO9A 4PY5A 4KB0A 3DLEA 4F3TA 1VSKA 1Y97A 4OPJA 3DOLA 4ZTFA 3ZT4A 1VSHA 3QNNA 4KB1A 1QTMA 2Z1IA 5CY4A 2EHGA 3DRRA 1IKXA 4CJLA 1QE1A 4CGDA 4B9SA 1X9WA 4ELUA 1L3SA 4E7HA 2D0AA 4KREA 1YT3A 4KHWA 2VG7A 5C25A 4CHQA 1J54A 3SCXA 3NF9A 4O5BA 1BQMA 1ITGA 3ZSOA 4CEBA 3LZJA 2G8KA 4E0DA 4HCBA 4BWJA 4DTNA 1FKPA 4K8XA 3C95A 3DYAA 4YNQA 4FCYA 3U3GA 3AVBA 3OYEA 4FLUA 1S1XA 3DLHA 1SUQA 4B9NA 4J2AA 3QINA 1BIUA 3DRPA 2PYLA 4DSKA 4RW6A 4IFVA 1HQUA 3LDSA 4Z4HA 1HJRA 3BGRA 4C8NA 4W5NA 1VSLA 4IG3A 3VQ7A 1I3AA 2IC3A 4Z4EA 2HNDA 3CM5A 3JYTA 1LW0A 3VA3A 3NH0A 1NJYA 3LP3A 2B5JA 3K2PA 3ZSZA 1C1AA 4GMJB 3OYHA 1NKEA 4EZ6A 3NDKA 3G0ZA 1BL3A 4FW1A 3EZ5A 5C24A 3D0PA 4JS4A 3ZCMA 4J2EA 2KZZA 3MEGA 1RDCA 3QESA 4E7JA 1KVCA 3L2QA 3PUFA 3L2WA 3AV9A 3ZSRA 4CHNA 5J2QA 5DMRA 1CLQA 4FLTA 4BE0A 1WSHA 2FBVA 2GBZA 1JLBA 2ETJA 3LPUA 3P1GA 4KHYA 3VQ4A 2D5RA 3ZT1A 2XY7A 4LSLA 1ZBUA 3SV3A 1U49A 1REVA 3AA5X 4GVMA 1RDAA 3V9ZA 1O1WA 1S1VA 3SPZA 1BCOA 3QETA 3UIQA 4KO0A 1C1BA 1TK5A 1L3TA 3AO2A 4E19A 1J9AA 3PX6A 1NK0A 4FZXC 2EX3A 1T8EA 4H4OA 3HJFA 4OGCA 3VQBA 1CZ9A 1UA1A 2YNGA 1KFSA 4LH5A 1XHZA 3LAMA 1EX4A 1U48A 4QOZB 3K58A 4OJRA 4RW4A 1VSFA 3RMCA 1TV6A 5KRTA 2G8FA 1RT6A 2QK9A 1GOAA 2HVHA 1MU2A 4Y1CA 3SZ2A 3L2UA 4DFPA 4E1MA 1TVRA 3PV8A 4CF8A 3TAMA 2G8IA 4AILC 2YKNA 1SKRA 2P51A 4AHTA 4O55A 4M3UA 1JL2A 4CIFA 1HPZA 1YTUA 4CHYA 2ZE2A 1TAUA 1IKYA 3DMJA 1NJZA 2E6LA 1EP4A 2OPSA 4M3RA 3WNHA 4CJ4A 3JSMA 3M8PA 4DF8A 3C6TA 3QERA 3AO4A 2PYJA 4FJLA 1RBRA 1HYZA 3SV4A 1KVBA 1WSIA 4DTOA 1RT7A 5T7BA 4E7IA 2BGGA 3HL8A 3WNEA 1SL1A 3LPTA 1VSIA 1ZBFA 1BISA 1NK5A 3H08A 3OYFA 3TR8A 1I39A 3LANA 1RTIA 1Q9YA 4CGJA 2B6AA 3OYLA 4KI6A 3MXMA 4CJQA 1RBSA 3VN5A 4M3YA 4FJHA 2FBXA 5CYMA 1NK8A 4HUEA 3C94A 4Q5VA 4KI4A 1NOYA 5J2NA 1QS4A 1QSYA 3KKRA 1JLQA 4O4GA 4CESA 3VA0A 1UAXA 3OYDA 4N41A 3CFOA 2KW4A 4MFBA 4CJWA 2Y1JA 3AA4A 1IKWA 2RPIA 3LAKA 4M41A 4KRFA 2Y1IA 3ZSVA 4CF1A 4N5SA 4IG0A 1HYVA 4KHUA 3DRSA 4CCHA 2A1SA 1C0TA 3F73A 3SNNA 4CERA 4LH4A 4FJXA 4CF2A 4FLVA 3CFPA 2BDPA 1LAWA 4N47A 3TWHA 3KK3A 3EY1A 1CXUA 2Z1GA 1SKSA 2HNZA 1IKVA 3AVMA 4DMNA 2GUIA 2YNFA 2YHAA 3AVKA 1HMVA 4I2QA 4FJGA 2IOCA 3KLGA 4WE1A 4HVJA 3O3HA 1VSEA 4IDKA 2X74A 4W5RA 4C8LA 4CHZA 2YNHA 4B9MA 1Q8IA 3OY9A 4E7KA 1RT5A 4JLHA 4DLEA 3S3OA 1JXBA 3B6OA 4CEOA 4HHTA 3VQ9A 4AHVA 1T05A 4NCGA 4DTMA 4FXDA 1VSMA 1EETA 2X78A 3IS9A 4CEEA 3HYFA 3AVHA 3TAEA 3PX0A 1HRHA 5SZTA 1UA0A 4HUFA 4CGHA 2YNIA 4K8ZA 4ELTA 1JLGA 3DLBA 2HHQA 1RTHA 1SV5A 4NCBA 3NFAA 4CK3A 1K6YA 3TABA 1A5WA 2NUBA 4CJSA 5HP1A 1DTQA 3VQ6A 1RBVA 3U6FA 3HSTB 1NKCA 3LWLA 4E3SA 4FJJA 1NK9A 1BCMA 1ASVA 2DFEA 4LY7A 4MQ3A 2ITGA 1C0UA 4B9VA 1R0AA 4FJIA 1JXEA 1YTAA 1KCFA 1Z26A 3B6PA 1S6QA 1D9FA 3QEVA 4C8MA 4EZ9A 4OKKA 1D5AA 4DTRA 4DQPA 4ICLA 1JL1A 3OVNA 3HP6A 5EU7A 2VG5A 4CF9A 3NH1A 4DQQA 4DSEA 1TL3A 4AH9A 4M3WA 4ID5A 2OPQA 1C1CA 1TGOA 4W5OA 5J2MA 1WSGA 1S1UA 3KKSA 4FYDA 3HO1A 2IS3A 1WSFA 1WAJA 4CGGA 4FJ7A 4FK4A 4O44A 1SKWA 2ZQBA 3KIOA 1S1TA 4TSXA 4AHCA 3IAYA 1F21A 4BACA 4OLAA 3VQ8A 5HRSA 2ZD1A 1RDDA 3TAFA 1QQCA 2JLEA 4JS5A 3TAQA 2KFNA 3WNGA 4Y1DA 4FM2A 4AHSA 3KLFA 3THVA 1LWCA 3LP2A 3MEEA 3SI6A 3NH2A 1X9MA 3PY8A 3S3MA 1S5JA 3G10A 5C42A 3MEDA 4LD0A 3L8BA 1LW2A 1TAQA 4ZHRA 3LWMA 4KTWA 3C6UA 1RBUA 4M42A 3HVTA 4M3XA 1RNHA 5KGXA 4DG1A 4DQSA 1J5OA 3ZSYA 5HBMA 1C6VA 1KTQA 2OZMA 2OPPA 4F3OA 4KHSA 3HT3A 4DS5A 1SL0A 3VQCA 3HXMA 4M3ZA 4FJ9A 5DK5A 1TKDA 4E89A 4KPYA 1GOBA 1WAFA 3OYBA 1NK6A 5D3GA 1KVAA 3CYMA 2E4LA 4B9TA 2HW3A 1QSSA 3NGYA 3RMDA 4DQRA 3O3FA 1L3VA 4J2BA 1RT2A 1NK7A 4GW6A 1RT3A 2IAJA 4DTJA 4RW8A 3ZT3A 1JLAA 3NF7A 4CFDA 4EP4A 3L2RA 1VSJA 3K5NA 3RMBA 3SUPA 5I3UA 4IFYA 3AVGA 5SWMA 3OYMA 4DTXA 2F8SA 3VQDA 4KFBA 1XC9A 4Z4IA 1UOCA 3DLRA 1FKOA 3NGZA 3VQPA 4QAGA 2PZSA 1WSJA 1RT4A 3LALA 4CGIA 1LV5A 1XHXA 2Z1HA 2XY8A 2DFFA 3SQ2A 2LSNA 3QEIA 3K59A 4BDPA 3AO5A 3AVFA 1BGXT 1HNIA 3VQEA 2P5GA 3EYZA 3LP0A 4AHUA 4BWMA 3OYKA 3KLHA 3DOKA 5CYQA 3O3GA 1ZBHA 4QCLA 4RW7A 4NYFA 4B9UA 1RCHA 1JLFA 4CJRA 1ASUA 1C0MA 4M45A 3KD1E 4ZTJA 3V81A 4FVMA 4DLGA 2G8WA 4CK1A 1KRPA 1RDBA 4CJVA 4IKFA 2OA8A 3L3UA 4HCCA 2HHSA 2BE2A 4CF0A 4CGFA 4UQGA 2HNYA 3ZT2A 4NYNA 2A1RA 4OLBA 4DTSA 2KTQA 4CJTA 4CJUA 4RG8A 4DQIA 2W42A 1WLJA 4FZYA 1VRUA 3OYNA 5CZ1A 3RMAA 1YVUA 4XIUA 3NGIA 3AA2A 1WN7A 1RT1A 5JS1A 4DFMA 5E41A 4HUGA 4LSNA 1B92A 1HQEA 1CXQA 1TL1A 5FRNA 3ULDA 4CE9A 3HP9A 3T1AA 2R7YA 5KRSA 4W5TA 1Z25A 2GV9A 1FK9A 3K5LA 3KTQA 3SQ0A 3MECA 3PO4A 4FJ8A 4ELVA 3LP1A 4I9QA 1CZBA 1RILA 2KQ2A 4EP5A 5CZ2A 1WNSA 1S6PA 3P5JA 2O4IA 3T19A 2VWKA 4FLWA 1D9DA 1KSPA 3M8RA 4CEAA 1TK8A 5J2PA 2XO7A 1LWFA 3QEXA 4I2PA 3OYJA 3ASMA 1BQNA 3ZT0A 3NCIA 4DSIA 3DLGA 4ID1A 1XWLA 4CIEA 5FDLA 3QLHA 1W0HA 1EKEA 4AHRA 1HYSA 5HROA 4CJEA 3AA3A 1S9GA 3NBPA 3WNFA 4O0JA 4C8KA 2D0BA 3ITHA 1D8YA 4FJNA 1T7PA 1ZBIA 3A2FA 2XRIA 3I8DA 4CECA 1TKTA 1IG9A 3QIPA 3RTVA 2ATQA 2D0CA 4FM1A 1U47A 4CHPA 2G8VA 3S9HA 2WONA 3CQ8A 3M8SA 3SYZA 1U04A 2QXFA 3RR7A 2KFZA 3MAQA 2OZSA 4FK2A 2IGIA 1QHTA 1ZYQA 1BI4A 4Z4CA 4CJPA 4DWIA 3ZSXA 1KFDA 3AO1A 4F4KA 2RKIA 3M8QA 3KLIA 1L5UA 1DLOA 1RTJA 4KTQA 4CJ3A 3KK2A 4YFUA 2YKMA 2JGUA 5HRPA 3NE6A 3SQ1A 2G8HA 3SQ4A 3MXIA 4F2SA 4Q0BA 4OVLA 4FK0A 2XY6A 2OPRA 2YV0X 5KGWA 4CFAA 4HTUA 4OKEA 1ZBLA 4B8CA 2YHBA 3HPGA 3NF6A 3V1QA 4DFJA 4BDYA 4DTPA 2QKKA 1G15A 2FBYA 1ASWA 3AVIA 4B9LA 3IG1A 3K5OA 5HRNA 3V4IA 3O4NA 5JS2A 4W5QA 4DS4A 3V9WA 1IO2A 1KLNA 2I5JA 4NCAA 3V9UA 4OKJA 3AO3A 4CJ5A 3HVRA 4FJKA 2XHBA 1WSEA 4CIGA 3QNOA 2RF2A 3OS1A 1HNVA 2G8UA 3NAEA 4KV8A 3SUNA 3AVAA 4CFBA 3LZIA 3HK2A 4BDZA 4PUOA 1NKBA 4N56A 2PY5A 1X9SA 4FLYA 1VK0A 4KHNA 1LAVA 3OJUA 1NK4A 2X6NA 4CFCA 4CEQA 3S3NA 1RTDA 2KZMA 3VQQA 3HPOA 2OYQA 4L8RB 3SUOA 2HHWA 3KK1A 3V1OA 1A5VA 3IRXA 4JRPA 2FC0A 1JLEA 3V1RA 2F96A 3TAGA 4FZZA 4I7FA 1NOZA 3AVLA 3U3YA 1BIZA 2VWJA 3I0RA 3RRHA 3HPHA 3QEPA 4KAZA 3KJVA 4DU4A 2BANA 3KD5E 3FFIA 3AVCA 1BHLA 1RBTA 4OGEA 4OPKA 3P83D 3KLEA 2Q3SA 1VRTA 5FROA 3V9XA 4O0IA 2HMIA 3QIOA 2VG6A 3OYIA 1KLMA 3ISNC 3AVJA 1U45A 4JRQA 4N76A 1Q9XA 4H8KA 4PWDA 2HHXA 2E6MA 4FW2A 4Z0UA 4KKOA 4FM0A 4M3TA 4DSLA 4BE2A 3I0SA 3TARA 3T3FA 1XI1A 4KTZA 4CJKA 5K14A 5J1EA 3OJSA 1BI4B 3K57A 4F2RA 4PQUA 5I42A 2QKBA 1GOCA 5KTQA 4DU3A 