4OQ1A

Structure of the streptococcal ancillary pilin
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
334
structure length
331
Chain Sequence
EDHTLVLQLENYQEVVSQLPSRDGHRLQVWKLDDSYSYDDRVQIVRDLHSWDENKLSSFKKTSFEMTFLENQIEVSHIPNGLYYVRSIIQTDAVSYPAEFLFEMTDQTVEPLVIVAKKTDTMTTKVKLIKVDQDHNRLEGVGFKLVSVARDVSAAAVPLIGEYRYSSSGQVGRTLYTDKNGEIFVTNLPLGNYRFKEVEPLAGYAVTTLDTDVQLVDHQLVTITVVNQKLPRGNVDFMKVDGRTNTSLQGAMFKVMKEESGHYTPVLQNGKEVVVTSGKDGRFRVEGLEYGTYYLWELQAPTGYVQLTSPVSFTIGKDELVTVVKNNKRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cell wall surface anchor family protein
publication title Structural Basis of Pilus Anchoring by the Ancillary Pilin RrgC of Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 78
structure length 331
sequence length 334
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oq1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oq1A03
2.60.40.4180 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4oq1A01
1IGYB 1NUFA 3M07A 5ADPH 1Y0LA 4L8CB 1E27A 1IAOB 3CH8A 3RGHA 4F8TA 2QHRH 4X4YA 4OCXL 4FZ8H 3K4DA 3NA4A 4R3SA 3WFEH 3ARFB 4G6JL 1KPVA 1I9JL 1JF5A 1P4LB 1RIUL 2X1QA 1UM5H 4XP4L 1A4JB 1LILA 2BXZA 3CMGA 2BY3A 2FLRT 4YBLB 3WFBL 3ARYA 1HHKB 1KLGB 3VGGA 2KDGA 2YD5A 5D1QA 2WWKT 2RCSH 3PV6A 5C0CD 2MPAH 2CIIB 1JZ6A 5MI0C 5M7QA 5ALCH 2B1AH 5C0GB 2QQQA 3QAZC 4Y4HC 1JE6A 5FYLL 5MEQB 3WNKA 1I7ZB 4KJWC 5AUMB 5C0AA 4BSWB 3PIQB 5K9KB 4ZSOA 5HYJE 1NEZG 2VLMD 2I60L 4OCMC 5M94B 4GKZB 1QHOA 3M1BB 4XCCL 5TDNA 4NZUH 2BXYA 5JHDA 3LQAC 1HQ4A 4BFGA 5IV2B 3T3PE 4Z8FL 4MGXA 2MQ3A 4XHQA 3U9UA 1FIEA 1WTLA 3MCG1 2BNRE 4Z7UA 3QIBD 4LNRA 4OT1H 4RISH 3QEUB 2BRQA 3QG7L 4HPOH 4JFEB 4LKCB 1MCOH 1KB5H 5EU6A 5ITBL 2OR8A 3M8OL 5KSBE 1JP5A 1FFNB 2AERT 1QHPA 3QCUH 4M1CC 5DD3L 4TNVK 5A40E 2GTWA 2GSGB 3IU3A 3GI9H 3MBXL 3AVEA 1IM3B 4OI9A 4EDWL 1P6FA 3S8WA 5I66A 2F15A 4PJIE 2BVPA 1NFDB 4JG0L 4EI5B 1NUDA 4LASH 3T8XB 5J57B 4G7YH 2F5AL 3C08H 1KJMA 3BRGC 1JYNA 3EYQD 3LN4B 5AYUL 1S3KL 4Q7DA 1IT9H 1CTNA 4LCUB 4PJBB 2UVEA 2OR7A 4GAFB 2M26A 1M7XA 3AMKA 1RUKH 3MV8D 4Y5VB 4UB0L 1FSKC 1T7WA 2QQNL 4KXZI 5TJWK 4ORGA 4NUJB 1A02N 5ERWB 3O4LE 2OX5A 3MRQB 4PLJD 4PY7B 1T7ZA 5FCUH 2VXUL 4K9EL 1WBZB 8FABA 4KY1H 1CICC 5JQ6L 1M05B 2MOVA 4L3EE 2VIRB 2P7TA 4C56E 3WLWC 1QACA 3VH8B 4D3CL 3L3JA 3F7PC 1OTUC 1QSFE 4JM4L 4HX1B 5B39G 3D1MC 1FL3B 2HLFC 2XY2A 5IOPA 5GZND 4MA1B 4FTVA 5ANME 1INQB 3AAZB 5F96H 3ZYJA 1U2CA 3OXSA 1KN2H 1U2HA 4KRPB 3LKRB 4J12A 5JUEH 1NEZB 3CC5A 1FQ9C 5CS7A 4YXHH 1FPTL 1EFXB 1J1PH 4K8RL 1HXYA 2OS7A 4JFDD 5I76A 2H2PC 3GBLA 5CINL 4YWGL 4OLUL 1N7MH 4NKDB 2FBJH 1BX2B 1KGCD 4JVWA 3WHE0 4GJTB 3AREC 1OGTA 1ORSB 1X9QA 3RNKB 2Z8WC 4LLAA 2X1OA 