4OPKA

Bh-rnaseh:2'-sme-dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
133
structure length
133
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generating Crystallographic Models of DNA Dodecamers from Structures of RNase H:DNA Complexes.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
molecule keywords Ribonuclease H
total genus 38
structure length 133
sequence length 133
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2014-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4opkA00
3QLHA 5J2QA 3S3OA 2G8KA 3V9WA 4QOZB 3NH2A 3KD5E 1L3VA 3HJFA 3H08A 1EX4A 1GOBA 1S6PA 3AA5X 4BWMA 4CEAA 4CHYA 1Q9XA 1TGOA 1LWFA 1TKZA 1YT3A 4KTWA 4RW6A 4CJ3A 1ZBHA 4EP5A 3OS0A 4DTSA 1TK0A 3NGIA 4KB1A 1TL1A 1XHXA 3NBPA 3VA3A 3VQCA 4JRQA 3RRGA 4FXDA 2VWKA 2R7YA 1MU2A 3O4NA 3SQ2A 4PY5A 2Z1JA 3PO4A 3ZSWA 3LWLA 1J5OA 3AVKA 3M8SA 3MXJA 4NYFA 2IDOA 3CM5A 3V4IA 3HPHA 1BIUA 3WNGA 1IKYA 5KRTA 2IS3A 1EETA 1CXUA 3IAYA 2G8UA 5KRSA 2LSNA 3QEWA 4OKKA 4FK4A 1A5WA 4CGFA 3K57A 3TI0A 1SKWA 3NF8A 4B8CA 2HHTA 3AVMA 4I2PA 4RW9A 4IG3A 4DTXA 4AHTA 4HUFA 3T3FA 2HW3A 5J2PA 3O3FA 3SV3A 3OYAA 2Y1IA 4Q5VA 4CHOA 3PO5A 3PX4A 4CGGA 1KFSA 4CIFA 2D0AA 3DRSA 3T1AA 1K6YA 3LWMA 3SUOA 1RT4A 2G8HA 4CJEA 2VWJA 3EYZA 1C1CA 1S1TA 4KTQA 3TAGA 2D5RA 4PWDA 3OYDA 1RDBA 4J2EA 4CK3A 4ZTJA 3P5JA 1N5YA 5C42A 3UIQA 4CESA 4KO0A 4DTJA 3PV8A 2RKIA 3U6FA 4DF4A 1ITGA 1YTAA 4FJLA 1ASVA 3HL8A 4JS4A 2O4IA 4F2RA 3OVNA 3OYBA 3CYMA 3V81A 1HNVA 4LD0A 1IKXA 3SQ4A 2D0CA 3NGZA 3KLEA 3RR8A 3ZT3A 1HYZA 1SUQA 1RTJA 4W5QA 3NH0A 4UQGA 3I8DA 1QQCA 2ITGA 2ZQBA 4FLXA 3S3NA 4CJQA 2IGIA 1EKEA 4AHUA 3AV9A 1VSLA 1UA1A 1IKVA 3VQ4A 2HHSA 2Z1HA 3ULDA 3QESA 3SJJA 4EZ6A 1YTUA 3AVAA 3KIOA 1XHZA 3LZIA 1JLAA 4M3RA 4CIEA 3B6PA 3RRHA 1WSEA 2P5OA 3WNEA 2HHUA 1CLQA 3LP3A 4IDKA 1TAQA 1D5AA 4CEFA 2YNIA 4LH4A 2EHGA 4FJGA 2X74A 3KJVA 2FBTA 1NK8A 1RNHA 4FJMA 4Q0BA 1IKWA 1XWLA 1RBRA 4F3TA 3EZ5A 3C94A 3AVHA 3NF6A 3ZSXA 4IG0A 3K5MA 1BQNA 3E01A 3VQAA 3K58A 3SZ2A 4E7IA 3G0ZA 4DTNA 4QCLA 4FJ9A 4KHYA 3V1RA 4K8ZA 1NJYA 1S1UA 2QK9A 3AVIA 2OZSA 4F2SA 5HBMA 1L5UA 2P5GA 3AO3A 2YNHA 3VQ9A 4CIGA 1TK5A 1S9EA 2X6SA 3QNNA 3LDSA 4DU4A 4CE9A 3TANA 3LAMA 1RTIA 4NCGA 1SL2A 3PY8A 4DWIA 2QKBA 1JLGA 5KGXA 3VN5A 4B9NA 1DLOA 1ZBIA 3A2FA 4OPKA 3RMBA 2XHBA 1TAUA 2JLEA 4BDYA 4FZZA 3L3VA 4O0IA 1HYVA 4DFJA 4CEEA 1KVAA 3FFIA 4CERA 3O4QA 3AVNA 3NFAA 4J2AA 1Y97A 3L2RA 1WSHA 1S5JA 3SI6A 3KD1E 3OS2A 3LALA 3QETA 3OYFA 1U48A 2VG6A 4CHZA 1ASWA 2GBZA 2JGUA 4N47A 4CJTA 3OYNA 2HMIA 2D0BA 3K2PA 1VRUA 2Z1GA 1S9GA 3OYKA 4OKEA 4BACA 4DSFA 4FK2A 2HHQA 2DFFA 5J1EA 1HYSA 3NCIA 4KPYA 1TL3A 1U47A 3CQ8A 2ZD1A 3SV4A 4B08A 1RBTA 2HHXA 4DU3A 1VSFA 1TKTA 4CJPA 1KVCA 3SYZA 1J53A 4NCBA 3KK1A 1R0AA 2GV9A 3V1OA 3JYTA 3HVTA 3ZSOA 1KSPA 3TAEA 1VSIA 4KHUA 3AVGA 1SKRA 1N6QA 4ELTA 3TAFA 3DYAA 4Z4CA 4B9SA 4M3ZA 3NHGA 4HUGA 4DSLA 4KTZA 4O55A 5HLFA 3HSTB 2DTUA 1BGXT 1JLQA 4OVLA 4FZYA 3AVCA 4M3UA 3OYEA 4ELVA 3LP2A 5EU7A 1NJXA 4F3OA 3OS1A 1TV6A 1NKBA 5KI6A 3AO5A 4KAZA 3KLFA 2PYLA 2YKMA 3ZCMA 2YNFA 1NJWA 3ITHA 3ZSRA 1NOYA 1TKXA 4CEBA 1JL1A 3QERA 4AHSA 1FK9A 4CHPA 1QSLA 1D9DA 4FJNA 3CFOA 1FKOA 3DRRA 3AA2A 4E7LA 2HHVA 1NK0A 4I9LA 1HMVA 5CY4A 4FM0A 2XY8A 3L3UA 4CF8A 3ASMA 2FBXA 1RT1A 1Z26A 3AO4A 3IS9A 4C8NA 4CK2A 1KCFA 4DFKA 4FJXA 3KK3A 3P83D 1KLNA 4FJJA 1WSIA 4F4KA 4CHQA 4OLAA 1HJRA 4CJFA 1GOCA 4OLBA 3QIOA 1GOAA 1B9FA 4Y1CA 4GMJB 3HO1A 3SCXA 1TVRA 3LP1A 5D3GA 2PYJA 1C0UA 5HRSA 4I9QA 4Y1DA 1QE1A 4DTUA 2B4JA 3KLHA 3DOKA 4FLUA 3HP6A 1WLJA 3NGYA 1CZ9A 3S9HA 2A1RA 1J54A 4QAGA 3U3YA 4AHCA 1LWEA 2NUBA 3DI6A 4MQ3A 4CFBA 3RMCA 4CEZA 4DQIA 1REVA 4MFBA 3TAQA 1NK5A 5K14A 3D0PA 5KTQA 4PUOA 4NYNA 1BCMA 4JLHA 1JLEA 3L8BA 2HNDA 5E41A 1X9WA 2G8FA 4FJ7A 2YHBA 3L2QA 2XY6A 2HVHA 2AJQA 3TAMA 4DQPA 2FBYA 3SUNA 2ATQA 3QO9A 4B9MA 4M3TA 4PQUA 2HVIA 4L8RB 2KFNA 4FM1A 4FVMA 4FJ5A 1JXEA 4CJKA 4DSIA 2XY5A 3AVBA 1S1XA 4OGEA 1KLMA 1BISA 3ZT4A 1L3TA 3ZSVA 3PX0A 3HYFA 4CHNA 1UA0A 4FJ8A 4FLVA 3QEIA 4JS5A 4IBNA 3PX6A 1VSMA 3M8QA 4E7KA 2A1SA 1JXBA 2Q3SA 1ZBLA 4N41A 4AILC 1RDCA 4LSLA 4ZHRA 4M45A 4Z4HA 4DQSA 3TARA 3SNNA 5KGWA 1NK7A 1IG9A 1QSYA 3ALYA 3V9SA 1JLBA 4DFMA 3M8PA 2PY5A 4CJRA 4H4OA 1WNSA 1KFDA 2OYQA 3I0SA 4XIUA 4BDPA 2BANA 4KFBA 3CM6A 1HQEA 3MECA 2VG5A 2WOMA 1BI4A 2RN2A 4H8KA 2GUIA 4WE1A 3OJUA 4KB0A 3ZSZA 1WAFA 4KV8A 3C95A 1X1PA 2XRIA 3AVJA 4ICLA 3VQDA 3ZSQA 4ID1A 4FLYA 2OA8A 3AO1A 1LW2A 4ID5A 2YNGA 4KHNA 5HP1A 5C24A 4CJ5A 3HM9A 4FJKA 3M8RA 3L2UA 4HTUA 1L3SA 1QTMA 3QIPA 1W0HA 3VQ6A 3TABA 3LANA 3LAKA 4TSXA 1BCOA 3TR8A 2KZMA 2OZMA 4W5RA 3OJSA 2KFZA 1C0MA 2IAJA 3NF9A 1BL3A 4E19A 3K5OA 2OPPA 1KRPA 3D45A 4B9LA 4O4GA 4E1MA 4FW1A 3OYMA 4KKOA 4HHTA 1HQUA 3QINA 5CZ2A 4E89A 4DLGA 1VSDA 4RW7A 4CFCA 5HRPA 2KZZA 4DTRA 4FK0A 4IFYA 4CECA 1LWCA 2HNYA 3T19A 4CF1A 4DLEA 4B9TA 4OJRA 4EZ9A 3AA4A 3HT3A 3VQBA 1RILA 3MXMA 3OYHA 5FRMA 4NCAA 4CJVA 3AO2A 4W5TA 1HNIA 3OYJA 3QNOA 5CYQA 1D8YA 3PUFA 2F8SA 3NH1A 2OPSA 4DTPA 4AHRA 5T7BA 4FLTA 4B3OA 3MXIA 2ETJA 4OKJA 4J2BA 1RDDA 1UOCA 2P1JA 3AA3A 1SL1A 1S6QA 3KKRA 4N56A 2F96A 4LSNA 4BDZA 2BDPA 2G8WA 2E6LA 3MEGA 3P1GA 4CGJA 4DSEA 3BGRA 1UWBA 4LY7A 1RDAA 3IG1A 3DLRA 3DM2A 1HRHA 4K8XA 4FLZA 3O3HA 1SV5A 1NJZA 4E0DA 3C6UA 4O5BA 2G8VA 1VSKA 1W9HA 4HVJA 3RWUA 1RCHA 3F9KA 3S3MA 3DLBA 1VRTA 2BE2A 4BE1A 1RBUA 3SQ0A 4E7HA 4Z4GA 5FRNA 1Q8IA 4Z4IA 1C1AA 3DOLA 4GW6A 3EY1A 4CEQA 1A5VA 5DMRA 4N76A 4M3XA 3MAQA 1I3AA 3MEDA 3VQ7A 3HPOA 1ASUA 2HB5A 1WSFA 3VQPA 4E1NA 1D9FA 3LZJA 4DQRA 3WNFA 1DTQA 4C8OA 3C6TA 4YFUA 1VSHA 1T03A 4FCYA 1RT6A 3LPTA 2ZE2A 4RG8A 3DLGA 2HNZA 3G10A 1C1BA 2QXFA 4FLWA 1BIZA 3KLIA 1XC9A 4I7FA 2KTQA 2XY7A 4JRPA 3HPGA 3SUPA 4KRFA 2Z1IA 4DFPA 3V9ZA 3F73A 1C6VA 4ZTFA 1U04A 3NAEA 1RT5A 5SZTA 2HHWA 3DLEA 1KVBA 2FC0A 1ZBFA 1Q9YA 3DMJA 1QS4A 2EX3A 4DQQA 1RT3A 1C0TA 4GVMA 1IH7A 5CYMA 4KREA 4M42A 1WN7A 4CFAA 3HP9A 4DTMA 2X6NA 3HVRA 3V9XA 1JKHA 1U4BA 3NF7A 1KTQA 4DS5A 3SPZA 1NK4A 2F8TA 3RR7A 3K5NA 1VSJA 3DRPA 3HK2A 1TKDA 3QEPA 1HPZA 4CK1A 1WSGA 4AH9A 3KLGA 5I42A 3ZT2A 4DSKA 2O4GA 3CFPA 4DF8A 2B5JA 3MEEA 4M3WA 1BHLA 4CF2A 1A5XA 1U45A 4DG1A 3ZT1A 3OYGA 4M3YA 1BI4B 1ZYQA 2DY4A 4CEOA 4KHSA 1U49A 4M41A 2BGGA 4FYDA 4I2QA 1NK6A 3VQQA 4CEDA 1T7PA 4C8LA 3IRXA 1QHTA 3OYIA 3ISNC 4DMNA 3HXMA 2E6MA 5FROA 4IFVA 4F8RA 1RBVA 1LAWA 3V1QA 3KTQA 2DFEA 4LH5A 4CFDA 3CFRA 3VQ5A 3V9UA 3AVFA 1CXQA 3VA0A 5J2MA 1S1VA 1G15A 3RMAA 1QSSA 4C8KA 4KHQA 3SUQA 1NOZA 5HRNA 5CZ1A 1JL2A 1T05A 3TWHA 4DTOA 4FM2A 4O44A 3SQ1A 4HCCA 1LAVA 5J2NA 3OYCA 1O1WA 1YVUA 1S1WA 4E7JA 3B6OA 4BWJA 1RT7A 3L2VA 4HCBA 3SPYA 3WNHA 3U3GA 1I39A 1LV5A 4J2DA 3BDPA 1L3UA 3CG7A 1NK9A 1BQMA 2VG7A 3O3GA 3ZSYA 4CJLA 1RTHA 1Z25A 1DTTA 2I5JA 1VK0A 4G1QA 4AHVA 1B92A 4CJ4A 2KQ2A 4HUEA 1SL0A 2IC3A 3K5LA 3LP0A 4KI4A 5HROA 3NE6A 1B9DA 4CF0A 1RBSA 2X78A 4KI6A 1FXXA 1X9SA 4RW4A 2OPRA 4BE0A 1JLCA 3KK2A 2FBVA 4B8AB 3RMDA 4FJIA 4Z0UA 5HRRA 1JLFA 4OPJA 4KHWA 3OYLA 3NDKA 2OPQA 1LW0A 4CJSA 5DK5A 5I3UA 1X9MA 1T8EA 4DSJA 4FZXC 2Y1JA 4ELUA 4N5SA 4EP4A 1WSJA 5SWMA 1CZBA 1ZBUA 4CCHA 4W5OA 4BE2A 1RT2A 5JS2A 2RPIA 4CGIA 3OY9A 4CGHA 3VQEA 3VQ8A 3DLHA 3L2WA 4DU1A 3V6DA 4CJWA 4B9VA 2G8IA 4CJUA 3JSMA 4Z4FA 4PA1A 4C8MA 4YNQA 3I0RA 5JS1A 1J9AA 2QKKA 1TK8A 1F21A 4DS4A 4FJHA 4FW2A 2DFHA 3LPUA 1NKCA 2B6AA 3QEXA 3THVA 3KKSA 1VSEA 5C25A 2E4LA 3QEVA 2IOCA 3ZT0A 2W42A 2P51A 4Z4EA 4OGCA 5FDLA 4W5NA 2YHAA 2YKNA 2YV0X 3AVLA 1SKSA 4CGDA 4B9UA 4O0JA 1EXQA 4CF9A 3DLKA 2RF2A 2KW4A 2WONA 2PZSA 4RW8A 1EP4A 4E3SA 1IO2A 3RTVA 3TAPA 1UAXA 2XO7A 4IKFA 1FKPA 3K59A 1XI1A 4R5PA 4H4MA 1NKEA 1WAJA 1RTDA
chains in the Genus database with same CATH superfamily