3E01A 1B9DA 3RWUA 5KI6A 2P1JA 3DM2A 3F9KA 2FBTA 3OS0A 4DU1A 4DFKA 2B4JA 5HLFA 1N6QA 3PO5A 3SJJA 1L3UA 1NJXA 3NHGA 3BDPA 2O4GA 4CK2A 3RRGA 2HVIA 3CM6A 3QEWA 3OYAA 2RN2A 1J53A 3OS2A 4DSJA 3DLKA 3VQAA 2IDOA 4BE1A 4B08A 4G1QA 1DTTA 3V9SA 3D45A 1TKZA 2WOMA 4RW9A 4DSFA 2XY5A 1N5YA 1S9EA 1U4BA 3L3VA 3PX4A 4FLZA 4R5PA 4FLXA 1QSLA 4F8RA 3OYCA 3HM9A 1UWBA 3CFRA 5HRRA 1B9FA 3VQ5A 4DF4A 1SL2A 2HHUA 4Z4FA 3TAPA 3NF8A 3TANA 2X6SA 2HHVA 4KHQA 2AJQA 4CEFA 3AVNA 1JKHA 1S1WA 2DTUA 3OYGA 1IH7A 1TKXA 1VSDA 3RR8A 3MXJA 4I9LA 3SPYA 4CEDA 3V6DA 1A5XA 1NJWA 1X1PA 2F8TA 1JLCA 4FJMA 3L2VA 3CG7A 4E1NA 4E7LA 3TI0A 4PA1A 2Z1JA 3SUQA 4CHOA 4H4MA 4CJFA 2P5OA 2DY4A 3K5MA 1W9HA 1LWEA 4CEZA 3ALYA 3ZSQA 3ZSWA 4B8AB 1TK0A 4Z4GA 3O4QA 4FJ5A 2HHTA 1FXXA 4IBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8O A;  1T03 A;  1EXQ A;  3DI6 A;  2HB5 A;  5FRM A;  4DTU A;  4J2D A;  4B3O A;  2DFH A;  3QO9 A;  4PY5 A;  4KB0 A;  3DLE A;  4F3T A;  1VSK A;  1Y97 A;  4OPJ A;  3DOL A;  4ZTF A;  3ZT4 A;  1VSH A;  3QNN A;  4KB1 A;  1QTM A;  2Z1I A;  5CY4 A;  2EHG A;  3DRR A;  1IKX A;  4CJL A;  1QE1 A;  4CGD A;  4B9S A;  1X9W A;  4ELU A;  1L3S A;  4E7H A;  2D0A A;  4KRE A;  1YT3 A;  4KHW A;  2VG7 A;  5C25 A;  4CHQ A;  1J54 A;  3SCX A;  3NF9 A;  4O5B A;  1BQM A;  1ITG A;  3ZSO A;  4CEB A;  3LZJ A;  2G8K A;  4E0D A;  4HCB A;  4BWJ A;  4DTN A;  1FKP A;  4K8X A;  3C95 A;  3DYA A;  4YNQ A;  4FCY A;  3U3G A;  3AVB A;  3OYE A;  4FLU A;  1S1X A;  3DLH A;  1SUQ A;  4B9N A;  4J2A A;  3QIN A;  1BIU A;  3DRP A;  2PYL A;  4DSK A;  4RW6 A;  4IFV A;  1HQU A;  3LDS A;  4Z4H A;  1HJR A;  3BGR A;  4C8N A;  4W5N A;  1VSL A;  4IG3 A;  3VQ7 A;  1I3A A;  2IC3 A;  4Z4E A;  2HND A;  3CM5 A;  3JYT A;  1LW0 A;  3VA3 A;  3NH0 A;  1NJY A;  3LP3 A;  2B5J A;  3K2P A;  3ZSZ A;  1C1A A;  4GMJ B;  3OYH A;  1NKE A;  4EZ6 A;  3NDK A;  3G0Z A;  1BL3 A;  4FW1 A;  3EZ5 A;  5C24 A;  3D0P A;  4JS4 A;  3ZCM A;  4J2E A;  2KZZ A;  3MEG A;  1RDC A;  3QES A;  4E7J A;  1KVC A;  3L2Q A;  3PUF A;  3L2W A;  3AV9 A;  3ZSR A;  4CHN A;  5J2Q A;  5DMR A;  1CLQ A;  4FLT A;  4BE0 A;  1WSH A;  2FBV A;  2GBZ A;  1JLB A;  2ETJ A;  3LPU A;  3P1G A;  4KHY A;  3VQ4 A;  2D5R A;  3ZT1 A;  2XY7 A;  4LSL A;  1ZBU A;  3SV3 A;  1U49 A;  1REV A;  3AA5 X;  4GVM A;  1RDA A;  3V9Z A;  1O1W A;  1S1V A;  3SPZ A;  1BCO A;  3QET A;  3UIQ A;  4KO0 A;  1C1B A;  1TK5 A;  1L3T A;  3AO2 A;  4E19 A;  1J9A A;  3PX6 A;  1NK0 A;  4FZX C;  2EX3 A;  1T8E A;  4H4O A;  3HJF A;  4OGC A;  3VQB A;  1CZ9 A;  1UA1 A;  2YNG A;  1KFS A;  4LH5 A;  1XHZ A;  3LAM A;  1EX4 A;  1U48 A;  4QOZ B;  3K58 A;  4OJR A;  4RW4 A;  1VSF A;  3RMC A;  1TV6 A;  5KRT A;  2G8F A;  1RT6 A;  2QK9 A;  1GOA A;  2HVH A;  1MU2 A;  4Y1C A;  3SZ2 A;  3L2U A;  4DFP A;  4E1M A;  1TVR A;  3PV8 A;  4CF8 A;  3TAM A;  2G8I A;  4AIL C;  2YKN A;  1SKR A;  2P51 A;  4AHT A;  4O55 A;  4M3U A;  1JL2 A;  4CIF A;  1HPZ A;  1YTU A;  4CHY A;  2ZE2 A;  1TAU A;  1IKY A;  3DMJ A;  1NJZ A;  2E6L A;  1EP4 A;  2OPS A;  4M3R A;  3WNH A;  4CJ4 A;  3JSM A;  3M8P A;  4DF8 A;  3C6T A;  3QER A;  3AO4 A;  2PYJ A;  4FJL A;  1RBR A;  1HYZ A;  3SV4 A;  1KVB A;  1WSI A;  4DTO A;  1RT7 A;  5T7B A;  4E7I A;  2BGG A;  3HL8 A;  3WNE A;  1SL1 A;  3LPT A;  1VSI A;  1ZBF A;  1BIS A;  1NK5 A;  3H08 A;  3OYF A;  3TR8 A;  1I39 A;  3LAN A;  1RTI A;  1Q9Y A;  4CGJ A;  2B6A A;  3OYL A;  4KI6 A;  3MXM A;  4CJQ A;  1RBS A;  3VN5 A;  4M3Y A;  4FJH A;  2FBX A;  5CYM A;  1NK8 A;  4HUE A;  3C94 A;  4Q5V A;  4KI4 A;  1NOY A;  5J2N A;  1QS4 A;  1QSY A;  3KKR A;  1JLQ A;  4O4G A;  4CES A;  3VA0 A;  1UAX A;  3OYD A;  4N41 A;  3CFO A;  2KW4 A;  4MFB A;  4CJW A;  2Y1J A;  3AA4 A;  1IKW A;  2RPI A;  3LAK A;  4M41 A;  4KRF A;  2Y1I A;  3ZSV A;  4CF1 A;  4N5S A;  4IG0 A;  1HYV A;  4KHU A;  3DRS A;  4CCH A;  2A1S A;  1C0T A;  3F73 A;  3SNN A;  4CER A;  4LH4 A;  4FJX A;  4CF2 A;  4FLV A;  3CFP A;  2BDP A;  1LAW A;  4N47 A;  3TWH A;  3KK3 A;  3EY1 A;  1CXU A;  2Z1G A;  1SKS A;  2HNZ A;  1IKV A;  3AVM A;  4DMN A;  2GUI A;  2YNF A;  2YHA A;  3AVK A;  1HMV A;  4I2Q A;  4FJG A;  2IOC A;  3KLG A;  4WE1 A;  4HVJ A;  3O3H A;  1VSE A;  4IDK A;  2X74 A;  4W5R A;  4C8L A;  4CHZ A;  2YNH A;  4B9M A;  1Q8I A;  3OY9 A;  4E7K A;  1RT5 A;  4JLH A;  4DLE A;  3S3O A;  1JXB A;  3B6O A;  4CEO A;  4HHT A;  3VQ9 A;  4AHV A;  1T05 A;  4NCG A;  4DTM A;  4FXD A;  1VSM A;  1EET A;  2X78 A;  3IS9 A;  4CEE A;  3HYF A;  3AVH A;  3TAE A;  3PX0 A;  1HRH A;  5SZT A;  1UA0 A;  4HUF A;  4CGH A;  2YNI A;  4K8Z A;  4ELT A;  1JLG A;  3DLB A;  2HHQ A;  1RTH A;  1SV5 A;  4NCB A;  3NFA A;  4CK3 A;  1K6Y A;  3TAB A;  1A5W A;  2NUB A;  4CJS A;  5HP1 A;  1DTQ A;  3VQ6 A;  1RBV A;  3U6F A;  3HST B;  1NKC A;  3LWL A;  4E3S A;  4FJJ A;  1NK9 A;  1BCM A;  1ASV A;  2DFE A;  4LY7 A;  4MQ3 A;  2ITG A;  1C0U A;  4B9V A;  1R0A A;  4FJI A;  1JXE A;  1YTA A;  1KCF A;  1Z26 A;  3B6P A;  1S6Q A;  1D9F A;  3QEV A;  4C8M A;  4EZ9 A;  4OKK A;  1D5A A;  4DTR A;  4DQP A;  4ICL A;  1JL1 A;  3OVN A;  3HP6 A;  5EU7 A;  2VG5 A;  4CF9 A;  3NH1 A;  4DQQ A;  4DSE A;  1TL3 A;  4AH9 A;  4M3W A;  4ID5 A;  2OPQ A;  1C1C A;  1TGO A;  4W5O A;  5J2M A;  1WSG A;  1S1U A;  3KKS A;  4FYD A;  3HO1 A;  2IS3 A;  1WSF A;  1WAJ A;  4CGG A;  4FJ7 A;  4FK4 A;  4O44 A;  1SKW A;  2ZQB A;  3KIO A;  1S1T A;  4TSX A;  4AHC A;  3IAY A;  1F21 A;  4BAC A;  4OLA A;  3VQ8 A;  5HRS A;  2ZD1 A;  1RDD A;  3TAF A;  1QQC A;  2JLE A;  4JS5 A;  3TAQ A;  2KFN A;  3WNG A;  4Y1D A;  4FM2 A;  4AHS A;  3KLF A;  3THV A;  1LWC A;  3LP2 A;  3MEE A;  3SI6 A;  3NH2 A;  1X9M A;  3PY8 A;  3S3M A;  1S5J A;  3G10 A;  5C42 A;  3MED A;  4LD0 A;  3L8B A;  1LW2 A;  1TAQ A;  4ZHR A;  3LWM A;  4KTW A;  3C6U A;  1RBU A;  4M42 A;  3HVT A;  4M3X A;  1RNH A;  5KGX A;  4DG1 A;  4DQS A;  1J5O A;  3ZSY A;  5HBM A;  1C6V A;  1KTQ A;  2OZM A;  2OPP A;  4F3O A;  4KHS A;  3HT3 A;  4DS5 A;  1SL0 A;  3VQC A;  3HXM A;  4M3Z A;  4FJ9 A;  5DK5 A;  1TKD A;  4E89 A;  4KPY A;  1GOB A;  1WAF A;  3OYB A;  1NK6 A;  5D3G A;  1KVA A;  3CYM A;  2E4L A;  4B9T A;  2HW3 A;  1QSS A;  3NGY A;  3RMD A;  4DQR