4OQ1A

Structure of the streptococcal ancillary pilin
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
334
structure length
331
Chain Sequence
EDHTLVLQLENYQEVVSQLPSRDGHRLQVWKLDDSYSYDDRVQIVRDLHSWDENKLSSFKKTSFEMTFLENQIEVSHIPNGLYYVRSIIQTDAVSYPAEFLFEMTDQTVEPLVIVAKKTDTMTTKVKLIKVDQDHNRLEGVGFKLVSVARDVSAAAVPLIGEYRYSSSGQVGRTLYTDKNGEIFVTNLPLGNYRFKEVEPLAGYAVTTLDTDVQLVDHQLVTITVVNQKLPRGNVDFMKVDGRTNTSLQGAMFKVMKEESGHYTPVLQNGKEVVVTSGKDGRFRVEGLEYGTYYLWELQAPTGYVQLTSPVSFTIGKDELVTVVKNNKRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall surface anchor family protein
publication title Structural Basis of Pilus Anchoring by the Ancillary Pilin RrgC of Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Cell adhesion
total genus 78
structure length 331
sequence length 334
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oq1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oq1A03
2.60.40.4180 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4oq1A01
1SMOA 4OJFH 3PQYE 4DTGH 3CLEH 3KPRE 1DBJH 3VFPB 3KAAA 1YNKH 3U30C 4LARH 5E1AB 4MCYA 1EEZB 3TIDA 4HPYH 4IM8A 1RU9L 1XR8B 4QNPE 5HHME 3BP5B 1KTDB 4HWEL 4ORGA 4H5SB 5IW1B 2DYPD 5FHAH 4LF3A 2ATKA 1CG9B 2JJSC 4FFWC 5HPOA 3L3JB 3O3AB 5SWQB 4FFWD 3IU4L 4R26L 2OL3H 2IH1A 5J0BA 2DB8A 3CX2A 4UDUB 2EIBA 1ADQL 4H88L 3X12A 3N9GH 1MJ8H 1NFDE 5GGTL 3ARFC 5IMOB 1KC5H 4U1KA 1P7KA 3DV4B 3BRFA 1G9NH 4LPUA 4GW5B 4LHQB 4L4VD 3VFGH 1OCWH 5ID0A 1BIIA 1ORQB 2P43B 4ODHH 1YMME 2EIZB 4XHJD 4R4ND 4P9HL 1C08A 4XBPB 3AXLB 3O45A 1AGCB 1JL8A 3GSWA 5F7UA 1KB9J 1I7TA 1Q9WA 1BBDH 1D9KB 1MHCB 4XAWH 3QUYB 1JV5A 4NN6B 4PV8A 2R29H 1LEKB 2DIJA 3H8NA 5I18H 4E5XB 1WT5A 4WJ5A 4Y16D 2MKWA 4M43H 3KDMA 3PQYB 4DKFL 2E9WA 3KPRB 4OFYA 4U1JB 4YBQD 1IMHC 2YPLD 2NNAB 1LGVA 4S2SA 2XN9D 1ZT1A 5DRXB 4E0RA 5KBNC 1UCBH 5EUKB 1U8JA 2XV6B 3EYFB 2VL5B 5HHMB 5F72S 2AK1L 4PJBE 4OZFB 1H15A 2DTML 4NQVB 3GBNH 1FVCA 4LHUG 3OG6B 1U8MB 4M7ZB 3ULVH 1JRHL 2B1AL 1YN7B 3CH8A 1MCHA 4HIXH 2VXVL 4QY8A 4LSSL 1KV3A 2R0KL 4EUPH 5EU3A 3QQ4B 3ZZ1A 1FVDB 1DBAH 1NFDB 4ZO6A 1T5WB 2X2YA 1AR2A 3QIBB 3GIVB 2EYRA 5DQDL 2HVKA 5B38G 4JQXC 3WIHL 1LEGA 3QRFM 4OCNC 3MRHA 1ADQA 4JZOA 4YDIL 1NCBH 4W6WB 2NX5E 2WWKT 5GGTA 4YFEA 3CSBA 1U3HD 4WIQA 1KG0B 4PRBA 1BLNB 1JFQH 1JYNA 1WBYB 1ONQA 1YMMB 3RWFB 4WY7L 3KWWA 25C8H 5F7EL 4U05A 3X3FL 5DJ2A 4FOMA 1F2QA 2ADFL 1P7QD 1KPUA 1WF5A 1EBPA 3S3SA 5E5UB 1KN4H 2HFEB 3GNMH 5T1KD 1YY8B 2VO5A 5HYFA 1XFPA 2FGZA 1CWVA 1NFIA 5D1ZB 4XPAL 5EIIA 3X17A 2NW3A 4OGZA 1I9JH 1ORSB 4Z0BL 1VKXA 1ZVSA 4I2XE 4OKVB 5FUOL 3U0TB 4X99A 3VXPA 2XWJB 5DHVA 5DZOA 4PV9A 3EJZC 1AIFB 4R97B 4NO2B 2AEQH 3IETB 2HT4C 1UYWL 4PJBB 5BXFB 2ZCHL 2ARJQ 4ZTPH 4Y5VA 5F7MC 2EE2A 3RIFF 4F9LA 4XP5H 1H3VA 2ZP0T 5E9DE 3UJTH 5KSBE 1EA9C 3DX8A 3OXSA 5F96L 1FO0H 1XF5B 3ZHDA 1DEDA 2Q7NA 5L0QB 3NCYS 4B7LA 3KNBA 4GRMB 2CXGA 5IVNA 1M7DA 4LCWE 1C5BL 2VDKL 2X70A 3VXUD 4RAHA 2H26B 1C12A 2NX5B 1QBMH 5CSBA 4H0GA 3ROOA 4UNTA 1P5UA 2LAGB 3WIHA 3NN8A 3MJ8B 4IRSD 4OGYH 2ITCB 2AJZA 3GRWH 4J3SA 3VW3H 2X1OA 1MJUH 4MQSB 1P4BL 4XCYB 3JTSB 3EUUA 3U1SH 1ZVYA 4N0UA 1J8KA 2IBBA 3BRGC 2X44D 4HBCL 4D0CA 1BIHA 5CINH 4EBQL 4UT7L 2BRRH 3QFDA 4KAQH 4ZOAA 3N85H 2F8OA 5BZWB 1F11A 5HD8D 1A7QL 4WFFE 1VB9A 4I2XB 3W39A 3WUWB 1S5IL 1JK8A 5FM4A 1IBGH 3QQNA 1WVZA 4P2OB 4JO1L 1CT8B 5AAWA 5I8CB 1L6ZA 2FJFB 3IFLL 3ISWA 2VQ1B 1A3RL 2Y4SA 5L8KB 4JZJC 3S35L 4PJIE 4MA1B 4PLKC 2EDRA 4H26A 2FO1A 1FBIH 3PUCA 1HQRB 5TGBA 5I1CH 1A8JH 4PLKD 2VXTH 3G6AA 1FFNB 5BCAA 1IAIL 5F21B 2QR0B 5E9DB 1BFVH 1N64H 5KSBB 2PETA 1U3ZA 3QDMA 1BQUA 1C5DB 1B6DA 2BOCA 1YMHB 1JZ8A 1VHPA 1AJ7L 2NY1B 2XPGB 4MA3A 5IBUB 1INQA 4G8IB 4LCWB 3RUGA 2H1PL 3RBSA 3FRPG 5DS8B 5EZLA 5GHWL 1FYTD 3NZ8B 3IXTA 5HVWA 2QQNL 2XWTB 3O2VL 4NSKB 5DDHB 3LRGA 1GIGL 1H9VA 1AGBA 4ZQKB 3DMMD 3LS4L 1H3UA 5ICXA 5LGJB 1RHHA 4PRAB 2VZSA 1ITBB 1F5WA 2H2PC 2MJWA 5D2NE 1DDHA 4M48H 4NKOB 1JNHA 3OKOA 5DJAB 1FIGH 1ZLWH 2QADC 3HHRB 4NOFA 3DYPA 4OZFH 5I1IL 4M5YH 3HLAB 1FZJA 1QBLH 1J1PL 5CCKH 2OJEA 3NFSL 2UWEA 3HNSH 3WLWC 4Q74A 4HV8A 2YN5A 3MRIA 5HGBA 2GUOB 3D2UB 3FO1B 4R96B 5E2WL 2EDTA 5F1OB 2DD8H 1TJHH 3UTSA 3MV11 1X4XA 3MRLA 3DXAA 4G7YH 1MCBA 4MNGE 1F4YH 1F3DJ 1EEYB 4OAWB 2EIEA 5MI0C 4XNMB 3VFUA 1TITA 3P2TA 4PJIB 4KVNH 3UBXB 4NBZB 5FIEA 5CJ8A 5EO0B 4P2RA 1NAKH 1UCTA 2YUZA 4L8SB 4PR5B 3H7BA 3EYUH 4GAFB 3TO4C 2CJUH 2PYFA 3GI9L 4JFEE 2W1NA 5DF0A 1RJZB 1MEXL 1I9RH 4M6NL 2WBWB 4L3CA 2NZ9C 1OSPL 1W72B 2GJZB 5SWSE 3B6SB 3MJ7A 4EDXB 4W81A 1J5OL 3LKOA 1I1AA 4YPGB 1CDJA 4RGND 3ECBB 2Y25A 3OSKA 2AABH 3PG2A 1YNTA 4EOWL 3GMPB 1UWXK 4ZNCD 2EDNA 2G75A 4DGVH 1S3KH 4NHUB 2VR4A 4LEXL 3U46B 4QTHB 4MD4A 5C0GB 1MRDH 5IVZB 4NRZB 3SE4C 4RA0C 1ERNA 1P4LA 1VGEH 5I16B 1JGUL 2HMIC 1SEBA 1X5ZA 2Y06L 4LVOB 4WU5B 5D2NB 3WNNA 5C3TA 3KJ4B 4P57B 2BVPB 1UM4L 4LOUC 2FDBP 1FGNL 2DQTH 4PJDE 1V5JA 2VIRB 1LO5A 4NNYB 1CE6B 5C0EA 4K8RD 3FQXB 43CAB 5I8KH 1ZAGA 1TVBA 2ZG1A 3S5LG 5JDJA 1S5HA 1A7RH 4OZGA 3CFDA 3SDYH 4N5EC 1H3PL 1T89C 4I9WD 2ADJB 1TTUA 2ARJB 5C9JB 1NAMA 5C0FA 4A6YB 1KTLA 5HYIA 3IYLW 4MNGB 2E5EA 2HKHH 5FGSA 1X3DA 5ALCL 3Q6GH 1WISA 3VG0H 3VGAB 1AO7E 2IPTL 3HB3D 5L9DH 4M1CC 