3V9WA 1IBLK 2P9IA 2A41A 2NRHA 4F8RA 3SMPA 1S6PA 1YT3A 2O8CA 4RW6A 4DR3K 4KB1A 3O1BA 3VQCA 1X9JA 4DB3A 1IG8A 1JJ2M 2R7YA 3PO4A 3LWLA 3DXKA 3A0IX 4ILHA 1XNQK 5KRTA 4K25A 1GLEG 3QBXA 3TTCA 1CXUA 2P9SA 4WQ4C 4CZIA 5KRSA 1NMDA 3M1FA 3NF8A 4I2PA 4BRMA 5H1SQ 1BO5O 4IG3A 2HW3A 4BG8A 4WQ5A 4Q5VA 4CHOA 1KFSA 1CZAN 4JI2K 2QI2A 2GWJA 3THWA 3EYZA 4GV3A 3EN9A 4UY8O 2RKIA 4JS4A 5HOOA 4F2RA 3OYBA 2P9UA 4BRHA 4ISEA 3SQ4A 3KLEA 4G9ZA 1Y64A 1EWQA 1NNEA 3I8DA 4OX9K 3CMEN 3S3NA 4NXMK 3M3ZA 2IGIA 3IKMA 3WEEB 2HHSA 2O8FA 3QESA 4EZ6A 1N34K 3LZIA 4M3RA 2NRWA 3H45C 3B6PA 3RRHA 3WNEA 3EKSA 5C10A 4DR6K 1TAQA 4NO7A 3FZMA 5AZIA 4WFAL 4YDUA 2X74A 1VQMN 1XWLA 3C94A 1CLQA 4IG0A 5CE3A 3K58A 4E7IA 4QCLA 3G0ZA 1N8RO 4K8ZA 4F2SA 2OZSA 3RSEA 3AO3A 3ZX0A 4BVOA 2UUAK 4CIGA 2X6SA 4FWNA 3QNNA 5EY4A 4DWIA 3IFRA 1DLOA 3UKRA 2YI1A 4OPKA 2XHBA 1TAUA 4FZZA 4O0IA 1HYVA 3DXMA 4DFJA 3FFIA 5JLFA 4CERA 3ZX3A 1QVFM 4B1ZA 2DPNA 3CQXA 4WQ4A 3GDQA 1GLJO 4N47A 4CJTA 4OLBA 1S9GA 5M1OA 3THWB 2UU9K 4IOAL 5BPLA 3OW2M 3AARA 5BPNA 5LMUK 2ZD1A 3SV4A 4B08A 4DV7K 4CJPA 1J53A 2GTDA 2GV9A 2P9UB 3TAEA 2KTQA 3TAFA 2QWMA 3DYAA 4Z4CA 3NVKA 3MN5A 4HUGA 2DTUA 4M3UA 4DUYK 2CH5A 3LP2A 1T6DA 3T69A 2O8DA 2OTLN 3EL2A 2ZJRL 4BR5A 3ZSRA 4BC5A 3QERA 5AQGA 1FK9A 3CFOA 3DRRA 3AA2A 4I9LA 4CK2A 2HHHK 3CI5A 4DV6K 4KHPK 5IT9O 1KLNA 4FJJA 1WSIA 2F9TA 4CHQA 4OLAA 1GOCA 5AQFA 3HSCA 2RE2A 4JD2A 1QE1A 4H5TA 3KLHA 3VEYA 1HJOA 1WLJA 1J54A 4QAGA 2HBMA 4LF9K 4CEZA 1T44A 1YHQN 4NYNA 3CJBA 3CPWM 1JLEA 5AQIA 4FJ7A 2IIRA 2UYTA 2XY6A 4BC4A 5JLHA 2HVIA 3QO9A 3RVCA 4JI4K 2KFNA 3WT0A 5BR9A 4FVMA 4CJKA 4DSIA 1S1XA 2I7PA 3THXA 1KLMA 4O8UA 5MLCQ 1L3TA 3ZSVA 5AQNA 4CHNA 3SAHA 2YHXA 1D4XA 3QEIA 4IBNA 3MMVA 4E1JA 2HF4A 4ZHRA 5AFUH 4DQSA 5AQLA 3V9SA 4DFMA 2CGKA 5FPDA 2PY5A 1NU0A 4H4OA 1KFDA 3I0SA 1MWKA 3MECA 3R8EA 3CJ9A 2A6AA 3ZSZA 2XRIA 3VQDA 1NGAA 3ZSQA 4K41A 1LW2A 5HP1A 2HF3A 4DHYA 4WCEL 2UXDK 4HTUA 1L3SA 4JN4A 3TABA 3LAKA 1BCOA 3OJSA 3P4IA 3NF9A 3GE1A 3K5OA 2OPPA 1KRPA 3CCQN 3OYMA 4HHTA 4RW7A 4CECA 5JVGL 4JI1K 4EZ9A 2FF6A 3MXMA 1NG9A 3OYHA 4CJVA 4CW7B 4AHRA 4V19S 3I33A 2ETJA 4OKJA 5GIPA 4PKIA 2IVNA 1GLFO 3AA3A 1SL1A 1ATNA 3BUZB 2F96A 4BDZA 1VQ9N 4H0TB 1RDAA 5A2QO 3BZKA 3DM2A 3O3HA 1SV5A 1NJZA 4H5WA 3LDPA 2G8VA 4LF8K 2PFUA 2E2PA 3O6WA 5BRHA 3E9OA 4X65K 2BE2A 4H0XB 4M7XA 5DMRA 4M3XA 4YOUA 2P9KA 1DTQA 1VQ8N 1T03A 3ZLJA 4FCYA 2HNZA 5C0YA 5M1PA 2ZJQL 4YOTA 3KVGA 3VOVA 4AM6A 3Q7CA 5AQPA 3DLLL 1LOTB 2FC0A 5F0XA 2EX3A 5CYMA 5KPZA 4M42A 1WN7A 4GKKK 3NF7A 1KTQA 5F1XA 3SPZA 1QVGM 1JCFA 3NVMA 3K5NA 3UB5A 3QEPA 1WSGA 3KLGA 3ZT2A 3CFPA 5GAHP 1BHLA 4PL8A 1U45A 4LF4K 3L4IA 4CEOA 3OHRA 3QFPA 4JI0K 4IOXA 3IDHA 4C8LA 3CMAN 4MDAA 4JEPA 2WC9A 2DFEA 4CFDA 3CFRA 5J2MA 3VQ5A 3AVFA 1CXQA 3CCRN 3VA0A 5CZ1A 1JL2A 1E4GT 1OKJA 5GINA 4DTOA 2QWLA 3QFUA 2FF3B 3SQ1A 1YVUA 1M1KO 1S1WA 3L2VA 1Z05A 4B3MK 3WNHA 3CCSN 3J8AA 3CJ7A 3ZSYA 4CJLA 2YJEA 1Z25A 1VK0A 1JCGA 1B92A 1BOTO 3O9QA 3K5LA 3LDOA 1B9DA 2VWBA 4KI6A 4DR5K 4RW4A 2OPRA 4BE0A 1JLCA 4JI6K 4OPAA 5I3UA 2OPQA 1LW0A 5DK5A 4FZXC 2Q36A 4A61A 1QQOA 2E1YA 4N5SA 3FZHA 1ZBUA 4CGIA 1NM1A 4IFEA 5JVHL 2P9IB 1J9AA 1BUPA 3GL1A 1Q81O 2QKKA 4IJAA 3MN9A 4FJHA 4FW2A 3LPUA 4H5RA 3THVA 3ZT0A 2W42A 4JI7K 4BRGA 4OGCA 4AF1A 1IBKK 1SKSA 4DR2K 5CR4A 5AQOA 3DLKA 4CF9A 2PZSA 4YY3K 5BN9A 4E3SA 1IO2A 4JHDB 4DCHA 4O8KA 2OANA 3K59A 4R5PA 1XI1A 2NRXA 3QIOA 3W3DA 1WAJA 1NKEA 3QLHA 3S3OA 2P9NB 3NH2A 3CXCM 3CCJN 3HJFA 4CEAA 3HRGA 3AA5X 4BWMA 4CHYA 4CVNE 1Q9XA 1TKZA 4KTWA 1YJWN 4EP5A 3NGIA 4FXDA 1MU2A 2J4RA 3K9JA 4PY5A 3ZSWA 4QS8A 3W0LA 1TYQB 3M8SA 3V4IA 4NYFA 2IDOA 3CM5A 3HPHA 1BIUA 3WNGA 2IS3A 1EETA 3WXMB 1SAZA 3N4PA 3QEWA 4OKKA 1A5WA 4CGFA 4LFAK 1TUYA 4B8CA 2HHTA 4RW9A 1GLBG 5AR0A 2Y1IA 3PO5A 2VYPA 2BUPA 2D0AA 3DRSA 3SUOA 2HBLA 3EKUA 4KH5A 1YXQA 1XNRK 5E26A 3OYDA 4J2EA 4CK3A 2W6KA 4BRLA 4DTJA 4FJLA 1OVYA 3MK6A 3OTOK 1Q82O 2O4IA 2AP1A 3CYMA 2FLOA 1IKXA 2QM1A 4J8FA 3NGZA 3B8AX 1SUQA 1NGHA 3NH0A 2ITGA 4FLXA 4CJQA 3F5TA 1EKEA 2V52B 1O13A 1V4TA 1YTUA 1XHZA 1JLAA 3MCAB 2E5LK 3FLCO 3LP3A 4I6MA 1D5AA 4CEFA 3CIPA 2YNIA 4LH4A 3KJVA 2FBTA 2I7NA 4LFCK 3HBTA 1RNHA 4F3TA 3EZ5A 2FSNA 1GLAG 3ZSXA 4A62A 3SZ2A 2XY7A 3V1RA 3AVIA 5HBMA 1IJJA 2YNHA 3VQ9A 2D4WA 4KHQA 4DU4A 3TANA 3LAMA 1RTIA 4NCGA 3PY8A 1JLGA 4MO5A 2P9PB 3D7EO 5AQMA 2ZM6K 1ZBIA 3RMBA 3CQYA 1S72N 1KAXA 1YI2N 3KWIA 4X64K 4FO0A 3NFAA 1S5JA 3SI6A 3QETA 3LALA 3OYFA 2JGUA 2DY4A 2Z1GA 3CJAA 3L4QA 3O9TA 4JHDA 1HYSA 3CC2N 4KPYA 1TL3A 1U47A 2HHXA 3SK3A 1YVNA 1KVCA 4QS9A 4NCBA 4NB4A 1R0AA 3HVTA 1ILYA 3MDQA 4KHUA 1VSIA 3O80A 1N6QA 4B9SA 2F4VK 3NHGA 4KTZA 4O55A 3HSTB 1BGXT 1JLQA 3QB0A 4FWRA 4CD3A 4FZYA 5LJWA 5EU7A 3KLFA 2PYLA 3VTHA 5IWAK 1NOYA 1XQSC 4B1YB 5E84A 1TKXA 1JL1A 4ILGB 1QSLA 4FJNA 1FKOA 5GAEP 2E1ZA 2XY8A 3L3UA 3ASMA 1Z26A 3IS9A 4DV2K 5AQWA 1WOQA 4FJXA 3KK3A 4A5AA 4F4KA 1HJRA 1BDGA 1BU6O 5LJVA 3CETA 3D2EB 1GOAA 5D3GA 2HMPA 4Y1DA 4H0VB 5AJ3K 3DOKA 3ZETA 3NGYA 4YOYA 4BQZA 2VGNA 4EAHD 3U3YA 2A1RA 1LWEA 4MQ3A 1W7AA 2VGMA 4DQIA 1K9MO 1REVA 2W40A 1NK5A 5EX5A 3D0PA 2ZJPL 1C0GA 4JLHA 3L8BA 5LY3A 1X9WA 2HVHA 3TAMA 2FBYA 4PQUA 4LC9B 2ASPA 4BQLA 1JXEA 4PL7A 1VQKN 2XY5A 3AVBA 1QZ6A 3HYFA 3G6EN 3ZX2A 4FLVA 4B3RK 2V7ZA 3M8QA 1JXBA 1ZBLA 1ZC6A 4N41A 4AILC 4Z4HA 3TARA 4M45A 2NRVA 1TYQA 1JLBA 1WNSA 1MWMA 3TTDA 2OYQA 1YUWA 4KFBA 4B9QA 4WE1A 3C95A 2F9WA 4ID1A 4FLYA 4HTLA 4ID5A 3VESA 2OA8A 3HM9A 5LL6Z 3VGLA 4FJKA 1QTMA 3QIPA 1W0HA 3E1YA 3VTIA 2NZTA 4PHTX 3TR8A 5M1FA 2KZMA 4IXCA 2YHYA 1C0MA 4E19A 2KFZA 1BL3A 2O8BA 4B9LA 5TKYA 4JKGB 1YJ9N 1K8KA 4CF1A 4DLEA 4B9TA 4OJRA 3THYA 3AA4A 3VF4A 2NRRA 3AO2A 4H5VA 3A5OC 3PUFA 4BROA 5AZJA 4BRNA 4FWPA 1UOCA 2P1JA 3BY5A 5AQZA 4FWMA 1S6QA 3KKRA 4LSNA 2D1KA 1WBDA 2BDPA 2G8WA 3QBWA 1ATRA 4FLZA 1X3NA 4O5BA 3C0BA 3PLAA 3RWUA 4CZLA 3F9KA 1VRTA 1HPMA 4R79A 3DOLA 1A5VA 4EHTA 3VQ7A 2HB5A 3VQPA 4DQRA 1NJIO 4C8OA 1VSHA 2P9PA 2ZE2A 2QEXN 4RG8A 5AZIB 3G10A 1BIZA 4JKAA 3HOTA 4JRPA 2FSKA 3HPGA 4KRFA 1N32K 3V9ZA 1SQKA 4ZTFA 3ENHA 3NAEA 1RT5A 3SAFA 3DLEA 1KVBA 3OBYA 3DMJA 3KK7A 3O9UA 4DQQA 1C0TA 4DTMA 5EXWA 4JK9A 3SBTA 1Q7YO 1TUUA 5M1NA 1VSJA 1S22A 5I42A 2O4GA 3DWLA 1HNWK 3J7AP 4DG1A 4M3YA 2BGGA 1T7PA 4CEDA 3IRXA 3OYIA 4DMNA 3HXMA 2E6MA 1LAWA 2WUSA 1P8ZA 1U48A 3V9UA 4XH4A 4IOCL 1S1VA 1T3VA 1IBMK 3JAMO 1N36K 1LAVA 5AQJA 5J2NA 1O1WA 4HCBA 1RT7A 3BDPA 2A40A 1SZ2A 4IEIA 3VPZA 1NGGA 2I5JA 4JKGA 1DTTA 3CPEA 4G1QA 1SL0A 4JKCA 2KQ2A 4BRDA 4C23A 2Q97A 1HNXK 1RGIA 4CF0A 4CZGA 2UXCK 2X78A 5JICA 3TSUA 2JWKA 1X9SA 1KD1O 3FR0A 5HRRA 4OPJA 3NDKA 1T8EA 3R1XA 3ATUA 5TKWA 4FPBA 5JS2A 4CGHA 3DLHA 4DU1A 2G8IA 4B9VA 5BR8K 4C8MA 1KAZA 4B1VA 4YNQA 3CCEN 4DS4A 1RDUA 2P9LA 3S41A 2DFHA 1XUPO 2B6AA 4DR4K 3CC4N 3BEXA 1YF5L 2E4LA 5KQDA 5DM6L 1FW6A 2YHAA 3AVLA 4CGDA 4FWOA 2RF2A 1EP4A 3HOSA 3CCUN 3RTVA 3TAPA 1FKPA 3ID6A 4K43A 4YOVA 5BRDA 2G8KA 4L3QA 3AAPA 1L3VA 4M7YA 1GOBA 1LWFA 3FZFA 3O5BA 3P39A 2Z1JA 3AVKA 1VAZA 1M90O 3SMSA 1BG3A 3ATVA 5AQRA 2QTDA 3J7ZO 4XH5A 3LM2A 2ITMA 3IAYA 4BGAA 2ZWHA 2G8UA 3TI0A 4FWKA 4IO8A 4HUFA 3SV3A 4H0OA 3TSPA 3PX4A 1K8AO 4CGGA 4CIFA 2WFBA 3T1AA 1RT4A 2G8HA 4CJEA 1C1CA 1S1TA 3AGRA 3PSIA 3R9PA 4GVEA 2D5RA 4XH1A 4I6MB 1RDBA 4ZTJA 3F2KA 3P5JA 3UIQA 3PV8A 4BR0A 2P9LB 3U6FA 1ITGA 1YTAA 1VQ6N 1QHAA 2D0CA 3RR8A 3ZT3A 1RTJA 4CZEA 4UQGA 2HSTA 3D2EA 5AFUA 3WEEA 2ZQBA 2O8FB 3QICA 3AV9A 1VSLA 1IKVA 3VQ4A 2Z1HA 3ULDA 3SJJA 3AVAA 2VQEK 2P5OA 3KWGA 4WYBA 3CCMN 5GADP 1J6ZA 3G25A 3O1WA 3TTFA 2Q0RA 4Q0BA 3ZEUA 3AVHA 3NF6A 3NMUA 3CCLN 1BQNA 3E01A 4DTNA 2VQFK 4FJ9A 3RSEB 1LCUA 2QK9A 3CJ1A 1L5UA 4A2AA 4RWTA 3VERA 1TK5A 3P38A 2P5GA 3VF6A 2QKBA 2E2NA 4JKBA 5KGXA 3VN5A 3AY9A 3A2FA 2JLEA 4BDYA 3BF1A 3L3VA 4JKEA 1EO1A 4GNIA 4CEEA 4M63C 2NRZA 3AVNA 3LL3A 1Y97A 3L2RA 3KD1E 3OS2A 1EWRA 2VG6A 1ASWA 2GBZA 3OYNA 3K2PA 4BACA 3I8BA 4BR4A 2BH1A 5J1EA 3BF3A 2GELA 4JAXA 3WXJA 4H5NA 2AA4A 4DU3A 1VSFA 1TKTA 3CD6N 3FE1A 5KPRA 4JYAK 3SYZA 5ELZA 3KK1A 3V1OA 3ZSOA 4IDHA 4WFNL 1KSPA 5EVZA 5KQ8A 3AVGA 1SKRA 4ELTA 4M3ZA 4DSLA 3U4LA 4OVLA 3MCPA 1TV6A 1NKBA 2O8BB 3AO5A 4KAZA 4DV4K 2O8DB 4FWLA 1NJWA 2YNFA 3ITHA 4EHUA 3L6QA 4JKHA 1YIJN 4AHSA 4CHPA 3THYB 1D9DA 2Q0UA 4E7LA 2HHVA 1HR0K 4FM0A 5CY4A 2VCPA 2FBXA 1RT1A 5LMNK 5KPTA 5CHIA 2EWSA 3SJHA 4FOIA 3JXUA 3O08A 1TVRA 3LP1A 5HRSA 1DT9A 4DTUA 3EEQA 2A5XA 4YORA 2GWKA 4FLUA 3HP6A 3C6HA 1OH6A 1CZ9A 4FL9A 1W2BM 3DI6A 4CFBA 5KTQA 3MWPA 5E41A 2AJQA 4DQPA 4M3TA 3PIPL 2ATQA 1IV0A 3THXB 3TSQA 1ZBSA 4Y0WA 4OGEA 5C2DA 2O8EA 4FJ8A 2O8CB 4CZMA 4KH6A 2WTUA 4LSLA 4Z94A 1QSYA 5KGWA 3R3LA 3ALYA 3HI0A 1RDWX 4CJRA 3GG4A 4WFBL 4IWVA 3EZWA 3MN6A 4XIUA 4BDPA 3WQTA 3CM6A 4IJNA 2JWLA 2VG5A 3JS6A 1BI4A 2RN2A 4BRPA 2GUIA 4H8KA 5HL7L 3OJUA 3FFKB 3AVJA 4ICLA 2YNGA 5C24A 4CJ5A 3M8RA 2QWPA 2E20A 3VQ6A 4TSXA 1T6CA 3I56N 2OZMA 4W5RA 4NLBA 1NMNA 1NGIA 3GBTA 4O4GA 4E1MA 4KKOA 3QINA 5CZ2A 4BRAA 4DLGA 4RCHA 4CFCA 4IFYA 1LWCA 3AAQA 1RILA 3BP8A 3QMLA 2NLXA 4W5TA 3OYJA 2F8SA 1HNZK 2A3ZA 4FLTA 1N33K 4B3OA 3MXIA 3G71N 1YJNN 4N56A 4OO1J 4BRCA 4X62K 3P1GA 4CGJA 4DSEA 3BGRA 4LY7A 3IG1A 3DLRA 1HRHA 4E0DA 3C6UA 4MLEA 1VQPN 1W9HA 3A8YA 3ENOA 4DV5K 4OPHA 2NRTA 3S3MA 1Z6RA 4KH4A 1NGJA 4BE1A 2ASOA 3SQ0A 1YAGA 3VF2A 4E7HA 2UUBK 1Q8IA 3VEZA 5FRNA 1C1AA 4GW6A 1I3AA 3MEDA 1ASUA 1WSFA 4EIAA 4E1NA 1E4FT 3LZJA 3WNFA 4YFUA 1RT6A 4YOWA 2QXFA 1HUXA 4DR1K 3R6MA 2KKZA 4NXNK 3SUPA 2E2OA 1OH8A 4NLCA 3O9RA 3F73A 1C6VA 5FPMA 1U04A 5SZTA 1HKGA 3H3OB 3H3NO 1ZBFA 1QS4A 1X3MA 2PAVA 1BA0A 4GVMA 1IH7A 3F9MA 3P31A 1KQSM 1DEJA 4CFAA 3HP9A 3HVRA 2F8TA 3RR7A 3VGKA 3ENBA 3OBWA 3M5RA 3DRPA 1TKDA 3U9DA 1HPZA 4AH9A 3HZ6A 2Q31A 2B5JA 3KHYA 3D6RA 3MEEA 4CF2A 1A5XA 3VETA 5AQUA 3E66A 4ILJA 2CGLA 2ASMA 3T1HK 4BGBA 4I2QA 1NK6A 2Q1NA 3ULEB 1RBVA 4LH5A 1QSSA 3RMAA 1G15A 3SUQA 4WF9L 5HRNA 3OA9A 1T05A 3LDQA 4HCCA 3CCVN 4BWJA 2P9KB 3PIOL 4J2DA 1L3UA 3CG7A 1Q86O 4YOXA 2VG7A 4K42A 1RTHA 3O9SA 4HUEA 1J5EK 2ZF5O 4BR9A 4KI4A 5HROA 3VEWA 3NE6A 4H0YB 1RBSA 3KK2A 4FJIA 4B8AB 3RMDA 2UXBK 5ADXA 1JLFA 4FOEA 4CJSA 1X9MA 5BRFA 3DAWA 4ELUA 1WSJA 1CZBA 4CCHA 1RT2A 2RPIA 3J80O 4A57A 3AGKA 1XC3A 4CJWA 4CJUA 3JSMA 4B3SK 4PA1A 2GUPA 4JNEA 3WQUA 1F21A 2O8EB 3VEOA 2WBNA 3QEXA 1VSEA 4B1XB 5C25A 4DV3K 4CJ7A 2IOCA 3QEVA 1VHXA 4H03B 2P51A 3K0SA 2V51B 