2XTLA 5MENB 1MHHA 3QXUA 3HCVA 4NZTH 4Y2DA 2FL5A 5FYJL 3SDCB 3IXAA 4BZ2H 2WLYA 4NGHH 1SVCP 5HGDB 3EOTH 4A6YA 1P5VA 4XPAL 2HKHH 1OM3H 2UWEE 3CFDA 5IVXF 2VERN 3BW9B 2YRZA 4JHWL 1SJHA 2CUMA 5ELIA 5HTSA 4HT1H 4OF5A 5BVPH 3P4NA 2JJUA 4P4KA 4OGAC 4JRXA 1I7UA 3KPTA 4D0DB 3GJFA 2Y23A 5IEKB 4ENED 2BNUB 5FUCE 4OLEA 2JJWA 5GJSH 3MRRA 3RU8H 3DVNA 1T21A 2C9AA 3MRIA 4WGVB 3VWKB 1TCMA 2A83A 3FONA 5CHNB 2E7LA 3LRHA 3FT3A 3TN0A 1CG9A 5K9JH 4ZFGL 4ETYA 3WS6A 3GHEL 5EOCH 5IIEB 4NQVA 3CLEH 1D3CA 1FORL 2E27L 4YR6B 1LEIB 4PLNC 2GW5A 4JJ5A 1QFOA 4H0GA 3VGDA 4OBSA 4YAQA 3FJTA 4F37K 2VXSH 2HFFB 4JFED 4AEHH 4DFIA 2QR0B 3QHZL 4HIIB 4KK9D 1G9ML 5KVDL 5DFVC 4JG1H 1E28B 2AAVA 4MAYA 3RGVB 4ZOAA 3O41B 2XYCA 3WXWL 3U2SB 2BNQB 4M8VA 3MV9B 3RWIA 3V0AC 3OB0K 2OXHA 4QRUA 1N6QL 4ISVB 3RUGB 3SDDB 3D85A 4NJ9L 4HBQA 3RVWD 3ZL4L 3QHTC 4NRYA 2JB5H 4EI5D 3V6FB 4CVUA 4M5YH 2Z31B 2A6DB 3BKCH 2FYYA 5EUOF 3VW3L 3FQUB 3EJYD 1HSAA 2UZXB 3IDIA 2VDPH 3D25B 3E6FB 4KKBD 4HULB 1PKQB 1PD6A 2IQ9H 3LKPB 2GFBB 2I5YL 5IHUL 2OK0H 1X5FA 3MFFA 4XP5L 3INUL 2X2YA 5DJAA 3FB7A 4TULL 1A6VH 4GRLB 3KPLB 4QRQB 2Q8AH 2XWJA 4IIQC 2NY7L 4X9BA 4RMUA 5ACZA 3MODH 3MNZB 5TE7H 4YK4B 1KTKE 3IT8D 2A9NH 3REWB 2XA8L 5LCVH 5I30H 1MWAA 3NIDE 2XN9A 5DRWA 1UM4L 1B0RA 5HGHA 3BUYA 2IGFH 2D03H 5HVGB 5F97E 3DIFA 1MHCA 1I1YB 1PY9A 4P2RE 1RFDL 4JN1H 3ELAT 3TBVB 1G9NL 3GJEB 1CLOH 3OQ3B 5C07E 1JTOA 1A7PH 2EKJA 3MGTB 5CILH 2E5EA 4ZAKB 1IC7L 2YXMA 3C5ZC 2R8SH 2LTQC 2O61A 3FRUA 4KRPD 1UZ8A 1WICA 2F8XC 5DTFA 3MUZ1 2EICA 4XCYB 4J4PD 4NQXB 4QOKE 5IVOA 1OP3H 1UWGH 4HF5H 3P77B 4OF6A 3O3BB 4H1LA 4C54A 3ARTA 4NQTA 3QT2A 4NCC1 3FO1A 4RGNC 3CFIC 5DRZA 5A2IH 1I8IA 3GMQB 3IU4L 4F57L 4GW5A 2F19L 4JKKA 1ZANL 2DBJA 2VSCA 3L5XL 3VFOB 4F80A 2IPTL 3MRLB 1FNHA 1JV5A 4OCYH 3SDCD 3Q5TA 1JMZA 1ZVSB 4OFYD 3PP3H 4OCNC 1JL8A 3F65A 4JZOA 4E42A 2P8PA 1ZA3B 3QO1A 5KVFH 4U2ZA 3WBDA 4I48A 4XPFL 4PLKC 1X6LA 3FMGH 4I77H 5MEPA 4XMPH 2QV2A 4GXVH 1JNNL 1JYWA 2R2BB 1SHMA 3HLAA 4PGCA 4H8WC 5FM5O 5C0BA 4MX7B 4YEEA 4Y4KB 3QJHB 4G80A 3DETC 3SQOH 3PGDB 3VWJA 3QCVH 2P46B 4RWYL 4WY7L 3KPSA 4YHPA 2VR9A 5I9QB 4I2XB 4GRWF 1M7DB 1N0XL 1Q72L 4YPGB 3VWKD 5LJYH 2Q86A 1PSKH 1HHHA 1YEFH 4PJAE 1J18A 3CFJB 1Q9KA 5FM4A 2OJEA 1WAAF 3E0GA 3EDFA 2W59A 4FP8H 1DQDH 1H9VA 5C09B 4OLVH 4KK8C 1EK3A 5JXAL 5K93A 3NH7H 1AGBB 1EEQA 2X70B 1DANT 1HDMB 2BSTB 3KNBB 2EIZA 5GRZA 4EUPH 5TGBA 1XR9A 3UTTD 2YSSA 4GBXA 3RHWK 1NCUA 3KR3L 3MLWH 3P4LA 2CRZA 3V6OA 1XFPA 1EX0A 5IB1B 3RGVD 2ERJC 3QRFM 2DQJH 2BNQD 3MV9D 4RFOL 4U1JB 4APQB 1K4DA 1CXFA 1JRHL 1MUJA 2EC9U 2YRLA 1RJYB 2VABA 3SDDD 3AB0C 4KROC 3W39A 3D6GA 2E9JA 3DTXB 4HS6A 5DVKA 2Z31D 5ICXA 4P9ML 4I13B 5CD3B 4N8PA 5C08B 