A;  3O3F A;  1L3V A;  4J2B A;  1RT2 A;  1NK7 A;  4GW6 A;  1RT3 A;  2IAJ A;  4DTJ A;  4RW8 A;  3ZT3 A;  1JLA A;  3NF7 A;  4CFD A;  4EP4 A;  3L2R A;  1VSJ A;  3K5N A;  3RMB A;  3SUP A;  5I3U A;  4IFY A;  3AVG A;  5SWM A;  3OYM A;  4DTX A;  2F8S A;  3VQD A;  4KFB A;  1XC9 A;  4Z4I A;  1UOC A;  3DLR A;  1FKO A;  3NGZ A;  3VQP A;  4QAG A;  2PZS A;  1WSJ A;  1RT4 A;  3LAL A;  4CGI A;  1LV5 A;  1XHX A;  2Z1H A;  2XY8 A;  2DFF A;  3SQ2 A;  2LSN A;  3QEI A;  3K59 A;  4BDP A;  3AO5 A;  3AVF A;  1BGX T;  1HNI A;  3VQE A;  2P5G A;  3EYZ A;  3LP0 A;  4AHU A;  4BWM A;  3OYK A;  3KLH A;  3DOK A;  5CYQ A;  3O3G A;  1ZBH A;  4QCL A;  4RW7 A;  4NYF A;  4B9U A;  1RCH A;  1JLF A;  4CJR A;  1ASU A;  1C0M A;  4M45 A;  3KD1 E;  4ZTJ A;  3V81 A;  4FVM A;  4DLG A;  2G8W A;  4CK1 A;  1KRP A;  1RDB A;  4CJV A;  4IKF A;  2OA8 A;  3L3U A;  4HCC A;  2HHS A;  2BE2 A;  4CF0 A;  4CGF A;  4UQG A;  2HNY A;  3ZT2 A;  4NYN A;  2A1R A;  4OLB A;  4DTS A;  2KTQ A;  4CJT A;  4CJU A;  4RG8 A;  4DQI A;  2W42 A;  1WLJ A;  4FZY A;  1VRU A;  3OYN A;  5CZ1 A;  3RMA A;  1YVU A;  4XIU A;  3NGI A;  3AA2 A;  1WN7 A;  1RT1 A;  5JS1 A;  4DFM A;  5E41 A;  4HUG A;  4LSN A;  1B92 A;  1HQE A;  1CXQ A;  1TL1 A;  5FRN A;  3ULD A;  4CE9 A;  3HP9 A;  3T1A A;  2R7Y A;  5KRS A;  4W5T A;  1Z25 A;  2GV9 A;  1FK9 A;  3K5L A;  3KTQ A;  3SQ0 A;  3MEC A;  3PO4 A;  4FJ8 A;  4ELV A;  3LP1 A;  4I9Q A;  1CZB A;  1RIL A;  2KQ2 A;  4EP5 A;  5CZ2 A;  1WNS A;  1S6P A;  3P5J A;  2O4I A;  3T19 A;  2VWK A;  4FLW A;  1D9D A;  1KSP A;  3M8R A;  4CEA A;  1TK8 A;  5J2P A;  2XO7 A;  1LWF A;  3QEX A;  4I2P A;  3OYJ A;  3ASM A;  1BQN A;  3ZT0 A;  3NCI A;  4DSI A;  3DLG A;  4ID1 A;  1XWL A;  4CIE A;  5FDL A;  3QLH A;  1W0H A;  1EKE A;  4AHR A;  1HYS A;  5HRO A;  4CJE A;  3AA3 A;  1S9G A;  3NBP A;  3WNF A;  4O0J A;  4C8K A;  2D0B A;  3ITH A;  1D8Y A;  4FJN A;  1T7P A;  1ZBI A;  3A2F A;  2XRI A;  3I8D A;  4CEC A;  1TKT A;  1IG9 A;  3QIP A;  3RTV A;  2ATQ A;  2D0C A;  4FM1 A;  1U47 A;  4CHP A;  2G8V A;  3S9H A;  2WON A;  3CQ8 A;  3M8S A;  3SYZ A;  1U04 A;  2QXF A;  3RR7 A;  2KFZ A;  3MAQ A;  2OZS A;  4FK2 A;  2IGI A;  1QHT A;  1ZYQ A;  1BI4 A;  4Z4C A;  4CJP A;  4DWI A;  3ZSX A;  1KFD A;  3AO1 A;  4F4K A;  2RKI A;  3M8Q A;  3KLI A;  1L5U A;  1DLO A;  1RTJ A;  4KTQ A;  4CJ3 A;  3KK2 A;  4YFU A;  2YKM A;  2JGU A;  5HRP A;  3NE6 A;  3SQ1 A;  2G8H A;  3SQ4 A;  3MXI A;  4F2S A;  4Q0B A;  4OVL A;  4FK0 A;  2XY6 A;  2OPR A;  2YV0 X;  5KGW A;  4CFA A;  4HTU A;  4OKE A;  1ZBL A;  4B8C A;  2YHB A;  3HPG A;  3NF6 A;  3V1Q A;  4DFJ A;  4BDY A;  4DTP A;  2QKK A;  1G15 A;  2FBY A;  1ASW A;  3AVI A;  4B9L A;  3IG1 A;  3K5O A;  5HRN A;  3V4I A;  3O4N A;  5JS2 A;  4W5Q A;  4DS4 A;  3V9W A;  1IO2 A;  1KLN A;  2I5J A;  4NCA A;  3V9U A;  4OKJ A;  3AO3 A;  4CJ5 A;  3HVR A;  4FJK A;  2XHB A;  1WSE A;  4CIG A;  3QNO A;  2RF2 A;  3OS1 A;  1HNV A;  2G8U A;  3NAE A;  4KV8 A;  3SUN A;  3AVA A;  4CFB A;  3LZI A;  3HK2 A;  4BDZ A;  4PUO A;  1NKB A;  4N56 A;  2PY5 A;  1X9S A;  4FLY A;  1VK0 A;  4KHN A;  1LAV A;  3OJU A;  1NK4 A;  2X6N A;  4CFC A;  4CEQ A;  3S3N A;  1RTD A;  2KZM A;  3VQQ A;  3HPO A;  2OYQ A;  4L8R B;  3SUO A;  2HHW A;  3KK1 A;  3V1O A;  1A5V A;  3IRX A;  4JRP A;  2FC0 A;  1JLE A;  3V1R A;  2F96 A;  3TAG A;  4FZZ A;  4I7F A;  1NOZ A;  3AVL A;  3U3Y A;  1BIZ A;  2VWJ A;  3I0R A;  3RRH A;  3HPH A;  3QEP A;  4KAZ A;  3KJV A;  4DU4 A;  2BAN A;  3KD5 E;  3FFI A;  3AVC A;  1BHL A;  1RBT A;  4OGE A;  4OPK A;  3P83 D;  3KLE A;  2Q3S A;  1VRT A;  5FRO A;  3V9X A;  4O0I A;  2HMI A;  3QIO A;  2VG6 A;  3OYI A;  1KLM A;  3ISN C;  3AVJ A;  1U45 A;  4JRQ A;  4N76 A;  1Q9X A;  4H8K A;  4PWD A;  2HHX A;  2E6M A;  4FW2 A;  4Z0U A;  4KKO A;  4FM0 A;  4M3T A;  4DSL A;  4BE2 A;  3I0S A;  3TAR A;  3T3F A;  1XI1 A;  4KTZ A;  4CJK A;  5K14 A;  5J1E A;  3OJS A;  1BI4 B;  3K57 A;  4F2R A;  4PQU A;  5I42 A;  2QKB A;  1GOC A;  5KTQ A;  4DU3 A;  3E01 A;  1B9D A;  3RWU A;  5KI6 A;  2P1J A;  3DM2 A;  3F9K A;  2FBT A;  3OS0 A;  4DU1 A;  4DFK A;  2B4J A;  5HLF A;  1N6Q A;  3PO5 A;  3SJJ A;  1L3U A;  1NJX A;  3NHG A;  3BDP A;  2O4G A;  4CK2 A;  3RRG A;  2HVI A;  3CM6 A;  3QEW A;  3OYA A;  2RN2 A;  1J53 A;  3OS2 A;  4DSJ A;  3DLK A;  3VQA A;  2IDO A;  4BE1 A;  4B08 A;  4G1Q A;  1DTT A;  3V9S A;  3D45 A;  1TKZ A;  2WOM A;  4RW9 A;  4DSF A;  2XY5 A;  1N5Y A;  1S9E A;  1U4B A;  3L3V A;  3PX4 A;  4FLZ A;  4R5P A;  4FLX A;  1QSL A;  4F8R A;  3OYC A;  3HM9 A;  1UWB A;  3CFR A;  5HRR A;  1B9F A;  3VQ5 A;  4DF4 A;  1SL2 A;  2HHU A;  4Z4F A;  3TAP A;  3NF8 A;  3TAN A;  2X6S A;  2HHV A;  4KHQ A;  2AJQ A;  4CEF A;  3AVN A;  1JKH A;  1S1W A;  2DTU A;  3OYG A;  1IH7 A;  1TKX A;  1VSD A;  3RR8 A;  3MXJ A;  4I9L A;  3SPY A;  4CED A;  3V6D A;  1A5X A;  1NJW A;  1X1P A;  2F8T A;  1JLC A;  4FJM A;  3L2V A;  3CG7 A;  4E1N A;  4E7L A;  3TI0 A;  4PA1 A;  2Z1J A;  3SUQ A;  4CHO A;  4H4M A;  4CJF A;  2P5O A;  2DY4 A;  3K5M A;  1W9H A;  1LWE A;  4CEZ A;  3ALY A;  3ZSQ A;  3ZSW A;  4B8A B;  1TK0 A;  4Z4G A;  3O4Q A;  4FJ5 A;  2HHT A;  1FXX A;  4IBN A; 
#chains in the Genus database with same CATH topology
 1VQ7 N;  1T03 A;  2A3Z A;  1EXQ A;  3FZF A;  3CC7 N;  4DTU A;  3QO9 A;  4K41 A;  3DLE A;  4A59 A;  4OPJ A;  3SAH A;  5TKY A;  4AM7 A;  3ZT4 A;  3QNN A;  2Z1I A;  3J8A A;  5CY4 A;  3DRR A;  1NMN A;  4ELU A;  2E20 A;  2D0A A;  3KK7 A;  2VG7 A;  4YHH K;  4CHQ A;  5AQV A;  4DUY K;  3NF9 A;  2G8K A;  1BQM A;  4CEB A;  4YOU A;  5C10 A;  4HCB A;  2JWL A;  4YNQ A;  3AVB A;  3DLH A;  1V4S A;  3FGU A;  4LF6 K;  4H0Y B;  1BIU A;  1W2B M;  4DSK A;  4RW6 A;  4IFV A;  5M1O A;  3H46 O;  3BGR A;  4C8N A;  2IC3 A;  4LF8 K;  1LW0 A;  4NXN K;  3NH0 A;  3LP3 A;  3K2P A;  3OYH A;  5AQK A;  5C24 A;  3MCA B;  3UKU B;  3MEG A;  1RDC A;  3TSQ A;  4DB3 A;  4BRI A;  4YDU A;  1WOQ A;  1OVY A;  1KXP A;  4FLT A;  3CJB A;  4JAX A;  4C1N I;  4H0V B;  3G6E N;  2D5R A;  3GE1 A;  4LSL A;  4BGA A;  1U49 A;  1NJI O;  4JD2 B;  4GVM A;  1D4X A;  1O1W A;  1IBM K;  1BCO A;  3QET A;  3UIQ A;  3E9O A;  1C1B A;  4B3T K;  1BOT