5FDLA 2V7YA 2QWNA 2YKNA 3T7ZA 1RFQA 1EXQA 4O0JA 2WONA 4RW8A 2ZGYA 1H1VA 2XO7A 2E88A 4LF5K 4IKFA 4JD2B 4H4MA 1RTDA 5J2QA 4QOZB 3J81O 2KLAA 1KXPA 3KD5E 3WXLA 3H08A 1EX4A 1TGOA 1ZBHA 4CJ3A 2W6LA 1TK0A 3U9ZA 3OS0A 4DTSA 1TL1A 1XHXA 3NBPA 4MLHA 3VA3A 4JRQA 3RRGA 2VWKA 4CZHA 3O4NA 3SQ2A 1J5OA 5B8HA 1NGFA 3MXJA 1IKYA 1YITN 4AQYK 1S3XA 1MA9B 4F9OA 4U67L 4RTFD 2LSNA 4ISGA 2FSJA 4IEEA 4FK4A 3SLCA 3K57A 1SKWA 1VQLN 2BTFA 3AVMA 4CD1A 4DTXA 1WBBA 4AHTA 3T3FA 5J2PA 3O3FA 1OVQA 3OYAA 1NGCA 1GLLO 5I9EB 3LWMA 1K6YA 5C12A 3ULEA 2VWJA 2D0PA 4KTQA 1DKGD 2IVPA 4JK8A 3TAGA 4PWDA 1N5YA 5C42A 4CESA 4KO0A 1DGKN 4DF4A 1ASVA 3HL8A 3OVNA 3V81A 3HTVA 1HNVA 3L0QA 4LD0A 4X66K 3VGMA 1OH5A 1HYZA 2GX9A 4W5QA 1XMOK 1QQCA 4EFHA 4AHUA 1UA1A 1NWKA 3KIOA 1R59O 4BC2A 4CIEA 1WSEA 5BPMA 2HHUA 4IDKA 4FJGA 1NGBA 2EHGA 3UKRB 2QWRA 1G99A 1NK8A 5AQQA 4FJMA 5F2RA 1IKWA 2FXUA 4FVUA 1RBRA 3I55N 3K5MA 3VQAA 3C6AA 4KHYA 1NJYA 1S1UA 4WQ5C 5AQKA 3UE5A 1S9EA 3LDLA 3LDSA 1SL2A 4CE9A 4DQ8A 3WXIA 4B9NA 4LFBK 4C1NI 5FPEA 1KVAA 1WUAA 3A5LC 3O4QA 4BR7A 4J2AA 4JKDA 1WSHA 4ISFA 4CHZA 2HMIA 2D0BA 3OYKA 1VRUA 1V4SA 4FK2A 4OKEA 4DSFA 2HHQA 2QXLA 3LDNA 2DFFA 4GKJK 5M1KA 3NCIA 1OH7A 3CQ8A 1K73O 1RBTA 2NNWA 3CC7N 2ZGZA 3EO3A 2UUCK 4FWQA 1VQ5N 3JYTA 3O4WA 2RHKA 3EE9A 3CJCA 2QWQA 4K0KK 5HLFA 3D2FA 3T1YK 3AVCA 4YDUC 3OYEA 5C2FA 4ELVA 4H0PA 1NJXA 4F3OA 3OS1A 5KI6A 5AZJB 2YKMA 3ZCMA 2CH6A 3O8MA 4CEBA 3MX2A 3VEVA 1VQNN 2W41A 4BREA 1NK0A 1HMVA 4CF8A 4C8NA 3AO4A 3UKUB 1KCFA 4DFKA 3P83D 1W97L 2KHOA 4CJFA 3E9PA 4HWIA 1B9FA 4Y1CA 4GMJB 3HO1A 3SCXA 3H1VX 4KBOA 3MX5A 1C0UA 2PYJA 5ADXH 4I9QA 1HKCA 1FJGK 2B4JA 1QZ5A 1JCEA 5AQSA 4MO4A 3VENA 1MDUB 4LF7K 3A5NC 4DV0K 3S9HA 5C15A 3RMCA 4AHCA 2NUBA 3ZETB 1VQ7N 4CBWA 5BN8A 4MFBA 3TAQA 5K14A 2QA4N 4JI3K 4PUOA 1BCMA 1ESVA 3VEXA 2HNDA 2G8FA 1SS6A 2YHBA 3L2QA 4PKGA 3U8XA 3SUNA 4B9MA 1BA1A 5AQXA 4L8RB 4FM1A 4FJ5A 5M1QA 3H6EA 3GOIA 1ATSA 1BISA 1KC8O 1NBWA 3ZT4A 3PX0A 4A5BA 4FWSA 1NGDA 2D0OA 1UA0A 1BWFO 4A2BA 2IVOA 4JS5A 4BC3A 3PX6A 1VSMA 3FZLA 4E7KA 2A1SA 2Q3SA 1RDCA 3SNNA 1NK7A 1IG9A 1GLDG 3M8PA 4BY9C 4JV5K 2YJFA 2BANA 3K9KA 1HQEA 1U6ZA 2WOMA 4KB0A 3ID8A 1GLCG 1WAFA 4KV8A 5AQHA 1X1PA 3H46O 4GV9A 3AO1A 4KHNA 2GEMA 1Q18A 3N4QA 3L2UA 1C0FA 3LANA 1HLUA 4CBUA 2HBJA 2IAJA 4CI6A 4CZKA 4BRQA 2HBKA 3D45A 4C1NK 4FW1A 3V9XA 1WB9A 1HQUA 3IMXA 4E89A 1VSDA 5HRPA 2KZZA 1HX1A 4DTRA 4FK0A 2E8AA 3MN7A 2HNYA 3T19A 5FRMA 3HT3A 3VQBA 3J7YP 4NCAA 4BVPA 1HNIA 3QNOA 1D8YA 3NH1A 2OPSA 4DTPA 1HKBA 3G4SN 5T7BA 3WXKA 3A5MC 4J2BA 1RDDA 1KAYA 2CGJA 3D2FB 3Q7BA 4CZFA 2E6LA 3MEGA 2H3GX 3CERA 1UWBA 4K8XA 3SBGA 3CF5L 2HOEA 5DM7L 3DJCA 1VSKA 4HVJA 1RCHA 3UKUA 4B1UB 4DR7K 3DLBA 4IZ9A 1RBUA 4Z4GA 3BZCA 4Z4IA 3EY1A 4CEQA 4N76A 3MAQA 1E3MA 5FPNA 3HPOA 3TPQA 4AM7A 1D9FA 4QS7A 3MWTA 3C6TA 3FZKA 3LPTA 3DLGA 1C1BA 4FLWA 4B3TK 3KLIA 3FGUA 1XC9A 4I7FA 3LM9A 2Z1IA 4DFPA 3ZYYX 2HHWA 3KZBA 3ZEUB 5FLXO 1Q9YA 1K8KB 4LF6K 1RT3A 3DXKB 3QDKA 4KREA 5AQYA 2QWOA 2X6NA 1JKHA 4BG9A 1U4BA 1NK4A 4DS5A 3WUHA 3M6GA 2F7TA 2P9SB 4DV1K 3HK2A 4CK1A 4DSKA 4DF8A 4M3WA 4CZJA 1NGEA 3IUCA 3OYGA 3ZT1A 3DXMB 1BI4B 1ZYQA 4O5FA 4FPAA 4XEIA 2A42A 1U49A 4M41A 4KHSA 4FYDA 3VQQA 1QHTA 5JMVA 3EE8A 1P90A 3ISNC 1U2VB 5FROA 4IFVA 3C7NA 3KTQA 3V1QA 4C8KA 2OTJN 1ZXOA 4JI5K 3C65A 1NOZA 2YCHA 3TWHA 5GIOA 4FM2A 4O44A 1NLVA 3C7NB 3OYCA 4E7JA 3B6OA 4MDBA 3SPYA 3SAGA 3U3GA 1I39A 2QW9A 1LV5A 1NK9A 5BREA 1BQMA 4DKWA 4GY2B 3CHWA 3O3GA 1XMQK 4B1WB 4BRKA 4U7BA 4BRFA 4AHVA 4CJ4A 4PKHA 4JKFA 1VQ4N 2IC3A 3LP0A 3VMFB 1EQYA 5GAGP 1FXXA 2YX6A 4DUZK 2OCEA 4GV6A 2FBVA 3HM8A 4Z0UA 4KHWA 1QQNA 3OYLA 2Q2RA 5EOYA 4DSJA 2YHWA 2Y1JA 5AQTA 4EP4A 5SWMA 4W5OA 4BE2A 3OY9A 3VQEA 3VQ8A 4BR2A 3L2WA 3V6DA 4A59A 4BRIA 4Z4FA 1I94K 5JS1A 3I0RA 2E2QA 3TU5A 4YHHK 1TK8A 3H1QA 5AQVA 1NKCA 2P9NA 3KKSA 4IO9L 3PSFA 1QQMA 4CBXA 4Z4EA 4W5NA 2YV0X 4B9UA 1VQON 4JI8K 3E9LA 4FSVA 2KW4A 2PBDA 1UAXA 1U2VA 4JK7A 5CYQA
chains in the Genus database with same CATH topology
3QLHA 5J2QA 3S3OA 2G8KA 3V9WA 4QOZB 3NH2A 3KD5E 1L3VA 3HJFA 3H08A 1EX4A 1GOBA 1S6PA 3AA5X 4BWMA 4CEAA 4CHYA 1Q9XA 1TGOA 1LWFA 1TKZA 1YT3A 4KTWA 4RW6A 4CJ3A 1ZBHA 4EP5A 3OS0A 4DTSA 1TK0A 3NGIA 4KB1A 1TL1A 1XHXA 3NBPA 3VA3A 3VQCA 4JRQA 3RRGA 4FXDA 2VWKA 2R7YA 1MU2A 3O4NA 3SQ2A 4PY5A 2Z1JA 3PO4A 3ZSWA 3LWLA 1J5OA 3AVKA 3M8SA 3MXJA 4NYFA 2IDOA 3CM5A 3V4IA 3HPHA 1BIUA 3WNGA 1IKYA 5KRTA 2IS3A 1EETA 1CXUA 3IAYA 2G8UA 5KRSA 2LSNA 3QEWA 4OKKA 4FK4A 1A5WA 4CGFA 3K57A 3TI0A 1SKWA 3NF8A 4B8CA 2HHTA 3AVMA 4I2PA 4RW9A 4IG3A 4DTXA 4AHTA 4HUFA 3T3FA 2HW3A 5J2PA 3O3FA 3SV3A 3OYAA 2Y1IA 4Q5VA 4CHOA 3PO5A 3PX4A 4CGGA 1KFSA 4CIFA 2D0AA 3DRSA 3T1AA 1K6YA 3LWMA 3SUOA 1RT4A 2G8HA 4CJEA 2VWJA 3EYZA 1C1CA 1S1TA 4KTQA 3TAGA 2D5RA 4PWDA 3OYDA 1RDBA 4J2EA 4CK3A 4ZTJA 3P5JA 1N5YA 5C42A 3UIQA 4CESA 4KO0A 4DTJA 3PV8A 2RKIA 3U6FA 4DF4A 1ITGA 1YTAA 4FJLA 1ASVA 3HL8A 4JS4A 2O4IA 4F2RA 3OVNA 3OYBA 3CYMA 3V81A 1HNVA 4LD0A 1IKXA 3SQ4A 2D0CA 3NGZA 3KLEA 3RR8A 3ZT3A 1HYZA 1SUQA 1RTJA 4W5QA 3NH0A 4UQGA 3I8DA 1QQCA 2ITGA 2ZQBA 4FLXA 3S3NA 4CJQA 2IGIA 1EKEA 4AHUA 3AV9A 1VSLA 1UA1A 1IKVA 3VQ4A 2HHSA 2Z1HA 3ULDA 3QESA 3SJJA 4EZ6A 1YTUA 3AVAA 3KIOA 1XHZA 3LZIA 1JLAA 4M3RA 4CIEA 3B6PA 3RRHA 1WSEA 2P5OA 3WNEA 2HHUA 1CLQA 3LP3A 4IDKA 1TAQA 1D5AA 4CEFA 2YNIA 4LH4A 2EHGA 4FJGA 2X74A 3KJVA 2FBTA 1NK8A 1RNHA 4FJMA 4Q0BA 1IKWA 1XWLA 1RBRA 4F3TA 3EZ5A 3C94A 3AVHA 3NF6A 3ZSXA 4IG0A 3K5MA 1BQNA 3E01A 3VQAA 3K58A 3SZ2A 4E7IA 3G0ZA 4DTNA 4QCLA 4FJ9A 4KHYA 3V1RA 4K8ZA 1NJYA 1S1UA 2QK9A 3AVIA 2OZSA 4F2SA 5HBMA 1L5UA 2P5GA 3AO3A 2YNHA 3VQ9A 4CIGA 1TK5A 1S9EA 2X6SA 3QNNA 3LDSA 4DU4A 4CE9A 3TANA 3LAMA 1RTIA 4NCGA 1SL2A 3PY8A 4DWIA 2QKBA 1JLGA 5KGXA 3VN5A 4B9NA 1DLOA 1ZBIA 3A2FA 4OPKA 3RMBA 2XHBA 1TAUA 2JLEA 4BDYA 4FZZA 3L3VA 4O0IA 1HYVA 4DFJA 4CEEA 1KVAA 3FFIA 4CERA 3O4QA 3AVNA 3NFAA 4J2AA 1Y97A 3L2RA 1WSHA 1S5JA 3SI6A 3KD1E 3OS2A 3LALA 3QETA 3OYFA 1U48A 2VG6A 4CHZA 1ASWA 2GBZA 2JGUA 4N47A 4CJTA 3OYNA 2HMIA 2D0BA 3K2PA 1VRUA 2Z1GA 1S9GA 3OYKA 4OKEA 4BACA 4DSFA 4FK2A 2HHQA 2DFFA 5J1EA 1HYSA 3NCIA 4KPYA 1TL3A 1U47A 3CQ8A 2ZD1A 3SV4A 4B08A 1RBTA 2HHXA 4DU3A 1VSFA 1TKTA 4CJPA 1KVCA 3SYZA 1J53A 4NCBA 3KK1A 1R0AA 2GV9A 3V1OA 3JYTA 3HVTA 3ZSOA 1KSPA 3TAEA 1VSIA 4KHUA 3AVGA 1SKRA 1N6QA 4ELTA 3TAFA 3DYAA 4Z4CA 4B9SA 4M3ZA 3NHGA 4HUGA 4DSLA 4KTZA 4O55A 5HLFA 3HSTB 2DTUA 1BGXT 1JLQA 4OVLA 4FZYA 3AVCA 4M3UA 3OYEA 4ELVA 3LP2A 5EU7A 1NJXA 4F3OA 3OS1A 1TV6A 1NKBA 5KI6A 3AO5A 4KAZA 3KLFA 2PYLA 2YKMA 3ZCMA 2YNFA 1NJWA 3ITHA 3ZSRA 1NOYA 1TKXA 4CEBA 1JL1A 3QERA 4AHSA 1FK9A 4CHPA 1QSLA 1D9DA 4FJNA 3CFOA 1FKOA 3DRRA 3AA2A 4E7LA 2HHVA 1NK0A 4I9LA 1HMVA 5CY4A 4FM0A 2XY8A 3L3UA 4CF8A 3ASMA 2FBXA 1RT1A 1Z26A 3AO4A 3IS9A 4C8NA 4CK2A 1KCFA 4DFKA 4FJXA 3KK3A 3P83D 1KLNA 4FJJA 1WSIA 4F4KA 4CHQA 4OLAA 1HJRA 4CJFA 1GOCA 4OLBA 3QIOA 1GOAA 1B9FA 4Y1CA 4GMJB 3HO1A 3SCXA 1TVRA 3LP1A 5D3GA 2PYJA 1C0UA 5HRSA 4I9QA 4Y1DA 1QE1A 4DTUA 2B4JA 3KLHA 3DOKA 4FLUA 3HP6A 1WLJA 3NGYA 1CZ9A 3S9HA 2A1RA 1J54A 4QAGA 3U3YA 4AHCA 1LWEA 2NUBA 3DI6A 4MQ3A 4CFBA 3RMCA 4CEZA 4DQIA 1REVA 4MFBA 3TAQA 1NK5A 5K14A 3D0PA 5KTQA 4PUOA 4NYNA 1BCMA 4JLHA 1JLEA 3L8BA 2HNDA 5E41A 1X9WA 2G8FA 4FJ7A 2YHBA 3L2QA 2XY6A 2HVHA 2AJQA 3TAMA 4DQPA 2FBYA 3SUNA 2ATQA 3QO9A 4B9MA 4M3TA 4PQUA 2HVIA 4L8RB 2KFNA 4FM1A 4FVMA 4FJ5A 1JXEA 4CJKA 4DSIA 2XY5A 3AVBA 1S1XA 4OGEA 1KLMA 1BISA 3ZT4A 1L3TA 3ZSVA 3PX0A 3HYFA 4CHNA 1UA0A 4FJ8A 4FLVA 3QEIA 4JS5A 4IBNA 3PX6A 1VSMA 3M8QA 4E7KA 2A1SA 1JXBA 2Q3SA 1ZBLA 4N41A 4AILC 1RDCA 4LSLA 4ZHRA 4M45A 4Z4HA 4DQSA 3TARA 3SNNA 5KGWA 1NK7A 1IG9A 1QSYA 3ALYA 3V9SA 1JLBA 4DFMA 3M8PA 2PY5A 4CJRA 4H4OA 1WNSA 1KFDA 2OYQA 3I0SA 4XIUA 4BDPA 2BANA 4KFBA 3CM6A 1HQEA 3MECA 2VG5A 2WOMA 1BI4A 2RN2A 4H8KA 2GUIA 4WE1A 3OJUA 4KB0A 3ZSZA 1WAFA 4KV8A 3C95A 1X1PA 2XRIA 3AVJA 4ICLA 3VQDA 3ZSQA 4ID1A 4FLYA 2OA8A 3AO1A 1LW2A 4ID5A 2YNGA 4KHNA 5HP1A 5C24A 4CJ5A 3HM9A 4FJKA 3M8RA 3L2UA 4HTUA 1L3SA 1QTMA 3QIPA 1W0HA 3VQ6A 3TABA 3LANA 3LAKA 4TSXA 1BCOA 3TR8A 2KZMA 2OZMA 4W5RA 3OJSA 2KFZA 1C0MA 2IAJA 3NF9A 1BL3A 4E19A 3K5OA 2OPPA 1KRPA 3D45A 4B9LA 4O4GA 4E1MA 4FW1A 3OYMA 4KKOA 4HHTA 1HQUA 3QINA 5CZ2A 4E89A 4DLGA 1VSDA 4RW7A 4CFCA 5HRPA 2KZZA 4DTRA 4FK0A 4IFYA 4CECA 1LWCA 2HNYA 3T19A 4CF1A 4DLEA 4B9TA 4OJRA 4EZ9A 3AA4A 3HT3A 3VQBA 1RILA 3MXMA 3OYHA 5FRMA 4NCAA 4CJVA 3AO2A 4W5TA 1HNIA 3OYJA 3QNOA 5CYQA 1D8YA 3PUFA 2F8SA 3NH1A 2OPSA 4DTPA 4AHRA 5T7BA 4FLTA 4B3OA 3MXIA 2ETJA 4OKJA 4J2BA 1RDDA 1UOCA 2P1JA 3AA3A 1SL1A 1S6QA 3KKRA 4N56A 2F96A 4LSNA 4BDZA 2BDPA 2G8WA 2E6LA 3MEGA 3P1GA 4CGJA 4DSEA 3BGRA 1UWBA 4LY7A 1RDAA 3IG1A 3DLRA 3DM2A 1HRHA 4K8XA 4FLZA 3O3HA 1SV5A 1NJZA 4E0DA 3C6UA 4O5BA 2G8VA 1VSKA 1W9HA 4HVJA 3RWUA 1RCHA 3F9KA 3S3MA 3DLBA 1VRTA 2BE2A 4BE1A 1RBUA 3SQ0A 4E7HA 4Z4GA 5FRNA 1Q8IA 4Z4IA 1C1AA 3DOLA 4GW6A 3EY1A 4CEQA 1A5VA 5DMRA 4N76A 4M3XA 3MAQA 1I3AA 3MEDA 3VQ7A 3HPOA 1ASUA 2HB5A 1WSFA 3VQPA 