3O4LE 3ZT6A 3RUGF 5GGUA 2NY4C 2W65A 2VDML 5EO9A 3N50A 3MUZ1 3QUXC 1JPSH 4Y2DC 2OI9B 2DKMA 3MV7E 1CS6A 4JFEB 2MQ0A 1F6FB 1X5AA 3HCVB 1HEZB 1KLGA 2E7MA 5GGRA 3MZGB 4NWUL 5SX4H 3VXMA 4NQXA 2DAVA 2OTUB 2VSCA 5SWSB 3RTQD 1V3MA 5EIQA 5J9PA 3FJTA 4KJWC 3SGKC 1R24A 4LK4A 1EGJL 4NZUH 2R1XA 3LY6A 2V17H 3HC0B 3RPIA 1RIVH 3UYRH 3LPGA 1G7PB 2UWEF 2CDFA 1KCVH 3TBTB 4AM0B 2YPKA 3LZFL 4LIQL 1RVFL 4R3SB 4HUNB 1KJMA 3TGXA 1A7NL 4RGOL 3CFCH 1QSFE 3QT2A 2I60H 1U95B 1A4KA 3WL9A 2WQ8A 4PJDB 4X7TB 3MLVH 5TQ0H 2DWEB 5DURD 1I7ZB 1U8HB 1LK2B 2GK0B 4GRLA 3IF1B 4X4XA 1ZXQA 2H45A 4MB3A 3CH1A 3HFML 3LN5A 2XT1B 4IBLT 4XH2B 4BZ2L 3SOBH 4U2ZA 5DSCA 2AK4D 2R15A 2RR3A 3OKKA 4LSPH 3ARGA 1IGTA 4RIRA 2EE6A 4KJQC 4LSRL 1OAZL 5J6GB 3NA9L 3BJ91 3E1F1 3F7VB 1JGLL 5JMOC 4CVZA 2HRPL 4NM8L 1AO7B 4NPYB 8FABB 5EORL 2Y1VA 3O4LB 1IQWL 1SVZA 4PP2A 5IMMA 4QRRE 2R4SH 1NLDH 3SGDI 3OAUL 1CICB 1MHHA 3QXDB 3WSQH 5E7BA 5JORB 4EEEA 3VRJA 1TZHB 4U6HA 2F19H 2OMBA 4RSVA 3MV7B 4LLVB 1NGXA 3P4LA 1SM3L 3OKDB 3TN0A 1G7IB 3BW9B 1UA6L 3I02A 1L0YA 1LVEA 3VGDA 3V4PH 2VDOH 2X42A 4XNUH 2A83B 4X9FA 5MHSE 2ED9A 3IRZA 5B39A 3T0DA 4OSUL 4YPJA 4MNQE 4PG2C 1NJ9B 4X4YB 1SJXA 3MR9B 3B9KC 3QPXL 2FBJH 1JJUA 4QHMA 5GS3A 5MEOB 2GQHA 3EDKA 4OZGF 4Q2ZB 4ACPA 4MJ5B 1CI5A 5DEZA 5D1XB 2D7OA 3TZVC 1QSFB 2F5BH 5C09D 4OT1H 4Y1AD 1C5CL 4OZ4A 3GSRA 4BK4A 3MCKA 5I1DA 1B2WL 1NGPL 4UB0L 5F1IB 1KCRH 1S9KC 3D18A 4J7RA 1FNGA 4OLYH 3OKLB 2CO6B 3MBED 4AIOA 4E9LA 2XZCL 1OW0A 3MOAL 5JXAH 4HIIA 4UT6H 3TWCH 1CL7H 4PGZA 4IS6B 5JHDD 2AJVL 1A3LL 4KK6D 1RURL 4GLRH 1QA9A 4FS0A 5MEPB 1W8OA 2NZIA 1CLZL 2QLVB 2VLRE 3MRDA 1UZ8B 4HUUB 1E27A 1MCFA 4HS3B 1MCSA 3CFJB 4QRRB 3ARDB 5I1KL 1ZOXA 4KTYA 3N1QC 3SCMB 4KRNA 4MA8L 1GOFA 3MYJB 4PJ7A 5DD6B 4JKPL 2EDBA 1T7ZA 2P5EE 3RIFK 1IKFH 4GXVL 3ESUF 4HMCA 1GAFL 5DWUL 4HUXA 3MRKB 1RUMH 1MVUB 3MBXH 5JNYA 1VFAB 1I3RA 4AH2B 4U6VL 5J89A 1F2XK 3DPBA 4GG8B 3WE6B 5K9KA 3GMQB 2PXYD 4EI5B 1NDMB 5I1GH 5T5FH 5LVEA 1CQKA 3I85A 5EC1A 3VCLA 5FYJU 4MNQB 3BXNA 3MV9D 1UKQA 3G6JE 2X9XA 4RNRB 5C0ND 3PABA 4FQ1H 2G9HB 4JPVL 5CIPB 1X44A 2HJKB 4GKNA 1A6TA 4G8GA 3O9WC 2ATPB 4DVRH 1XGRA 3QDJD 1N2RA 4M3JA 2MCPL 4Q9CA 3KPNB 3FTGB 3LVEA 2IPKA 4S1RL 5E4IA 4W70A 3VGHA 1BEYH 5H37G 3A6OA 1TZGL 2N7AA 1CZ8L 5JLZB 3WS6C 4Z0XA 3V0AC 1A5FL 3V95A 1M7IB 3FFDB 4YIQA 2VLRB 3TBYB 3PL6D 4I48A 2A6KA 5F7HA 2IGFH 3MFFA 3RA7H 3RWDB 5FDWB 3OJ2C 5CBAA 4X7FC 2GFBA 3AVEA 3IDUA 2FATH 4U1HA 3U48A 5JXEA 3HAEB 4JFPA 4KKNA 2P5EB 3KYOB 1J0ZA 4FQQB 4CJ1A 3MA7A 3CDGB 3GJFH 5CJQL 5GIRA 4WDIA 4HKZB 3MXVH 2FYYA 2R2EB 1XMWA 4CADA 4U1GC 4OB5H 2VAAA 5DZLA 1H8OA 4NUGH 4PJ5E 4MNHB 5E7FA 2WINA 4ODTL 1LP9F 2A1WL 1A1OB 3BMVA 3G6JB 1C16B 2G5BA 1YEEH 3ZKMD 2BNUB 2ZSWB 1VFUA 1ITCA 4HGWB 3DIFA 4KK8D 1IT9L 5LXGL 4W4OC 2ZNWA 3V6OE 3IDNA 1RZGA 1I8IA 3T4YA 2X4RB 3MRJB 2Z31B 3CFKA 1KGCE 4WUUD 2FJGA 4GKSB 2A0LC 4DWHA 3CLFL 4UT9L 1XCQA 1M1SA 4OV5A 5GJSH 1PW3A 5ERWA 1ZTXL 1WEJL 1RJCA 4NIKB 5D2LE 3I6KB 1UXWB 4HJ0C 1NC2D 4XMKL 3GMRB 5DUML 4XNXH 1EPFA 5DLMH 3RVUD 1HYSC 5GRJH 4WHCA 3HNTL 3C5ZC 4PP1C 4KMLB 3U9UA 4P48A 3OX8A 5DK3A 3UMTA 4LSDA 4ODBD 3VFWA 3MLSH 4JPWH 3EJYD 3MSPA 4HJJH 2DI9A 4JFFA 5DRZA 3UTTA 4NCDA 1C7SA 3C5SB 4PJ7F 5D8JH 5BJTB 4YX2H 1WIPA 1CTNA 1IQDA 1X5JA 4UBDC 4PB9L 1B0GA 4NQTA 2PCPB 35C8L 1FNSL 5BZDA 5CP3H 1N6VA 3T3MF 2ENYA 1R3HB 1P5VA 1VEPA 2J8UE 2K3TA 2ESVA 4D0DA 5F6IB 5DJYB 2FWOB 4MD5B 3LQZB 1DUZA 1X5FA 1KENL 2KBGA 3HMWL 4PJ5B 1KT2B 3DLQR 4OCYH 1S7VA 4APQB 3MV8A 4NP4L 3T2PA 5EOCH 2B2XL 3NFNA 4O2FA 4Y4KB 4KK5C 1HK6A 2WBKA 1I8LA 1LILA 4KK5D 5INDB 1GVIA 4TUOA 1FLRH 3ARBC 2HKFL 3ZT5A 3QNZB 4F33A 4FTVA 3TYGL 1HKFA 5ICZA 2VC2L 3HZMA 1KBGL 4I4WB 4GAYA 1B6UA 4QEGA 3STLA 5D2LB 5T3ZH 3LV3B 1YQVL 3QWRD 1OAYH 1NEUA 3SDAC 3D39D 4OF6A 4LPTA 3SDAD 3CVIH 1TTFA 1UG9A 3O6FA 4FN0A 1TDQA 3QG6B 5TPWH 4OM0H 3OAZK 1D5XB 2Z93B 1UGNA 3PP3K 5DTFA 4MCZA 4MDIA 2LTQB 4MMXC 4U1SB 4JN2B 4FABH 4R0LB 4N1HB 4Y4FD 4KU1A 2CIKB 3C2AL 2YD3A 4QF1A 2HVJB 3ZHLA 1PEWA 1KIRB 5CILL 4H1LG 1GC1H 4XRCB 1JHTA 2XKNB 3WJLA 4ZSOA 4LVNC 4Z7NF 4LHUB 4NZRH 1EFQA 1PSKH 2WIMA 2J8UB 3HI5H 4WFEE 1N0XL 5I76A 3DNKA 2FRGP 1D6EA 4NNXA 5B8CB 1N59A 2YD2A 3EO1A 4KTEH 3SO3B 5DJDA 2RFXA 1HXMB 5JOPD 4OCSL 4PGEB 3V6FA 1GZQB 3OR7B 5B38B 1ND0A 1NMCC 3QUKA 5CUSL 4HT1H 3O6LL 3C08H 3SDXA 5F1KC 5D7LD 1U8NA 1KJVB 1FGVL 1HCVA 2DQDL 1U8QB 5F7WC 4HXBL 4PRHA 3QDHA 4FQXA 2R0ZH 3TYFA 4HPOH 1DEEB 3WHE0 1MAKA 4MYWB 1DUYA 3U9PH 3QJFA 4KI5F 2WW8A 1S7WB 2E8ZA 1WZKA 3VWJA 5ECJE 4I18C 3WHXA 3O0RH 3T8XB 3RZCC 4F7EA 2W9DL 5FO7B 4U7KA 3RZCD 4UILH 5JO5B 2JK5A 2BCKA 3HAEH 2I26N 2FECL 3EOTH 4Y2OA 2X6MA 3N06B 5BV7L 2EDXA 3FB7B 4OFKA 4WI7A 3ALWA 1IM9B 3SO5A 4R2GB 3L95A 4P4KA 4E41A 4ODUB 4MAUL 1KPVB 3BFOA 3U7WL 1ZA3B 5D5ME 2XWBB 4Z7UE 1FN4B 1CFTB 4PJXA 2IC2A 3CFEA 3FQNA 5F6HJ 3VD9A 1P2CA 1JMXA 1RUKL 5JIHA 4U1LA 3MLRL 3OR6B 4KKAD 5C0BD 3TP4A 4IRJD 3PIQB 4GH7B 4C56D 5I9QB 3CX5J 2YZ1A 3VXOB 3RQ3A 3C8DA 4NQEE 1GXEA 4DUVA 2IQ9L 1JUFB 2UVFA 4QCIA 2DWDA 3HE7B 2VXQL 3GM0A 4HIJB 4JFYA 2D7NA 3IDYC 3A6CL 3ZDYF 2OR8A 2AXGB 2XG4A 3D69A 2NY5L 3HMXL 3P9MA 3LSOB 2JKXA 1L6XA 4KI1A 2NW2B 3QIWA 4XXCC 5JQ6H 1A9BA 4H8WC 1G9MH 