4CN6A 3JVGC 3QI9B 3KYOA 5I16A 1G6RL 3NFSH 3MREA 4I0PB 3L7FA 5JDSB 4R0LA 1BD2B 3WHE1 2DIAA 1R3KA 1XIWA 3HPJA 2FSEA 3F5WB 3K0WA 3VFPA 4JZNB 1ITCA 4X4ME 5HGAA 1FGNL 1QO3B 3IDNA 4GRLD 3MXVL 5C0JA 4P9HC 3MCKA 4YGVB 1FO0B 1JPGA 2HKFL 2P45B 1WC7A 3DMMD 4IOIB 3KPNA 4PRNA 3FO9B 1HHJA 1UT9A 1DR9A 1A22B 3LDBB 1T5WA 2V17H 5IR1B 3PWUA 2QKIA 1A6AB 4XMKL 3DV4A 5H2BB 5HYFA 1EBAA 5EORH 2IPUG 4M9PA 3A0OA 1U3HC 3DYOA 1KJ2B 4Q9RL 2G75A 4U0RB 4WIQA 4ODTL 5CEZH 4XC3L 3N50A 5HDBF 2VSDA 3S5LB 4NRXB 1YMHB 5IWLA 3MRCB 1CD8A 1KELL 3O4OC 2EDYA 1ADQH 5F7WC 4R26H 1AXSA 4NOBA 1LP9B 1EXUA 3C60C 2V2TB 1F02I 1MY7A 3KYMB 1N59B 3LHPL 1BEYH 1VACA 1BFVL 3MPCA 4IRZH 4LBEA 1CFNB 2I9TB 2EC8A 1NGYB 1SM3H 3N1PC 5I1DB 3L3GB 3UC0L 4LCWB 1S5IL 3P2TA 2GHWB 3CFCH 1UACL 3HZKB 3RX7A 1T03H 1FLRL 3GMRA 5C3TA 4M02A 2CUIA 3JBG7 3V6ZB 5ALBH 3RI5K 2Y6SC 1KIPB 3MLYH 4PIRF 1SMOA 1YEIL 4FQ2L 3V0WL 4DUVA 3QFJA 4HK3J 2ARJA 1RIVH 3K7UA 3EGSB 4G6KL 3VGAC 1OY3B 2R1WB 4MNGE 1TJGL 3IKCB 5DD1L 4YHKH 4NHCH 5J8OA 4XXCA 1I8KA 3HB3C 4PJDA 5KVMC 4MD4B 3GSWA 1DBMH 3WEXA 1GGCH 2OJZH 3H9SA 1FFQA 5J3HC 3EKCA 1IVLA 5ETUB 5DI8A 3S96A 1D5IH 3T65B 1K8DA 1QRNB 3WJLA 3BVNA 3R8QA 4ZS7L 4H8WH 4QXTB 1MLBB 5KTEL 3BT2L 1UCTA 4BK4A 1S8DB 5IMLA 1XGPA 1IEAA 4Y4KD 3TO4C 5FB8A 1G7PB 4QHMA 3MRNA 5ESVA 3BQUA 1X5KA 1O7VA 5SWZE 4JPWH 3JTSA 3CDCA 4MQ7B 2A38A 4LSTL 2DLHA 3IJSB 3IVKA 1LEGA 1FDLH 4OTXH 2NXYC 4P5MA 4H5SA 1DBJH 4HIHB 1I9RL 3MCLH 4CU6A 4L8CA 1IAIH 2VLKE 4TNVF 3U4BL 3B3IA 1QR1B 3ARFA 5C09D 1P4LA 2CJUH 5AZEL 5DJ0A 1CLZL 3TJEL 1A4JA 2DYPB 1YN6B 1DQTA 1IL1B 1HHKA 5CJBA 3HI5L 2XNAA 3QPXH 4M4RA 5DUBA 1YQ2A 5FF6B 4UMGA 4HCRH 5F7DA 1DDHB 2CIIA 1NGWB 2HT4D 1CDBA 2FEDC 2ZKHL 2C1PB 1W72B 5C0GA 1EEYB 4HIXH 3U7WH 5D1ZB 4FA8A 5GGTH 3VFUA 5MEQA 4APQD 5GRJH 2PXYB 4U1GC 4BSWA 5GRUL 5F9DC 1BQUA 4J23A 1DBBH 3RTQB 4K3DL 5E5MB 1BJ1J 4HK3N 5AD0B 4JFXB 4NQCB 4GKZA 3M1BA 3L3HA 1S7SB 5CGYD 2YK1L 5C08D 4ZFFA 1FZJB 4CVZB 3QXDB 4DZBB 4I0PD 1P53A 1A14H 1WUNT 2DLGA 2VB5A 3VMOA 1BD2D 3QEUA 1EUTA 2G60H 4JFEA 4LKCA 4L4TB 4KQ3H 4IMLB 3OKYA 1H5BC 1FFNA 4P9HH 5T1LB 3NIFF 1ETZB 1G1CA 1FG2A 5TF1H 5F9AC 4U3XA 2GSGA 4Z78B 3EJZC 1JPTL 2ZUXA 5FFLA 3H9YA 2DF3A 4NBZB 4F9PA 5E8DH 2CMRH 4QRRD 4I9WE 2C3XA 4MXQC 5LGJB 1CE1L 1KIQA 1WZ1H 1LK3L 3TEUA 4KZEH 1A7BA 5E4EB 1NFDA 2O5YH 4EI5A 2DM4A 3T8XA 3MA9H 3QDJE 4ZQKA 1I8MB 3MUJA 1CN4A 2OXGA 3GSNL 4Y4FC 4OCWH 2YPLB 5JMOC 1VDGA 3KXFB 2NY6C 3LN4A 5GGVY 4LPCA 3OV6A 4HQQL 1OSZA 2HTKC 4X4ZA 4LCUA 4PJBA 4JY5H 1IBGH 5IGXL 4DKEH 4ZXBD 5GGSY 1HN1A 3BEVB 5CD5C 43C9B 4OGYH 1MFCL 5E9DB 5F3HB 1IC1A 4Y5VA 4PJEE 2AKRA 4LVHB 4NUJA 1FJ1B 5D6CB 5ERWA 5GJTL 3MRQA 1OSPL 5CP3A 4OGXL 4MQXD 1ZTXH 1A2YA 1WBZA 2Z4QB 