4E1NA 1D9FA 3LZJA 4DQRA 3WNFA 1DTQA 4C8OA 3C6TA 4YFUA 1VSHA 1T03A 4FCYA 1RT6A 3LPTA 2ZE2A 4RG8A 3DLGA 2HNZA 3G10A 1C1BA 2QXFA 4FLWA 1BIZA 3KLIA 1XC9A 4I7FA 2KTQA 2XY7A 4JRPA 3HPGA 3SUPA 4KRFA 2Z1IA 4DFPA 3V9ZA 3F73A 1C6VA 4ZTFA 1U04A 3NAEA 1RT5A 5SZTA 2HHWA 3DLEA 1KVBA 2FC0A 1ZBFA 1Q9YA 3DMJA 1QS4A 2EX3A 4DQQA 1RT3A 1C0TA 4GVMA 1IH7A 5CYMA 4KREA 4M42A 1WN7A 4CFAA 3HP9A 4DTMA 2X6NA 3HVRA 3V9XA 1JKHA 1U4BA 3NF7A 1KTQA 4DS5A 3SPZA 1NK4A 2F8TA 3RR7A 3K5NA 1VSJA 3DRPA 3HK2A 1TKDA 3QEPA 1HPZA 4CK1A 1WSGA 4AH9A 3KLGA 5I42A 3ZT2A 4DSKA 2O4GA 3CFPA 4DF8A 2B5JA 3MEEA 4M3WA 1BHLA 4CF2A 1A5XA 1U45A 4DG1A 3ZT1A 3OYGA 4M3YA 1BI4B 1ZYQA 2DY4A 4CEOA 4KHSA 1U49A 4M41A 2BGGA 4FYDA 4I2QA 1NK6A 3VQQA 4CEDA 1T7PA 4C8LA 3IRXA 1QHTA 3OYIA 3ISNC 4DMNA 3HXMA 2E6MA 5FROA 4IFVA 4F8RA 1RBVA 1LAWA 3V1QA 3KTQA 2DFEA 4LH5A 4CFDA 3CFRA 3VQ5A 3V9UA 3AVFA 1CXQA 3VA0A 5J2MA 1S1VA 1G15A 3RMAA 1QSSA 4C8KA 4KHQA 3SUQA 1NOZA 5HRNA 5CZ1A 1JL2A 1T05A 3TWHA 4DTOA 4FM2A 4O44A 3SQ1A 4HCCA 1LAVA 5J2NA 3OYCA 1O1WA 1YVUA 1S1WA 4E7JA 3B6OA 4BWJA 1RT7A 3L2VA 4HCBA 3SPYA 3WNHA 3U3GA 1I39A 1LV5A 4J2DA 3BDPA 1L3UA 3CG7A 1NK9A 1BQMA 2VG7A 3O3GA 3ZSYA 4CJLA 1RTHA 1Z25A 1DTTA 2I5JA 1VK0A 4G1QA 4AHVA 1B92A 4CJ4A 2KQ2A 4HUEA 1SL0A 2IC3A 3K5LA 3LP0A 4KI4A 5HROA 3NE6A 1B9DA 4CF0A 1RBSA 2X78A 4KI6A 1FXXA 1X9SA 4RW4A 2OPRA 4BE0A 1JLCA 3KK2A 2FBVA 4B8AB 3RMDA 4FJIA 4Z0UA 5HRRA 1JLFA 4OPJA 4KHWA 3OYLA 3NDKA 2OPQA 1LW0A 4CJSA 5DK5A 5I3UA 1X9MA 1T8EA 4DSJA 4FZXC 2Y1JA 4ELUA 4N5SA 4EP4A 1WSJA 5SWMA 1CZBA 1ZBUA 4CCHA 4W5OA 4BE2A 1RT2A 5JS2A 2RPIA 4CGIA 3OY9A 4CGHA 3VQEA 3VQ8A 3DLHA 3L2WA 4DU1A 3V6DA 4CJWA 4B9VA 2G8IA 4CJUA 3JSMA 4Z4FA 4PA1A 4C8MA 4YNQA 3I0RA 5JS1A 1J9AA 2QKKA 1TK8A 1F21A 4DS4A 4FJHA 4FW2A 2DFHA 3LPUA 1NKCA 2B6AA 3QEXA 3THVA 3KKSA 1VSEA 5C25A 2E4LA 3QEVA 2IOCA 3ZT0A 2W42A 2P51A 4Z4EA 4OGCA 5FDLA 4W5NA 2YHAA 2YKNA 2YV0X 3AVLA 1SKSA 4CGDA 4B9UA 4O0JA 1EXQA 4CF9A 3DLKA 2RF2A 2KW4A 2WONA 2PZSA 4RW8A 1EP4A 4E3SA 1IO2A 3RTVA 3TAPA 1UAXA 2XO7A 4IKFA 1FKPA 3K59A 1XI1A 4R5PA 4H4MA 1NKEA 1WAJA 1RTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QLH A;  5J2Q A;  3S3O A;  2G8K A;  3V9W A;  4QOZ B;  3NH2 A;  3KD5 E;  1L3V A;  3HJF A;  3H08 A;  1EX4 A;  1GOB A;  1S6P A;  3AA5 X;  4BWM A;  4CEA A;  4CHY A;  1Q9X A;  1TGO A;  1LWF A;  1TKZ A;  1YT3 A;  4KTW A;  4RW6 A;  4CJ3 A;  1ZBH A;  4EP5 A;  3OS0 A;  4DTS A;  1TK0 A;  3NGI A;  4KB1 A;  1TL1 A;  1XHX A;  3NBP A;  3VA3 A;  3VQC A;  4JRQ A;  3RRG A;  4FXD A;  2VWK A;  2R7Y A;  1MU2 A;  3O4N A;  3SQ2 A;  4PY5 A;  2Z1J A;  3PO4 A;  3ZSW A;  3LWL A;  1J5O A;  3AVK A;  3M8S A;  3MXJ A;  4NYF A;  2IDO A;  3CM5 A;  3V4I A;  3HPH A;  1BIU A;  3WNG A;  1IKY A;  5KRT A;  2IS3 A;  1EET A;  1CXU A;  3IAY A;  2G8U A;  5KRS A;  2LSN A;  3QEW A;  4OKK A;  4FK4 A;  1A5W A;  4CGF A;  3K57 A;  3TI0 A;  1SKW A;  3NF8 A;  4B8C A;  2HHT A;  3AVM A;  4I2P A;  4RW9 A;  4IG3 A;  4DTX A;  4AHT A;  4HUF A;  3T3F A;  2HW3 A;  5J2P A;  3O3F A;  3SV3 A;  3OYA A;  2Y1I A;  4Q5V A;  4CHO A;  3PO5 A;  3PX4 A;  4CGG A;  1KFS A;  4CIF A;  2D0A A;  3DRS A;  3T1A A;  1K6Y A;  3LWM A;  3SUO A;  1RT4 A;  2G8H A;  4CJE A;  2VWJ A;  3EYZ A;  1C1C A;  1S1T A;  4KTQ A;  3TAG A;  2D5R A;  4PWD A;  3OYD A;  1RDB A;  4J2E A;  4CK3 A;  4ZTJ A;  3P5J A;  1N5Y A;  5C42 A;  3UIQ A;  4CES A;  4KO0 A;  4DTJ A;  3PV8 A;  2RKI A;  3U6F A;  4DF4 A;  1ITG A;  1YTA A;  4FJL A;  1ASV A;  3HL8 A;  4JS4 A;  2O4I A;  4F2R A;  3OVN A;  3OYB A;  3CYM A;  3V81 A;  1HNV A;  4LD0 A;  1IKX A;  3SQ4 A;  2D0C A;  3NGZ A;  3KLE A;  3RR8 A;  3ZT3 A;  1HYZ A;  1SUQ A;  1RTJ A;  4W5Q A;  3NH0 A;  4UQG A;  3I8D A;  1QQC A;  2ITG A;  2ZQB A;  4FLX A;  3S3N A;  4CJQ A;  2IGI A;  1EKE A;  4AHU A;  3AV9 A;  1VSL A;  1UA1 A;  1IKV A;  3VQ4 A;  2HHS A;  2Z1H A;  3ULD A;  3QES A;  3SJJ A;  4EZ6 A;  1YTU A;  3AVA A;  3KIO A;  1XHZ A;  3LZI A;  1JLA A;  4M3R A;  4CIE A;  3B6P A;  3RRH A;  1WSE A;  2P5O A;  3WNE A;  2HHU A;  1CLQ A;  3LP3 A;  4IDK A;  1TAQ A;  1D5A A;  4CEF A;  2YNI A;  4LH4 A;  2EHG A;  4FJG A;  2X74 A;  3KJV A;  2FBT A;  1NK8 A;  1RNH A;  4FJM A;  4Q0B A;  1IKW A;  1XWL A;  1RBR A;  4F3T A;  3EZ5 A;  3C94 A;  3AVH A;  3NF6 A;  3ZSX A;  4IG0 A;  3K5M A;  1BQN A;  3E01 A;  3VQA A;  3K58 A;  3SZ2 A;  4E7I A;  3G0Z A;  4DTN A;  4QCL A;  4FJ9 A;  4KHY A;  3V1R A;  4K8Z A;  1NJY A;  1S1U A;  2QK9 A;  3AVI A;  2OZS A;  4F2S A;  5HBM A;  1L5U A;  2P5G A;  3AO3 A;  2YNH A;  3VQ9 A;  4CIG A;  1TK5 A;  1S9E A;  2X6S A;  3QNN A;  3LDS A;  4DU4 A;  4CE9 A;  3TAN A;  3LAM A;  1RTI A;  4NCG A;  1SL2 A;  3PY8 A;  4DWI A;  2QKB A;  1JLG A;  5KGX A;  3VN5 A;  4B9N A;  1DLO A;  1ZBI A;  3A2F A;  4OPK A;  3RMB A;  2XHB A;  1TAU A;  2JLE A;  4BDY A;  4FZZ A;  3L3V A;  4O0I A;  1HYV A;  4DFJ A;  4CEE A;  1KVA A;  3FFI A;  4CER A;  3O4Q A;  3AVN A;  3NFA A;  4J2A A;  1Y97 A;  3L2R A;  1WSH A;  1S5J A;  3SI6 A;  3KD1 E;  3OS2 A;  3LAL A;  3QET A;  3OYF A;  1U48 A;  2VG6 A;  4CHZ A;  1ASW A;  2GBZ A;  2JGU A;  4N47 A;  4CJT A;  3OYN A;  2HMI A;  2D0B A;  3K2P A;  1VRU A;  2Z1G A;  1S9G A;  3OYK A;  4OKE A;  4BAC A;  4DSF A;  4FK2 A;  2HHQ A;  2DFF A;  5J1E A;  1HYS A;  3NCI A;  4KPY A;  1TL3 A;  1U47 A;  3CQ8 A;  2ZD1 A;  3SV4 A;  4B08 A;  1RBT A;  2HHX A;  4DU3 A;  1VSF A;  1TKT A;  4CJP A;  1KVC A;  3SYZ A;  1J53 A;  4NCB A;  3KK1 A;  1R0A A;  2GV9 A;  3V1O A;  3JYT A;  3HVT A;  3ZSO A;  1KSP A;  3TAE A;  1VSI A;  4KHU A;  3AVG A;  1SKR A;  1N6Q A;  4ELT A;  3TAF A;  3DYA A;  4Z4C A;  4B9S A;  4M3Z A;  3NHG A;  4HUG A;  4DSL A;  4KTZ A;  4O55 A;  5HLF A;  3HST B;  2DTU A;  1BGX T;  1JLQ A;  4OVL A;  4FZY A;  3AVC A;  4M3U A;  3OYE A;  4ELV A;  3LP2 A;  5EU7 A;  1NJX A;  4F3O A;  3OS1 A;  1TV6 A;  1NKB A;  5KI6 A;  3AO5 A;  4KAZ A;  3KLF A;  2PYL A;  2YKM A;  3ZCM A;  2YNF A;  1NJW A;  3ITH A;  3ZSR A;  1NOY A;  1TKX A;  4CEB A;  1JL1 A;  3QER A;  4AHS A;  1FK9 A;  4CHP A;  1QSL A;  1D9D A;  4FJN A;  3CFO A;  1FKO A;  3DRR A;  3AA2 A;  4E7L A;  2HHV A;  1NK0 A;  4I9L A;  1HMV A;  5CY4 A;  4FM0 A;  2XY8 A;  3L3U A;  4CF8 A;  3ASM A;  2FBX A;  1RT1 A;  1Z26 A;  3AO4 A;  3IS9 A;  4C8N A;  4CK2 A;  1KCF A;  4DFK A;  4FJX A;  3KK3 A;  3P83 D;  1KLN A;  4FJJ A;  1WSI A;  4F4K A;  4CHQ A;  4OLA A;  1HJR A;  4CJF A;  1GOC A;  4OLB A;  3QIO A;  1GOA A;  1B9F A;  4Y1C A;  4GMJ B;  3HO1 A;  3SCX A;  1TVR A;  3LP1 A;  5D3G A;  2PYJ A;  1C0U A;  5HRS A;  4I9Q A;  4Y1D A;  1QE1 A;  4DTU A;  2B4J A;  3KLH A;  3DOK A;  4FLU A;  3HP6 A;  1WLJ A;  3NGY A;  1CZ9 A;  3S9H A;  2A1R A;  1J54 A;  4QAG A;  3U3Y A;  4AHC A;  1LWE A;  2NUB A;  3DI6 A;  4MQ3 A;  4CFB A;  3RMC A;  4CEZ A;  4DQI A;  1REV A;  4MFB A;  3TAQ A;  1NK5 A;  5K14 A;  3D0P A;  5KTQ A;  4PUO A;  4NYN A;  1BCM A;  4JLH A;  1JLE A;  3L8B A;  2HND A;  5E41 A;  1X9W A;  2G8F A;  4FJ7 A;  2YHB A;  3L2Q A;  2XY6 A;  2HVH A;  2AJQ A;  3TAM A;  4DQP A;  2FBY A;  3SUN A;  2ATQ A;  3QO9 A;  4B9M A;  4M3T A;  4PQU A;  2HVI A;  4L8R B;  2KFN A;  4FM1 A;  4FVM A;  4FJ5 A;  1JXE A;  4CJK A;  4DSI A;  2XY5 A;  3AVB A;  1S1X A;  4OGE A;  1KLM A;  1BIS A;  3ZT4 A;  1L3T A;  3ZSV A;  3PX0 A;  3HYF A;  4CHN A;  1UA0 A;  4FJ8 A;  4FLV A;  3QEI A;  4JS5 A;  4IBN A;  3PX6 A;  1VSM A;  3M8Q A;  4E7K A;  2A1S A;  1JXB A;  2Q3S A;  1ZBL A;  4N41 A;  4AIL C;  1RDC A;  4LSL A;  4ZHR A;  4M45 A;  4Z4H A;  4DQS A;  3TAR A;  3SNN A;  5KGW A;  1NK7 A;  1IG9 A;  1QSY A;  3ALY A;  3V9S A;  1JLB A;  4DFM A;  3M8P A;  2PY5 A;  4CJR A;  4H4O A;  1WNS A;  1KFD A;  2OYQ A;  3I0S A;  4XIU A;  4BDP A;  2BAN A;  4KFB A;  3CM6 A;  1HQE A;  3MEC A;  2VG5 A;  2WOM A;  1BI4 A;  2RN2 A;  4H8K A;  2GUI A;  4WE1 A;  3OJU A;  4KB0 A;  3ZSZ A;  1WAF A;  4KV8 A;  3C95 A;  1X1P A;  2XRI A;  3AVJ A;  4ICL A;  3VQD A;  3ZSQ A;  4ID1 A;  4FLY A;  2OA8 A;  3AO1 A;  1LW2 A;  4ID5 A;  2YNG A;  4KHN A;  5HP1 A;  5C24 A;  4CJ5 A;  3HM9 A;  4FJK A;  3M8R A;  3L2U A;  4HTU A;  1L3S A;  1QTM A;  3QIP A;  1W0H A;  3VQ6 A;  3TAB A;  3LAN A;  3LAK A;  4TSX A;  1BCO A;  3TR8 A;  2KZM A;  2OZM A;  4W5R A;  3OJS A;  2KFZ A;  1C0M A;  2IAJ A;  3NF9 A;  1BL3 A;  4E19 A;  3K5O A;  2OPP A;  1KRP A;  3D45 A;  4B9L A;  4O4G A;  4E1M A;  4FW1 A;  3OYM A;  4KKO A;  4HHT A;  1HQU A;  3QIN A;  5CZ2 A;  4E89 A;  4DLG A;  1VSD A;  4RW7 A;  4CFC A;  5HRP A;  2KZZ A;  4DTR A;  4FK0 A;  4IFY A;  4CEC A;  1LWC A;  2HNY A;  3T19 A;  4CF1 A;  4DLE A;  4B9T A;  4OJR A;  4EZ9 A;  3AA4 A;  3HT3 A;  3VQB A;  1RIL A;  3MXM A;  3OYH A;  5FRM A;  4NCA A;  4CJV A;  3AO2 A;  4W5T A;  1HNI A;  3OYJ A;  3QNO A;  5CYQ A;  1D8Y A;  3PUF A;  2F8S A;  3NH1 A;  2OPS A;  4DTP A;  4AHR A;  5T7B A;  4FLT A;  4B3O A;  3MXI A;  2ETJ A;  4OKJ A;  4J2B A;  1RDD A;  1UOC A;  2P1J A;  3AA3 A;  1SL1 A;  1S6Q A;  