1F4AA 4TYUA 5J06A 3FRPA 4L1DA 3O2WH 2DL2A 5E1HB 3RNQA 4FQHA 5F7KC 1GSMA 4FQJH 1WWBX 4F15C 1FH5H 1HHGA 3ORJA 4HIHA 3PGCB 5EBMA 1OGTA 2OQJB 3MLZH 4M6OH 5D7JB 2X1QA 5F9JB 5FHBH 1HHHB 5D6DA 4QXGL 2Q1EA 3GSVA 3MUGA 1ZHKA 3PGDB 4P5TA 4BQBA 1YEIH 2A2QT 3NCYP 3AB0B 1KB9K 5IG7A 4LKXB 4X98A 1OAUL 3TT1H 1CFQB 4NC2B 4AIZA 2OP4H 5D5MB 5T1MA 5JIPA 1XIWA 4M1DL 3W81A 5IHLB 4Z7UB 2EH8H 3TF7C 1XGQA 4PS4L 5GSRA 1J0IA 3SKJH 1G7LA 3RI5F 4MXQC 1ZHNA 1MHEA 3U2SB 2A9NL 2F53D 3O6ML 5DT1L 4JDZA 5DMYA 4B50A 3FB8B 1H3WM 3SDXF 5IK3A 5D1QA 5J12C 5I8OH 4Y0GA 4NQEB 4LSTH 5GGVY 3MYZA 2AQ3A 1YY9D 1WK0A 3T65B 1NDGA 2UVEA 4MB4A 4Z6AT 4G6JL 3OKMB 1SJEB 5E8NB 3QHFL 3CK0L 5C6TH 2V7HA 1JHKH 3CUPB 5FECA 5E5RB 1X6LA 4FXLA 2D03H 1YEGL 3GSXB 3LQAC 2NY2C 5SWZA 3S4SA 5E8OA 5EC2B 3WKNA 3VXRA 4PBVC 2NY2D 4U1MA 2NPLX 1HI6A 3C6SB 2J88H 2HFFB 1Q0YL 4X4ME 3UCRA 4OM1L 1TETL 3T0EE 2IANA 5B22A 3AREC 2YUXA 5BV7B 3VJ6B 4U3CA 4ONHB 4G42A 2O5XH 4PLJC 4RGMC 4PRNB 2HT3D 5E6IA 4NBYB 3W0WD 1MQKL 4PJXF 5GSVB 3L1OH 3GJEA 3D0VB 5IP4A 4HULB 1JHLH 4CMMA 5TH2B 3ZKQD 3NGBC 5EZOL 2W60A 12E8H 5BO1L 1FVEA 4P23A 4LASH 1EUTA 5IB2A 4UTBH 5FYJE 4XC1L 1DN0B 2GW5A 4MWFB 4YDKH 2XA3A 2EC9T 1CBVH 1HINH 5K9JL 4BZ1H 4Z7QE 3FN9A 2HJFB 1T1XB 1K8IB 2Z91B 3V4VL 4UINH 1A2YB 1N8ZB 2FD6L 2CLRA 4G8FA 3W9DA 4IOFD 1A6VH 5HI5C 2AJYL 1QFUH 4QRQA 4QHKI 4NUJA 3ZKXB 2BVQB 2MTPA 3TA3A 4EVNA 1U8LA 3DRQB 3T08A 1EAPB 3QEQD 3QO1A 6FABL 1NH6A 1MCKA 1RZKL 4M8QA 3X13A 5KVDH 4GS7C 1J8HE 2CK0H 1UXSA 5DK0B 4PGCA 4R4FL 4DKEL 2YEZB 1J12A 2NQCA 2YUVA 2DKSA 3MRPA 1JRHI 4Z7WA 2MHAB 5ACZB 3S3PA 4LLUA 4R7DA 5IMLA 5TDPA 3T0EB 4P46A 1R3KB 2HWZL 1NPUA 1R3IH 3L3DA 3TNMA 3K0WA 5GS1C 3S5LB 1EJOL 3HC3L 4P5MB 1ETZA 4K7FB 4F9PA 4PRIA 3N1PC 3TBVA 1ZT7B 3RVXC 1FZMB 3CC5B 3MOBL 3REWB 2GY7B 1DQML 4ETQA 1P1ZA 2XQYG 3TCXA 3QEHA 3SE9L 2ZUQC 4YXLL 3RDTD 2ICEB 5KSVB 2AXFB 4F37K 4XNYL 5DI8B 1BD2E 4GRWH 4JY5H 4RAVA 1J1XH 1ZT4A 4PG9A 3L7EB 2EH7L 1MFEH 4H20H 1LO3H 4G43B 3VFNB 1SY6H 5FUCE 1Q9OB 1F3RB 1B9ZA 1QZ1A 5TE7H 3UDWA 1D6VL 5BS0D 4ELKB 4Z7VE 5BW7C 4JB9L 5E8EA 4M93C 5C7XH 2VN7A 4OFPA 4Q6YA 1QTYT 4NN5C 2R2HB 5A1AA 1VFMA 2OZ4L 1CLYH 2NY6B 4OLVL 4U1KB 5GRUL 3L7FA 2V2TA 2DLHA 4ODVL 4KHTH 3GMOB 1J8HB 4WHTB 4TVPL 4J2XA 4JRXE 2RHEA 3KLHD 3C09B 2XQBH 3RGHA 5C0AE 1CDHA 3UBXI 5CEZE 1L4IA 1DP0A 2AVGA 1JCKA 5ANMA 4LCUB 4J4PA 2JELL 3BN3B 1RZ7H 2QSCL 4N90D 3T0AA 5F7YC 4PJFE 5DRWB 1IC7H 4EN3C 3O45B 1X7QB 5I73B 3BKJH 4LLYA 4NZDA 2NTFB 1S7TA 4EN3D 4PBWD 3MQIA 4FXKB 4WFHD 3D87B 2GKIA 4UV4L 1OTUC 1RI8A 3MROB 4YHLL 3LEYH 4GLRI 3B3IB 2AXJA 1QHPA 3DX7A 4FG6D 3B9AA 2R69H 1BD2B 3AMLA 1RJYA 4CVUA 2FIKA 1FL3B 2QHRL 2AV1A 1WC7B 5I15H 1R0AL 3ILPB 2VDPL 3NACL 4OF8A 3T3PE 5DK2A 4AQOA 2BSED 1MCIA 5F3BA 1MRFH 5JW4M 1Q8MA 1F4WL 3P9WB 4NWTH 1BGXH 3PDGA 4YE4H 1CD0A 4F7MB 5FCUL 1GHFH 1NL0H 1K3IA 2B4CH 2AEWA 1Q94A 2IPUG 1FZOA 4Z7VB 5DXWA 3QQ9D 1MNUL 3I84A 2H9GA 5GPRA 4AYFA 5I1LA 1IEHA 1MCRA 4JLRA 5SX5K 1H5BC 1PD6A 4QT5B 1OARH 5FO9B 3JVGA 4Z7WF 2XZQH 2XOTA 3DHJA 1G9NC 4HCRL 2DYPA 2ADGB 1Y6NR 4JO2H 1RK0A 2IAMC 4B41A 4KRPB 1BHGA 4GQ9H 2WP3O 5A43C 4JRXB 1FFOA 3L3KA 5C0AB 4LCIH 3FFCE 4XPHL 4FZ8H 1IAII 1N3NB 4LLWA 2E7BA 1O7SA 4KKBC 3OXRB 3JWDC 4PJFB 1GGYA 2CGRL 3ARFA 4KKBD 2WZPD 3VG9C 3IJYA 4K3JH 4K23L 3LKRA 2KUTA 1EAJA 4L4VA 5FYLH 2D0FA 5D7KD 5F3HB 4FMFA 4PB0H 1OTTD 5HYQA 4Z7OE 4Y5XC 1U58B 2Q7YB 3QBTB 4HWZB 4R8WL 3JSSA 4PGJA 4NT6A 4C57C 4OD3H 1Q1JL 4BSVA 3G5VB 4YHYC 2AJUL 4TULL 1V8HA 3WFHA 4R7NA 3S88L 4C59B 5E00A 2YK1H 5ITBH 1HH6A 3EFDL 4NZTL 1TVHA 2OM5A 4JKKA 2PTVA 1FJ1B 4YDLC 2Y07L 3QUZD 4P0DA 3EFFB 4J3UA 3ARXA 1PYWA 4Y16A 3P11H 3ULVC 1OD7A 4LBEA 1WFNA 4OCXH 2ORBH 5F1SA 3TESA 4F3FA 3PE9A 2AJSL 2YPLA 1PDKA 1FC1A 2XN9A 1CVSC 1PY9A 2EE9A 2YPVL 2ED8A 1IGCL 3IDXH 3RKDD 1T20B 1F4XH 5A2FA 2VMFA 1RFDL 4IRZH 5L7XL 1INDL 4HS6B 3I9GH 4JRYE 4MQTB 3GSOB 2Z92A 3BD5A 3VGEA 2CK2A 2HRLA 1EV2E 3FFCB 4HCRA 4KUCF 1C1EL 4PRDA 3ULUE 3FCTB 2H3NA 1OPGL 4NZJA 4PJFF 3K4DA 5IB5B 1NLBH 4LLAA 3HC4L 3MREA 2VH5H 1DBMH 3VXQB 4JQXA 1QRNE 2CIIB 4PFEA 1YPZA 1MCJA 1U3HA 4L4TD 3FB5A 4UIKL 1HSAB 1YUHB 5BVPL 3SGEH 4XWGL 1Y0LA 3AAZA 4DK3A 1UKTA 4ZNEA 1ZLUK 1P7QA 1PEZA 1J9CT 1U8IA 2IG2L 3WEXA 1A9EA 4OUOA 4WGWB 4F7PA 4NQCE 5DJ8A 1HDMA 3TNNB 4JREC 4KKCC 5LQBH 3CVHB 4N0CC 4KKCD 3RI5K 4KGLA 1G0XA 1NBQA 4YHZH 4NKMA 5HDQL 2D31A 5I19H 3G6DL 4GG6A 4P2RE 4AL8L 4Y4HB 4LCCC 3GMNA 5ETUB 1J7VR 3DGCR 5IT2L 2ZUWA 1HE7A 4HUMB 3MMEA 5DEFA 5TF0A 4JRYB 1XGTA 1DVFC 1KJ2L 1OGAA 4D9QD 4LDLB 2ICES 4EI6B 1CGTA 3BE1L 4U1IA 1OHQA 4JE4B 4XPGH 3B4NA 3C60B 2FGWH 3QH3B 1REIA 3VD3A 3NTCH 3UTPD 4JFDD 4JRWA 1AQDB 1PKQE 4HHAA 4XPFH 2EDDA 5HHPA 4ELME 3VXUA 1QRNB 3MNWA 1U91A 1BQSA 1EHLL 5CZXC 3HNVH 3KPLB 1LD9B 4G5ZL 1TCMA 4K71B 1OD9A 4L1HA 2E6PA 4IRSA 3THMH 4YHML 1NUNB 1VA9A 5HHOA 1RU9H 4L9LA 3H9SD 5F8QC 4OLZH 4XBGB 1IAKA 2AI0H 4L8BB 4QHUB 3ZE1F 3T77B 1WAAA 3D3VD 4NQCB 3B43A 5LCVH 4OLWH 4Y19E 3IU4H 2O5ZH 5DHYB 2R9HC 1ADQH 2P24A 2YSSA 4H88H 1QUNA 1XCTA 1XGUB 2R9HD 2FO4A 2W9EH 2ZOLB 3ZHKA 1QSEE 5EO1B 1JYVA 1BREA 4BQ6A 2CUIA 5BQ7B 4NC1E 5A16B 4Z95L 4LSQL 1HCFX 4P2RB 2UZIL 5C0RL 5DQJA 1S8DA 3LKNA 2E3VA 3GK8L 2BC4B 4NFBA 