3OKLA 4FABL 3VGBA 5JXED 3MOAH 4F33B 4NUGL 4O4YH 2CDEB 4IM8A 2CH8A 2VNCA 4LVEA 5SX5H 3P11H 4EQ2A 3VH8A 3RZCB 3O9WB 2KUTA 3ARRA 1U8MA 3QCTH 5C0DB 5J9PB 1IGFH 1OW0C 2C4XA 5D7IA 1NGXB 1QKZH 3EYFB 5FECA 4HX1A 1ZEAL 4QNPE 3LKNB 3KJ4B 4WFFD 1E4XI 5JW4N 2JIXB 1D9KB 3NFPB 2P5WD 4DUXA 1INQA 4UTAL 1F3DJ 1JGVL 2ZZUT 1SY6H 4JREB 4HS3B 1QRND 4XCNB 3LQZB 3LKRA 1FVCB 4J4PA 1EFXA 5CEZE 3TLRA 1IGMH 4OV6F 3MUGA 2Y7QA 3JWOC 5GPRA 1XCQB 4RFEA 1AR2A 1X7QB 5KVEH 1B90A 1XH3B 5I1GH 4NKDA 2YUZA 3BD3A 3NZHL 1BX2A 3FQTB 1VEOA 4R90H 1JF1B 4F37F 5L8LB 4MJ4A 4XBPB 3CDFA 4M6ML 1ORSA 3RNKA 4HAGA 5E0QA 1ZLUH 5IMOB 5MENA 3BUTA 2WAHA 2APFA 3F7QA 4XZUB 4PJFF 1OAUL 4OFYA 4JLRB 3RKDD 2VJXA 3S88L 3HE6B 5ID0B 4BH8A 2AABH 5KAQG 1VA9A 3S36L 3N1MC 3ZE1E 5EH1A 4EXPX 2H26A 5HYJB 4PV8B 4PRIA 3WE6B 4RGNE 5EBWA 4E0RB 4YLQT 4CU7A 4PR5B 4OF7A 4RBPK 1JZ7A 4D0DA 3KLHC 1FYHB 3HR5B 2D3VA 5IEKA 4PGDB 2BNUA 4LCCC 5CUSL 4JFOB 2OZ4L 5EBLB 3T2OA 1ZGLB 2BNRB 2BVTA 1T6VN 3O45B 4WUKH 2W60A 5DUML 1Y6MR 2PXYD 2GT9B 3VWKA 3MO1B 3NIGE 1Z3GH 2R29L 1KLUB 3K2UH 1KXQE 2FX7H 2VDNH 4Z76B 5CHNA 1OARL 1RMFL 1PBYA 1MFDL 5KSBB 1BREA 3QQ9D 4NQCD 4I3GA 1KTLB 1BM3L 4JQIH 3GMOB 5TH2B 4TSAH 5IIEA 4ODUB 3QDGB 4K55A 4YR6A 1LEIA 1QG3A 4TQEH 4LLYB 4UV4L 4PB9L 2P8LB 5E8OB 1BWWA 3UPRA 3O2DA 4B7LA 4M4PA 1C5CH 2HFFA 2VZVA 3U0TA 5ABDE 1ZV5A 4P2CG 4L4TD 2QR0A 1WITA 5TE4H 1YNLH 1BZ7B 2AV7B 2YD9A 4DGIL 5I15L 5T1LD 2YHGA 3ULUH 1HZHL 5E8PB 1E28A 1T80A 3QUZA 3RGVA 1DQMH 3AMLA 3O41A 3E6HB 4M61B 4W70A 3MV9A 4YHZL 2WP3O 3JV6B 1N26A 2UZIL 1QPXA 4ISVA 5DMJB 3RUGA 3SDDA 4K94L 1I1AB 2NLJB 2D7MA 3EOYG 3HNSH 5D1XC 1FC1A 3A6CH 5IKCB 4M93B 3V6FA 1AKJB 4UU9B 2Z31A 3BN9C 5GGRB 2A6DA 3O4LB 4QRTA 3KJ6H 3FQUA 2P5EE 3SO3B 4LSRL 4KVNH 2YPLD 3D25A 3E6FA 1K4CB 1DQLH 2IMMA 1PKQA 4OD3H 4XPBH 5IB2B 2GFBA 1HINL 3BSZH 3LKPA 4KRLB 4R4ND 2C4FT 5IG7B 1FHGA 4L3EB 1EEZB 4C56B 5CSBA 4L9DA 1UXSB 5DLMH 3ARGD 3TBTA 5E9DD 3GIZL 5HHNB 4GRLA 1A6WH 5GS2D 1RJLB 3IJYA 3NTCH 3LEXB 1F2XK 3MNZA 4YDIL 4CVXB 5KBNC 2DKUA 3REWA 5I18L 4KV5F 2AJYL 3MRGB 5ANMB 3VXPA 1D5XB 5EIQA 5T3ZH 1XF1A 3U83A 5D5MF 5FHAL 3RZCD 1Q0YH 2EIEA 4PBXA 3MOBL 1I1YA 1QEWB 2R4RH 3B9AA 2BJML 5D93B 4P3WA 2B2XH 4JO3H 1YECL 1D6EB 1TETH 3GJEA 3TBVA 1D9KD 4XNYL 1REIA 3MGTA 4ZAKA 3CPLB 4FFYL 4P0DA 2ZCHH 2EDQA 1H3UA 4NC2B 3Q3GB 3J8F7 1A7RH 4LRNL 4L8DB 3LS5H 1Q1JH 3TYGL 4XCYA 4NQXA 5C0IB 4Y2DC 5BRZB 3JWOH 3RL1B 4YFLI 1B9ZA 5D72H 2QADC 4EDXB 4RZCB 4G42B 4OAWB 3P77A 3O3BA 2FX9H 2EIDA 1DTUA 4HV8B 2UWEB 1FZMB 3GMQA 4JPVL 2VLRA 5IM7A 4XNQA 5E03A 5I1CH 3UTOA 2VISB 2IPUK 1YYML 4IRSB 3RHWF 4POZD 4P4KC 1A0QL 4K7PX 1TFHA 3H9ZA 3VFOA 3MRLA 3X12A 1UA6L 3QHFL 4HWZB 1ZVSA 3N0PB 3HE6D 3IS1X 1DVFD 