3KKR A;  4N56 A;  2F96 A;  4LSN A;  4BDZ A;  2BDP A;  2G8W A;  2E6L A;  3MEG A;  3P1G A;  4CGJ A;  4DSE A;  3BGR A;  1UWB A;  4LY7 A;  1RDA A;  3IG1 A;  3DLR A;  3DM2 A;  1HRH A;  4K8X A;  4FLZ A;  3O3H A;  1SV5 A;  1NJZ A;  4E0D A;  3C6U A;  4O5B A;  2G8V A;  1VSK A;  1W9H A;  4HVJ A;  3RWU A;  1RCH A;  3F9K A;  3S3M A;  3DLB A;  1VRT A;  2BE2 A;  4BE1 A;  1RBU A;  3SQ0 A;  4E7H A;  4Z4G A;  5FRN A;  1Q8I A;  4Z4I A;  1C1A A;  3DOL A;  4GW6 A;  3EY1 A;  4CEQ A;  1A5V A;  5DMR A;  4N76 A;  4M3X A;  3MAQ A;  1I3A A;  3MED A;  3VQ7 A;  3HPO A;  1ASU A;  2HB5 A;  1WSF A;  3VQP A;  4E1N A;  1D9F A;  3LZJ A;  4DQR A;  3WNF A;  1DTQ A;  4C8O A;  3C6T A;  4YFU A;  1VSH A;  1T03 A;  4FCY A;  1RT6 A;  3LPT A;  2ZE2 A;  4RG8 A;  3DLG A;  2HNZ A;  3G10 A;  1C1B A;  2QXF A;  4FLW A;  1BIZ A;  3KLI A;  1XC9 A;  4I7F A;  2KTQ A;  2XY7 A;  4JRP A;  3HPG A;  3SUP A;  4KRF A;  2Z1I A;  4DFP A;  3V9Z A;  3F73 A;  1C6V A;  4ZTF A;  1U04 A;  3NAE A;  1RT5 A;  5SZT A;  2HHW A;  3DLE A;  1KVB A;  2FC0 A;  1ZBF A;  1Q9Y A;  3DMJ A;  1QS4 A;  2EX3 A;  4DQQ A;  1RT3 A;  1C0T A;  4GVM A;  1IH7 A;  5CYM A;  4KRE A;  4M42 A;  1WN7 A;  4CFA A;  3HP9 A;  4DTM A;  2X6N A;  3HVR A;  3V9X A;  1JKH A;  1U4B A;  3NF7 A;  1KTQ A;  4DS5 A;  3SPZ A;  1NK4 A;  2F8T A;  3RR7 A;  3K5N A;  1VSJ A;  3DRP A;  3HK2 A;  1TKD A;  3QEP A;  1HPZ A;  4CK1 A;  1WSG A;  4AH9 A;  3KLG A;  5I42 A;  3ZT2 A;  4DSK A;  2O4G A;  3CFP A;  4DF8 A;  2B5J A;  3MEE A;  4M3W A;  1BHL A;  4CF2 A;  1A5X A;  1U45 A;  4DG1 A;  3ZT1 A;  3OYG A;  4M3Y A;  1BI4 B;  1ZYQ A;  2DY4 A;  4CEO A;  4KHS A;  1U49 A;  4M41 A;  2BGG A;  4FYD A;  4I2Q A;  1NK6 A;  3VQQ A;  4CED A;  1T7P A;  4C8L A;  3IRX A;  1QHT A;  3OYI A;  3ISN C;  4DMN A;  3HXM A;  2E6M A;  5FRO A;  4IFV A;  4F8R A;  1RBV A;  1LAW A;  3V1Q A;  3KTQ A;  2DFE A;  4LH5 A;  4CFD A;  3CFR A;  3VQ5 A;  3V9U A;  3AVF A;  1CXQ A;  3VA0 A;  5J2M A;  1S1V A;  1G15 A;  3RMA A;  1QSS A;  4C8K A;  4KHQ A;  3SUQ A;  1NOZ A;  5HRN A;  5CZ1 A;  1JL2 A;  1T05 A;  3TWH A;  4DTO A;  4FM2 A;  4O44 A;  3SQ1 A;  4HCC A;  1LAV A;  5J2N A;  3OYC A;  1O1W A;  1YVU A;  1S1W A;  4E7J A;  3B6O A;  4BWJ A;  1RT7 A;  3L2V A;  4HCB A;  3SPY A;  3WNH A;  3U3G A;  1I39 A;  1LV5 A;  4J2D A;  3BDP A;  1L3U A;  3CG7 A;  1NK9 A;  1BQM A;  2VG7 A;  3O3G A;  3ZSY A;  4CJL A;  1RTH A;  1Z25 A;  1DTT A;  2I5J A;  1VK0 A;  4G1Q A;  4AHV A;  1B92 A;  4CJ4 A;  2KQ2 A;  4HUE A;  1SL0 A;  2IC3 A;  3K5L A;  3LP0 A;  4KI4 A;  5HRO A;  3NE6 A;  1B9D A;  4CF0 A;  1RBS A;  2X78 A;  4KI6 A;  1FXX A;  1X9S A;  4RW4 A;  2OPR A;  4BE0 A;  1JLC A;  3KK2 A;  2FBV A;  4B8A B;  3RMD A;  4FJI A;  4Z0U A;  5HRR A;  1JLF A;  4OPJ A;  4KHW A;  3OYL A;  3NDK A;  2OPQ A;  1LW0 A;  4CJS A;  5DK5 A;  5I3U A;  1X9M A;  1T8E A;  4DSJ A;  4FZX C;  2Y1J A;  4ELU A;  4N5S A;  4EP4 A;  1WSJ A;  5SWM A;  1CZB A;  1ZBU A;  4CCH A;  4W5O A;  4BE2 A;  1RT2 A;  5JS2 A;  2RPI A;  4CGI A;  3OY9 A;  4CGH A;  3VQE A;  3VQ8 A;  3DLH A;  3L2W A;  4DU1 A;  3V6D A;  4CJW A;  4B9V A;  2G8I A;  4CJU A;  3JSM A;  4Z4F A;  4PA1 A;  4C8M A;  4YNQ A;  3I0R A;  5JS1 A;  1J9A A;  2QKK A;  1TK8 A;  1F21 A;  4DS4 A;  4FJH A;  4FW2 A;  2DFH A;  3LPU A;  1NKC A;  2B6A A;  3QEX A;  3THV A;  3KKS A;  1VSE A;  5C25 A;  2E4L A;  3QEV A;  2IOC A;  3ZT0 A;  2W42 A;  2P51 A;  4Z4E A;  4OGC A;  5FDL A;  4W5N A;  2YHA A;  2YKN A;  2YV0 X;  3AVL A;  1SKS A;  4CGD A;  4B9U A;  4O0J A;  1EXQ A;  4CF9 A;  3DLK A;  2RF2 A;  2KW4 A;  2WON A;  2PZS A;  4RW8 A;  1EP4 A;  4E3S A;  1IO2 A;  3RTV A;  3TAP A;  1UAX A;  2XO7 A;  4IKF A;  1FKP A;  3K59 A;  1XI1 A;  4R5P A;  4H4M A;  1NKE A;  1WAJ A;  1RTD A; 
#chains in the Genus database with same CATH topology
 3V9W A;  1IBL K;  2P9I A;  2A41 A;  2NRH A;  4F8R A;  3SMP A;  1S6P A;  1YT3 A;  2O8C A;  4RW6 A;  4DR3 K;  4KB1 A;  3O1B A;  3VQC A;  1X9J A;  4DB3 A;  1IG8 A;  1JJ2 M;  2R7Y A;  3PO4 A;  3LWL A;  3DXK A;  3A0I X;  4ILH A;  1XNQ K;  5KRT A;  4K25 A;  1GLE G;  3QBX A;  3TTC A;  1CXU A;  2P9S A;  4WQ4 C;  4CZI A;  5KRS A;  1NMD A;  3M1F A;  3NF8 A;  4I2P A;  4BRM A;  5H1S Q;  1BO5 O;  4IG3 A;  2HW3 A;  4BG8 A;  4WQ5 A;  4Q5V A;  4CHO A;  1KFS A;  1CZA N;  4JI2 K;  2QI2 A;  2GWJ A;  3THW A;  3EYZ A;  4GV3 A;  3EN9 A;  4UY8 O;  2RKI A;  4JS4 A;  5HOO A;  4F2R A;  3OYB A;  2P9U A;  4BRH A;  4ISE A;  3SQ4 A;  3KLE A;  4G9Z A;  1Y64 A;  1EWQ A;  1NNE A;  3I8D A;  4OX9 K;  3CME N;  3S3N A;  4NXM K;  3M3Z A;  2IGI A;  3IKM A;  3WEE B;  2HHS A;  2O8F A;  3QES A;  4EZ6 A;  1N34 K;  3LZI A;  4M3R A;  2NRW A;  3H45 C;  3B6P A;  3RRH A;  3WNE A;  3EKS A;  5C10 A;  4DR6 K;  1TAQ A;  4NO7 A;  3FZM A;  5AZI A;  4WFA L;  4YDU A;  2X74 A;  1VQM N;  1XWL A;  3C94 A;  1CLQ A;  4IG0 A;  5CE3 A;  3K58 A;  4E7I A;  4QCL A;  3G0Z A;  1N8R O;  4K8Z A;  4F2S A;  2OZS A;  3RSE A;  3AO3 A;  3ZX0 A;  4BVO A;  2UUA K;  4CIG A;  2X6S A;  4FWN A;  3QNN A;  5EY4 A;  4DWI A;  3IFR A;  1DLO A;  3UKR A;  2YI1 A;  4OPK A;  2XHB A;  1TAU A;  4FZZ A;  4O0I A;  1HYV A;  3DXM A;  4DFJ A;  3FFI A;  5JLF A;  4CER A;  3ZX3 A;  1QVF M;  4B1Z A;  2DPN A;  3CQX A;  4WQ4 A;  3GDQ A;  1GLJ O;  4N47 A;  4CJT A;  4OLB A;  1S9G A;  5M1O A;  3THW B;  2UU9 K;  4IOA L;  5BPL A;  3OW2 M;  3AAR A;  5BPN A;  5LMU K;  2ZD1 A;  3SV4 A;  4B08 A;  4DV7 K;  4CJP A;  1J53 A;  2GTD A;  2GV9 A;  2P9U B;  3TAE A;  2KTQ A;  3TAF A;  2QWM A;  3DYA A;  4Z4C A;  3NVK A;  3MN5 A;  4HUG A;  2DTU A;  4M3U A;  4DUY K;  2CH5 A;  3LP2 A;  1T6D A;  3T69 A;  2O8D A;  2OTL N;  3EL2 A;  2ZJR L;  4BR5 A;  3ZSR A;  4BC5 A;  3QER A;  5AQG A;  1FK9 A;  3CFO A;  3DRR A;  3AA2 A;  4I9L A;  4CK2 A;  2HHH K;  3CI5 A;  4DV6 K;  4KHP K;  5IT9 O;  1KLN A;  4FJJ A;  1WSI A;  2F9T A;  4CHQ A;  4OLA A;  1GOC A;  5AQF A;  3HSC A;  2RE2 A;  4JD2 A;  1QE1 A;  4H5T A;  3KLH A;  3VEY A;  1HJO A;  1WLJ A;  1J54 A;  4QAG A;  2HBM A;  4LF9 K;  4CEZ A;  1T44 A;  1YHQ N;  4NYN A;  3CJB A;  3CPW M;  1JLE A;  5AQI A;  4FJ7 A;  2IIR A;  2UYT A;  2XY6 A;  4BC4 A;  5JLH A;  2HVI A;  3QO9 A;  3RVC A;  4JI4 K;  2KFN A;  3WT0 A;  5BR9 A;  4FVM A;  4CJK A;  4DSI A;  1S1X A;  2I7P A;  3THX A;  1KLM A;  4O8U A;  5MLC Q;  1L3T A;  3ZSV A;  5AQN A;  4CHN A;  3SAH A;  2YHX A;  1D4X A;  3QEI A;  4IBN A;  3MMV A;  4E1J A;  2HF4 A;  4ZHR A;  5AFU H;  4DQS A;  5AQL A;  3V9S A;  4DFM A;  2CGK A;  5FPD A;  2PY5 A;  1NU0 A;  4H4O A;  1KFD A;  3I0S A;  1MWK A;  3MEC A;  3R8E A;  3CJ9 A;  2A6A A;  3ZSZ A;  2XRI A;  3VQD A;  1NGA A;  3ZSQ A;  4K41 A;  1LW2 A;  5HP1 A;  2HF3 A;  4DHY A;  4WCE L;  2UXD K;  4HTU A;  1L3S A;  4JN4 A;  3TAB A;  3LAK A;  1BCO A;  3OJS A;  3P4I A;  3NF9 A;  3GE1 A;  3K5O A;  2OPP A;  1KRP A;  3CCQ N;  3OYM A;  4HHT A;  4RW7 A;  4CEC A;  5JVG L;  4JI1 K;  4EZ9 A;  2FF6 A;  3MXM A;  1NG9 A;  3OYH A;  4CJV A;  4CW7 B;  4AHR A;  4V19 S;  3I33 A;  2ETJ A;  4OKJ A;  5GIP A;  4PKI A;  2IVN A;  1GLF O;  3AA3 A;  1SL1 A;  1ATN A;  3BUZ B;  2F96 A;  4BDZ A;  1VQ9 N;  4H0T B;  1RDA A;  5A2Q O;  3BZK A;  3DM2 A;  3O3H A;  1SV5 A;  1NJZ A;  4H5W A;  3LDP A;  2G8V A;  4LF8 K;  2PFU A;  2E2P A;  3O6W A;  5BRH A;  3E9O A;  4X65 K;  2BE2 A;  4H0X B;  4M7X A;  5DMR A;  4M3X A;  4YOU A;  2P9K A;  1DTQ A;  1VQ8 N;  1T03 A;  3ZLJ A;  4FCY A;  2HNZ A;  5C0Y A;  5M1P A;  2ZJQ L;  4YOT A;  3KVG A;  3VOV A;  4AM6 A;  3Q7C A;  5AQP A;  3DLL L;  1LOT B;  2FC0 A;  5F0X A;  2EX3 A;  5CYM A;  5KPZ A;  4M42 A;  1WN7 A;  4GKK K;  3NF7 A;  1KTQ A;  5F1X A;  3SPZ A;  1QVG M;  1JCF A;  3NVM A;  3K5N A;  3UB5 A;  3QEP A;  1WSG A;  3KLG A;  3ZT2 A;  3CFP A;  5GAH P;  1BHL A;  4PL8 A;  1U45 A;  4LF4 K;  3L4I A;  4CEO A;  3OHR A;  3QFP A;  4JI0 K;  4IOX A;  3IDH A;  4C8L A;  3CMA N;  4MDA A;  4JEP A;  2WC9 A;  2DFE A;  4CFD A;  3CFR A;  5J2M A;  3VQ5 A;  3AVF A;  1CXQ A;  3CCR N;  3VA0 A;  5CZ1 A;  1JL2 A;  1E4G T;  1OKJ A;  5GIN A;  4DTO A;  2QWL A;  3QFU A;  2FF3 B;  3SQ1 A;  1YVU A;  1M1K O;  1S1W A;  3L2V A;  1Z05 A;  4B3M K;  3WNH A;  3CCS N;  3J8A A;  3CJ7 A;  3ZSY A;  4CJL A;  2YJE A;  1Z25 A;  1VK0 A;  1JCG A;  1B92 A;  1BOT O;  3O9Q A;  3K5L A;  3LDO A;  1B9D A;  2VWB A;  4KI6 A;  4DR5 K;  4RW4 A;  2OPR A;  4BE0 A;  1JLC A;  4JI6 K;  4OPA A;  5I3U A;  2OPQ A;  1LW0 A;  5DK5 A;  4FZX C;  2Q36 A;  4A61 A;  1QQO A;  2E1Y A;  4N5S A;  3FZH A;  1ZBU A;  4CGI A;  1NM1 A;  4IFE A;  5JVH L;  2P9I B;  1J9A A;  1BUP A;  3GL1 A;  1Q81 O;  2QKK A;  4IJA A;  3MN9 A;  4FJH A;  4FW2 A;  3LPU A;  4H5R A;  3THV A;  3ZT0 A;  2W42 A;  4JI7 K;  4BRG A;  4OGC A;  4AF1 A;  1IBK K;  1SKS A;  4DR2 K;  5CR4 A;  5AQO A;  3DLK A;  4CF9 A;  2PZS A;  4YY3 K;  5BN9 A;  4E3S A;  1IO2 A;  4JHD B;  4DCH A;  4O8K A;  2OAN A;  3K59 A;  4R5P A;  1XI1 A;  2NRX A;  3QIO A;  3W3D A;  1WAJ A;  