3WFEL 3MXWL 4QRSB 3QUYC 1D9KD 4GAGH 5CEYB 1NBZA 1I7UA 1VADB 3NIDE 4P9HH 4TTDD 1U36A 3ULSA 4POYA 1IGML 3B5HA 4AENA 4I77L 2RIKA 3MJ7B 2C4FU 1UT9A 1FFPB 1WIOA 1YPZF 5HHVL 1EUUA 3BZ4A 2FZ3A 3KPRD 3OPZL 3QIUB 3CXDH 1PKQB 4QHLB 5IQ7L 2FCBA 4ELMB 2COQA 4NYLA 2VKWA 5CJOL 3PHSA 1MCOH 1NGZB 1VACA 1S7RA 1RZIB 1BOGA 3RU8L 1X4YA 3W11D 3QZWG 5IFAH 4HF5L 4YO0A 2BNRE 1M05A 2FSEA 3DMMA 3RWEA 2ZSVA 1BP3B 4DCQB 1NGQH 3D9AL 1R3JA 2J4WH 5FGBC 1IAMA 4MD0A 1W2KT 3M17B 3WN5A 2Z8SA 2AK1H 4XP6L 3V0VB 1QLRA 3QIBC 2DTMH 4MXVF 3RY6C 2PNDA 4FFZH 3BP4A 5EFIB 4H1LB 5AD0A 1NAMB 4GG6F 1U8KB 2A77L 1JPTL 4LSSH 4Y19B 5GRVL 2R0KH 1EJ6A 4LNRA 3BQUB 3EOAB 1UB6A 1QSEB 3N1GC 3DO7B 5DQDH 2YD4A 4JZJB 4ZUUB 1CXEA 3BP6A 4YHNA 1YA5A 4Z5RB 3ZYIA 3IDIB 4NQDE 3WS3A 1XH3A 5EWIL 4I3RL 4HGKC 1BFOB 4YK4B 3BVNA 1ES0A 3DETD 5DMGC 1KJ2B 1RJLA 5D1ZC 3Q3GB 5C0CE 3WDJA 3F7QA 5F7EH 2AJXL 2L0DA 1MRCH 1UVQB 3C5JB 2BVEA 1VFBB 1T7WA 5E08H 2K1MA 1FL5B 2R4RL 5HYEA 5DRNA 1CD8A 4U0QB 4XPAH 4PJEF 1E4XL 4R97C 1I1YA 1I7RA 5F7FA 1XF3B 4ZS6C 3OAZH 3CVHH 4DN3H 1K5NB 2NY7L 3PP3H 4KDVA 1WAAF 4PJAE 4ZD3H 5DA4A 2BNRB 2C7UA 4YHOL 2DM3A 4LSUL 1Z2KA 3U4EB 4D9RD 2VDLL 4YEFA 2QADB 1YYLH 3BZEA 4X4XB 3VXSE 4JHZA 4XPBL 5HJ3A 1LNUB 3CFBA 2NR6C 1QNZH 4OBRA 3BEVA 2RBLA 5K9OA 3GHEL 5CSZB 4WI3A 4RIRB 5C92A 7FABL 4PJCA 2NX5D 1NANI 1P9MA 5GISH 5IWLC 1OAKH 5MI0B 5C08E 2AV7B 3ULUH 4YDVA 4PGDA 3FQWB 4NQDB 1QACA 5F9DC 2BXYA 2CDGA 2P5WE 4KJYA 1M71B 2IMMA 5C0IA 3NMEA 3TO4B 4ZDHA 4OIIH 5C0CB 1P4BH 1X5KA 4X8JA 4UUJB 5F89A 3UPCA 3BP7A 4HBCH 3MGOA 4P2OC 4LEOB 4MQ7A 1NQBA 4LRNL 4P2OD 3OKEA 2OMNA 2WBJB 2DRUA 3LCYA 4MA1C 3OBAA 3RTQA 2HT2D 3O8XC 2B7DT 4NQSA 4PJAB 1IM3B 4AEHL 1TENA 1D5BB 5CSGA 5INCB 5HDBE 3P0GB 3LH2H 1WWCA 5SV3A 1KYOJ 4L4JA 1IEAB 1SYSA 5E9DD 3IKCB 3S35H 3Q5OA 3VXSB 1T3FA 1MJJB 4P3CL 4JZNB 2NY1C 5TDOA 2GIYA 1T5XB 3QQ3B 3K74B 4KRMB 4L8DA 2DQUH 4YDJA 4U6YB 3FT4B 4HH9B 3KYMA 3QNXB 3GSUB 4JY4B 2FH8A 1KIQB 2JB6A 3MRMA 3K1DA 5MENE 3LRSB 3WV0A 1AJ7H 4CMHC 5C08B 4BQ8A 3HRPA 2H1PH 5GHWH 3RX5A 3WD5L 3EHBC 2AK4A 2C4XA 5HHXL 2FX7L 5E6ZA 5F8RC 4ZXBB 2MFNA 1Y18A 2P1YA 2Z8RA 1ULVA 4JJ5B 4LPVA 4U1NA 3VFVA 2NY4B 2P5WB 2OR7A 3QUXB 4UQ3B 4Y2DB 5DD5H 3LKQB 1ZGLA 4WCYH 1JPGB 3M1BB 3S96B 3VXTA 5TE6L 2BDNL 4WFFD 3D2UD 4IHOB 4YGAB 1YEJL 4XCCL 1A6ZA 3RL1A 1U8PB 4PBXA 2A6JB 3RWIB 1IEBB 5TDNA 4BM7A 3PABB 1NAMH 3BWAA 3F12B 4F7CA 3W5MA 1AR1D 3WBDA 4PJAF 1UB5B 2OJZH 3LMJL 4Z77B 3PJSB 4ZFZB 5CWSB 1T03L 4JQVC 1BJ8A 4L8SC 5CJ5A 3MRGB 4PG2A 4PJCF 3OJVC 3UC0L 1NMBL 1BPVA 1Z9OA 1PQZA 5EU6E 4BZYA 1G6RA 5DJ0B 5EOTA 4LU5H 3MLWL 5C0DA 3DI3B 3TCLB 4FFYH 1QQDB 2HLFC 1HH9A 5LBSL 3L3IB 4Y1AA 3BRDA 1GGUA 1U41A 2YWYA 4X5WA 2HLFD 5M95B 5FYKE 3GI9H 5E95B 4ONFL 5MENB 3MBEA 4QTIH 4M6NH 4P3WA 1OSPH 5EBLA 1LK3L 3L5WA 5FK9A 3DRTA 3MLTA 2DDQL 5JHDA 3UTOA 4LVOC 5D2NC 3SDDB 2V9QA 2ESVE 3EW3B 4YHIB 4ZFFB 2G2RA 4LEXH 1PLGL 3L3GB 3CX5K 1S9VB 5DEGB 3CZFA 5CLTA 5A2JH 9CGTA 3MNZB 4YQXL 1CF8L 1QRKA 1BJMA 4WWID 5DFVD 1MY5A 2C3GA 3KYNA 4DUWA 1IL1B 2KQNA 5JZ7D 1FGNH 5ILTH 5EPMB 2DQHH 4TSBH 5I6XC 4F57L 3GKZA 2A74B 3L3OB 1W0YT 4UAOB 3VGAC 5IEHB 3VRLE 3E0GA 1H3PH 3TH4T 2PXYA 4OF7A 3B9KB 5GZOC 1LE5A 2VLLA 5FKAB 4MJ2A 4P49A 5E8PA 3MV9A 2I9LB 2PYEE 4XAKE 4CBPA 3TZVB 2VE6B 3JXAA 2OI9C 4LLMA 1OQOA 2EICA 1R5WB 3GKWL 5EU6B 4JFED 4XP9H 4CGTA 2ZG2A 3W9EB 1N6QH 3LKPA 4UOW1 1DQLL 2VDMH 1GZPA 4PJ8C 4ALAL 3P9LB 5SWSD 3T0BA 5HPMA 1CFBA 3O9WA 4HMEA 2BY2A 3QDJA 2OK0H 2FJHA 3UROR 5CD5C 5E2UL 2UUDK 3KPPB 5KW9L 3FB6A 4YHPB 4LP5A 2V5RA 5BZDB 4NKDA 4FFVC 3REVA 3KLAA 1YEHL 3BKML 4ZUWA 4JVPA 4YXKL 2FECI 3INUH 5C2BH 1IGYA 5D9SA 3V5DA 3PL6A 3ZDZE 4WW2A 1DSFH 2X4OA 3UX9B 5KS9E 2ZPKL 3BEWB 3EGSB 2WNGA 1FL6A 5JW3L 4LIQH 4HUVA 1P69B 5DJXA 5FKPB 1A7NH 4RGOH 3TBSB 3BH8A 3CD4A 3ZE0E 4WNQB 4EUPG 2ZUTA 5J3HC 2BK8A 2YOCA 3VFMB 4GXUN 3OL2A 4HWBL 3L6FA 3U4BH 3H9ZA 1AGDB 1AI1L 3L3HB 5J4MA 3TFKD 4TUOB 3IDMB 1S7QB 1SMAA 3HPLB 3NIFE 4YBLB 3DSFL 1ED3B 2VISA 1F97A 1T66D 3M8OL 1T1YA 1EFXB 1JGDA 2Z0BA 4X8XA 1R5IB 5CD3A 3O4LD 2PYEB 1FCCA 1OAZH 1CICD 2OSLA 1JGLH 3RKPA 1D5IL 3VA2C 3KGRA 4NM8H 3TLRA 3MV7D 4ODWB 2VLME 4W4OA 2DM2A 1V3KA 3VXNA 2VABB 3LD8B 4QXTB 4WUUA 1ACZA 3P77A 4EQ2A 3OAUH 3FT2A 4X6FA 4G80A 3FONA 3F7YA 1ZSDB 2OXGA 3BH9B 4J8RA 1SEQH 5C0JB 3WIFB 1SM3H 2UY7A 1CE1L 5JHLH 1RZ8B 4JANB 1JNLL 1BZQK 4XTRC 2I9TA 1U8OB 1BECA 1B4JH 4ZOCA 5D1XD 1RIHL 1QSFD 2DQFA 1OTSD 4JY6B 1HWGB 4P4RA 5HGAA 3S98A 5KS9B 1N59B 5T1DL 4JVWA 4OCWL 1V7ML 3IFNH 4WTZG 1MUJB 5L2KE 4KKLC 1L7IL 4M1GL 2AS5M 1BZ9A 4YGVA 4F58L 2OR9L 1K9TA 3NAAL 3O41A 3A6BL 4U3HA 2YD8A 5FXCH 3RIAF 1K6QL 2CO7B 4XPTH 1B2WH 1NGPH 5C70A 1AFVL 3SKOB 3WNMA 1IGIL 3BGMA 4ZFGL 5E2VL 3QG7H 4O5LL 3RWGA 3BHBB 4G6AC 3T1WA 4HWBA 4M9PA 3ARDC 1CD9B 2AJVH 3GMMA 4XI5D 1Q38A 4L8CA 2VZVA 4TOYH 3SCMD 5IBTL 3OWEA 3E6FA 1GGIH 2D7TL 4DK6A 1IRAY 1SVCP 3W82A 4O2CB 1MOEA 2HN7B 5F88B 1OAQL 3FQUA 2F5AL 5IKCB 4HDIA 4N0FB 1MI5E 3C5ZB 2QSQA 4EI5C 1QFWH 4PY8J 3QWRA 5MERA 4JKPH 1KACB 5MHSD 1F3DH 3SDAA 4WW2F 1GC1C 4LMQE 4DGIL 1DANU 4NHCH 4WEBH 4ODXB 2C3VB 5KJRH 4OLUH 4U6VH 5E94A 5FFLA 5B4MD 4G3YL 3ZE2E 4LLQB 3UYPA 4LKCA 4DQOH 3O3EB 3EJJX 1ZANH 3GMLB 3RHWF 