1ZA3A 1T66D 3ARVA 3MV11 3CMOH 4LF3B 2ZPKH 3NPSB 3CLFL 4AMKL 3DUSA 5HHVL 1KENH 1MIML 1QTYT 3QR2A 2X4QB 3W9DB 3BKJH 4KRNA 2E7LC 3QWOB 4MX7A 3L5HA 4ETQB 4HG4K 4LMQE 4Y4KA 3V7MA 2YWZA 1KCUH 3DX8A 1GZPB 4MA7L 1A47A 5D7SH 1LDPH 3CZFB 4YPGA 4XPHL 5DHYA 4EN3B 4WFED 4HKJB 4PUBH 3V7AE 3CFJA 4GAJH 1WIUA 2V5SA 4RNRB 5GRXG 2JELL 5SX4I 5ILTH 5D7LD 2OLDA 4F7PB 3QDGD 4FFVD 3FT4A 4DTGL 1NAMH 1OAQH 4V1DE 1J0IA 3GMLA 4L9LB 1WF5A 2NYYD 2X70A 4PBWD 2YD4A 4WV1B 1HDMA 2BSTA 3KNBA 4OFVA 3SGEI 2XFXB 2HWZL 1MH5B 1D7FA 1NFKA 4OD2A 3NA9L 1IGTB 4AL8L 2YS4A 2B8OT 1P4IH 2XQBH 4NNPL 5IB1A 5IESH 4G6FB 5C1MB 2JJTA 1U9KA 2X7LB 4U1IA 5D71L 1UB6B 5DVNA 1J87A 2VQ1B 1RJYA 1RURH 4K3HA 4O2FB 1N4XH 4UILH 1U3ZA 5HHQB 1SEQH 1I1AD 4AZ8A 3CXDL 5BV7C 2VDLL 3DTXA 4J1UB 3ULVD 2X4OA 4QO1A 3P4OB 1AKJD 4Y1AE 1QFWL 5EUKA 2J8UF 1PX4A 4LEOB 4NWUH 3O4LD 5C08A 3QI9A 4RGMB 5I71C 1NMCB 3RY4A 4I0PA 1S78D 4ZPVB 5JDSA 2EZ0D 3RI5F 4Q0XL 4WNQB 2IG2H 3I2CL 4C56D 4ZD3H 4GRWH 4JZNA 1HNFA 1MCPL 5HYSG 2X89D 1DN2A 5I1IL 5HJ3B 4K8RC 4QWWC 4M7LT 2BRRL 1FO0A 4DVBB 1KB5B 2PR4L 1UJTA 1KT2A 4NQSB 1EERB 2BZDA 4P2RB 4IOIA 4HHAB 4JANB 4ODSL 5GHWL 2DJ4A 3LH2H 5C07B 2P49B 5TFSH 4B50A 1J7VR 1FZOB 1A6AA 4LCYB 2DD8H 3FAXA 5DD0H 4WHDA 4LIQL 1JRHI 3RWEB 5H2BA 3ZKXC 1KJ2A 4HC1A 2H2SD 4PJ9C 4OCXH 4OIBA 1QUNA 4L4JA 4B7IA 5IMMA 3S5LA 4NRXA 2NX5E 4G6JH 1OQOA 4O02L 1I9JH 1R5VB 4QOKB 1RIUH 3CX2A 3BPOB 5F9WB 4XP4H 1SBSL 3HUJF 1NC4B 3IYLW 1F00I 1RI8A 3WFBH 3BKYL 4X8JB 5ISZA 4S1RL 3ZKNC 2V2TA 2CDFA 3KYMA 1T2QL 3MLZL 2FGWL 1CFNA 1ES0B 2VXVL 2I9TA 1NGYA 1RZJL 3L3GA 4LCWA 3UCRA 1N6VA 5BRZD 1MCCA 3EZJB 3HZKA 5FYLH 5JPNB 1ZHLB 5JW5B 3V6ZA 4JZJC 5JXEA 3GZKA 1KCVL 3I50L 3S7GA 4HG4J 3A67L 2F54E 4I0CC 3FO2B 4NQED 2KKQA 3HG1D 1S7XA 2I60H 3MJ7B 1QLEL 4XCCH 3RQ3A 1TPXB 5JTWA 1MFBL 5E2WL 1DANU 4DJMA 4ZFOA 4MA8L 3EGSA 4Z8FH 4IRSD 3MQIA 3IKCA 4PP1D 5A3ID 1F58L 4MD4A 2YBRB 1UH2A 4KTYA 4XP9L 5B38B 2YD2A 1IEBB 1PX3A 3WFHB 3QG7H 1J1XL 3PHSA 5ETUA 5FDWB 4KQ4L 3T65A 4B53A 5ITBH 3M8OH 2UUDH 1P69B 1MWAL 3FN9A 3MUHL 1PJ9A 4X7EC 4RMTA 5DD3H 3GFUA 1OTSC 3PHQB 4G6AC 4QXTA 3OMZA 3MBXH 3SJVD 1BGXL 2PYEE 4CMHC 2AQ3A 1G7PA 2R0KL 4EDWH 1WGOA 2WK2A 2Y25A 3RVVD 4HFWA 4WUUB 5EU5A 3TYFB 4JG0H 5DFWH 3G6JA 1HE7A 4OZHF 2F5AH 2J6EL 4J3TA 4YBHA 2EEBA 5HYSB 5AYUH 5C6WH 2RHEA 1S3KH 2ZSWB 5GS1B 1TQCC 2OL3B 5EUOE 1QR1A 3S35L 1S7TB 4GT7A 4NZRL 3R8BB 4HGKC 5BO1L 2DYPA 1YN6A 4PJXF 3PE9A 4UB0H 2QQNH 2AS5M 1AQDB 1UJ3B 3QJFB 1KIUA 5H37G 5FF6A 4XVTL 1DDHA 1NGWA 1T7YA 2VXUH 4MXWL 5I75C 2C1PA 4K9EH 4G6FD 5E5RB 5JQ6H 4C4KO 3OPZL 4KI5D 5D1ZA 3V52L 5HYIA 5IP4A 2XZQL 3QIBC 3IDGB 2PXYA 1LO5B 4ZUSB 2EE9A 1VENA 3T0ED 3RTQA 4D3CH 4IJ3C 4GG6B 3OJ2C 4X6EB 