O;  1TUU A;  4CZL A;  4E19 A;  2VYP A;  4JKG B;  4H4O A;  2Q2R A;  1Z6R A;  1XHZ A;  1U48 A;  1TYQ A;  2FSN A;  3WQT A;  4F9O A;  1TV6 A;  1GOA A;  2OAN A;  2P9K A;  3L2U A;  1J5E K;  3BEX A;  4BR7 A;  1JL2 A;  4WFB L;  1HPZ A;  1YTU A;  2ZE2 A;  1TAU A;  1IKY A;  4NLC A;  2WUS A;  3T69 A;  3O9Q A;  1NGA A;  2YJE A;  3UKR A;  1BIS A;  5IWA K;  3LAN A;  5C2D A;  4CGJ A;  2B6A A;  3OYL A;  4KI6 A;  3MXM A;  4JI6 K;  1RBS A;  4FJH A;  2FBX A;  1YF5 L;  1JJ2 M;  3KKR A;  4PL8 A;  1OKJ A;  4N41 A;  2KW4 A;  4MFB A;  4CJW A;  2Y1J A;  3SJH A;  4KRF A;  4CF1 A;  4FWO A;  4CCH A;  2A1S A;  1U2V A;  3F73 A;  1NGC A;  4FJX A;  3SBT A;  4FLV A;  3CFP A;  2BDP A;  1LAW A;  4N47 A;  2Z1G A;  2H3G X;  2GUI A;  4M63 C;  4I2Q A;  4HVJ A;  2PAV A;  4H0T B;  1Q8I A;  3OY9 A;  1HNX K;  2ZM6 K;  3CQX A;  3B6O A;  3VQ9 A;  4AHV A;  4NCG A;  5EY4 A;  1VSM A;  1EET A;  2X78 A;  5BR8 K;  2O8C A;  3HYF A;  3PX0 A;  4CGH A;  1JLG A;  5M1N A;  3NFA A;  1C0G A;  3LDO A;  3WQU A;  4V19 S;  1A5W A;  2NUB A;  5HP1 A;  3E9P A;  5F2R A;  3HST B;  1YVN A;  4R79 A;  4LF7 K;  4E3S A;  3CPW M;  3M6G A;  1N34 K;  4MO5 A;  2DFE A;  2VCP A;  1SQK A;  2V51 B;  4NLB A;  1JXE A;  1Z26 A;  3J80 O;  1LOT B;  1D9F A;  4C8M A;  4WFA L;  4DQP A;  4ISG A;  3OVN A;  4DSE A;  3QB0 A;  4AH9 A;  4ID5 A;  4NB4 A;  1C1C A;  3RSE B;  1WSG A;  3KKS A;  3HO1 A;  4FJ7 A;  1V4T A;  1SKW A;  3C6A A;  2ZQB A;  4TSX A;  4WFN L;  1F21 A;  4BAC A;  4OLA A;  2EWS A;  3G71 N;  5BRH A;  3TAF A;  3A0I X;  3UKU A;  1K8K B;  4Y1D A;  4FM2 A;  5AQM A;  4B3R K;  1X9M A;  1LWC A;  3LP2 A;  3MEE A;  1S5J A;  5C42 A;  4BRC A;  1LW2 A;  3VET A;  3LWM A;  4EHT A;  5KGX A;  4DG1 A;  3ZSY A;  4L3Q A;  3HT3 A;  1RFQ A;  1MWK A;  4FJ9 A;  5DK5 A;  5M1P A;  2QXL A;  1KVA A;  1XUP O;  2E4L A;  4GKK K;  2CH6 A;  4DQR A;  1BO5 O;  3O3F A;  4J2B A;  1RT2 A;  4DTJ A;  1RT3 A;  4MDA A;  3RMB A;  4CFD A;  3K5N A;  5I3U A;  3R9P A;  5SWM A;  3AVG A;  3THX A;  2F8S A;  1QVG M;  2QA4 N;  1IJJ A;  4CBW A;  1FKO A;  4BRG A;  1OH8 A;  3DXM A;  4CGI A;  1LV5 A;  3ZET B;  2Z1H A;  1YUW A;  4A57 A;  5AQT A;  4JKE A;  1QZ6 A;  2P5G A;  5EX5 A;  4BWM A;  4QCL A;  3THY A;  2NNW A;  4RW7 A;  4B9U A;  1ASU A;  2HVI A;  3V81 A;  3MN7 A;  1RDB A;  2OA8 A;  3L3U A;  3CCR N;  4HCC A;  2ASM A;  4KH4 A;  4A5B A;  4CF0 A;  1KD1 O;  3ZT2 A;  2ASP A;  4DTS A;  4FOI A;  2YJF A;  2OCE A;  4DQI A;  1XMO K;  3AA2 A;  5AQX A;  3DWL A;  3VPZ A;  4IDH A;  3U9Z A;  3CER A;  2YHW A;  3TTC A;  1CXQ A;  1TL1 A;  1HUX A;  2GV9 A;  4I6M A;  4K25 A;  1DEJ A;  2IVO A;  3MEC A;  3KTQ A;  2A40 A;  3LP1 A;  3M3Z A;  4CJ7 A;  2YCH A;  1FJG K;  1WNS A;  1BU6 O;  2O4I A;  1G99 A;  4KH5 A;  2O8C B;  3CC2 N;  3R1X A;  4CEA A;  1TK8 A;  5J2P A;  3Q7B A;  4LC9 B;  5FPE A;  3ASM A;  3NCI A;  5HL7 L;  2OTJ N;  5FDL A;  1WBB A;  4AHR A;  3NBP A;  4C8K A;  2D0B A;  3ITH A;  2XRI A;  1U6Z A;  2W6K A;  3O08 A;  4DV2 K;  4XH1 A;  1YJ9 N;  3CHW A;  2A5X A;  3M5R A;  3RR7 A;  2WON A;  3CQ8 A;  3SYZ A;  3H3N O;  2WTU A;  3MAQ A;  3CCL N;  3RSE A;  3J81 O;  3ZSX A;  1KFD A;  4JHD B;  5CHI A;  5IT9 O;  1DLO A;  1RTJ A;  3THW A;  3NE6 A;  3SQ4 A;  4OVL A;  2YV0 X;  3R8E A;  4BRL A;  1ZBL A;  1ASW A;  3IG1 A;  3VOV A;  3V9W A;  2PBD A;  4FO0 A;  4CIG A;  3QNO A;  5C12 A;  3P39 A;  4KV8 A;  3AVA A;  3LZI A;  4BDZ A;  4IEI A;  5CE3 A;  4UY8 O;  4X62 K;  4N56 A;  2HF4 A;  4FLY A;  1Q86 O;  4KHN A;  4PKI A;  3S3N A;  1YI2 N;  1RTD A;  3VQQ A;  2HHW A;  5GAH P;  3V1O A;  3FZH A;  4AF1 A;  3TAG A;  1NOZ A;  3HSC A;  2NRX A;  1HJO A;  2D0P A;  4DU4 A;  1BHL A;  5JVG L;  2Q36 A;  3P83 D;  2Q0U A;  5FRO A;  3TSU A;  3O9U A;  5KPZ A;  2P9L A;  1E4F T;  2VG6 A;  3ISN C;  3OYI A;  4JRQ A;  2Q31 A;  4Z0U A;  4M3T A;  4BE2 A;  2YI1 A;  3ZX2 A;  3EN9 A;  5K14 A;  4GV6 A;  2QKB A;  5KTQ A;  3BP8 A;  4IO8 A;  4DFK A;  3ULE B;  4HTL A;  4CK2 A;  5E84 A;  1J53 A;  1Q18 A;  4DSJ A;  4DUZ K;  1HNW K;  5F0X A;  1DTT A;  4RW9 A;  2VWB A;  4DSF A;  1QZ5 A;  2NRV A;  4JK7 A;  3NMU A;  1ILY A;  2E2O A;  1QSL A;  4A5A A;  3HM9 A;  1UWB A;  5HRR A;  4DF4 A;  3EO3 A;  4BR5 A;  2X6S A;  4CBU A;  2NRR A;  3DXK B;  3AVN A;  4XEI A;  2P9I A;  3RR8 A;  4DR5 K;  1NJW A;  1QVF M;  4JKG A;  4NXM K;  4FJM A;  2E2N A;  4E1N A;  4E7L A;  3TI0 A;  1K9M O;  4PA1 A;  2Z1J A;  4CHO A;  2P5O A;  1IG8 A;  5AFU H;  3O4Q A;  1VHX A;  4FJ5 A;  1FXX A;  3L0Q A;  2QWL A;  5AQI A;  4F3T A;  4ZTF A;  5GAD P;  3WEE B;  2EHG A;  3BF3 A;  3CCJ N;  4BC3 A;  5C25 A;  1J54 A;  4DHY A;  3SCX A;  2O8D A;  1HKC A;  4FOE A;  1WB9 A;  3ZSO A;  3VEX A;  4E0D A;  4DTN A;  3OA9 A;  3C95 A;  1GLC G;  3DYA A;  4IO9 L;  4FLU A;  5AQZ A;  4B9N A;  4IZ9 A;  4A2B A;  3QIN A;  2PYL A;  3THW B;  1HQU A;  3LDS A;  1VSL A;  3VQ7 A;  1I3A A;  3KVG A;  4Z4E A;  2ZJQ L;  3O6W A;  2B5J A;  4EZ6 A;  3NDK A;  4IWV A;  3EZ5 A;  3D0P A;  3ZCM A;  1KAY A;  1OVQ A;  3QES A;  1KVC A;  3L2Q A;  3PUF A;  5AQF A;  1CLQ A;  4CHN A;  3LDP A;  3VER A;  5DMR A;  4BE0 A;  2O8E B;  1WSH A;  2Q0R A;  5AQH A;  3LPU A;  3L4I A;  5KQD A;  3WXI A;  2XY7 A;  3MX2 A;  4OPA A;  3SV3 A;  1S1V A;  3SPZ A;  4KO0 A;  4FZX C;  1NK0 A;  2EX3 A;  1T8E A;  1SAZ A;  4OGC A;  3VQB A;  1UA1 A;  1KFS A;  3LAM A;  1M1K O;  3K58 A;  4OJR A;  4H5V A;  3RMC A;  2G8F A;  1MU2 A;  4DKW A;  3CJ9 A;  1TVR A;  4BC2 A;  4BRD A;  2YKN A;  4AHT A;  4M3U A;  1HNZ K;  4Z94 A;  1EP4 A;  4CJ4 A;  4DF8 A;  3QER A;  2PYJ A;  3A5L C;  3C6H A;  3O4W A;  3P31 A;  1KVB A;  1WSI A;  4DTO A;  4JV5 K;  4E7I A;  3HL8 A;  3WNE A;  3LPT A;  2JWK A;  1NK5 A;  3OBW A;  1RTI A;  3VN5 A;  1QS4 A;  1JLQ A;  3VEY A;  1UAX A;  1BG3 A;  3CFO A;  1MDU B;  1QQO A;  2P9S A;  4DV1 K;  3AA4 A;  1IKW A;  4DR7 K;  1XQS C;  2BTF A;  3ZSV A;  2Y1I A;  4KHU A;  3BY5 A;  4CZF A;  5ADX H;  4CF2 A;  3AAQ A;  3VMF B;  3CCM N;  4LFB K;  2P9P A;  3KK3 A;  3EY1 A;  1CXU A;  3DXK A;  3AVM A;  2YNF A;  2VGM A;  4QS8 A;  2YHA A;  4FVU A;  3ZX3 A;  2ZWH A;  1HMV A;  4O8K A;  4FJG A;  2F9W A;  3O3H A;  2YNH A;  4B9M A;  1OH7 A;  4E7K A;  1BUP