2R1YA 2FEDD 1PG7W 2F9BT 1WCBB 2M26A 5IB3B 2FNBA 1H0DA 5I1HL 1FRGL 5IROC 1OB1A 3LKSB 5HY9B 1XF2A 4ONGH 3I50L 1K2DA 1KB5L 3H9HB 2BZDA 3MCLL 4OQ1A 5L2KB 1I85C 2XYCA 1AHWB 1C8PA 3B9VA 3PWUA 2DQJL 4AIXA 3O2DL 5AZ2L 2QQLL 2HTLC 4CN6A 3CU1A 2MCPH 3NIFF 4GAJL 4S1RH 5DMIL 2VLRD 1ZWIA 5FYKH 4HLZH 1K8DA 5IHZA 4NO5A 4M6ML 1AGEA 1T4KA 3P0VL 3ARBB 1CZ8H 4UDTA 4WO4C 4H8WL 5D7LA 1QFOA 3L5XL 3RJQB 2EYSA 2FB4L 1LE9B 5GGVH 4X0KA 3NFPB 3HPJA 4ESKA 2VITB 3S36L 5E8DL 3MUHL 4G6MH 1P6FA 3FN0H 4K7PL 1OSZA 1HILB 2DBLL 1I8MB 3TH2T 3KPTA 3UEZA 3VGBA 3DROA 4OZFG 1QO3A 1MI5B 1W0VA 5DJ6B 3VRIB 3G5XB 4JO3L 4WFGE 3WXWL 4I18A 2HLAB 3PNWB 3RZCA 3KPQA 2OXHA 4QRPE 3UZVB 4H25B 4JFXA 5IJVB 4OZIA 2IQAA 4G8GD 1JN6B 1HQ4B 1A64A 4XXDB 3GB7B 4HEPG 4XCFL 1KXQE 1NGYB 1V3JA 4J6RH 2BSRB 3RAJL 2EXWD 2Z31C 2GHWB 4RZCB 4GSDH 2A1WH 1KCKA 1LHZA 1KNOA 4XCNB 3P30H 2WWKO 4JM2B 1WZMA 1WBZB 4PRPE 4RRPG 4XP4H 2APVA 1MCQA 3BPNC 1IT9H 3QEUB 1T7XA 5BOPA 5LAXB 2I24N 2VLJE 4GW1B 4TUKL 4KZDL 1R6VA 4NKQB 5C0BA 2H6PA 4IRJA 4C56A 2X89A 1FV1A 1RAMA 1G9MC 1RK1B 1R5VB 4DAGH 1NMCB 2ZJSL 2Q20A 4YWGL 2CLZB 1AXTL 3VI4E 1LO0L 1OY3B 3O2DA 5T3XE 2Q3AA 4L3EA 2YXMA 3IFPA 1DBBL 1QLFA 4DVBB 1U2HA 4KZEL 4HFUL 1HOCA 2E27H 3LQAL 5F6IC 1F6LL 1AH1A 5IF0B 4XXCA 1ZLUH 1ZA6A 1I4FA 4ZUSB 5ESAB 35C8H 4MDJA 5E6IB 3HUJE 1CFSB 4O51A 5AZEH 3QZWA 1A14L 2H32B 1Q9KA 4PJ5D 5HDOA 4APQC 1F90L 1CFNA 3K4ZA 3G5ZA 4Y4KC 4QRPB 3K46A 2ICCA 1A1MA 4QHNB 4UMGA 4Y4KD 3OGCB 5IEKB 4ZUVB 3V6OC 1F6AA 5DR5H 5KSAC 1JZ4A 4XMLL 3GSNL 3RWJA 1LO2H 3BKCL 1X5IA 5AYUL 3E8UL 4KDWA 1KGCD 4LP4A 4ERSL 4KI5D 3CGTA 3ZDXF 4PRPB 1KB5B 3DV6A 5F93C 4S0TD 3SE8H 4D8PB 2X4SA 3RVWD 3KHQA 3MRFB 2VLJB 2H8PB 4QRUA 4ZYKB 3UTTD 3TYGH 2F53A 1FNEB 4KY1L 4BFGA 2VC2H 1KBGH 4IIQB 5JPMA 2BSSB 3IDYB 3NH7L 4IMKC 4CVXA 4HJGB 2LTQC 4DGYL 2LU4A 4P9MH 4R0LC 1MJ7L 5ICYA 3UJJH 3KPOB 1FZKB 4XBEH 5FDYA 2F58H 3HS0A 1PG7X 1AKJA 3GFUA 2MOVA 1WZ1H 3MRBA 5FA3B 3MRRB 1XR9A 4AY0A 3SQOH 5IJKC 3FAXA 4X6EA 4RFOL 1U42A 4UQ2B 4EJ1C 4QGYA 1YNLL 3A0OA 4KK9C 4F15B 4LHUD 3ARYA 1T04B 3C2AH 4KXZH 5FF6A 5H35A 5B8CC 4C4KT 4OZIF 2BMKB 3MV8D 4XVJH 3HUJB 3V79C 4HKBA 1E4KA 4F80A 1UKSA 3H3PH 1N0XH 4M61A 3K8MA 1E4WL 4P3DB 4TTGA 4PJHA 5FO8A 5IVXA 4D9LL 2NY0C 2HJLA 2GSGA 3ZKNC 3HR5A 2Q87A 5IBUG 4NCC2 3C6LC 4IDJH 4MXWL 3PXHA 5ID1A 4PJGE 1IKNA 1J1OL 2P8MB 2VWEE 3ABZA 3O6FD 4XWOC 5KVMC 2OYPA 1EH9A 1FGVH 1MWAL 1G7HB 3HZVB 2DQDH 4PGBA 5D6CB 5I1JH 4LVEA 4HXBH 3C2SA 4TQEL 1Z5LB 2PTUA 3GSNA 3ARTA 4M7JL 5HYJA 1EBAA 2NTSP 3VGFA 1VCAA 5J12B 3RVVC 5GJTH 3OJDA 2NLJA 1DJSA 4QO1A 1D5MB 3VWKB 2ITDB 2VDNH 4Z76A 5IHUL 3QA3A 4MZ2A 5GGSY 2W9DH 1VERA 3VI4F 3MLYL 1IM9D 4XZUA 4CJ0A 4ONOA 4R2GD 3BT2L 1N5YH 3L7FB 2V2TB 2DQGL 2BNQE 4PTTA 1A7PH 3C9NB 5DVKA 3T1FA 3BO8A 4FQCL 2J8HA 3LEXB 4N8VG 5F9WB 1NCWH 4NFDA 5I9QC 1TXKA 3QEQA 3U7WH 3GI8L 3SGJC 1LDPL 1T0MB 2XQYK 2R0LL 4ENED 5J1AA 4NRXA 3UBXG 3AREB 3QHTC 4RDQG 3RVTC 1RUKH 2R1WB 5T5NG 3RWHA 3HE7D 4TN9A 3RGVC 4RGMB 3RVTD 4FP8L 4LL9A 4DN4L 2BY3A 4JFZH 5L6YL 2IQ9H 3AROA 5IW6A 1UQSB 2JLLA 4X5XB 1FORL 1VEOA 4HKXA 3ARPA 3A6CH 3IDJB 4OJFL 1TMCB 4DTGL 3CLEL 2BERA 4PJGB 1XAUA 1HKLH 3MCG1 3RDTA 5H94B 4LARL 2CKBA 1RUPH 4XC3L 4HPYL 2QL1A 4OD2B 1J86A 5D7JD 1FG2B 2A73B 2FX9H 4BA8A 1MWAA 4P4KD 1SJVA 4E41D 4MAYC 1BBJB 1JMZA 1DLHA 3PWPE 4KV5F 4S11A 3GSQB 2OL3L 3I3BA 2H32H 3N9GL 3RIAK 1MJ8L 2BNQB 1UJ3C 5BS0A 1KC5L 2IMNA 2CMRH 4RMQA 5BW7A 3DHMA 1G9NL 5IQ9A 1MCPH 3VFGL 4D0BB 1J88A 5KVGL 1YEDA 4PJHF 1RIUL 5IVXF 3STZA 4GOSA 3LRHA 4M1DH 1KLUA 5FA4A 3VFOA 1S9YB 3NCBB 4QWWD 3B5TA 2ILLA 4ODSH 5GS1B 3O6MH 4GBXC 3JWDL 2A6DA 1OLZA 2YC1B 3NOIA 1JF5A 1WFUA 2DMBA 2P8PA 1BBDL 1UM6H 3MRCA 4XAWL 2D9CA 4JFHD 3X14B 3B9DA 3BIKA 2YA0A 2ZUQB 2R29L 1JWSA 4EN3A 4M43L 1WIUA 3IJSA 3O3DA 4G9DB 2Z8WC 4CNIB 5CMAB 1T22A 1DLFH 4G8EA 3B2UC 2IPUK 2B4CC 2X4NA 3KXFE 4Y16B 2Q86A 3Q2CA 3MNVA 1I9IH 3RHWK 5J56B 1UCBL 1YC7A 1R3LA 4F3FB 3TO2B 2BP3A 3RL2B 1ZMYA 5CBEB 5BRZE 1A6UH 2P48B 3GBNL 3ULVL 4F2MB 2EZ0C 3PWPB 3I6LE 4HIXL 3PV6A 5IFJB 3K3QA 4OM1H 1TETH 3E6HB 4BUGA 2XA8H 3DX9A 3PWJA 4NN5B 4X6BB 5GS0H 1IFHH 1MLBA 5I1AB 2Z35B 4QRTA 3QFJE 2X1WL 4G6KH 2E8YA 2ZUYA 3SBWC 5MEQB 2OL3A 2PO6C 3VI3F 4NKIH 4NRYA 3WFDH 3RNKB 4MZ3A 3R06A 3SY0B 5ESVA 1NCBL 2FIRT 3P4NB 3QI9C 1JZ6A 5EU7E 4U31A 1JFQL 2R2CA 2YMXH 4OQTL 1G9EA 4Q6IB 25C8L 4QLRA 5DD0H 3GNML 4YH6A 3DVNA 5K9JH 3QP3A 3ZKXC 3QUMA 5SV4A 3VXRD 1Z9LA 3V4VH 1I9JL 2QSVA 4NC0B 4BH8B 4OTXH 5T1KB 1L0XA 4LCYA 1UZ6E 4FQ2L 2IAND 3DTXA 3SKNA 3OKNB 3T0XA 4KQ3H 2PTTA 2EXYD 1VGKB 3KXFB 5EBWA 4MX7A 1NBVL 1TCRB 1TQCC 4FQIL 1RZKH 2AEQL 4EXPX 4HWUA 3BGFC 3T0ED 2DLEA 3IDGA 5BRZB 4MSWA 3QULA 3GMNB 4OI9A 4XP5L 4DZ8A 1PX3A 3SKMA 3MRNB 3SDCC 1FO0L 5ISZE 3NBNA 3K80A 2GSIA 3P4OA 1H5BB 4X6DA 3HC3H 3HE6C 4KJPD 3QFJB 1ZLSH 2W0FA 2ZUUA 3CPLB 2E7HA 1M7XA 1DQMH 3L9RA 5I71B 3BPCA 1QBML 4RQQA 1A21A 5FYJD 5IVOA 2FR4B 2MQ3A 3GZKA 4XNYH 3OB0K 1FAKT 3ESVF 1OVZA 4OGYL 3VW3L 1FYTE 3MRQB 4LRIC 4TUJA 1MJUL 4Q9QH 4N9GB 3TA3D 3FO9A 4X9HA 3VG9B 4LNVA 3HI1A 5IMKB 2PW2B 1BZ7A 5D7IA 1T21B 3U1SL 1Z0NA 1N0LA 2C3XA 3G9VA 4OQTA 5K33A 2C4FT 4N1EA 1KYOK 1I8KA 4PREB 5CINL 4I1NB 4Y5XB 3SJVE 2RJMA 4KAQL 