1NKE A;  3QLH A;  3S3O A;  2P9N B;  3NH2 A;  3CXC M;  3CCJ N;  3HJF A;  4CEA A;  3HRG A;  3AA5 X;  4BWM A;  4CHY A;  4CVN E;  1Q9X A;  1TKZ A;  4KTW A;  1YJW N;  4EP5 A;  3NGI A;  4FXD A;  1MU2 A;  2J4R A;  3K9J A;  4PY5 A;  3ZSW A;  4QS8 A;  3W0L A;  1TYQ B;  3M8S A;  3V4I A;  4NYF A;  2IDO A;  3CM5 A;  3HPH A;  1BIU A;  3WNG A;  2IS3 A;  1EET A;  3WXM B;  1SAZ A;  3N4P A;  3QEW A;  4OKK A;  1A5W A;  4CGF A;  4LFA K;  1TUY A;  4B8C A;  2HHT A;  4RW9 A;  1GLB G;  5AR0 A;  2Y1I A;  3PO5 A;  2VYP A;  2BUP A;  2D0A A;  3DRS A;  3SUO A;  2HBL A;  3EKU A;  4KH5 A;  1YXQ A;  1XNR K;  5E26 A;  3OYD A;  4J2E A;  4CK3 A;  2W6K A;  4BRL A;  4DTJ A;  4FJL A;  1OVY A;  3MK6 A;  3OTO K;  1Q82 O;  2O4I A;  2AP1 A;  3CYM A;  2FLO A;  1IKX A;  2QM1 A;  4J8F A;  3NGZ A;  3B8A X;  1SUQ A;  1NGH A;  3NH0 A;  2ITG A;  4FLX A;  4CJQ A;  3F5T A;  1EKE A;  2V52 B;  1O13 A;  1V4T A;  1YTU A;  1XHZ A;  1JLA A;  3MCA B;  2E5L K;  3FLC O;  3LP3 A;  4I6M A;  1D5A A;  4CEF A;  3CIP A;  2YNI A;  4LH4 A;  3KJV A;  2FBT A;  2I7N A;  4LFC K;  3HBT A;  1RNH A;  4F3T A;  3EZ5 A;  2FSN A;  1GLA G;  3ZSX A;  4A62 A;  3SZ2 A;  2XY7 A;  3V1R A;  3AVI A;  5HBM A;  1IJJ A;  2YNH A;  3VQ9 A;  2D4W A;  4KHQ A;  4DU4 A;  3TAN A;  3LAM A;  1RTI A;  4NCG A;  3PY8 A;  1JLG A;  4MO5 A;  2P9P B;  3D7E O;  5AQM A;  2ZM6 K;  1ZBI A;  3RMB A;  3CQY A;  1S72 N;  1KAX A;  1YI2 N;  3KWI A;  4X64 K;  4FO0 A;  3NFA A;  1S5J A;  3SI6 A;  3QET A;  3LAL A;  3OYF A;  2JGU A;  2DY4 A;  2Z1G A;  3CJA A;  3L4Q A;  3O9T A;  4JHD A;  1HYS A;  3CC2 N;  4KPY A;  1TL3 A;  1U47 A;  2HHX A;  3SK3 A;  1YVN A;  1KVC A;  4QS9 A;  4NCB A;  4NB4 A;  1R0A A;  3HVT A;  1ILY A;  3MDQ A;  4KHU A;  1VSI A;  3O80 A;  1N6Q A;  4B9S A;  2F4V K;  3NHG A;  4KTZ A;  4O55 A;  3HST B;  1BGX T;  1JLQ A;  3QB0 A;  4FWR A;  4CD3 A;  4FZY A;  5LJW A;  5EU7 A;  3KLF A;  2PYL A;  3VTH A;  5IWA K;  1NOY A;  1XQS C;  4B1Y B;  5E84 A;  1TKX A;  1JL1 A;  4ILG B;  1QSL A;  4FJN A;  1FKO A;  5GAE P;  2E1Z A;  2XY8 A;  3L3U A;  3ASM A;  1Z26 A;  3IS9 A;  4DV2 K;  5AQW A;  1WOQ A;  4FJX A;  3KK3 A;  4A5A A;  4F4K A;  1HJR A;  1BDG A;  1BU6 O;  5LJV A;  3CET A;  3D2E B;  1GOA A;  5D3G A;  2HMP A;  4Y1D A;  4H0V B;  5AJ3 K;  3DOK A;  3ZET A;  3NGY A;  4YOY A;  4BQZ A;  2VGN A;  4EAH D;  3U3Y A;  2A1R A;  1LWE A;  4MQ3 A;  1W7A A;  2VGM A;  4DQI A;  1K9M O;  1REV A;  2W40 A;  1NK5 A;  5EX5 A;  3D0P A;  2ZJP L;  1C0G A;  4JLH A;  3L8B A;  5LY3 A;  1X9W A;  2HVH A;  3TAM A;  2FBY A;  4PQU A;  4LC9 B;  2ASP A;  4BQL A;  1JXE A;  4PL7 A;  1VQK N;  2XY5 A;  3AVB A;  1QZ6 A;  3HYF A;  3G6E N;  3ZX2 A;  4FLV A;  4B3R K;  2V7Z A;  3M8Q A;  1JXB A;  1ZBL A;  1ZC6 A;  4N41 A;  4AIL C;  4Z4H A;  3TAR A;  4M45 A;  2NRV A;  1TYQ A;  1JLB A;  1WNS A;  1MWM A;  3TTD A;  2OYQ A;  1YUW A;  4KFB A;  4B9Q A;  4WE1 A;  3C95 A;  2F9W A;  4ID1 A;  4FLY A;  4HTL A;  4ID5 A;  3VES A;  2OA8 A;  3HM9 A;  5LL6 Z;  3VGL A;  4FJK A;  1QTM A;  3QIP A;  1W0H A;  3E1Y A;  3VTI A;  2NZT A;  4PHT X;  3TR8 A;  5M1F A;  2KZM A;  4IXC A;  2YHY A;  1C0M A;  4E19 A;  2KFZ A;  1BL3 A;  2O8B A;  4B9L A;  5TKY A;  4JKG B;  1YJ9 N;  1K8K A;  4CF1 A;  4DLE A;  4B9T A;  4OJR A;  3THY A;  3AA4 A;  3VF4 A;  2NRR A;  3AO2 A;  4H5V A;  3A5O C;  3PUF A;  4BRO A;  5AZJ A;  4BRN A;  4FWP A;  1UOC A;  2P1J A;  3BY5 A;  5AQZ A;  4FWM A;  1S6Q A;  3KKR A;  4LSN A;  2D1K A;  1WBD A;  2BDP A;  2G8W A;  3QBW A;  1ATR A;  4FLZ A;  1X3N A;  4O5B A;  3C0B A;  3PLA A;  3RWU A;  4CZL A;  3F9K A;  1VRT A;  1HPM A;  4R79 A;  3DOL A;  1A5V A;  4EHT A;  3VQ7 A;  2HB5 A;  3VQP A;  4DQR A;  1NJI O;  4C8O A;  1VSH A;  2P9P A;  2ZE2 A;  2QEX N;  4RG8 A;  5AZI B;  3G10 A;  1BIZ A;  4JKA A;  3HOT A;  4JRP A;  2FSK A;  3HPG A;  4KRF A;  1N32 K;  3V9Z A;  1SQK A;  4ZTF A;  3ENH A;  3NAE A;  1RT5 A;  3SAF A;  3DLE A;  1KVB A;  3OBY A;  3DMJ A;  3KK7 A;  3O9U A;  4DQQ A;  1C0T A;  4DTM A;  5EXW A;  4JK9 A;  3SBT A;  1Q7Y O;  1TUU A;  5M1N A;  1VSJ A;  1S22 A;  5I42 A;  2O4G A;  3DWL A;  1HNW K;  3J7A P;  4DG1 A;  4M3Y A;  2BGG A;  1T7P A;  4CED A;  3IRX A;  3OYI A;  4DMN A;  3HXM A;  2E6M A;  1LAW A;  2WUS A;  1P8Z A;  1U48 A;  3V9U A;  4XH4 A;  4IOC L;  1S1V A;  1T3V A;  1IBM K;  3JAM O;  1N36 K;  1LAV A;  5AQJ A;  5J2N A;  1O1W A;  4HCB A;  1RT7 A;  3BDP A;  2A40 A;  1SZ2 A;  4IEI A;  3VPZ A;  1NGG A;  2I5J A;  4JKG A;  1DTT A;  3CPE A;  4G1Q A;  1SL0 A;  4JKC A;  2KQ2 A;  4BRD A;  4C23 A;  2Q97 A;  1HNX K;  1RGI A;  4CF0 A;  4CZG A;  2UXC K;  2X78 A;  5JIC A;  3TSU A;  2JWK A;  1X9S A;  1KD1 O;  3FR0 A;  5HRR A;  4OPJ A;  3NDK A;  1T8E A;  3R1X A;  3ATU A;  5TKW A;  4FPB A;  5JS2 A;  4CGH A;  3DLH A;  4DU1 A;  2G8I A;  4B9V A;  5BR8 K;  4C8M A;  1KAZ A;  4B1V A;  4YNQ A;  3CCE N;  4DS4 A;  1RDU A;  2P9L A;  3S41 A;  2DFH A;  1XUP O;  2B6A A;  4DR4 K;  3CC4 N;  3BEX A;  1YF5 L;  2E4L A;  5KQD A;  5DM6 L;  1FW6 A;  2YHA A;  3AVL A;  4CGD A;  4FWO A;  2RF2 A;  1EP4 A;  3HOS A;  3CCU N;  3RTV A;  3TAP A;  1FKP A;  3ID6 A;  4K43 A;  4YOV A;  5BRD A;  2G8K A;  4L3Q A;  3AAP A;  1L3V A;  4M7Y A;  1GOB A;  1LWF A;  3FZF A;  3O5B A;  3P39 A;  2Z1J A;  3AVK A;  1VAZ A;  1M90 O;  3SMS A;  1BG3 A;  3ATV A;  5AQR A;  2QTD A;  3J7Z O;  4XH5 A;  3LM2 A;  2ITM A;  3IAY A;  4BGA A;  2ZWH A;  2G8U A;  3TI0 A;  4FWK A;  4IO8 A;  4HUF A;  3SV3 A;  4H0O A;  3TSP A;  3PX4 A;  1K8A O;  4CGG A;  4CIF A;  2WFB A;  3T1A A;  1RT4 A;  2G8H A;  4CJE A;  1C1C A;  1S1T A;  3AGR A;  3PSI A;  3R9P A;  4GVE A;  2D5R A;  4XH1 A;  4I6M B;  1RDB A;  4ZTJ A;  3F2K A;  3P5J A;  3UIQ A;  3PV8 A;  4BR0 A;  2P9L B;  3U6F A;  1ITG A;  1YTA A;  1VQ6 N;  1QHA A;  2D0C A;  3RR8 A;  3ZT3 A;  1RTJ A;  4CZE A;  4UQG A;  2HST A;  3D2E A;  5AFU A;  3WEE A;  2ZQB A;  2O8F B;  3QIC A;  3AV9 A;  1VSL A;  1IKV A;  3VQ4 A;  2Z1H A;  3ULD A;  3SJJ A;  3AVA A;  2VQE K;  2P5O A;  3KWG A;  4WYB A;  3CCM N;  5GAD P;  1J6Z A;  3G25 A;  3O1W A;  3TTF A;  2Q0R A;  4Q0B A;  3ZEU A;  3AVH A;  3NF6 A;  3NMU A;  3CCL N;  1BQN A;  3E01 A;  4DTN A;  2VQF K;  4FJ9 A;  3RSE B;  1LCU A;  2QK9 A;  3CJ1 A;  1L5U A;  4A2A A;  4RWT A;  3VER A;  1TK5 A;  3P38 A;  2P5G A;  3VF6 A;  2QKB A;  2E2N A;  4JKB A;  5KGX A;  3VN5 A;  3AY9 A;  3A2F A;  2JLE A;  4BDY A;  3BF1 A;  3L3V A;  4JKE A;  1EO1 A;  4GNI A;  4CEE A;  4M63 C;  2NRZ A;  3AVN A;  3LL3 A;  1Y97 A;  3L2R A;  3KD1 E;  3OS2 A;  1EWR A;  2VG6 A;  1ASW A;  2GBZ A;  3OYN A;  3K2P A;  4BAC A;  3I8B A;  4BR4 A;  2BH1 A;  5J1E A;  3BF3 A;  2GEL A;  4JAX A;  3WXJ A;  4H5N A;  2AA4 A;  4DU3 A;  1VSF A;  1TKT A;  3CD6 N;  3FE1 A;  5KPR A;  4JYA K;  3SYZ A;  5ELZ A;  3KK1 A;  3V1O A;  3ZSO A;  4IDH A;  4WFN L;  1KSP A;  5EVZ A;  5KQ8 A;  3AVG A;  1SKR A;  4ELT A;  4M3Z A;  4DSL A;  3U4L A;  4OVL A;  3MCP A;  1TV6 A;  1NKB A;  2O8B B;  3AO5 A;  4KAZ A;  4DV4 K;  2O8D B;  4FWL A;  1NJW A;  2YNF A;  3ITH A;  4EHU A;  3L6Q A;  4JKH A;  1YIJ N;  4AHS A;  4CHP A;  3THY B;  1D9D A;  2Q0U A;  4E7L A;  2HHV A;  1HR0 K;  4FM0 A;  5CY4 A;  2VCP A;  2FBX A;  1RT1 A;  5LMN K;  5KPT A;  5CHI A;  2EWS A;  3SJH A;  4FOI A;  3JXU A;  3O08 A;  1TVR A;  3LP1 A;  5HRS A;  1DT9 A;  4DTU A;  3EEQ A;  2A5X A;  4YOR A;  2GWK A;  4FLU A;  3HP6 A;  3C6H A;  1OH6 A;  1CZ9 A;  4FL9 A;  1W2B M;  3DI6 A;  4CFB A;  5KTQ A;  3MWP A;  5E41 A;  2AJQ A;  4DQP A;  4M3T A;  3PIP L;  2ATQ A;  1IV0 A;  3THX B;  3TSQ A;  1ZBS A;  4Y0W A;  4OGE A;  5C2D A;  2O8E A;  4FJ8 A;  2O8C B;  4CZM A;  4KH6 A;  2WTU A;  4LSL A;  4Z94 A;  1QSY A;  5KGW A;  3R3L A;  3ALY A;  3HI0 A;  1RDW X;  4CJR A;  3GG4 A;  4WFB L;  4IWV A;  3EZW A;  3MN6 A;  4XIU A;  4BDP A;  3WQT A;  3CM6 A;  4IJN A;  2JWL A;  2VG5 A;  3JS6 A;  1BI4 A;  2RN2 A;  4BRP A;  2GUI A;  4H8K A;  5HL7 L;  3OJU A;  3FFK B;  3AVJ A;  4ICL A;  2YNG A;  5C24 A;  4CJ5 A;  3M8R A;  2QWP A;  2E20 A;  3VQ6 A;  4TSX A;  1T6C A;  3I56 N;  2OZM A;  4W5R A;  4NLB A;  1NMN A;  1NGI A;  3GBT A;  4O4G A;  4E1M A;  4KKO A;  3QIN A;  5CZ2 A;  4BRA A;  4DLG A;  4RCH A;  4CFC A;  4IFY A;  1LWC A;  3AAQ A;  1RIL A;  3BP8 A;  3QML A;  2NLX A;  4W5T A;  3OYJ A;  2F8S A;  1HNZ K;  2A3Z A;  4FLT A;  1N33 K;  4B3O A;  3MXI A;  3G71 N;  1YJN N;  4N56 A;  4OO1 J;  4BRC A;  4X62 K;  3P1G A;  4CGJ A;  4DSE A;  3BGR A;  4LY7 A;  3IG1 A;  3DLR A;  1HRH A;  4E0D A;  3C6U A;  4MLE A;  1VQP N;  1W9H A;  3A8Y A;  3ENO A;  4DV5 K;  4OPH A;  2NRT A;  3S3M A;  1Z6R A;  4KH4 A;  1NGJ A;  4BE1 A;  2ASO A;  3SQ0 A;  1YAG A;  3VF2 A;  4E7H A;  2UUB K;  1Q8I A;  3VEZ A;  5FRN A;  1C1A A;  4GW6 A;  1I3A A;  3MED A;  1ASU A;  1WSF A;  4EIA A;  4E1N A;  1E4F T;  3LZJ A;  3WNF A;  4YFU A;  1RT6 A;  4YOW A;  2QXF A;  1HUX A;  4DR1 K;  3R6M A;  2KKZ A;  4NXN K;  3SUP A;  2E2O A;  1OH8 A;  4NLC A;  