A;  1RT5 A;  5H1S Q;  4JLH A;  3EE9 A;  5BPM A;  4DLE A;  3GL1 A;  4HHT A;  3CJ1 A;  4JKH A;  1GLL O;  3TAE A;  2ITM A;  3CQY A;  2YNI A;  4EFH A;  1Q81 O;  1HX1 A;  4NCB A;  4CJS A;  1RDU A;  1RBV A;  1NKC A;  4RWT A;  2V7Z A;  3AGK A;  1BCM A;  1ASV A;  2F7T A;  2FSJ A;  4MQ3 A;  4K42 A;  2Q97 A;  1C0U A;  1YTA A;  1KCF A;  3RVC A;  3FZK A;  4OKK A;  3ZEU B;  1RGI A;  4DTR A;  4ICL A;  2UUA K;  1BA1 A;  2UXD K;  5EXW A;  2HOE A;  3UKR B;  4DCH A;  1NGD A;  1TGO A;  2CGJ A;  4B1Y B;  2D4W A;  4O44 A;  5GAG P;  1P8Z A;  3VQ8 A;  4BR2 A;  1RDD A;  3TAQ A;  4BVO A;  3THV A;  3PY8 A;  3O1B A;  1NBW A;  5BN8 A;  4ZHR A;  2O8B B;  4KTW A;  3C6U A;  3VF6 A;  4I6M B;  3HVT A;  4M42 A;  1J5O A;  4JKD A;  5HBM A;  1KTQ A;  2OZM A;  2QWO A;  1ATS A;  4DS5 A;  2V7Y A;  1TKD A;  3OYB A;  5FPD A;  5JLH A;  5D3G A;  5LL6 Z;  5CR4 A;  3NGY A;  1NK7 A;  2IAJ A;  4RW8 A;  3NF7 A;  1VSJ A;  4FL9 A;  3F9M A;  3SAG A;  3OYM A;  2O8F A;  5BPN A;  4JKF A;  3A5M C;  3E9L A;  1N8R O;  1LCU A;  3DLR A;  1YIJ N;  2FXU A;  1WSJ A;  3LAL A;  4JYA K;  3DJC A;  1E3M A;  2DFF A;  3SQ2 A;  1JCG A;  4BR0 A;  4ILH A;  4BDP A;  5AQQ A;  3BZC A;  1HNI A;  3VQE A;  3EYZ A;  3LP0 A;  1DT9 A;  4NYF A;  1RCH A;  4CJR A;  4JHD A;  2NRW A;  3KD1 E;  3D2E B;  1KRP A;  4CK1 A;  1E4G T;  3QBX A;  2HHS A;  4GY2 B;  4B3S K;  4UQG A;  2A1R A;  4H5T A;  4MO4 A;  4GNI A;  4RG8 A;  4H0X B;  4DR1 K;  4LFC K;  4FZY A;  1VRU A;  1NWK A;  3RMA A;  4XIU A;  1WN7 A;  3PLA A;  1RT1 A;  2PFU A;  5E41 A;  4DV5 K;  5KRS A;  4W5T A;  3NVM A;  2I7N A;  4BRA A;  3ENH A;  4ELV A;  2NRT A;  4I9Q A;  1CZB A;  1RIL A;  2KQ2 A;  4HWI A;  4EP5 A;  1NGF A;  3IKM A;  4K43 A;  5AZJ A;  3VEV A;  3T19 A;  1D9D A;  1KSP A;  3M8R A;  4ISF A;  4CZI A;  4DV6 K;  3QEX A;  4CZM A;  3ZT0 A;  2VGN A;  3DLG A;  2ASO A;  1XWL A;  2HST A;  5AFU A;  1GLE G;  1D8Y A;  1ZBI A;  4WQ5 C;  3I8D A;  4CEC A;  3QIP A;  3ZYY X;  1YHQ N;  3ZET A;  5AQU A;  3AAR A;  1U47 A;  2ZGZ A;  1NGI A;  5AR0 A;  2RHK A;  1ZYQ A;  1BI4 A;  4DWI A;  1XNQ K;  3THY B;  5C0Y A;  3CXC M;  2Q1N A;  2WFB A;  4OX9 K;  3MMV A;  3EZW A;  4CJ3 A;  4CZG A;  5AQS A;  2YKM A;  4YFU A;  2G8H A;  4CW7 B;  3MXI A;  4CFA A;  3OW2 M;  2YHB A;  3NF6 A;  5JS1 A;  3AVI A;  3FR0 A;  3PIP L;  5JS2 A;  4W5Q A;  1KLN A;  1IO2 A;  1GLJ O;  4NCA A;  2O8B A;  1XC3 A;  4EIA A;  4AQY K;  2RF2 A;  1BA0 A;  2E1Y A;  1HNV A;  2G8U A;  3SUN A;  4LF9 K;  2E2P A;  4JKA A;  1QQM A;  2PY5 A;  1X9S A;  3EL2 A;  1VK0 A;  1LAV A;  1OH5 A;  4CFC A;  3VTH A;  1MWM A;  2KZM A;  3PSI A;  1GLB G;  3TTF A;  3NVK A;  4L8R B;  3IFR A;  4FSV A;  1TYQ B;  4I7F A;  2VWJ A;  3QEP A;  2BAN A;  3AVC A;  4OPK A;  3HZ6 A;  3T7Z A;  1VRT A;  3V9X A;  4O0I A;  2HMI A;  4FWP A;  1EWQ A;  4N76 A;  1Q9X A;  2V52 B;  4FW2 A;  4JI3 K;  4KKO A;  4FM0 A;  4DSL A;  3TAR A;  1XI1 A;  4CJK A;  4PQU A;  2HBM A;  3E01 A;  3VGK A;  3H3O B;  5HLF A;  3F9K A;  3DM2 A;  1N6Q A;  4CZK A;  2KHO A;  2GWK A;  1L3U A;  3BDP A;  3RRG A;  5AQL A;  2ZJP L;  3OYA A;  3B8A X;  5EVZ A;  3DLK A;  3I33 A;  4BE1 A;  4GVE A;  3V9S A;  2WOM A;  1N5Y A;  4FLX A;  3CD6 N;  4F8R A;  3SMS A;  1SL2 A;  1B9F A;  3ENO A;  2UU9 K;  3NF8 A;  1EO1 A;  1YIT N;  3OTO K;  5ADX A;  3T1H K;  2AJQ A;  1GLF O;  3MK6 A;  4CEF A;  1JKH A;  1KAZ A;  4PL7 A;  4DR3 K;  2RE2 A;  5AZJ B;  4CED A;  2HBK A;  1X1P A;  1JLC A;  4YOW A;  4U7B A;  3J7Z O;  2DY4 A;  4H4M A;  1LWE A;  4CEZ A;  3ALY A;  3ZSQ A;  3ZSW A;  4B8A B;  5E26 A;  4Y1C A;  4C8O A;  3DI6 A;  4YOR A;  4E1J A;  4B3O A;  4PY5 A;  4KB0 A;  2AP1 A;  1Y97 A;  2E2Q A;  4CZE A;  3DOL A;  1VSH A;  2W6L A;  2W41 A;  4OPH A;  4JN4 A;  1IKX A;  4CGD A;  4B9S A;  3C7N B;  4B1Z A;  1NG9 A;  1YT3 A;  4KHW A;  2GEM A;  3QML A;  4BWJ A;  4EHU A;  4FCY A;  3U3G A;  4JKB A;  2NRH A;  4FWL A;  1Z05 A;  4IOC L;  4Z4H A;  1HJR A;  4IG3 A;  4H5W A;  1M90 O;  3VA3 A;  3HM8 A;  1NK6 A;  1VQ9 N;  3UE5 A;  4FW1 A;  4JS4 A;  1HKG A;  4E7J A;  3L2W A;  3ZSR A;  3P38 A;  4FWK A;  3WXK A;  2GBZ A;  4J8F A;  3EEQ A;  1JLB A;  2ETJ A;  3P1G A;  5KPT A;  4X64 K;  4KHY A;  1REV A;  3AA5 X;  1DGK N;  4BG8 A;  2UUC K;  1VQN N;  3AO2 A;  3PX6 A;  3QIC A;  3HJF A;  3GG4 A;  1NNE A;  3O1W A;  1CZ9 A;  4RCH A;  1EX4 A;  3MDQ A;  2IVN A;  4B3M K;  1VSF A;  1CZA N;  5KRT A;  2QK9 A;  1RT6 A;  3PV8 A;  4DFP A;  4CF8 A;  1J6Z A;  1X3M A;  2NLX A;  4CIF A;  1MA9 B;  4CHY A;  3CCQ N;  3DXM B;  3DMJ A;  3WEE A;  2E6L A;  2OPS A;  4M3R A;  3JSM A;  1VQM N;  4RTF D;  5EOY A;  4FJL A;  4JKC A;  3AO4 A;  2A42 A;  3ZEU A;  1VQ4 N;  2UYT A;  1RBR A;  4FWM A;  4H5R A;  1RT7 A;  5T7B A;  4DV0 K;  1K8A O;  1SL1 A;  1VSI A;  1ZBF A;  4WQ4 C;  2J4R A;  3OYF A;  3U8X A;  1I39 A;  4CJQ A;  1VQ5 N;  5CYM A;  1NK8 A;  4JI0 K;  4Q5V A;  4KBO A;  1QSY A;  1YXQ A;  4CES A;  3VA0 A;  3OYD A;  2KLA A;  2ZJR L;  4M41 A;  1HYV A;  3DRS A;  3LDN A;  4A2A A;  3CIP A;  3SNN A;  4KHP K;  4CER A;  5LMN K;  2GEL A;  3C65 A;  2FF6 A;  4BQL A;  2HNZ A;  1IKV A;  1KC8 O;  3TU5 A;  2F9T A;  2IOC A;  3KLG A;  3N4P A;  4IDK A;  2X74 A;  2CH5 A;  4W5R A;  4CHZ A;  1YJW N;  3VEZ A;  1T05 A;  1SZ2 A;  3IS9 A;  3JAM O;  4HUF A;  1K73 O;  4K8Z A;  2CGK A;  2HHQ A;  1SV5 A;  3CJC A;  4JI2 K;  3E66 A;  4CK3 A;  1K6Y A;  4BR9 A;  3AGR A;  3VQ6 A;  1HLU A;  3U6F A;  2AA4 A;  1NK9 A;  3U9D A;  3KZB A;  4BRE A;  1NMD A;  2E1Z A;  2BH1 A;  4LY7 A;  2WBN A;  3CPE A;  4B9V A;  4FJI A;  4AM6 A;  3B6P A;  4A62 A;  3O8M A;  3QDK A;  1D5A A;  2NRZ A;  4ISE A;  3HP6 A;  2VG5 A;  4CF9 A;  3NH1 A;  4DQQ A;  4WYB A;  4M3W A;  3K9K A;  5AQY A;  2IS3 A;  1VQK N;  3IDH A;  1S1T A;  4AHC A;  3BZK A;  2YHX A;  5HRS A;  1NGH A;  2ZD1 A;  4GKJ K;  1VQP N;  2P9S B;  4G9Z A;  1QQC A;  4JS5 A;  2KFN A;  3SBG A;  3CCE N;  3KLF A;  3BF1 A;  3J7Y P;  4H5N A;  3L8B A;  4LD0 A;  3VEN A;  1TAQ A;  1C0F A;  1ATR A;  1NLV A;  1C6V A;  1NGJ A;  4F3O A;  4KHS A;  3EE8 A;  5JLF A;  1NU0 A;  4X66 K;  3HXM A;  4M3Z A;  2FLO A;  4BRH A;  4KPY A;  1WAF A;  3SLC A;  3CJ7 A;  1I94 K;  4EP4 A;  3L2R A;  4DTX