5E5MA 5AD0A 3PHOB 4NQCA 4JM4H 3NN8A 4P2YA 1P6AB 3TT1L 3ZE2F 2IJ0C 1YJDL 2JLLA 2ZUQB 4CVZA 4DZBA 1P7QA 3R0NA 4RWHA 5CZVL 1SVZA 1TZGL 3NGBB 3AS0A 2COQA 5C70A 1N2RB 4L4TA 1XAUA 1FPTH 4K8RH 1OT1A 3BX7C 2P24B 4UOW0 4Z77B 4OKVB 3DVGB 2R1YB 5CINH 4YWGH 4P2RD 3EYQC 1IARB 4OLUH 1MAJA 1CXKA 4L29B 2QSCL 5GS0D 5IWLC 5C07D 1SMAA 4UQ2A 4MCYB 5LGJA 1E6JL 1FRGL 4YDVA 4HJJL 5JOPD 4P5KB 2MHAB 1B4JL 2OP4L 3DOSA 2WANA 4U6HA 1I8MA 5FYJH 1HEZB 1NANH 5D2LB 1B4RA 2E8ZA 4PLJC 3QIWB 1CQYA 4GQPH 2VLJE 4OKDA 3KXFA 5FKAB 5HDOA 4ZDHA 3AXLB 3FQRB 2V5YA 5CBAB 4JPIB 3ZKMD 3M17A 1I1CA 4JHWH 43C9A 1EA9C 5A2FA 2DQDL 5E9DA 4M9OA 5F3HA 1I8LA 2W9EL 4QY8B 5IHBA 3CK0H 1NGQL 5D6CA 4Y16B 3ULVL 5IW1B 3SE3A 2BSRB 5GGSB 3V0VA 4XXCC 2P8MB 4JHBA 4U2YA 2H45A 3KPMB 5GZNC 2Z4QA 2XKUA 3U48A 3FB8B 3UTZB 4F33A 5BMFL 2OI9B 4N1EA 4V2CB 1CICB 2B5IC 4LP5A 2AEPL 3HFML 3O9WA 4GRWE 3WJLC 4ZFGH 3BAEL 3GHEH 5C0DA 4LSVL 5J9PA 1FORH 2E27H 3BISA 1WAAE 4Y19E 3L7EB 1RJZB 2JIXA 1D9KA 3NFPA 4XWOD 1M6OB 1VKXA 5C2UB 2VE6A 4JRYA 4X6DE 5FGRA 1JUFB 2UYLA 4J6RH 5I2IB 5SWZB 4PTTB 3QHZH 1DQQB 4HS3A 1G9MH 3LQZA 4GAGL 4XCNA 2W38A 1FVCA 5KVDH 2MSPA 4UIMB 5AWNL 5IQ7L 3WXWH 4LHUB 2PYFB 1XCQA 2K7PA 1X7QA 1N6QH 3O2VL 1XH3A 4NJ9H 3H3PL 3SPVB 3FQTA 2NW2B 4WUUD 1S9XB 3RA7L 3EOBB 4XBPA 5JW4M 4YBLC 2ICWA 5LBSL 3FT2A 3REVB 2LVEA 3E2HB 4NC1C 3QQ4B 4XAKE 3VW3H 1JZ4A 1WIPA 3I6KB 4XZUA 3UBXI 1CK0L 3D48R 4JLRA 4ZFZB 4NO5B 4ENEC 2I5YH 5ID0A 3MRMB 4XP5H 5FYLE 4MJIE 1BOGB 4TULH 1L0YA 5HD8D 5KN5A 2AEQL 1LP9F 1ZLVH 5E56A 3PABB 5HYJA 3PWNB 1X4ZA 4PV8A 3WE6A 2N7BA 3BDBA 2NY7H 1KLFA 4E0RA 4PR5A 1AIFB 3HR5A 4PGDA 2WIMA 5CLTA 4JFOA 4C83B 4PJCB 3HC3L 2XA8H 4HXAL 5EBLA 1ZGLA 2BNRA 1RVFL 3O45A 2VN7A 3EDJA 5FHBL 4MNQE 1JHLL 3SBWA 3PUCA 1UM4H 2GT9A 3O0RL 1PYWA 3MO1A 1G9EA 4Z76A 4NHUB 3HC0B 3IDJA 4ZUUB 4KK9C 5KSBA 2J7LA 1RFDH 5BOZG 1ZA6B 3GMOA 3VU2A 5TH2A 1G9NH 5HDBE 2WM0A 4ODUA 1U8OB 2MQ0A 4WI5A 1F3JB 1U91B 4LLYA 1NGZA 1IC7H 3QDHA 2A6KA 2P8LA 4JHZA 5LVEA 5E8OA 2W92A 1ZHKA 1A3RL 3RVWC 5IHLB 4PJIA 4HK0B 4EUPB 2X1PA 4EI5C 2DL2A 4PRBB 1BZ7A 2AV7A 2IC2A 5EOTB 1LO0L 4GS7B 1UEMA 5E8PA 3SY0A 2XXCB 3EJYC 3HI1B 4X7SL 1KJVB 4KKBC 3JV6A 1L6XA 2AGJL 2I9LA 1ZHBB 2NTSP 4XGZB 4RIRB 2XV6B 1T0MA 4OZFH 5A1AA 3IU4H 3HMXL 3P9MB 4UBDD 4F57H 5I19L 5SX4H 4PTUB 2F19H 1FNGB 4NYLB 4Q2ZB 4Y5VC 43CAB 2BOCB 4PJEB 4UU9A 3L5XH 1FIGL 1NKRA 1X5IA 5GGRA 2IPTH 1KBGL 3O4LA 2D0GA 3B4NA 4WJ5B 2RFXB 3QIWD 5DK2B 1XF5B 1K4CA 3GSUB 3CU7A 3SGEH 3F58H 4X6FA 2GCYB 5IB2A 3DX7B 4XPFH 1AFVL 2MPAL 5IG7A 1JNNH 4KUCF 4L3EA 1EEZA 2X05A 1QYGL 4C56A 4N68A 1UXSA 5HHNA 2GUOB 3D69B 4IMKC 1RJLA 3KAAA 5DT1L 4Y16D 3LEXA 1QSFA 1FCCA 3VFVB 1MELA 4RQQB 2APTA 4CVXA 4L3CB 4HLJA 