5FOBA 2NY6C 1D5ZB 4L4TA 3IRPX 1J8HD 4JDVB 1T0NA 4P46D 3C09C 1X5YA 1Y6MR 3TBWB 5F7DA 5L8JB 4QYOB 4PRID 4KTDL 1KFAH 1RPQA 5GRUH 4ODVH 4AT6A 2BOBA 5CEXB 1SYVB 5IV2B 3J8F7 1FBIL 5DGQA 1F02I 2AAVA 2HG5A 2VXTL 4Y5YB 5I73C 4HZLB 1LEIB 1DQQA 2CRYA 2X7LA 4EUPB 3MX0A 1N64L 5CGYD 2K9UA 5ISZB 2QSCH 3D25B 1E28A 3M45A 2EYTA 1WT5C 4UI2A 1FO0A 2LU3A 1BD2D 1EXUB 4GKZA 2YN3A 2P8LB 1TZIA 1KIPA 4L3AA 4LCCA 3P40A 3FQRA 5DJCA 4BK5A 1KSRA 2CDEB 3IJHB 5IM7B 3DGGB 3SKUD 3VFRB 4Z8FL 5FUCC 5IIEB 3BAEH 2GTZA 1FYTB 2QHRH 2CR3A 1OAXH 4NN7C 4AMKH 2VDPH 4HC1H 3R0MA 5L2JB 4V2BA 3V8CA 3VFPA 1AD9B 4ZS7H 1ZHLB 4M48L 5KTEH 3U82B 1BQHB 5E1AA 3HAEG 4M5YL 3WN5B 1EEZA 4M7KH 3TV3H 3FOLB 3ROLB 3MV01 3SJVB 3HNSL 5IR1B 1XR8A 2YA1A 3S9DB 3BP5A 1KTDA 4H5SA 2DD8L 5IW1A 2YD9A 1FNFA 1MHPL 5JIIA 1CG9A 4KRPD 1FIEA 3U83A 3L3JA 4N0RA 4G7YL 3O3AA 5SWQA 1YECL 4JREB 1F4YL 4UU9B 2UYLB 4UDUA 1PGRB 5CEZD 1LQSR 3NCFB 1JBJA 4KUCD 3B2VL 4CW1B 3ULVF 4X6DF 4LDEB 4MJIE 5IMOA 4MHHG 4A2MA 1YJDC 3DV4A 2WWMC 5JW4Q 2EDEA 4XPHH 1QR4A 4GW5A 1ZVHA 4P9HC 4XMPL 3EYUL 1MCLA 4G7VL 1T1ZB 5BVJA 3PDOA 5A2LH 1Q0XH 1A1NB 1ORQA 3QEGH 3WKML 1NMAH 2QBWA 2EIZA 1I9RL 3BD4A 4HQQH 4XBPA 1M4KA 1DVFB 3AXLA 1NCDL 2FHCA 4LLDB 3X3GH 3PWNB 5D7IF 3VMNA 3H6JA 2J6EH 3G04B 2HH0H 1D9KA 4LGSB 1MHCA 4P2QE 1I7RB 3QUYA 1S9WB 4TNVF 1MRDL 1LEKA 4E5XA 5JDSB 4Y5VC 3D48R 3PQYA 4F9LC 3KPRA 3QPQC 4NZTH 3MODH 3LQMA 4U1JA 3QPQD 4RA3A 2NNAA 3NPSC 1S7SB 5DRXA 2HYMA 3BKYH 2MPAL 5EUKA 5JUEL 3EYFA 2VL5A 3AS1A 1A7RL 2AJSH 3H9YA 1RZFH 4OZFA 4ZTOH 3W2DH 1IAOB 3BIAX 4TVPD 4NQVA 1G1CA 1U8MA 2A6IB 2YPVH 3ARFD 1YN7A 4BSJA 1S78C 5I8EB 3D0LA 1MLCB 1INDH 2EDLA 3FFCD 3QQ4A 2HKHL 5FGBA 1INEH 4RAUA 1FFQA 1FVDA 3Q6GL 4KQ4L 1NFDA 4V1DE 5EOQH 1T5WA 5IB4B 4MJIB 3QIBA 4WHYH 3U0PB 1J11A 3GIVA 5L9DL 3IFOB 4G9FD 1JPSL 1OPGH 4RISH 2W9LA 1Z0MA 1KG0A 1BLNA 2JJVA 4YZFF 1YMMA 4X8JB 4XB8A 2AKRB 1KUMA 2XRAH 4UIKH 1AE6H 2HFEA 4JFQB 4V2CB 1YY8A 2BVOB 4NCC1 2EIDA 1UWEH 4P2QB 2V17L 2WUCH 5D1ZA 1RIVL 3UYRL 5LWYL 1Z6JT 4S1SH 3D6GA 5TQ2L 1S9XA 2SEBB 1ORSA 1KCVL 4JN1H 3VH8B 4OI8A 1JI1A 4OKVA 2VDRL 2V5SA 3U0TA 1MCEA 5IESL 1SYSB 2A38A 2I60L 2XWJA 4WU7B 3QO0B 4Y4HC 1CU4H 4UV7L 1AIFA 2BY1A 4Y4HD 3JV5A 4Y89A 3DYOA 3P73B 5HGDB 4NO2A 3IETA 3RX8A 2Z4QB 4PJBA 4JRYD 3G6DH 5BXFA 1UJTA 1UACL 5C09E 2XFXB 1QFWM 4I5BB 1I75A 4JPKL 3C60C 4RWYH 1HXYB 5KVEH 3ULUC 1XF5A 3FZUC 1DQJB 4JHWL 2DL9A 4GRMA 4V1DB 1ZGLP 1SBSH 1I1RA 1YEFH 4OGXH 3BE1H 1QBBA 2R4SL 3VFVB 2H26A 2NX5A 1N7MH 4K2UH 3JZ7A 2EKSB 2F19L 4K71C 5I1EH 1XZ0B 2C3HA 3MJ8A 4O2EB 3ZTJH 4KMTL 2ITCA 5CHNB 5HHQB 2IBZY 2ADIB 2Y5EA 4JG0H 3QJHB 4XCYA 3JTSA 3GBMH 2VDOL 3V4PL 1EHLH 4IOSD 4G5ZH 3WJJC 3T2NL 5M7QA 4NQCD 3NCCB 4E42B 3DOSA 3BWAB 5I75B 1NBYB 4KXZI 1CFVH 3ES6B 2GTWB 4NDMB 4XGZB 1JPFB 4ZOBA 3BDXA 3EJZD 4QNPF 2FBJL 4NFCA 4HUWB 4I2XA 3WUWA 4W6YB 4J12A 1AP2B 2HT4D 2F5BL 1OGAD 1ZLVK 4P2OA 3ARRA 1CT8A 2Q6WB 4OT1L 5I8CA 2FJFA 2VQ1A 5EBGA 4KDTA 5IOPB 2R2BB 4GUPB 1KCRL 4OLYL 1CLOH 1NFDF 4ZG1A 1WWWX 5EG6C 1HQRA 5JW4R 1MY7A 5KG9B 5C09B 2VLKE 4YFDB 2UZIH 5JXAL 3Q5YA 1FFNA 2IEPA 1I1AC 4UIMB 4UT6L 3TWCL 2QR0A 1CGUA 5E9DA 1UENA 5KSBA 1A4JB 5D96B 5AEAA 2GCYB 1MFCH 1C5DA 3QIUC 1W72L 3GK8H 4IMLB 5HI4C 5JW5B 4YR6A 4D2NA 3LS5H 3MACH 1IGMH 3BN9C 4IJ3B 5DC4B 3L5WB 2WQRA 4WWKB 4G8IA 4LCWA 4LGRB 4BH7B 5HHOD 5DQ9B 2C1OB 4MQXC 5DS8A 1D3CA 1KEMH 3NZ8A 2XWTA 4X6CE 4NSKA 5E99H 5HVHC 3OZ9L 5DDHA 2RGSA 2DLFH 15C8H 4ZQKA 4DKDC 3QWOB 5A3IC 5LGJA 3GGWB 4PRAA 3MBXL 5A2KH 5A3ID 4LMQI 1UM5L 2O61A 4B0MM 5I1GL 2EO1A 4NKOA 5DJAA 3L5IA 3D9AH 4Y19D 3HLAA 3BQUC 4K8RH 4A6YL 5EUOE 5EZJB 3H3BC 5JR1H 3NIGE 5DUBB 2GUOA 3D2UA 3FO1A 4NC1C 4R96A 1QSED 4PJBF 3C8KB 3CAFA 3HR6A 4CU8A 2A77H 3O8XB 5FV1L 5IBLC 3DX6A 2IALB 2B8OT 4JHAL 2FX8H 4YK4C 1A7BA 1EEYA 4XNMA 2NXZB 2GJJA 4PJIA 2NCMA 4X80H 3LKPB 2VLKB 3CSYB 4QOKE 3S37L 5C07E 2NXYC 1BEYL 5EO0A 4JQVA 2EDYA 4L8SA 4PR5A 3F7RA 4K3EH 3JTTB 5FUZL 2BY0A 5HYSG 1RJZA 1EMTH 1GYAA 4CMHB 3RA7L 2NMSA 5LGHH 1W72A 2GJZA 4Z78B 3B6SA 4EDXA 4YPGA 5JA8B 3ECBA 4U6XB 4X6CB 2EKJA 2FATL 1QFPA 1KELH 3GMPA 2BNRD 2H2PD 1AQKL 1RZJL 4NHUA 4ZPVB 2BXZA 3U46A 4QTHA 5C0GA 2JE8A 3MXVL 2QADD 5IVZA 4NRZA 2NY7H 5I16A 1EK3A 1Q72H 5I66B 1FYHB 4WU5A 5D2NA 3WLWD 3ARGC 4P57A 2BVPA 1QFHA 2VIRA 3ZSTA 4N8VB 4NNYA 1CE6A 2YBRB 3IVKB 1BQLH 2CR6A 1YEEL 3FQXA 1EDQA 4U7SA 1F00I 3Q0HA 5EUOB 1QYGL 2GYSA 4PJ9B 5IB1B 3EOYG 2E6JA 5CD3B 3BYYA 3D85B 2ADJA 5C9JA 7FABH 1HZHH 4N5UA 4A6YA 5GJSL 4XVSL 2F8VA 5FGRA 5KSBF 3BPLB 4MNGA 3LB6C 4BKLB 4WI4A 4XNXL 5DLML 3TN0C 5GRJL 1YDPB 2X9YA 3TO4D 4LQFH 4QOKB 5C0CD 5EU5B 5C07B 3X11B 3EO9L 2ZZUT 5BOZG 2HFGH 3MLSL 4JPWL 1NC2B 4KUZH 5CLWA 4ISVB 2EEAA 3D39E 2NZ9D 5GS2D 3V4UH 4HJJL 4EKXA 1JGVH 1J18A 4B5EA 4JFEA 5D8JL 3AGVA 2WBJC 1A47A 3HCVA 3O11B 4YX2L 1HEZA 2Y36H 2WBJD 4ZFOL 4Y8AA 2IFFL 2OTUA 5SWSA 1FFRA 3FT3A 4YFLI 2HMID 2DJSA 3QXUA 4YC2B 3HC0A 5ABDE 3VGGA 1BX2B 1G7PA 1ROWA 4LOUD 3H42H 3DBXB 1OW0C 5F9AC 3VXSD 4AM0A 3TBTA 3K4AA 4HMDA 1NCAH 4R3SA 1DANT 1G6RH 4X9IA 1U95A 4PJDA 4X7TA 4N5ED 2DWEA 1JWUB 3LN9A 2B0SL 1I7ZA 1U8HA 1LK2A 2GK0A 3IF1A 5JOPE 5I6XB 4P3CH 5T1LB 4Q0XH 4PJIF 1FLRL 4OLXL 2ERJC 2JB5L 5D71L 4OZHE 4OKDA 