A;  5C15 A;  4B9Q A;  1O13 A;  4Z4I A;  1UOC A;  3NGZ A;  3VEW A;  3VQP A;  4PHT X;  4YOX A;  4BGB A;  2PZS A;  4JK9 A;  1XHX A;  2XY8 A;  2LSN A;  3O9R A;  2NZT A;  3TSP A;  3K59 A;  3AVF A;  4GV3 A;  5AQR A;  4AHU A;  3ID6 A;  3OYK A;  3DOK A;  3O3G A;  3CI5 A;  4FVM A;  5JVH L;  4IKF A;  3MN6 A;  3SK3 A;  2D1K A;  2BE2 A;  4CGF A;  4O5F A;  2HNY A;  4NYN A;  3HI0 A;  3LL3 A;  4KH6 A;  2KTQ A;  4CJT A;  4CJU A;  2W42 A;  1JCF A;  3OYN A;  1U2V B;  1YVU A;  3NGI A;  4DFM A;  4HUG A;  4LSN A;  1NGE A;  1B92 A;  1HQE A;  3A5N C;  3HP9 A;  3T1A A;  2R7Y A;  3CET A;  1Z25 A;  3K5L A;  4FJ8 A;  4CI6 A;  3PO4 A;  3K0S A;  2P9N A;  5CZ2 A;  1XMQ K;  3P5J A;  3VTI A;  1VQ6 N;  3EKS A;  1ZC6 A;  4FLW A;  1ZBS A;  3VES A;  2XO7 A;  1LWF A;  4XH5 A;  4DV3 K;  3OYJ A;  2YHY A;  4ID1 A;  4CIE A;  1W0H A;  1EKE A;  5HRO A;  4CJE A;  3AA3 A;  1S9G A;  3EKU A;  4O0J A;  1T3V A;  1IG9 A;  4QS9 A;  2QWN A;  4FM1 A;  1N33 K;  3CJA A;  3S9H A;  3M8S A;  2QXF A;  2KFZ A;  4FK2 A;  1EQY A;  2IGI A;  3TTD A;  3QFU A;  4F4K A;  3O9S A;  3M8Q A;  1L5U A;  4KTQ A;  5AQJ A;  2JGU A;  2P9U B;  2VQE K;  1ZXO A;  1IBL K;  4FK0 A;  5KGW A;  4HTU A;  4B8C A;  3HPG A;  3LM2 A;  3V1Q A;  1EWR A;  3LDQ A;  1N36 K;  2FBY A;  4B9L A;  5HRN A;  3K5O A;  3V4I A;  3O4N A;  4DS4 A;  2I5J A;  1QQN A;  4FJK A;  5BN9 A;  3AO3 A;  4BR4 A;  1JCE A;  3F5T A;  3NAE A;  4B1V A;  5BRD A;  4PUO A;  3VGL A;  4YOY A;  1NKB A;  3KWG A;  5M1Q A;  3K9J A;  1S22 A;  4BQZ A;  1NK4 A;  3MX5 A;  3VEO A;  3BUZ B;  5GIN A;  4JK8 A;  2OYQ A;  4B1X B;  3SUO A;  3KK1 A;  4CBX A;  1A5V A;  3IRX A;  4DV4 K;  4JRP A;  1JLE A;  3V1R A;  3AVL A;  3U3Y A;  1BIZ A;  3I0R A;  3RRH A;  4KAZ A;  4IJN A;  4BRK A;  3CMA N;  3HTV A;  3ATU A;  3QIO A;  2FSK A;  2YX6 A;  4PWD A;  2HBL A;  2E6M A;  4BRO A;  2WC9 A;  4KTZ A;  4CD1 A;  5BPL A;  5J1E A;  1BI4 B;  4F2R A;  4BY9 C;  5I42 A;  1GOC A;  5KI6 A;  3OS0 A;  3PO5 A;  2F4V K;  2B4J A;  4ILG B;  1NJX A;  3NHG A;  2O4G A;  3CM6 A;  2E5L K;  2RN2 A;  2IDO A;  4U67 L;  2IVP A;  4DR2 K;  1YAG A;  1WBD A;  3D45 A;  1S9E A;  4JI1 K;  4IXC A;  3PX4 A;  4FLZ A;  4EAH D;  4J2A A;  3OYC A;  3VQ5 A;  5GIO A;  2HHU A;  4Z4F A;  3TAN A;  4JI8 K;  2HHV A;  3OYG A;  1IH7 A;  1VSD A;  2QI2 A;  4QS7 A;  3SPY A;  5GIP A;  2IIR A;  3V6D A;  2F8T A;  3L2V A;  3SUQ A;  4CJF A;  1W9H A;  2HHT A;  3O80 A;  1TK0 A;  4CZJ A;  4IBN A;  4H0O A;  2HB5 A;  5FRM A;  3FLC O;  4J2D A;  2DFH A;  2DPN A;  2FF3 B;  3SMP A;  1VSK A;  4KB1 A;  3DAW A;  1QTM A;  2UUB K;  3FZL A;  4CJL A;  1QE1 A;  1X9W A;  1L3S A;  4E7H A;  4KRE A;  3HBT A;  1GLD G;  2ZGY A;  3LZJ A;  4O5B A;  1ITG A;  4JI4 K;  4YOT A;  1FKP A;  2QWR A;  4K8X A;  3OYE A;  5DM6 L;  1S1X A;  1SUQ A;  2ZF5 O;  3ZX0 A;  3DRP A;  2GTD A;  4YOV A;  1H1V A;  2P9U A;  1VQL N;  4W5N A;  3G4S N;  3MWP A;  2HND A;  1VQO N;  3CM5 A;  3JYT A;  1NJY A;  1NKE A;  3ZSZ A;  1P90 A;  1C1A A;  4GMJ B;  4BVP A;  3G0Z A;  1BL3 A;  5BRE A;  3CF5 L;  4J2E A;  2KZZ A;  1YJN N;  1S3X A;  3AV9 A;  5J2Q A;  3JXU A;  1VAZ A;  1W7A A;  4H0P A;  1SS6 A;  2FBV A;  3D2F A;  5LMU K;  3VQ4 A;  3ZT1 A;  3R6M A;  4LFA K;  1ZBU A;  3V9Z A;  1RDA A;  1T6D A;  2A6A A;  4A61 A;  1TK5 A;  1L3T A;  4B1W B;  1J9A A;  5AQG A;  3PIO L;  2BUP A;  2YNG A;  2GWJ A;  4LH5 A;  4QOZ B;  4CVN E;  4RW4 A;  3ENB A;  2HVH A;  3SZ2 A;  4E1M A;  3TAM A;  2G8I A;  4AIL C;  1SKR A;  2P51 A;  4O55 A;  2QWP A;  2UXC K;  1NJZ A;  1BDG A;  3D7E O;  3WNH A;  1ATN A;  3M8P A;  3C6T A;  3C7N A;  3S41 A;  3SV4 A;  1HYZ A;  1ESV A;  2BGG A;  3JS6 A;  1NM1 A;  5FLX O;  3H08 A;  1HKB A;  3CCS N;  3TR8 A;  1Q9Y A;  3L4Q A;  3OHR A;  4M3Y A;  4HUE A;  3C94 A;  3D2E A;  4KI4 A;  1NOY A;  5J2N A;  2UXB K;  3W0L A;  4BC4 A;  1DKG D;  4O4G A;  1HPM A;  3GDQ A;  5ELZ A;  2RPI A;  3I55 N;  1K8K A;  3LAK A;  3GBT A;  3QFP A;  3G25 A;  4N5S A;  4IG0 A;  5KQ8 A;  3M1F A;  1C0T A;  3I8B A;  4LH4 A;  4BRP A;  3E1Y A;  5DM7 L;  3TWH A;  4BRQ A;  1SKS A;  4DMN A;  1VQ8 N;  4MLH A;  3CCU N;  3AVK A;  2A41 A;  2KKZ A;  4WE1 A;  1VSE A;  4YDU C;  4C8L A;  4LF4 K;  4BRN A;  4DQ8 A;  4JD2 A;  3HOS A;  5LY3 A;  3S3O A;  1JXB A;  4CEO A;  3VGM A;  4DTM A;  4FXD A;  4CEE A;  1TUY A;  3A5O C;  3AVH A;  4M7Y A;  1UA0 A;  1HRH A;  5SZT A;  1BWF O;  3N4Q A;  4WQ5 A;  4ELT A;  3DLB A;  1RTH A;  2HMP A;  4GV9 A;  2HHH K;  3TAB A;  1FW6 A;  1DTQ A;  2P9K B;  3H1Q A;  2VQF K;  3LWL A;  4FJJ A;  3L6Q A;  2HF3 A;  2ITG A;  2QWQ A;  1R0A A;  2O8D B;  1S6Q A;  3QEV A;  4EZ9 A;  5KPR A;  4Y0W A;  1JL1 A;  5I9E B;  5EU7 A;  3IMX A;  1TL3 A;  3IUC A;  4M7X A;  3ZLJ A;  2OPQ A;  4W5O A;  5J2M A;  4FYD A;  1S1U A;  1WSF A;  1WAJ A;  3PSF A;  5AZI B;  4CGG A;  3CME N;  2GX9 A;  1OH6 A;  4FK4 A;  3WXJ A;  3KIO A;  3IAY A;  3SAF A;  2HBJ A;  3QBW A;  4XH4 A;  5FPN A;  2JLE A;  4WCE L;  3WNG A;  4AHS A;  3SI6 A;  3NH2 A;  3S3M A;  1GLA G;  5B8H A;  3G10 A;  3FZM A;  3MED A;  1RBU A;  4M3X A;  4FWQ A;  3ATV A;  1RNH A;  4DQS A;  3OBY A;  3T1Y K;  2OPP A;  1SL0 A;  3VQC A;  4NO7 A;  1IBK K;  4E89 A;  1GOB A;  2QM1 A;  3CYM A;  3KWI A;  4B9T A;  2HW3 A;  1QSS A;  3RMD A;  4X65 K;  1L3V A;  4GW6 A;  3Q7C A;  2D0O A;  3ZT3 A;  1JLA A;  3SUP A;  4IFY A;  4LF5 K;  3R3L A;  2OTL N;  3VQD A;  4KFB A;  1S72 N;  5JIC A;  1XC9 A;  3H45 C;  5LJW A;  4QAG A;  1RT4 A;  5TKW A;  4FWS A;  1X3N A;  5AQN A;  3QEI A;  3AO5 A;  1BGX T;  3ID8 A;  3KLH A;  4O8U A;  1ZBH A;  5CYQ A;  3I56 N;  1JLF A;  5A2Q O;  1C0M A;  4M45 A;  4ZTJ A;  2G8W A;  3H1V X;  4DLG A;  3VF4 A;  4CJV A;  1RDW X;  1Y64 A;  3F2K A;  4OLB A;  4FPB A;  1WLJ A;  3MN5 A;  4DR4 K;  5CZ1 A;  1Q82 O;  5M1K A;  4YY3 K;  4BG9 A;  4OO1 J;  2W40 A;  4IOA L;  2P9P B;  3ULD A;  3LM9 A;  4CE9 A;  2CGL A;  3WT0 A;  5FPM A;  4DR6 K;  4DV7 K;  3O5B A;  1FK9 A;  5LJV A;  3SQ0 A;  3KHY A;  4FWR A;  1N32 K;  1S6P A;  1WUA A;  2VWK A;  2QWM A;  4H03 B;  4IOX A;  4I2P A;  3FE1 A;  1BQN A;  4DSI A;  3QLH A;  3GOI A;  3THX B;  1HYS A;  1NGB A;  3WNF A;  4FJN A;  4PKH A;  1T7P A;  3A2F A;  1TKT A;  4JEP