3O9R A;  3F73 A;  1C6V A;  5FPM A;  1U04 A;  5SZT A;  1HKG A;  3H3O B;  3H3N O;  1ZBF A;  1QS4 A;  1X3M A;  2PAV A;  1BA0 A;  4GVM A;  1IH7 A;  3F9M A;  3P31 A;  1KQS M;  1DEJ A;  4CFA A;  3HP9 A;  3HVR A;  2F8T A;  3RR7 A;  3VGK A;  3ENB A;  3OBW A;  3M5R A;  3DRP A;  1TKD A;  3U9D A;  1HPZ A;  4AH9 A;  3HZ6 A;  2Q31 A;  2B5J A;  3KHY A;  3D6R A;  3MEE A;  4CF2 A;  1A5X A;  3VET A;  5AQU A;  3E66 A;  4ILJ A;  2CGL A;  2ASM A;  3T1H K;  4BGB A;  4I2Q A;  1NK6 A;  2Q1N A;  3ULE B;  1RBV A;  4LH5 A;  1QSS A;  3RMA A;  1G15 A;  3SUQ A;  4WF9 L;  5HRN A;  3OA9 A;  1T05 A;  3LDQ A;  4HCC A;  3CCV N;  4BWJ A;  2P9K B;  3PIO L;  4J2D A;  1L3U A;  3CG7 A;  1Q86 O;  4YOX A;  2VG7 A;  4K42 A;  1RTH A;  3O9S A;  4HUE A;  1J5E K;  2ZF5 O;  4BR9 A;  4KI4 A;  5HRO A;  3VEW A;  3NE6 A;  4H0Y B;  1RBS A;  3KK2 A;  4FJI A;  4B8A B;  3RMD A;  2UXB K;  5ADX A;  1JLF A;  4FOE A;  4CJS A;  1X9M A;  5BRF A;  3DAW A;  4ELU A;  1WSJ A;  1CZB A;  4CCH A;  1RT2 A;  2RPI A;  3J80 O;  4A57 A;  3AGK A;  1XC3 A;  4CJW A;  4CJU A;  3JSM A;  4B3S K;  4PA1 A;  2GUP A;  4JNE A;  3WQU A;  1F21 A;  2O8E B;  3VEO A;  2WBN A;  3QEX A;  1VSE A;  4B1X B;  5C25 A;  4DV3 K;  4CJ7 A;  2IOC A;  3QEV A;  1VHX A;  4H03 B;  2P51 A;  3K0S A;  2V51 B;  5FDL A;  2V7Y A;  2QWN A;  2YKN A;  3T7Z A;  1RFQ A;  1EXQ A;  4O0J A;  2WON A;  4RW8 A;  2ZGY A;  1H1V A;  2XO7 A;  2E88 A;  4LF5 K;  4IKF A;  4JD2 B;  4H4M A;  1RTD A;  5J2Q A;  4QOZ B;  3J81 O;  2KLA A;  1KXP A;  3KD5 E;  3WXL A;  3H08 A;  1EX4 A;  1TGO A;  1ZBH A;  4CJ3 A;  2W6L A;  1TK0 A;  3U9Z A;  3OS0 A;  4DTS A;  1TL1 A;  1XHX A;  3NBP A;  4MLH A;  3VA3 A;  4JRQ A;  3RRG A;  2VWK A;  4CZH A;  3O4N A;  3SQ2 A;  1J5O A;  5B8H A;  1NGF A;  3MXJ A;  1IKY A;  1YIT N;  4AQY K;  1S3X A;  1MA9 B;  4F9O A;  4U67 L;  4RTF D;  2LSN A;  4ISG A;  2FSJ A;  4IEE A;  4FK4 A;  3SLC A;  3K57 A;  1SKW A;  1VQL N;  2BTF A;  3AVM A;  4CD1 A;  4DTX A;  1WBB A;  4AHT A;  3T3F A;  5J2P A;  3O3F A;  1OVQ A;  3OYA A;  1NGC A;  1GLL O;  5I9E B;  3LWM A;  1K6Y A;  5C12 A;  3ULE A;  2VWJ A;  2D0P A;  4KTQ A;  1DKG D;  2IVP A;  4JK8 A;  3TAG A;  4PWD A;  1N5Y A;  5C42 A;  4CES A;  4KO0 A;  1DGK N;  4DF4 A;  1ASV A;  3HL8 A;  3OVN A;  3V81 A;  3HTV A;  1HNV A;  3L0Q A;  4LD0 A;  4X66 K;  3VGM A;  1OH5 A;  1HYZ A;  2GX9 A;  4W5Q A;  1XMO K;  1QQC A;  4EFH A;  4AHU A;  1UA1 A;  1NWK A;  3KIO A;  1R59 O;  4BC2 A;  4CIE A;  1WSE A;  5BPM A;  2HHU A;  4IDK A;  4FJG A;  1NGB A;  2EHG A;  3UKR B;  2QWR A;  1G99 A;  1NK8 A;  5AQQ A;  4FJM A;  5F2R A;  1IKW A;  2FXU A;  4FVU A;  1RBR A;  3I55 N;  3K5M A;  3VQA A;  3C6A A;  4KHY A;  1NJY A;  1S1U A;  4WQ5 C;  5AQK A;  3UE5 A;  1S9E A;  3LDL A;  3LDS A;  1SL2 A;  4CE9 A;  4DQ8 A;  3WXI A;  4B9N A;  4LFB K;  4C1N I;  5FPE A;  1KVA A;  1WUA A;  3A5L C;  3O4Q A;  4BR7 A;  4J2A A;  4JKD A;  1WSH A;  4ISF A;  4CHZ A;  2HMI A;  2D0B A;  3OYK A;  1VRU A;  1V4S A;  4FK2 A;  4OKE A;  4DSF A;  2HHQ A;  2QXL A;  3LDN A;  2DFF A;  4GKJ K;  5M1K A;  3NCI A;  1OH7 A;  3CQ8 A;  1K73 O;  1RBT A;  2NNW A;  3CC7 N;  2ZGZ A;  3EO3 A;  2UUC K;  4FWQ A;  1VQ5 N;  3JYT A;  3O4W A;  2RHK A;  3EE9 A;  3CJC A;  2QWQ A;  4K0K K;  5HLF A;  3D2F A;  3T1Y K;  3AVC A;  4YDU C;  3OYE A;  5C2F A;  4ELV A;  4H0P A;  1NJX A;  4F3O A;  3OS1 A;  5KI6 A;  5AZJ B;  2YKM A;  3ZCM A;  2CH6 A;  3O8M A;  4CEB A;  3MX2 A;  3VEV A;  1VQN N;  2W41 A;  4BRE A;  1NK0 A;  1HMV A;  4CF8 A;  4C8N A;  3AO4 A;  3UKU B;  1KCF A;  4DFK A;  3P83 D;  1W97 L;  2KHO A;  4CJF A;  3E9P A;  4HWI A;  1B9F A;  4Y1C A;  4GMJ B;  3HO1 A;  3SCX A;  3H1V X;  4KBO A;  3MX5 A;  1C0U A;  2PYJ A;  5ADX H;  4I9Q A;  1HKC A;  1FJG K;  2B4J A;  1QZ5 A;  1JCE A;  5AQS A;  4MO4 A;  3VEN A;  1MDU B;  4LF7 K;  3A5N C;  4DV0 K;  3S9H A;  5C15 A;  3RMC A;  4AHC A;  2NUB A;  3ZET B;  1VQ7 N;  4CBW A;  5BN8 A;  4MFB A;  3TAQ A;  5K14 A;  2QA4 N;  4JI3 K;  4PUO A;  1BCM A;  1ESV A;  3VEX A;  2HND A;  2G8F A;  1SS6 A;  2YHB A;  3L2Q A;  4PKG A;  3U8X A;  3SUN A;  4B9M A;  1BA1 A;  5AQX A;  4L8R B;  4FM1 A;  4FJ5 A;  5M1Q A;  3H6E A;  3GOI A;  1ATS A;  1BIS A;  1KC8 O;  1NBW A;  3ZT4 A;  3PX0 A;  4A5B A;  4FWS A;  1NGD A;  2D0O A;  1UA0 A;  1BWF O;  4A2B A;  2IVO A;  4JS5 A;  4BC3 A;  3PX6 A;  1VSM A;  3FZL A;  4E7K A;  2A1S A;  2Q3S A;  1RDC A;  3SNN A;  1NK7 A;  1IG9 A;  1GLD G;  3M8P A;  4BY9 C;  4JV5 K;  2YJF A;  2BAN A;  3K9K A;  1HQE A;  1U6Z A;  2WOM A;  4KB0 A;  3ID8 A;  1GLC G;  1WAF A;  4KV8 A;  5AQH A;  1X1P A;  3H46 O;  4GV9 A;  3AO1 A;  4KHN A;  2GEM A;  1Q18 A;  3N4Q A;  3L2U A;  1C0F A;  3LAN A;  1HLU A;  4CBU A;  2HBJ A;  2IAJ A;  4CI6 A;  4CZK A;  4BRQ A;  2HBK A;  3D45 A;  4C1N K;  4FW1 A;  3V9X A;  1WB9 A;  1HQU A;  3IMX A;  4E89 A;  1VSD A;  5HRP A;  2KZZ A;  1HX1 A;  4DTR A;  4FK0 A;  2E8A A;  3MN7 A;  2HNY A;  3T19 A;  5FRM A;  3HT3 A;  3VQB A;  3J7Y P;  4NCA A;  4BVP A;  1HNI A;  3QNO A;  1D8Y A;  3NH1 A;  2OPS A;  4DTP A;  1HKB A;  3G4S N;  5T7B A;  3WXK A;  3A5M C;  4J2B A;  1RDD A;  1KAY A;  2CGJ A;  3D2F B;  3Q7B A;  4CZF A;  2E6L A;  3MEG A;  2H3G X;  3CER A;  1UWB A;  4K8X A;  3SBG A;  3CF5 L;  2HOE A;  5DM7 L;  3DJC A;  1VSK A;  4HVJ A;  1RCH A;  3UKU A;  4B1U B;  4DR7 K;  3DLB A;  4IZ9 A;  1RBU A;  4Z4G A;  3BZC A;  4Z4I A;  3EY1 A;  4CEQ A;  4N76 A;  3MAQ A;  1E3M A;  5FPN A;  3HPO A;  3TPQ A;  4AM7 A;  1D9F A;  4QS7 A;  3MWT A;  3C6T A;  3FZK A;  3LPT A;  3DLG A;  1C1B A;  4FLW A;  4B3T K;  3KLI A;  3FGU A;  1XC9 A;  4I7F A;  3LM9 A;  2Z1I A;  4DFP A;  3ZYY X;  2HHW A;  3KZB A;  3ZEU B;  5FLX O;  1Q9Y A;  1K8K B;  4LF6 K;  1RT3 A;  3DXK B;  3QDK A;  4KRE A;  5AQY A;  2QWO A;  2X6N A;  1JKH A;  4BG9 A;  1U4B A;  1NK4 A;  4DS5 A;  3WUH A;  3M6G A;  2F7T A;  2P9S B;  4DV1 K;  3HK2 A;  4CK1 A;  4DSK A;  4DF8 A;  4M3W A;  4CZJ A;  1NGE A;  3IUC A;  3OYG A;  3ZT1 A;  3DXM B;  1BI4 B;  1ZYQ A;  4O5F A;  4FPA A;  4XEI A;  2A42 A;  1U49 A;  4M41 A;  4KHS A;  4FYD A;  3VQQ A;  1QHT A;  5JMV A;  3EE8 A;  1P90 A;  3ISN C;  1U2V B;  5FRO A;  4IFV A;  3C7N A;  3KTQ A;  3V1Q A;  4C8K A;  2OTJ N;  1ZXO A;  4JI5 K;  3C65 A;  1NOZ A;  2YCH A;  3TWH A;  5GIO A;  4FM2 A;  4O44 A;  1NLV A;  3C7N B;  3OYC A;  4E7J A;  3B6O A;  4MDB A;  3SPY A;  3SAG A;  3U3G A;  1I39 A;  2QW9 A;  1LV5 A;  1NK9 A;  5BRE A;  1BQM A;  4DKW A;  4GY2 B;  3CHW A;  3O3G A;  1XMQ K;  4B1W B;  4BRK A;  4U7B A;  4BRF A;  4AHV A;  4CJ4 A;  4PKH A;  4JKF A;  1VQ4 N;  2IC3 A;  3LP0 A;  3VMF B;  1EQY A;  5GAG P;  1FXX A;  2YX6 A;  4DUZ K;  2OCE A;  4GV6 A;  2FBV A;  3HM8 A;  4Z0U A;  4KHW A;  1QQN A;  3OYL A;  2Q2R A;  5EOY A;  4DSJ A;  2YHW A;  2Y1J A;  5AQT A;  4EP4 A;  5SWM A;  4W5O A;  4BE2 A;  3OY9 A;  3VQE A;  3VQ8 A;  4BR2 A;  3L2W A;  3V6D A;  4A59 A;  4BRI A;  4Z4F A;  1I94 K;  5JS1 A;  3I0R A;  2E2Q A;  3TU5 A;  4YHH K;  1TK8 A;  3H1Q A;  5AQV A;  1NKC A;  2P9N A;  3KKS A;  4IO9 L;  3PSF A;  1QQM A;  4CBX A;  4Z4E A;  4W5N A;  2YV0 X;  4B9U A;  1VQO N;  4JI8 K;  3E9L A;  4FSV A;  2KW4 A;  2PBD A;  1UAX A;  1U2V A;  4JK7 A;  5CYQ A; 
#chains in the Genus database with same CATH homology
 3QLH A;  5J2Q A;  3S3O A;  2G8K A;  3V9W A;  4QOZ B;  3NH2 A;  3KD5 E;  1L3V A;  3HJF A;  3H08 A;  1EX4 A;  1GOB A;  1S6P A;  3AA5 X;  4BWM A;  4CEA A;  4CHY A;  1Q9X A;  1TGO A;  1LWF A;  1TKZ A;  1YT3 A;  4KTW A;  4RW6 A;  4CJ3 A;  1ZBH A;  4EP5 A;  3OS0 A;  4DTS A;  1TK0 A;  3NGI A;  4KB1 A;  1TL1 A;  1XHX A;  3NBP A;  3VA3 A;  3VQC A;  4JRQ A;  3RRG A;  4FXD A;  2VWK A;  2R7Y A;  1MU2 A;  3O4N A;  3SQ2 A;  4PY5 A;  2Z1J A;  3PO4 A;  3ZSW A;  3LWL A;  1J5O A;  3AVK A;  3M8S A;  3MXJ A;  4NYF A;  2IDO A;  3CM5 A;  3V4I A;  3HPH A;  1BIU A;  3WNG A;  1IKY A;  5KRT A;  2IS3 A;  1EET A;  1CXU A;  3IAY A;  2G8U A;  5KRS A;  2LSN A;  3QEW A;  4OKK A;  4FK4 A;  1A5W A;  4CGF A;  3K57 A;  3TI0 A;  1SKW A;  3NF8 A;  4B8C A;  2HHT A;  3AVM A;  4I2P A;  4RW9 A;  4IG3 A;  4DTX A;  4AHT A;  4HUF A;  3T3F A;  2HW3 A;  5J2P A;  3O3F A;  3SV3 A;  3OYA A;  2Y1I A;  4Q5V A;  4CHO A;  3PO5 A;  3PX4 A;  4CGG A;  1KFS A;  4CIF A;  2D0A A;  3DRS A;  3T1A A;  1K6Y A;  3LWM A;  3SUO A;  1RT4 A;  2G8H A;  4CJE A;  2VWJ A;  3EYZ A;  1C1C A;  1S1T A;  4KTQ A;  3TAG A;  2D5R A;  4PWD A;  3OYD A;  1RDB A;  4J2E A;  4CK3 A;  4ZTJ A;  3P5J A;  1N5Y A;  5C42 A;  3UIQ A;  4CES A;  4KO0 A;  4DTJ A;  3PV8 A;  2RKI A;  3U6F A;  4DF4 A;  1ITG A;  1YTA A;  4FJL A;  1ASV A;  3HL8 A;  4JS4 A;  2O4I A;  4F2R A;  3OVN A;  3OYB A;  3CYM A;  3V81 A;  1HNV A;  4LD0 A;  1IKX A;  3SQ4 A;  2D0C A;  3NGZ A;  3KLE A;  3RR8 A;  3ZT3 A;  1HYZ A;  1SUQ A;  1RTJ A;  4W5Q A;  3NH0 A;  4UQG A;  3I8D A;  1QQC A;  2ITG A;  2ZQB A;  4FLX A;  3S3N A;  4CJQ A;  2IGI A;  1EKE A;  4AHU A;  3AV9 A;  1VSL