4XH2A 5C08D 3EIFA 5E2TH 5L88H 4TNVK 3ZTNH 2IH3B 3UTQA 5AUMB 4ZXBC 5HGHA 4M1CD 5ESQB 1JGEA 5FB8B 3E6FB 3ZMRA 4LPWA 4YJZL 1UH2A 1OAYL 3KYAA 3F7VA 2NY4D 1A6WH 5J6GA 2P5WD 2CRMA 1J05B 3QUXD 1AO7A 1UWGL 4NPYA 4Y2DD 8FABA 3V5KB 5EZIL 5FGCE 4PLNC 5TPWL 4OM0L 3O4LA 3QCUH 1CICA 3QXDA 3BGAA 1PZ5B 5JORA 3D39B 4PJ8B 1IC5L 1TZHA 4HLJA 3MV7A 4LLVA 3OKDA 4KJWD 5HVFB 1G7IA 5DYOB 3BW9A 5TE6H 1T0PB 1UC6A 1GC1L 2OTWB 4CDGC 2A83A 4Y4FB 1PSKL 2O5YH 2JCCE 2P44B 3HI5L 3GJFB 1HNGA 1UH3A 1BVLB 1NJ9A 4X4YA 4KTEL 3MR9A 5GGSB 4I3GA 4AQ1B 5MEOA 2VXUL 4Q2ZA 5F9OH 4MJ5A 1AD0B 4GMTH 3VDAA 1T03H 5D1XA 2YRLA 4BSWB 5JTWA 2CH8A 1QSFA 2K7QA 4LVHB 5DMJB 2DQIH 2YA2A 4HT1L 3C08L 2CLVB 3Q1SL 4MJ6B 5F1IA 4RFEB 1EZVY 2YRPA 3KJ6H 3OKLA 1MPAH 4KJQD 1EO8H 5EA0L 1KTKE 3EAKA 4OZHB 3U9PL 1HYRC 5LBSH 2V5YA 1A0QL 2EEDA 3SDDC 4IS6A 5T3ZE 5JXEC 3QSKB 3HRZB 2Y5TB 2F74A 3O0RL 4JQIH 3IB4A 5MEPA 1TPXC 4HKJB 4N9OB 2ZG3A 1LK3H 1MAML 1UZ8A 3DURB 3QXAB 4HUUA 1ZS8B 4K3DH 4UILL 4HS3A 5FGCB 2DDQH 4J3TA 2JJWA 3CFJA 1WCQA 4QRRA 3ARDA 5F6HI 1F13A 4ZMAT 4OD1H 1Q9LB 2GJ6E 1AGFB 4RBPK 3SCMA 1BOYA 1V3LA 3MYJA 1PLGH 1G84A 5DD6A 3I3DA 4JFXB 3MUY1 4ZFOB 3MRKA 1MVUA 4UAOC 4YQXH 1CF8H 3T4AB 1VFAA 3WFCH 1IC4H 4AH2A 2QHLA 1BF8A 4TVSa 4GG8A 3WE6A 2YKLH 3GMQA 4EI5A 1NDMA 3B9KD 1EGJA 2JCCB 4U2YA 4MNQA 4PJDF 1LP9A 3TZVD 4RNRA 2WIIB 4O58L 1U92B 2G9HA 2WUBH 3KVQA 5CIPA 3CMOL 2HJKA 3V7MA 5CGMA 5DMKB 1JVKA 3FHAA 1YN6B 4LSVL 4C83B 4R90L 2CUMA 2Q8BL 3L5JA 3EOBB 2ATPA 5IROA 5CZVL 4HX1B 4JJHA 5JQ6L 2B1HL 1G9ML 3FTGA 4JFOA 1DQLH 3CXHK 1K4DB 1GPOL 1QBAA 2JIXB 5JLZA 2X4UB 3R1GH 1ZLWK 1M7IA 1TTGA 3FFDA 3LN4B 4CDHA 1RULL 5E2UH 2VLRA 4M6OL 3MLZL 3TBYA 1N6UA 5KW9H 3P4MB 1O5DT 3K8KA 2BX5A 3V52L 3RWDA 5DFTA 4YXKH 2W0LA 3KR3H 5FDWA 1YEIL 4MS8C 2GJ6B 4HK0B 1DL7H 5F1NB 3QDGE 3HAEA 1SJHB 2ZPKH 2P5EA 3KYOA 4FQQA 3TT1L 1I8LC 3CDGA 4AJ0A 3EYVB 4HKZA 5JW3H 2R2EA 3W0WE 1MH5B 4YBLC 2VL4A 2EH8L 2F54E 2AJ3B 4NM4L 2NYYC 2ZCKH 4OBSA 3GO1L 1HSBB 4MNHA 1EFXD 2NYYD 4HWBH 4O4YH 3RWCB 1KCUL 2V6HA 5D70H 3IU3B 5ELIA 1J10A 1CDGA 2PYED 1A1OA 3Q6FB 4KHXH 4JKMA 1C16A 1XGPB 4XAKD 2V2XB 5J6HA 5I8OL 2BNUA 2ZSWA 1B0RB 4HGWA 3M8OH 3O9WD 3LD8C 1S7XB 2X4RA 3MRJA 3MLXL 4HG4J 4WI2A 3DUHA 5JPMB 4GKSA 1TVDA 1D5IH 4PD4K 3I6KA 1UXWA 4LDOB 4TRPH 1HHJA 3GMRA 1A02N 2B39A 1W8NA 1JHKL 4KGJA 2P7TB 3KPSE 5IW3A 2BHZA 2D03L 1T7VA 4X6EB 3GUTB 3WJLC 2E9BA 4M5ZH 4BQ9A 4WO4B 2J88L 4U6TA 1JWMB 3C5SA 4F7TB 1JYXA 5BJTA 5FV2A 2LABA 2PCPA 2G60L 2O5XL 3CSGA 5K9QI 3QDGB 2BSTB 4YLQT 2VN4A 3U0WH 3L1OL 1MIEL 1R3HA 1U3YA 3PWVB 1GGTA 5DJYA 2FWOA 3BZFB 1V7MH 4MD5A 3LQZA 5GGRY 1CXIA 1T1WA 4FQXC 4J3XA 3FOMA 3W0WB 1PBYA 1FAIL 2YWZA 4M1GH 3QNYB 2WMPA 1FSKC 2F54B 12E8L 4F58H 2R56H 1MREL 5JPNB 4PJ5A 3TPUB 1KT2A 3KLSA 4LASL 2XY1A 2W0KA 4APQA 1DFBL 4YDKL 2D3VA 1CBVL 1HINL 1X4ZA 3KS0J 4Y4KA 1F3JB 5T33H 2A0LD 2V5TA 2Q76B 5INDA 3AMKA 3V6OA 3BPNB 1AXSB 4HJ0D 4PY7B 3QNZA 4UINL 4UTAL 4J1UB 2Y6SC 1JTPA 1HYSD 3NCMA 2IADB 1A6VL 2LV4A 3EYQC 4I4WA 5IBTH 1QFUL 3C5ZD 4PP1D 3BDYH 2V2WB 4PTUB 4RFNC 5D2LA 2D7TH 3LV3A 2VTFA 3MA9L 4U49A 5DVOA 5C2UB 5H2BB 5MP6L 1T83C 3KHOA 4D94A 3SEPA 3HZKB 3EYOB 1WBXB 1XT5A 3KPSB 2F5AH 3WO4B 3QG6A 5J1SC 1CXHA 5I74C 2CK0L 1TJIH 1D5XA 2Z93A 3PWLB 2WLYA 4UBDD 5AWNH 4PYGA 1VPOL 3EO0B 1QVOB 4U1SA 4DGIH 4JN2A 4R0LA 2RCSL 3H0TB 2CIKA 5CKAA 2HVJA 1KCSL 1R3IL 1KIRA 4XRCA 3U36B 1AHWC 3ME0A 5L2KD 1NC4B 2XKNA 1EO5A 4LHUA 5F70A 2I07A 1WICA 2QQQA 5EN2B 1FRGH 1TIUA 3QIWC 3G6JF 5B8CA 3MCLH 1JPST 4UZGA 1UEMA 1MVFA 4JY5L 4WW1B 1HXMA 2EE3A 4PGEA 1GZQA 3OR7A 2DQJH 5B38A 5KSAB 3G08B 1NUDA 5AZ2H 3RDTB 3ARBD 2X4PB 1MFEL 1G7MB 4WV1B 1E6JH 2E6QA 1KJVA 4GAJH 1LO3L 1U8QA 4H20L 4BELD 5C8JB 1CN4A 1CD1B 4M6MH 3MJGX 1DEEA 4JG1H 4WUKH 5IUSA 1S7WA 1ACYH 2FB4H 2GT9B 2V7NB 4LAQH 3QDAA 3TPKA 5CGTA 4L5FH 3S36H 5E8DH 3T8XA 2E7LA 5CJXC 3MLUH 1LO4L 4JM4H 5FO7A 2FL5B 4OFVA 5J57B 5JO5A 5J13C 4JPIB 2FBOJ 4KHTL 5K59E 3WXWH 3BWUC 2XQBL 3FB7A 1IM9A 3IGAB 5D1QC 4JM2C 3WMSA 3STZB 2J8OA 4KVCH 3UYOD 4ODUA 3TIEB 2KPNA 1FDLL 4JM2D 5ALBL 5KZCB 4XCFH 1ZA3A 5L8LB 2L4OA 2X10A 1IC7L 2XWBA 2Q8AH 1YEKL 1MFBH 1FN4A 1CFTA 2BFVH 2C3WA 3BKJL 5ADOL 5KSUB 3OR6A 1VEMA 3PIQA 4EIZC 3AU1B 4YAQB 5KN5B 2QKIB 3VXOA 3NABL 1ZEAH 4GRWE 3V5HB 2R69L 1JUFA 2NY0B 4NO3B 3HE7A 1HNFA 4P5KB 3JV6B 4OFDA 5M94B 5I15L 4HIJA 2C5DC 3C6LB 1KTRL 3TH3T 3ALXA 2AXGA 3T0WA 1I1FB 2ZJSH 3LSOA 1MRFL 1GGBH 2NW2A 2Q86B 1BGXL 5D2LF 4YE4L 3FO2B 3O6KH 1GHFL 1D7FA 2WLZA 3AM8C 5E6IC 2B4CL 2C1PB 3PXJA 3MC0A 5C6WH 3HZYB 2APFA 3MTRA 3PHQB 4KZEH 3TJHC 3BSZH 4HFUH 3DUUB 3LQAH 4DW2L 3U6RB 3TJHD 4WFGD 3PGCA 2OQJA 5D7JA 1OARL 5F9JA 1HHHA 2XZQL 1IGJB 43C9B 4QRPD 4Z18A 1OP3K 2ICWB 4JO2L 3PGDA 4P23C 1HHKB 4GQ9L 1A14H 3UPRB 4RWHA 4ZOEA 1MCNA 3MPCA 4LCIL 2ZUSA 3JV4B 4LKXA 2J8UF 4FZ8L 3BZDA 3O3BB 2MNUA 2CPCA 1CFQA 2X89D 4PRPD 3DWTA 3UO1H 5D5MA 4XMLH 2XI9A 4Z7UA 1M6OB 3GSNH 4K3JL 4QKXB 2VLJD 5AYUH 3LIZL 3BUTA 4ERSH 3U2SA 4IIQC 2KKQA 1A6PA 3ETBF 3FB8A 3RGVB 1K4CB 4PB0L 4YXHH 4L3ED 2QJDA 4GRWB 4NQEA 4BFIB 3S7GA 3VD7A 3V7AG 3T2QA 3V6ZB 3ZYJA 3B8YA 3T65A 4KY1H 3KPMB 3MGTB 5ITBL 1J0JA 3T2OA 3OKMA 2A9MH 5T3XD 1SJEA 3EYSH 5E8NA 5GXBB 1DE4B 1AY1H 