A;  3J7A P;  2P9L B;  3RTV A;  2ATQ A;  1X9J A;  4MDB A;  3UB5 A;  2D0C A;  4IEE A;  1T6C A;  4CHP A;  2G8V A;  3W3D A;  1U04 A;  4PKG A;  2OZS A;  1QHT A;  3HOT A;  4Z4C A;  4CJP A;  3DLL L;  5AZI A;  3AO1 A;  4C1N K;  1T44 A;  2RKI A;  3CC4 N;  3KLI A;  3ULE A;  3KK2 A;  5HRP A;  3SQ1 A;  4F2S A;  2I7P A;  4Q0B A;  2XY6 A;  2OPR A;  4OKE A;  1XNR K;  4DFJ A;  4BDY A;  4DTP A;  2QKK A;  1G15 A;  2E88 A;  5AQP A;  5GAE P;  3V9U A;  4OKJ A;  4IFE A;  4CJ5 A;  3HVR A;  5M1F A;  5BR9 A;  1W97 L;  3MCP A;  2XHB A;  3TPQ A;  1WSE A;  3OS1 A;  2P9I B;  4CFB A;  3O9T A;  3HK2 A;  3A8Y A;  4JI5 K;  3D6R A;  2P9N B;  5AJ3 K;  3HRG A;  3OJU A;  4CZH A;  2X6N A;  4CEQ A;  1KQS M;  3MN9 A;  3HPO A;  3U4L A;  2O8F B;  2FC0 A;  2QW9 A;  2F96 A;  4FZZ A;  1IV0 A;  3WXM B;  4BC5 A;  3HPH A;  4WF9 L;  3KJV A;  3KD5 E;  3FFI A;  1RBT A;  4OGE A;  1HR0 K;  4BRM A;  1QHA A;  3KLE A;  2Q3S A;  4JI7 K;  4IJA A;  1KLM A;  3AVJ A;  1U45 A;  4C23 A;  2HHX A;  4H8K A;  5F1X A;  3FFK B;  5JMV A;  2GUP A;  3MWT A;  3C0B A;  3I0S A;  4WQ4 A;  3T3F A;  5AQW A;  3VF2 A;  4BRF A;  3OJS A;  3K57 A;  4DU3 A;  3CCV N;  1B9D A;  4JNE A;  5AQO A;  4ILJ A;  3RWU A;  5FRN A;  2P1J A;  2FBT A;  4DU1 A;  4K0K K;  5MLC Q;  5HOO A;  3SJJ A;  5C2F A;  3QEW A;  2E8A A;  2QTD A;  1NGG A;  3OS2 A;  3VQA A;  4B08 A;  4G1Q A;  1TKZ A;  3AAP A;  2XY5 A;  3WXL A;  1U4B A;  3L3V A;  2O8E A;  4R5P A;  4CD3 A;  5BRF A;  3CFR A;  3D2F B;  3TAP A;  3AY9 A;  4MLE A;  1Q7Y O;  4KHQ A;  1S1W A;  3H6E A;  2DTU A;  3WUH A;  1TKX A;  3MXJ A;  4I9L A;  4B1U B;  1A5X A;  3LDL A;  2QEX N;  3CG7 A;  1R59 O;  1KAX A;  4FWN A;  4FPA A;  3K5M A;  4Z4G A;  3P4I A; 
#chains in the Genus database with same CATH homology
 4C8O A;  1T03 A;  1EXQ A;  3DI6 A;  2HB5 A;  5FRM A;  4DTU A;  4J2D A;  4B3O A;  2DFH A;  3QO9 A;  4PY5 A;  4KB0 A;  3DLE A;  4F3T A;  1VSK A;  1Y97 A;  4OPJ A;  3DOL A;  4ZTF A;  3ZT4 A;  1VSH A;  3QNN A;  4KB1 A;  1QTM A;  2Z1I A;  5CY4 A;  2EHG A;  3DRR A;  1IKX A;  4CJL A;  1QE1 A;  4CGD A;  4B9S A;  1X9W A;  4ELU A;  1L3S A;  4E7H A;  2D0A A;  4KRE A;  1YT3 A;  4KHW A;  2VG7 A;  5C25 A;  4CHQ A;  1J54 A;  3SCX A;  3NF9 A;  4O5B A;  1BQM A;  1ITG A;  3ZSO A;  4CEB A;  3LZJ A;  2G8K A;  4E0D A;  4HCB A;  4BWJ A;  4DTN A;  1FKP A;  4K8X A;  3C95 A;  3DYA A;  4YNQ A;  4FCY A;  3U3G A;  3AVB A;  3OYE A;  4FLU A;  1S1X A;  3DLH A;  1SUQ A;  4B9N A;  4J2A A;  3QIN A;  1BIU A;  3DRP A;  2PYL A;  4DSK A;  4RW6 A;  4IFV A;  1HQU A;  3LDS A;  4Z4H A;  1HJR A;  3BGR A;  4C8N A;  4W5N A;  1VSL A;  4IG3 A;  3VQ7 A;  1I3A A;  2IC3 A;  4Z4E A;  2HND A;  3CM5 A;  3JYT A;  1LW0 A;  3VA3 A;  3NH0 A;  1NJY A;  3LP3 A;  2B5J A;  3K2P A;  3ZSZ A;  1C1A A;  4GMJ B;  3OYH A;  1NKE A;  4EZ6 A;  3NDK A;  3G0Z A;  1BL3 A;  4FW1 A;  3EZ5 A;  5C24 A;  3D0P A;  4JS4 A;  3ZCM A;  4J2E A;  2KZZ A;  3MEG A;  1RDC A;  3QES A;  4E7J A;  1KVC A;  3L2Q A;  3PUF A;  3L2W A;  3AV9 A;  3ZSR A;  4CHN A;  5J2Q A;  5DMR A;  1CLQ A;  4FLT A;  4BE0 A;  1WSH A;  2FBV A;  2GBZ A;  1JLB A;  2ETJ A;  3LPU A;  3P1G A;  4KHY A;  3VQ4 A;  2D5R A;  3ZT1 A;  2XY7 A;  4LSL A;  1ZBU A;  3SV3 A;  1U49 A;  1REV A;  3AA5 X;  4GVM A;  1RDA A;  3V9Z A;  1O1W A;  1S1V A;  3SPZ A;  1BCO A;  3QET A;  3UIQ A;  4KO0 A;  1C1B A;  1TK5 A;  1L3T A;  3AO2 A;  4E19 A;  1J9A A;  3PX6 A;  1NK0 A;  4FZX C;  2EX3 A;  1T8E A;  4H4O A;  3HJF A;  4OGC A;  3VQB A;  1CZ9 A;  1UA1 A;  2YNG A;  1KFS A;  4LH5 A;  1XHZ A;  3LAM A;  1EX4 A;  1U48 A;  4QOZ B;  3K58 A;  4OJR A;  4RW4 A;  1VSF A;  3RMC A;  1TV6 A;  5KRT A;  2G8F A;  1RT6 A;  2QK9 A;  1GOA A;  2HVH A;  1MU2 A;  4Y1C A;  3SZ2 A;  3L2U A;  4DFP A;  4E1M A;  1TVR A;  3PV8 A;  4CF8 A;  3TAM A;  2G8I A;  4AIL C;  2YKN A;  1SKR A;  2P51 A;  4AHT A;  4O55 A;  4M3U A;  1JL2 A;  4CIF A;  1HPZ A;  1YTU A;  4CHY A;  2ZE2 A;  1TAU A;  1IKY A;  3DMJ A;  1NJZ A;  2E6L A;  1EP4 A;  2OPS A;  4M3R A;  3WNH A;  4CJ4 A;  3JSM A;  3M8P A;  4DF8 A;  3C6T A;  3QER A;  3AO4 A;  2PYJ A;  4FJL A;  1RBR A;  1HYZ A;  3SV4 A;  1KVB A;  1WSI A;  4DTO A;  1RT7 A;  5T7B A;  4E7I A;  2BGG A;  3HL8 A;  3WNE A;  1SL1 A;  3LPT A;  1VSI A;  1ZBF A;  1BIS A;  1NK5 A;  3H08 A;  3OYF A;  3TR8 A;  1I39 A;  3LAN A;  1RTI A;  1Q9Y A;  4CGJ A;  2B6A A;  3OYL A;  4KI6 A;  3MXM A;  4CJQ A;  1RBS A;  3VN5 A;  4M3Y A;  4FJH A;  2FBX A;  5CYM A;  1NK8 A;  4HUE A;  3C94 A;  4Q5V A;  4KI4 A;  1NOY A;  5J2N A;  1QS4 A;  1QSY A;  3KKR A;  1JLQ A;  4O4G A;  4CES A;  3VA0 A;  1UAX A;  3OYD A;  4N41 A;  3CFO A;  2KW4 A;  4MFB A;  4CJW A;  2Y1J A;  3AA4 A;  1IKW A;  2RPI A;  3LAK A;  4M41 A;  4KRF A;  2Y1I A;  3ZSV A;  4CF1 A;  4N5S A;  4IG0 A;  1HYV A;  4KHU A;  3DRS A;  4CCH A;  2A1S A;  1C0T A;  3F73 A;  3SNN A;  4CER A;  4LH4 A;  4FJX A;  4CF2 A;  4FLV A;  3CFP A;  2BDP A;  1LAW A;  4N47 A;  3TWH A;  3KK3 A;  3EY1 A;  1CXU A;  2Z1G A;  1SKS A;  2HNZ A;  1IKV A;  3AVM A;  4DMN A;  2GUI A;  2YNF A;  2YHA A;  3AVK A;  1HMV A;  4I2Q A;  4FJG A;  2IOC A;  3KLG A;  4WE1 A;  4HVJ A;  3O3H A;  1VSE A;  4IDK A;  2X74 A;  4W5R A;  4C8L A;  4CHZ A;  2YNH A;  4B9M A;  1Q8I A;  3OY9 A;  4E7K A;  1RT5 A;  4JLH A;  4DLE A;  3S3O A;  1JXB A;  3B6O A;  4CEO A;  4HHT A;  3VQ9 A;  4AHV A;  1T05 A;  4NCG A;  4DTM A;  4FXD A;  1VSM A;  1EET A;  2X78 A;  3IS9 A;  4CEE A;  3HYF A;  3AVH A;  3TAE A;  3PX0 A;  1HRH A;  5SZT A;  1UA0 A;  4HUF A;  4CGH A;  2YNI A;  4K8Z A;  4ELT A;  1JLG A;  3DLB A;  2HHQ A;  1RTH A;  1SV5 A;  4NCB A;  3NFA A;  4CK3 A;  1K6Y A;  3TAB A;  1A5W A;  2NUB A;  4CJS A;  5HP1 A;  1DTQ A;  3VQ6 A;  1RBV A;  3U6F A;  3HST B;  1NKC A;  3LWL A;  4E3S A;  4FJJ A;  1NK9 A;  1BCM A;  1ASV A;  2DFE A;  4LY7 A;  4MQ3 A;  2ITG A;  1C0U A;  4B9V A;  1R0A A;  4FJI A;  1JXE A;  1YTA A;  1KCF A;  1Z26 A;  3B6P A;  1S6Q A;  1D9F A;  3QEV A;  4C8M A;  4EZ9 A;  4OKK A;  1D5A A;  4DTR A;  4DQP A;  4ICL A;  1JL1 A;  3OVN A;  3HP6 A;  5EU7 A;  2VG5 A;  4CF9 A;  3NH1 A;  4DQQ A;  4DSE A;  1TL3 A;  4AH9 A;  4M3W A;  4ID5 A;  2OPQ A;  1C1C A;  1TGO A;  4W5O A;  5J2M