4RWYH 4DGYL 3MRGA 4WY7H 5ANMA 4MA1C 5GS3A 1D5XA 1N0XH 1Q72H 3ES6B 5D96B 2HT3D 3T4AB 4KRPC 1UB5B 4QLRA 4ESKA 2EDFA 1DFBH 1QEWA 1ORQA 3GHBL 1YPZF 1ZAGA 3LN9A 4J4PC 3VDAA 3WNNA 4E5XA 4BJLA 5JXAH 5IFJA 1D6EA 1H3PL 2WBJA 2F9BT 1Q0XL 1MRDL 2D7TL 1JK8B 1Q38A 1H3TA 4JFHD 4NM8L 5GS0L 1GL4B 5F8RC 4F9LA 2KL6A 3KR3H 3QDMD 3Q3GA 4OIAA 4L8DA 1UXWB 1EVTC 1IGJB 3EZ8A 2PN5A 3K81A 3SDCC 4RFOH 2Q8BL 3RKPA 4RZCA 4EDXA 4LHUD 4G42A 4OAWA 1JRHH 2YWYA 3CDYA 3UTQA 3B9KB 4HH8A 2UWEA 1FZMA 1RZKC 4KJQD 3B8SA 4P9MH 2AJZB 4RGNB 4KDTC 1SYVB 4Q58C 4YDJB 2VISA 4UOW1 5JDJA 3P4MA 1G6RH 5JHLL 5EZLB 4LHJB 2K1MA 5D70L 4LOUC 2AJ3B 4XWGL 1FGNH 4LF3A 2AJVL 3MXVH 3KLDA 3VE0B 3ISWA 4S2SB 3VFWB 3VWKC 4NC0B 4KY1L 4M3KB 2HKFH 2X4QA 1B2WL 4RAVB 3QWOA 4G8EA 3OKMB 3D3VB 1CVSC 3CUPB 3NIFE 3DLQR 5AZ2L 5FYKE 5DC9B 4ETQA 1OVZA 1CIDA 2XWTA 4ZTOL 2HMID 4XMKH 2Q7YB 1A1OB 2D4FA 1GZPA 3JSSA 5KS9F 3CZFA 4Q9RH 3CXHK 4GW4B 4EN3A 4ODTH 4XC3H 1I7TA 3BWAB 5C9JB 2C4FU 1FNSL 4R2GB 1JGUL 2MNUA 1ZVHA 2X09A 4FHBD 4F7PA 1KELH 3ZMRA 3G5YA 3RGVC 3SKUD 2FJGA 4L9LA 5IT2L 4FXKA 3I02B 1Z9LA 3SDDC 1X44A 2XFXA 1BFVH 1MH5A 3EYVA 3N9GL 1OAXL 1IGTA 3C5JB 5EWIL 3UC0H 1S5IH 1UACH 3OB8A 1UWXK 1FLRH 5DUPL 5C0CE 1CDYA 1HSBB 3ALXA 4NRZB 4D0CB 3BDXA 1YEIH 2VQ1A 4FQ2H 3B6SB 3U0PB 3U9PL 3V0WH 5E7BA 2DQUH 1RK1B 2EO1A 1NC2B 4BZ2L 4NZDA 4KROB 4J1UA 4K3GA 4J3SA 4GRLC 4G6KH 4Z7VF 1P7HL 1TJGH 5E1HB 5IMKB 3EOTL 4XB8A 5DD1H 1IMHC 4EJ1C 3TPUB 1P7KB 2BSSB 5BOPA 3DMMC 4HT1L 3HHRB 3FHQA 4MB5A 1FFOB 3C5SA 3TBWB 4ZPVA 1GXEA 3BGFB 4WNQA 5KSVB 5J56B 1FNLA 3HPLB 4N1HB 4ZS7H 1QLRA 3KPRE 4U1MB 5HJ3A 5L9DL 4PFEA 5KTEH 5IFAL 3BT2H 4DVBA 1KB5A 2NZIA 1OPGL 2C5DC 4NQSA 4P2RA 4HHAA 1ACYL 4JANA 4AQOA 5HDLA 1G7HB 4DKFL 5C07A 2PUQT 3OKNB 4LSTH 1FZOA 4TUJB 1TTUA 1BJ1H 4OZIF 2XG5A 3RWEA 4NJAL 1I9RH 5C6TH 1WFUA 3RJDA 4CGTA 3CSPA 3MJ9A 2AP2A 2VKWA 2DLFL 1Q94B 3U4BH 3MJGX 3U6RA 1ED3B 2VH5L 3DX9A 5CEZD 4H25B 2DQHL 1R5VA 4QOKA 1QFWI 3OR7B 5AZEH 4KJYB 5E8EB 4PJFE 4NBYB 3TJEH 2V2XB 3RZWA 4ZNCD 3ARWA 1NC4A 2J4WL 4JKPL 5DURD 2F5BL 2KQMA 3SDXB 3FRPG 4W6YB 3QH3B 1S7QB 3HI5H 3VRJA 4XPGL 4HMEA 3VD4A 4V2BA 5C6PB 3MV8E 1ES0A 1Z9SA 1CFTB 2ZKHH 3QNZB 1X4YA 4LEXL 1FL5B 2XICA 4R8WL 5JOFB 1T0NB 1HCFX 5JPNA 2CK0L 1ZHLA 5JW5A 5HYQB 4QHKI 3WO3B 5JIKA 4P23B 3PP3K 4OFKA 5GRUH 3B9KD 3FO2A 4MDIB 4K3DH 3MJ7A 4PJ8B 2IQ9L 5GISL 2W9DL 3RL2B 2LU3A 3ULVF 1P9MA 5IEHB 1Q9WB 2BCKA 2YK1H 5J13B 3CXHJ 1KULA 2IH3B 3U7AA 5GGVL 4Y89A 1CQKA 3MTRA 1JN6B 1B3JA 5B38A 4S11A 1I1FB 2AJUL 3D39B 3WFHA 5TDPB 1BIIB 1TITA 3BH9B 1IM9A 5DQDL 5DMKB 1L0QA 1RK0B 4PLKD 5C8JB 2OCFD 4PJAA 2CLZB 3MNVB 3PHQA 3D3VD 5DMGD 1JPTH 1IC5L 2BMKB 2YKLH 1HHIB 4JFDE 3ZTNL 4MB3A 1CE1H 3WNOA 4V1DB 