5B39G 1W0WB 2UY6A 1NEZB 5KVFH 3CUPA 1A6AB 3S6CA 3HG1E 3P11L 4OUUB 4FA8A 4ZUTB 2JF1A 3O3UN 4OCXL 3VFTB 2ORBL 1GL4B 4F9PC 4HIEB 1MCCA 3QUZB 5EC2A 3CCHB 2R23B 32C2B 4JVUA 5GS0C 4MAYB 1CYGA 1MELA 1G7QB 3C6SA 2HFFA 3IDXL 1F4XL 4IRZL 2W38A 1F58H 1OT2A 1J0YA 3I9GL 3VJ6A 4ONHA 1S7UB 1RUQH 2EDQA 1UJ3B 4PRNA 1G6VK 2CRIA 1ZLVH 5GSVA 3T04D 5ACMA 1ZHBB 3D0VA 5F7LB 3PGFL 4MXQD 3TVMB 5FYJL 1NLBL 3I75B 5TH2A 1QR1B 2CKBH 2VH5L 3UDWC 1GGCL 5FYLE 1DBML 1KEGH 2X4QB 2ZCLH 4NJAL 3VWKC 4JFDE 1MWAH 1DN0A 1U6AH 1AKJD 4MWFA 1IC1A 4GBXB 2QSTA 2AQ1A 4OCMC 4HZAA 1KN2H 5HYSB 3ZL4L 4M4PA 2HJFA 3MO1B 1K8IA 4K9EH 2Z91A 1A2YA 3HMXA 1T0NB 2DF3A 4NO0B 5IHUH 5LGKA 4HFWB 2XY2A 3H9SE 6CGTA 3OHXB 5LQBL 2BVQA 1I3VA 2V9RA 5F9WC 4J4PC 3MJ6A 2DQGH 4AT6B 1OF2B 2OLDA 3DVGB 4XNQB 1FPTH 3HG1B 3D3VE 3DRQA 3FRUB 4X7CC 4YHZL 1EAPA 4FXGB 5KAQG 2ZOKB 5DK0A 3UTZB 5I19L 3ARED 5E56A 2GAZB 4NNPH 5ITFB 2M2DA 2YEZA 4PLJD 4X4MA 4KROC 4QGTA 2MHAA 3OAYK 1IGFL 1MFDL 5ACZA 3T0EA 1R3KA 2ZKHH 3U7AA 3S5LA 5D5MF 4P5MA 2EC9U 4K7FA 4Z7UF 4ZAKB 3P0YH 5HYJD 1QLEH 1ZT7A 2VWEC 5CP7B 5L6YH 2PO6B 1FZMA 3CC5A 3REWA 5J8OA 2FGWL 5HHNB 5LJYH 3FQTB 3NTCL 4MA7H 3QI9B 2ICEA 4IOIB 5KSVA 2AXFA 5I17B 5DI8A 5TFSL 2YXFA 2Y7QB 4XPFL 1WSST 4PUBH 2XZZA 4HWNA 1NCTA 3VE0B 5HI3C 3VFSB 4JFDB 1KPRB 4I0PB 5E0QA 5SX4I 3L7EA 3HNVL 5HI3D 5DD1H 3THML 4XC3H 3JVGC 2RB8A 3BIBX 4G43A 4S0SD 3VFNA 1Q9OA 5HI5D 4OLZL 4QXUH 2AI0L 1P7HL 4YNYB 4LRIA 3OMZA 5CAYB 2BNQD 1DBKL 4ELKA 5LCVL 4OLWL 5AAMA 4GW4B 5A2IH 1JF1B 3H9SB 1QOKA 2O5ZL 4L29B 2R2HA 4TNWF 5JW4N 2MQCA 2W9EL 3D3VB 1Z9SA 3TT3H 5CEZL 4G6FB 1TQCB 3PHOB 3GMOA 3SPVB 1J8HA 4ZO9A 5DJZB 4WHTA 3IXAB 5ENWB 2X4TB 3BGFB 2ARWA 4N0YH 5JOFB 3IKKA 1QEWB 5KVGH 3WUZA 2Z9TA 1YJDL 2X41A 1RIUH 5BVJB 3PDOB 4LCUA 4XHJC 4R4NC 3SDCB 1NGWB 3RVXD 1FNHA 4GAGL 1Z3GH 3JUYA 5DRWA 3QUMH 1RV6X 5DHXB 3HE6B 3JWDH 1X7QA 2NTFA 4ZPTA 4XVTH 4FXKA 3MROA 4M8VA 3B3IA 4HLZG 4FNLL 3CXDL 1I3GH 4Y16C 4MCYB 1JNJA 3TIDB 1BD2A 2VDQH 5FM5M 3UZQA 5E4EB 1FL3A 2FLBT 1WC7A 4YBQC 1MCOL 3ILPA 4ORGB 2YD7A 4LF3B 5IFAL 2ATKB 3Q48A 4S1DC 3PWPD 1NGQL 4S1DD 3ZYOA 1UWXH 2IH1B 2J4WL 4CN4A 3X12B 4F7MA 1ZGLM 4FFZL 5J11B 3WIIH 1P7KB 4Z7VA 2V9TA 4D9RE 4YUEL 1NCCL 5LG1A 3D0LB 4RMVA 3HTLX 4RAUB 2K7PA 4QT5A 5FO9A 5ID0B 1BIIB 4FZEL 1NSNH 2ADGA 3BPOC 5AG8A 4Q6IC 1C08B 3RY4A 1U3HC 5ADPL 1BAFL 4JRXA 1EHNA 4XP1H 4WGVB 5C0AA 3B9EA 1MIML 4MJ4A 1N3NA 3GSWB 1I7TB 1CL7I 1Q9WB 2VZ1A 4HS8H 4OQTH 2PR4H 4PPTA 3OXRA 4PJFA 1OTUD 1JV5B 5KOVC 4PV8B 2VNCA 4WJ5B 1MRCL 3FMGH 3KDMB 2O26U 1CR9L 3JV0A 4P59H 5F7NC 2UZXB 1F8TH 1YYML 2O93L 5E08L 2DLGA 5F3HA 1PZUB 4JO4H 1DTUA 1U58A 2Q7YA 4S2SB 4HWZA 1ZT1B 1S9XB 5DC9B 3KXFD 4E0RB 4Z7QF 2AEPL 3G5VA 3CVHL 4DN3L 1U8JB 4TPRL 1TJGL 4FQ2H 4NN7B 1H15B 4K94H 2DQCL 1FVCB 4ZD3L 5BRZD 3U7YH 1FJ1A 4QY8B 3EFFA 3I6LD 3JWOH 3OB8A 1NBVH 4FQIH 4DEPB 1YYLL 3BDBA 4XB7A 1GH7A 5EU3B 5H8DA 4DOHE 1N5AA 4JDTL 5DA0B 2DTSA 5E70A 2EYRB 1QNZL 3QFJD 4NGHH 2HVKB 2VUYA 3U4AA 1LEGB 3U79A 3MRHB 3H7LA 2XTJE 4JZOB 2IAMD 5I71C 2JJSA 4POUB 2CRZA 2OZ4A 5EU7C 1T20A 1JNNH 5GISL 4HS6A 4PRBB 3QRGH 1OAKL 2DS4A 3GSOA 3ULUL 1ONQB 1OL0A 3KWWB 5DJ2B 3FFCA 1KPUB 2EDFA 4IRSC 4N0UE 4FHBD 3FCTA 4L9LC 5IB5A 4KPHH 1NFIB 4OIIL 4JAMA 5EIIB 2FHBA 3CMGA 2NW3B 4O00A 4KFZC 3VXQA 2CIIA 4G9FA 1VKXB 1ZVSB 3I2CL 5D7SH 4EDWL 1GOHA 1P6AB 1HSAA 1YUHA 4X99B 3VXPB 3E3QE 5DHVB 5TF1H 1A7OH 4PV9B 4U0RB 2Q3ZA 5HD8C 2XZAL 2VQTA 2AP2A 3VMPA 1CLCA 2CQVA 4RBPH 4Y5YC 3ULVD 3HN3A 4W68A 4Y5VB 3TNNA 4Z7VF 4OF5A 3LH2L 5I0DA 3CVHA 4W4NA 3N1MC 4KTDH 3DX8B 3OXSB 2DQEH 1JTTA 3QDME 4DOHB 3F7PC 3NPSB 1E0OB 1MF2L 5ISZD 3KNBB 5FYKU 4YBHA 2EECA 3NCJL 1M7DB 1KXVC 2DQUL 3RUGE 2X70B 2XTJB 4Y4HA 1C12B 5ETUA 4YR6B 3ZKSD 3ROOB 4HK3N 4OCRL 1I1CA 3NN8B 4JRYA 1BM3H 2J7LA 3TJEL 2AQ2A 3CDYA 4EI6A 2LFGA 3KYKL 2AJZB 1OM3H 2QEJA 3S3JA 3SE3C 5IFHH 4I3SH 3C60A 3NZHH 3QH3A 4N0UB 3DMMC 4Z8FH 4JGJA 3QHZH 1AQDA 3WN5C 4D0CB 5DD5L 2UWEE 4WCYL 3QFDB 3SJVD 2O61B 1RMFH 1RUAL 1QRNA 1F11B 4N68A 1EHAA 3ARQA 3W39B 3T3PF 3UTSE 1JK8B 3KPLA 1LD9A 3DXAE 4X7SL 1OOAA 1NAML 4WI5A 2H2SC 4XBGA 4L8BA 2H2SD 4QHUA 2DI7A 4N0CD 4H26B 1MHPH 3T77A 3AY4C 5TGBB 2OJZL 4NQCA 3WJJA 3ARWA 3DX6B 3G6AB 5TE4H 2VRAA 1YECH 2VQUA 5DHYA 4CAGA 1BVKA 3QDMB 1XGUA 3B2VH 2BOCB 3QR2A 2ZOLA 5EO1A 4BJLA 5BQ7A 4LU5L 5A16A 4MA3B 3K2UH 1INQB 4N8CH 3RUGB 4FFYL 5FOJA 5EZLB 5KANI 4ZO8A 1DVFD 4XMPH 4D3CL 3LEVH 1I9EA 5EH1A 4O02H 4G7VH 3IXTB 4LFHG 1HIML 1PG7H 4AG4H 4QTIL 2BC4A 3WKMH 4QRSA 5CEYA 1VADA 1AGBB 1AC6A 2WK2A 1NCDH 1MFAL 4RGNC 5ICXB 1RHHB 1FFPA 1TQBC 3S4SG 4RX4A 1DDHB 5DGRA 1JNHB 3OKOB 3QIUA 2EDHA 4LHJB 4Z7OF 5CZXD 1QKZL 4PJEA 1PKQA 1FZJB 4QHLA 2OJEB 2UWEB 4ELMA 4HV8B 1OWRM 3MRIB 1SQ2N 4OZGE 5HGBB 2DI8A 4HWEH 1NGZA 1RZIA 4RCAA 3UTSB 5DUPL 4K8RC 5ILTL 2DQHL 1ZE3C 3K2MC 3FKUS 3MRLB 3DXAB 4TSBL 1P9MC 4DCQA 1RSFA 2KDGA 4R26H 2MPAH 2VYRE 3AS2A 5JUEH 3M17A 3VFUB 3V0VA 5GGTH 4JEGB 5EFIA 4H1LA 4MJID 1U8KA 1DZBA 4Y19A 3ALPA 1T2QL 2C9AA 3BQUA 4KQ4H 3H7BB 3HB3C 3EOAA 2PYFB 1QSEA 4XP9L 3DO7A 3L5HA 4JZJA 4ZUUA 2P46B 1N6QL 4L3CB 3QUYD 4Z5RA 3VXME 3IDIA 1G7JA 4S10A 2XTLA 3LKOB 1I1AB 4I0CC 1BFOA 3PQYD 2OK0L 3ULUF 1YNTB 1KJ2A 3QXVA 2G75B