A;  1WSG A;  1S1U A;  3KKS A;  4FYD A;  3HO1 A;  2IS3 A;  1WSF A;  1WAJ A;  4CGG A;  4FJ7 A;  4FK4 A;  4O44 A;  1SKW A;  2ZQB A;  3KIO A;  1S1T A;  4TSX A;  4AHC A;  3IAY A;  1F21 A;  4BAC A;  4OLA A;  3VQ8 A;  5HRS A;  2ZD1 A;  1RDD A;  3TAF A;  1QQC A;  2JLE A;  4JS5 A;  3TAQ A;  2KFN A;  3WNG A;  4Y1D A;  4FM2 A;  4AHS A;  3KLF A;  3THV A;  1LWC A;  3LP2 A;  3MEE A;  3SI6 A;  3NH2 A;  1X9M A;  3PY8 A;  3S3M A;  1S5J A;  3G10 A;  5C42 A;  3MED A;  4LD0 A;  3L8B A;  1LW2 A;  1TAQ A;  4ZHR A;  3LWM A;  4KTW A;  3C6U A;  1RBU A;  4M42 A;  3HVT A;  4M3X A;  1RNH A;  5KGX A;  4DG1 A;  4DQS A;  1J5O A;  3ZSY A;  5HBM A;  1C6V A;  1KTQ A;  2OZM A;  2OPP A;  4F3O A;  4KHS A;  3HT3 A;  4DS5 A;  1SL0 A;  3VQC A;  3HXM A;  4M3Z A;  4FJ9 A;  5DK5 A;  1TKD A;  4E89 A;  4KPY A;  1GOB A;  1WAF A;  3OYB A;  1NK6 A;  5D3G A;  1KVA A;  3CYM A;  2E4L A;  4B9T A;  2HW3 A;  1QSS A;  3NGY A;  3RMD A;  4DQR A;  3O3F A;  1L3V A;  4J2B A;  1RT2 A;  1NK7 A;  4GW6 A;  1RT3 A;  2IAJ A;  4DTJ A;  4RW8 A;  3ZT3 A;  1JLA A;  3NF7 A;  4CFD A;  4EP4 A;  3L2R A;  1VSJ A;  3K5N A;  3RMB A;  3SUP A;  5I3U A;  4IFY A;  3AVG A;  5SWM A;  3OYM A;  4DTX A;  2F8S A;  3VQD A;  4KFB A;  1XC9 A;  4Z4I A;  1UOC A;  3DLR A;  1FKO A;  3NGZ A;  3VQP A;  4QAG A;  2PZS A;  1WSJ A;  1RT4 A;  3LAL A;  4CGI A;  1LV5 A;  1XHX A;  2Z1H A;  2XY8 A;  2DFF A;  3SQ2 A;  2LSN A;  3QEI A;  3K59 A;  4BDP A;  3AO5 A;  3AVF A;  1BGX T;  1HNI A;  3VQE A;  2P5G A;  3EYZ A;  3LP0 A;  4AHU A;  4BWM A;  3OYK A;  3KLH A;  3DOK A;  5CYQ A;  3O3G A;  1ZBH A;  4QCL A;  4RW7 A;  4NYF A;  4B9U A;  1RCH A;  1JLF A;  4CJR A;  1ASU A;  1C0M A;  4M45 A;  3KD1 E;  4ZTJ A;  3V81 A;  4FVM A;  4DLG A;  2G8W A;  4CK1 A;  1KRP A;  1RDB A;  4CJV A;  4IKF A;  2OA8 A;  3L3U A;  4HCC A;  2HHS A;  2BE2 A;  4CF0 A;  4CGF A;  4UQG A;  2HNY A;  3ZT2 A;  4NYN A;  2A1R A;  4OLB A;  4DTS A;  2KTQ A;  4CJT A;  4CJU A;  4RG8 A;  4DQI A;  2W42 A;  1WLJ A;  4FZY A;  1VRU A;  3OYN A;  5CZ1 A;  3RMA A;  1YVU A;  4XIU A;  3NGI A;  3AA2 A;  1WN7 A;  1RT1 A;  5JS1 A;  4DFM A;  5E41 A;  4HUG A;  4LSN A;  1B92 A;  1HQE A;  1CXQ A;  1TL1 A;  5FRN A;  3ULD A;  4CE9 A;  3HP9 A;  3T1A A;  2R7Y A;  5KRS A;  4W5T A;  1Z25 A;  2GV9 A;  1FK9 A;  3K5L A;  3KTQ A;  3SQ0 A;  3MEC A;  3PO4 A;  4FJ8 A;  4ELV A;  3LP1 A;  4I9Q A;  1CZB A;  1RIL A;  2KQ2 A;  4EP5 A;  5CZ2 A;  1WNS A;  1S6P A;  3P5J A;  2O4I A;  3T19 A;  2VWK A;  4FLW A;  1D9D A;  1KSP A;  3M8R A;  4CEA A;  1TK8 A;  5J2P A;  2XO7 A;  1LWF A;  3QEX A;  4I2P A;  3OYJ A;  3ASM A;  1BQN A;  3ZT0 A;  3NCI A;  4DSI A;  3DLG A;  4ID1 A;  1XWL A;  4CIE A;  5FDL A;  3QLH A;  1W0H A;  1EKE A;  4AHR A;  1HYS A;  5HRO A;  4CJE A;  3AA3 A;  1S9G A;  3NBP A;  3WNF A;  4O0J A;  4C8K A;  2D0B A;  3ITH A;  1D8Y A;  4FJN A;  1T7P A;  1ZBI A;  3A2F A;  2XRI A;  3I8D A;  4CEC A;  1TKT A;  1IG9 A;  3QIP A;  3RTV A;  2ATQ A;  2D0C A;  4FM1 A;  1U47 A;  4CHP A;  2G8V A;  3S9H A;  2WON A;  3CQ8 A;  3M8S A;  3SYZ A;  1U04 A;  2QXF A;  3RR7 A;  2KFZ A;  3MAQ A;  2OZS A;  4FK2 A;  2IGI A;  1QHT A;  1ZYQ A;  1BI4 A;  4Z4C A;  4CJP A;  4DWI A;  3ZSX A;  1KFD A;  3AO1 A;  4F4K A;  2RKI A;  3M8Q A;  3KLI A;  1L5U A;  1DLO A;  1RTJ A;  4KTQ A;  4CJ3 A;  3KK2 A;  4YFU A;  2YKM A;  2JGU A;  5HRP A;  3NE6 A;  3SQ1 A;  2G8H A;  3SQ4 A;  3MXI A;  4F2S A;  4Q0B A;  4OVL A;  4FK0 A;  2XY6 A;  2OPR A;  2YV0 X;  5KGW A;  4CFA A;  4HTU A;  4OKE A;  1ZBL A;  4B8C A;  2YHB A;  3HPG A;  3NF6 A;  3V1Q A;  4DFJ A;  4BDY A;  4DTP A;  2QKK A;  1G15 A;  2FBY A;  1ASW A;  3AVI A;  4B9L A;  3IG1 A;  3K5O A;  5HRN A;  3V4I A;  3O4N A;  5JS2 A;  4W5Q A;  4DS4 A;  3V9W A;  1IO2 A;  1KLN A;  2I5J A;  4NCA A;  3V9U A;  4OKJ A;  3AO3 A;  4CJ5 A;  3HVR A;  4FJK A;  2XHB A;  1WSE A;  4CIG A;  3QNO A;  2RF2 A;  3OS1 A;  1HNV A;  2G8U A;  3NAE A;  4KV8 A;  3SUN A;  3AVA A;  4CFB A;  3LZI A;  3HK2 A;  4BDZ A;  4PUO A;  1NKB A;  4N56 A;  2PY5 A;  1X9S A;  4FLY A;  1VK0 A;  4KHN A;  1LAV A;  3OJU A;  1NK4 A;  2X6N A;  4CFC A;  4CEQ A;  3S3N A;  1RTD A;  2KZM A;  3VQQ A;  3HPO A;  2OYQ A;  4L8R B;  3SUO A;  2HHW A;  3KK1 A;  3V1O A;  1A5V A;  3IRX A;  4JRP A;  2FC0 A;  1JLE A;  3V1R A;  2F96 A;  3TAG A;  4FZZ A;  4I7F A;  1NOZ A;  3AVL A;  3U3Y A;  1BIZ A;  2VWJ A;  3I0R A;  3RRH A;  3HPH A;  3QEP A;  4KAZ A;  3KJV A;  4DU4 A;  2BAN A;  3KD5 E;  3FFI A;  3AVC A;  1BHL A;  1RBT A;  4OGE A;  4OPK A;  3P83 D;  3KLE A;  2Q3S A;  1VRT A;  5FRO A;  3V9X A;  4O0I A;  2HMI A;  3QIO A;  2VG6 A;  3OYI A;  1KLM A;  3ISN C;  3AVJ A;  1U45 A;  4JRQ A;  4N76 A;  1Q9X A;  4H8K A;  4PWD A;  2HHX A;  2E6M A;  4FW2 A;  4Z0U A;  4KKO A;  4FM0 A;  4M3T A;  4DSL A;  4BE2 A;  3I0S A;  3TAR A;  3T3F A;  1XI1 A;  4KTZ A;  4CJK A;  5K14 A;  5J1E A;  3OJS A;  1BI4 B;  3K57 A;  4F2R A;  4PQU A;  5I42 A;  2QKB A;  1GOC A;  5KTQ A;  4DU3 A;  3E01 A;  1B9D A;  3RWU A;  5KI6 A;  2P1J A;  3DM2 A;  3F9K A;  2FBT A;  3OS0 A;  4DU1 A;  4DFK A;  2B4J A;  5HLF A;  1N6Q A;  3PO5 A;  3SJJ A;  1L3U A;  1NJX A;  3NHG A;  3BDP A;  2O4G A;  4CK2 A;  3RRG A;  2HVI A;  3CM6 A;  3QEW A;  3OYA A;  2RN2 A;  1J53 A;  3OS2 A;  4DSJ A;  3DLK A;  3VQA A;  2IDO A;  4BE1 A;  4B08 A;  4G1Q A;  1DTT A;  3V9S A;  3D45 A;  1TKZ A;  2WOM A;  4RW9 A;  4DSF A;  2XY5 A;  1N5Y A;  1S9E A;  1U4B A;  3L3V A;  3PX4 A;  4FLZ A;  4R5P A;  4FLX A;  1QSL A;  4F8R A;  3OYC A;  3HM9 A;  1UWB A;  3CFR A;  5HRR A;  1B9F A;  3VQ5 A;  4DF4 A;  1SL2 A;  2HHU A;  4Z4F A;  3TAP A;  3NF8 A;  3TAN A;  2X6S A;  2HHV A;  4KHQ A;  2AJQ A;  4CEF A;  3AVN A;  1JKH A;  1S1W A;  2DTU A;  3OYG A;  1IH7 A;  1TKX A;  1VSD A;  3RR8 A;  3MXJ A;  4I9L A;  3SPY A;  4CED A;  3V6D A;  1A5X A;  1NJW A;  1X1P A;  2F8T A;  1JLC A;  4FJM A;  3L2V A;  3CG7 A;  4E1N A;  4E7L A;  3TI0 A;  4PA1 A;  2Z1J A;  3SUQ A;  4CHO A;  4H4M A;  4CJF A;  2P5O A;  2DY4 A;  3K5M A;  1W9H A;  1LWE A;  4CEZ A;  3ALY A;  3ZSQ A;  3ZSW A;  4B8A B;  1TK0 A;  4Z4G A;  3O4Q A;  4FJ5 A;  2HHT A;  1FXX A;  4IBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...