A;  1UA1 A;  1IKV A;  3VQ4 A;  2HHS A;  2Z1H A;  3ULD A;  3QES A;  3SJJ A;  4EZ6 A;  1YTU A;  3AVA A;  3KIO A;  1XHZ A;  3LZI A;  1JLA A;  4M3R A;  4CIE A;  3B6P A;  3RRH A;  1WSE A;  2P5O A;  3WNE A;  2HHU A;  1CLQ A;  3LP3 A;  4IDK A;  1TAQ A;  1D5A A;  4CEF A;  2YNI A;  4LH4 A;  2EHG A;  4FJG A;  2X74 A;  3KJV A;  2FBT A;  1NK8 A;  1RNH A;  4FJM A;  4Q0B A;  1IKW A;  1XWL A;  1RBR A;  4F3T A;  3EZ5 A;  3C94 A;  3AVH A;  3NF6 A;  3ZSX A;  4IG0 A;  3K5M A;  1BQN A;  3E01 A;  3VQA A;  3K58 A;  3SZ2 A;  4E7I A;  3G0Z A;  4DTN A;  4QCL A;  4FJ9 A;  4KHY A;  3V1R A;  4K8Z A;  1NJY A;  1S1U A;  2QK9 A;  3AVI A;  2OZS A;  4F2S A;  5HBM A;  1L5U A;  2P5G A;  3AO3 A;  2YNH A;  3VQ9 A;  4CIG A;  1TK5 A;  1S9E A;  2X6S A;  3QNN A;  3LDS A;  4DU4 A;  4CE9 A;  3TAN A;  3LAM A;  1RTI A;  4NCG A;  1SL2 A;  3PY8 A;  4DWI A;  2QKB A;  1JLG A;  5KGX A;  3VN5 A;  4B9N A;  1DLO A;  1ZBI A;  3A2F A;  4OPK A;  3RMB A;  2XHB A;  1TAU A;  2JLE A;  4BDY A;  4FZZ A;  3L3V A;  4O0I A;  1HYV A;  4DFJ A;  4CEE A;  1KVA A;  3FFI A;  4CER A;  3O4Q A;  3AVN A;  3NFA A;  4J2A A;  1Y97 A;  3L2R A;  1WSH A;  1S5J A;  3SI6 A;  3KD1 E;  3OS2 A;  3LAL A;  3QET A;  3OYF A;  1U48 A;  2VG6 A;  4CHZ A;  1ASW A;  2GBZ A;  2JGU A;  4N47 A;  4CJT A;  3OYN A;  2HMI A;  2D0B A;  3K2P A;  1VRU A;  2Z1G A;  1S9G A;  3OYK A;  4OKE A;  4BAC A;  4DSF A;  4FK2 A;  2HHQ A;  2DFF A;  5J1E A;  1HYS A;  3NCI A;  4KPY A;  1TL3 A;  1U47 A;  3CQ8 A;  2ZD1 A;  3SV4 A;  4B08 A;  1RBT A;  2HHX A;  4DU3 A;  1VSF A;  1TKT A;  4CJP A;  1KVC A;  3SYZ A;  1J53 A;  4NCB A;  3KK1 A;  1R0A A;  2GV9 A;  3V1O A;  3JYT A;  3HVT A;  3ZSO A;  1KSP A;  3TAE A;  1VSI A;  4KHU A;  3AVG A;  1SKR A;  1N6Q A;  4ELT A;  3TAF A;  3DYA A;  4Z4C A;  4B9S A;  4M3Z A;  3NHG A;  4HUG A;  4DSL A;  4KTZ A;  4O55 A;  5HLF A;  3HST B;  2DTU A;  1BGX T;  1JLQ A;  4OVL A;  4FZY A;  3AVC A;  4M3U A;  3OYE A;  4ELV A;  3LP2 A;  5EU7 A;  1NJX A;  4F3O A;  3OS1 A;  1TV6 A;  1NKB A;  5KI6 A;  3AO5 A;  4KAZ A;  3KLF A;  2PYL A;  2YKM A;  3ZCM A;  2YNF A;  1NJW A;  3ITH A;  3ZSR A;  1NOY A;  1TKX A;  4CEB A;  1JL1 A;  3QER A;  4AHS A;  1FK9 A;  4CHP A;  1QSL A;  1D9D A;  4FJN A;  3CFO A;  1FKO A;  3DRR A;  3AA2 A;  4E7L A;  2HHV A;  1NK0 A;  4I9L A;  1HMV A;  5CY4 A;  4FM0 A;  2XY8 A;  3L3U A;  4CF8 A;  3ASM A;  2FBX A;  1RT1 A;  1Z26 A;  3AO4 A;  3IS9 A;  4C8N A;  4CK2 A;  1KCF A;  4DFK A;  4FJX A;  3KK3 A;  3P83 D;  1KLN A;  4FJJ A;  1WSI A;  4F4K A;  4CHQ A;  4OLA A;  1HJR A;  4CJF A;  1GOC A;  4OLB A;  3QIO A;  1GOA A;  1B9F A;  4Y1C A;  4GMJ B;  3HO1 A;  3SCX A;  1TVR A;  3LP1 A;  5D3G A;  2PYJ A;  1C0U A;  5HRS A;  4I9Q A;  4Y1D A;  1QE1 A;  4DTU A;  2B4J A;  3KLH A;  3DOK A;  4FLU A;  3HP6 A;  1WLJ A;  3NGY A;  1CZ9 A;  3S9H A;  2A1R A;  1J54 A;  4QAG A;  3U3Y A;  4AHC A;  1LWE A;  2NUB A;  3DI6 A;  4MQ3 A;  4CFB A;  3RMC A;  4CEZ A;  4DQI A;  1REV A;  4MFB A;  3TAQ A;  1NK5 A;  5K14 A;  3D0P A;  5KTQ A;  4PUO A;  4NYN A;  1BCM A;  4JLH A;  1JLE A;  3L8B A;  2HND A;  5E41 A;  1X9W A;  2G8F A;  4FJ7 A;  2YHB A;  3L2Q A;  2XY6 A;  2HVH A;  2AJQ A;  3TAM A;  4DQP A;  2FBY A;  3SUN A;  2ATQ A;  3QO9 A;  4B9M A;  4M3T A;  4PQU A;  2HVI A;  4L8R B;  2KFN A;  4FM1 A;  4FVM A;  4FJ5 A;  1JXE A;  4CJK A;  4DSI A;  2XY5 A;  3AVB A;  1S1X A;  4OGE A;  1KLM A;  1BIS A;  3ZT4 A;  1L3T A;  3ZSV A;  3PX0 A;  3HYF A;  4CHN A;  1UA0 A;  4FJ8 A;  4FLV A;  3QEI A;  4JS5 A;  4IBN A;  3PX6 A;  1VSM A;  3M8Q A;  4E7K A;  2A1S A;  1JXB A;  2Q3S A;  1ZBL A;  4N41 A;  4AIL C;  1RDC A;  4LSL A;  4ZHR A;  4M45 A;  4Z4H A;  4DQS A;  3TAR A;  3SNN A;  5KGW A;  1NK7 A;  1IG9 A;  1QSY A;  3ALY A;  3V9S A;  1JLB A;  4DFM A;  3M8P A;  2PY5 A;  4CJR A;  4H4O A;  1WNS A;  1KFD A;  2OYQ A;  3I0S A;  4XIU A;  4BDP A;  2BAN A;  4KFB A;  3CM6 A;  1HQE A;  3MEC A;  2VG5 A;  2WOM A;  1BI4 A;  2RN2 A;  4H8K A;  2GUI A;  4WE1 A;  3OJU A;  4KB0 A;  3ZSZ A;  1WAF A;  4KV8 A;  3C95 A;  1X1P A;  2XRI A;  3AVJ A;  4ICL A;  3VQD A;  3ZSQ A;  4ID1 A;  4FLY A;  2OA8 A;  3AO1 A;  1LW2 A;  4ID5 A;  2YNG A;  4KHN A;  5HP1 A;  5C24 A;  4CJ5 A;  3HM9 A;  4FJK A;  3M8R A;  3L2U A;  4HTU A;  1L3S A;  1QTM A;  3QIP A;  1W0H A;  3VQ6 A;  3TAB A;  3LAN A;  3LAK A;  4TSX A;  1BCO A;  3TR8 A;  2KZM A;  2OZM A;  4W5R A;  3OJS A;  2KFZ A;  1C0M A;  2IAJ A;  3NF9 A;  1BL3 A;  4E19 A;  3K5O A;  2OPP A;  1KRP A;  3D45 A;  4B9L A;  4O4G A;  4E1M A;  4FW1 A;  3OYM A;  4KKO A;  4HHT A;  1HQU A;  3QIN A;  5CZ2 A;  4E89 A;  4DLG A;  1VSD A;  4RW7 A;  4CFC A;  5HRP A;  2KZZ A;  4DTR A;  4FK0 A;  4IFY A;  4CEC A;  1LWC A;  2HNY A;  3T19 A;  4CF1 A;  4DLE A;  4B9T A;  4OJR A;  4EZ9 A;  3AA4 A;  3HT3 A;  3VQB A;  1RIL A;  3MXM A;  3OYH A;  5FRM A;  4NCA A;  4CJV A;  3AO2 A;  4W5T A;  1HNI A;  3OYJ A;  3QNO A;  5CYQ A;  1D8Y A;  3PUF A;  2F8S A;  3NH1 A;  2OPS A;  4DTP A;  4AHR A;  5T7B A;  4FLT A;  4B3O A;  3MXI A;  2ETJ A;  4OKJ A;  4J2B A;  1RDD A;  1UOC A;  2P1J A;  3AA3 A;  1SL1 A;  1S6Q A;  3KKR A;  4N56 A;  2F96 A;  4LSN A;  4BDZ A;  2BDP A;  2G8W A;  2E6L A;  3MEG A;  3P1G A;  4CGJ A;  4DSE A;  3BGR A;  1UWB A;  4LY7 A;  1RDA A;  3IG1 A;  3DLR A;  3DM2 A;  1HRH A;  4K8X A;  4FLZ A;  3O3H A;  1SV5 A;  1NJZ A;  4E0D A;  3C6U A;  4O5B A;  2G8V A;  1VSK A;  1W9H A;  4HVJ A;  3RWU A;  1RCH A;  3F9K A;  3S3M A;  3DLB A;  1VRT A;  2BE2 A;  4BE1 A;  1RBU A;  3SQ0 A;  4E7H A;  4Z4G A;  5FRN A;  1Q8I A;  4Z4I A;  1C1A A;  3DOL A;  4GW6 A;  3EY1 A;  4CEQ A;  1A5V A;  5DMR A;  4N76 A;  4M3X A;  3MAQ A;  1I3A A;  3MED A;  3VQ7 A;  3HPO A;  1ASU A;  2HB5 A;  1WSF A;  3VQP A;  4E1N A;  1D9F A;  3LZJ A;  4DQR A;  3WNF A;  1DTQ A;  4C8O A;  3C6T A;  4YFU A;  1VSH A;  1T03 A;  4FCY A;  1RT6 A;  3LPT A;  2ZE2 A;  4RG8 A;  3DLG A;  2HNZ A;  3G10 A;  1C1B A;  2QXF A;  4FLW A;  1BIZ A;  3KLI A;  1XC9 A;  4I7F A;  2KTQ A;  2XY7 A;  4JRP A;  3HPG A;  3SUP A;  4KRF A;  2Z1I A;  4DFP A;  3V9Z A;  3F73 A;  1C6V A;  4ZTF A;  1U04 A;  3NAE A;  1RT5 A;  5SZT A;  2HHW A;  3DLE A;  1KVB A;  2FC0 A;  1ZBF A;  1Q9Y A;  3DMJ A;  1QS4 A;  2EX3 A;  4DQQ A;  1RT3 A;  1C0T A;  4GVM A;  1IH7 A;  5CYM A;  4KRE A;  4M42 A;  1WN7 A;  4CFA A;  3HP9 A;  4DTM A;  2X6N A;  3HVR A;  3V9X A;  1JKH A;  1U4B A;  3NF7 A;  1KTQ A;  4DS5 A;  3SPZ A;  1NK4 A;  2F8T A;  3RR7 A;  3K5N A;  1VSJ A;  3DRP A;  3HK2 A;  1TKD A;  3QEP A;  1HPZ A;  4CK1 A;  1WSG A;  4AH9 A;  3KLG A;  5I42 A;  3ZT2 A;  4DSK A;  2O4G A;  3CFP A;  4DF8 A;  2B5J A;  3MEE A;  4M3W A;  1BHL A;  4CF2 A;  1A5X A;  1U45 A;  4DG1 A;  3ZT1 A;  3OYG A;  4M3Y A;  1BI4 B;  1ZYQ A;  2DY4 A;  4CEO A;  4KHS A;  1U49 A;  4M41 A;  2BGG A;  4FYD A;  4I2Q A;  1NK6 A;  3VQQ A;  4CED A;  1T7P A;  4C8L A;  3IRX A;  1QHT A;  3OYI A;  3ISN C;  4DMN A;  3HXM A;  2E6M A;  5FRO A;  4IFV A;  4F8R A;  1RBV A;  1LAW A;  3V1Q A;  3KTQ A;  2DFE A;  4LH5 A;  4CFD A;  3CFR A;  3VQ5 A;  3V9U A;  3AVF A;  1CXQ A;  3VA0 A;  5J2M A;  1S1V A;  1G15 A;  3RMA A;  1QSS A;  4C8K A;  4KHQ A;  3SUQ A;  1NOZ A;  5HRN A;  5CZ1 A;  1JL2 A;  1T05 A;  3TWH A;  4DTO A;  4FM2 A;  4O44 A;  3SQ1 A;  4HCC A;  1LAV A;  5J2N A;  3OYC A;  1O1W A;  1YVU A;  1S1W A;  4E7J A;  3B6O A;  4BWJ A;  1RT7 A;  3L2V A;  4HCB A;  3SPY A;  3WNH A;  3U3G A;  1I39 A;  1LV5 A;  4J2D A;  3BDP A;  1L3U A;  3CG7 A;  1NK9 A;  1BQM A;  2VG7 A;  3O3G A;  3ZSY A;  4CJL A;  1RTH A;  1Z25 A;  1DTT A;  2I5J A;  1VK0 A;  4G1Q A;  4AHV A;  1B92 A;  4CJ4 A;  2KQ2 A;  4HUE A;  1SL0 A;  2IC3 A;  3K5L A;  3LP0 A;  4KI4 A;  5HRO A;  3NE6 A;  1B9D A;  4CF0 A;  1RBS A;  2X78 A;  4KI6 A;  1FXX A;  1X9S A;  4RW4 A;  2OPR A;  4BE0 A;  1JLC A;  3KK2 A;  2FBV A;  4B8A B;  3RMD A;  4FJI A;  4Z0U A;  5HRR A;  1JLF A;  4OPJ A;  4KHW A;  3OYL A;  3NDK A;  2OPQ A;  1LW0 A;  4CJS A;  5DK5 A;  5I3U A;  1X9M A;  1T8E A;  4DSJ A;  4FZX C;  2Y1J A;  4ELU A;  4N5S A;  4EP4 A;  1WSJ A;  5SWM A;  1CZB A;  1ZBU A;  4CCH A;  4W5O A;  4BE2 A;  1RT2 A;  5JS2 A;  2RPI A;  4CGI A;  3OY9 A;  4CGH A;  3VQE A;  3VQ8 A;  3DLH A;  3L2W A;  4DU1 A;  3V6D A;  4CJW A;  4B9V A;  2G8I A;  4CJU A;  3JSM A;  4Z4F A;  4PA1 A;  4C8M A;  4YNQ A;  3I0R A;  5JS1 A;  1J9A A;  2QKK A;  1TK8 A;  1F21 A;  4DS4 A;  4FJH A;  4FW2 A;  2DFH A;  3LPU A;  1NKC A;  2B6A A;  3QEX A;  3THV A;  3KKS A;  1VSE A;  5C25 A;  2E4L A;  3QEV A;  2IOC A;  3ZT0 A;  2W42 A;  2P51 A;  4Z4E A;  4OGC A;  5FDL A;  4W5N A;  2YHA A;  2YKN A;  2YV0 X;  3AVL A;  1SKS A;  4CGD A;  4B9U A;  4O0J A;  1EXQ A;  4CF9 A;  3DLK A;  2RF2 A;  2KW4 A;  2WON A;  2PZS A;  4RW8 A;  1EP4 A;  4E3S A;  1IO2 A;  3RTV A;  3TAP A;  1UAX A;  2XO7 A;  4IKF A;  1FKP A;  3K59 A;  1XI1 A;  4R5P A;  4H4M A;  1NKE A;  1WAJ A;  1RTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...