3TO4B 1MOEA 1LK3H 4WUUA 5SWSD 1GC1L 1Z5LB 5EB9A 2IQAB 2FX8L 5KAQF 1KGCE 3EO9L 1PG7L 3GSNH 4R2GD 2NXYB 3EO1B 4PJHF 1F97A 2HT4C 4HQQH 4N5ED 1CDUA 1MCDA 2ZSWA 2OL3A 5GS1A 3LEVL 1AD9B 3BYYA 5IGXH 2WQRA 3SKMA 2JJTC 4WTXA 5F88A 3VFRB 5A2JH 3VA2C 1MFCH 4APQC 1S7RA 5HBBA 1AQDA 2WP3T 4WU7B 3QJFA 2OMNA 5GJTH 2W0KA 1OSPH 4UNVA 4NC1E 2DM3A 4OGXH 1HOCB 2VYRE 1KSRA 4JB9L 5CGYC 3IFLL 4FABH 3VRIB 4LU5L 4QT5B 4NUGH 1FV1B 4KV5E 1TENA 4HH9B 4I0PC 1JHTB 1L9NA 4Y4HA 1LO5A 1T1ZB 3QUML 2DJSA 4X4MA 4XVSL 1NC2D 4N9GA 5KANI 4X6EA 4KROD 3PHOA 3SOBL 5D5ME 1B0GB 5T1MA 1OCWL 3VGHA 1EFQA 1ZEAH 3KYKL 4JO1L 1NEUA 5DJYB 3SO5A 1OHQA 1BZQK 4RX4A 1WFTA 2Z92B 1JGVH 4RRPG 1G7IB 2IPKB 2QL1A 3SEPA 3LDBC 1J8KA 1RV6X 4Q9BA 5DMYA 2ZJSL 3UEZA 3P0VL 2P24A 1CFSB 4U0RC 4Z77A 4OKVA 1NBZA 2R1YA 1JMXA 4LDLB 1JNLL 2NX5B 2R4SL 4U3CA 3NZHH 2A73B 3WD5L 1JF6A 4M6MH 4MCYA 4ZXBC 1YN7A 2ORBL 3IAQA 4WW2F 1S9YB 3BP6B 3DSNA 4P5KA 2MHAA 4W6WB 5IVXB 2MQCA 1PEWA 1DLHB 1HEZA 3B9EA 5DJDB 1OAUH 4XHJD 1NLDL 3S88H 1HYRC 1RUAL 5FKAA 3AXLA 3FQRA 1D5ZB 4MQXC 4Y4FB 3S36H 3JTTB 4JFQA 4JPIA 5HVHB 1AI1L 2DICA 5JXEC 2VL4A 3JWDC 4CRPA 3U46B 5ICZB 3RDTB 3QXAB 1ZLSH 2DQJL 4QY8A 4JEGB 2HP4A 4EIGB 5HDQL 2VXQL 3L6FB 4Y16A 3ZHDA 3I3EA 1FE8H 5IW1A 4MNGA 4Z6AT 5CUSH 2BSRA 2OZ4H 4OZGF 1NAKL 2P8MA 3KPMA 2BVEA 5EC1B 1LWRA 4KI5F 4P23D 5K59E 3FB8A 3UTZA 2IALB 2R29H 2DOCA 1CICA 3BGAA 3V2AR 1OARH 1RMFH 4PRPE 5C92A 4TUKH 3WO4B 1MFDH 2QLVB 2A6JB 4F7MB 3LKQA 4TOYL 1CCZA 4PJ8D 1BM3H 5FGBC 4OIIL 5F89B 3HC4L 4NFBA 4AYFA 4OV5B 2HJLB 4PB9H 3ARQA 2PYEB 3L7EA 1RJZA 3PGCB 1JUFA 3D39D 5I2IA 4XBGB 5SWZA 2QJDA 1NL0L 5IJVB 4PTTA 3WFCL 1DQQA 2JF1A 4LDOB 5I15H 4DGIH 1FYTE 3FQXB 4LP4A 4UV7L 3SKNB 1WWCA 4AK1A 1HZHH 4HC1L 4N9OB 4WI4A 2MTPA 4YHZH 2VLKA 1JPST 4LHUA 2UZIH 3O3EB 1MCJA 3BIBX 4N90E 4KUZL 5EUOB 3RKDC 4Z7OF 5JIIA 4K94H 3QP3A 4V1DD 2NW2A 2VITA 1S9XA 3EOBA 2BVOB 5I74B 2Z8RA 3MV01 3CSGA 4U1HB 1HQRA 3A6OA 3QQ4A 4HZAA 1U93B 5HY9B 5LKNA 4TPRL 3BYTA 4LSRH 1QZ1A 3T0VA 3I6KA 2A0LD 5F1IA 4ZFZA 4NO5A 1HINH 3UTSB 3QQ3B 3VI4F 4IRZL 2NNAA 4NO0B 3MRMA 4OI7A 1BOGA 2NY0B 1B6UA 1GPOL 2EEDA 3PL6D 2WBWB 3GIZH 1DN0B 3PABA 5EC2B 3PWNA 1K85A 3MRJB 4HUXB 1T89C 4OFDA 2HRPL 3QQ9C 4YDIH 4WI7A 4ZFOL 4RBPH 1BQLL 5I18H 3I3BA 1R24B 1GGIL 3EJJX 2OYPA 4XH2B 3T1FB 4LCCB 2N4IA 4RA0C 4YHKL 1BQHG 3EO0A 1JYXA 3HC0A 2D9QB 3FOMB 2RR3A 3MOBH 4ZUUA 2BJMH 2QSQA 4PYHA 1ZA6A 1YECH 5JW4R 5DK0B 1U8OA 2X1XR 4MWFA 1F3JA 1U91A 3QUYD 4XNYH 3SGDI 1ZGLM 4CN4A 1A6UL 1UH4A 4FFYH 1NAMB 2J8HA 2NY1B 3HUJE 2YPKB 5LXGH 1TIUA 4R9HA 1DSFL 1KN4H 3GNMH 4LRNH 2VQTA 4HK0A 4U1NB 3DO3A 3TYGH 6FABL 3QDJA 3I6GB 2KBGA 4JPWL 3UTTE 5EOTA 1HI6B 3OKKA 1EJOL 3ESVF 3D87B 3HI1A 1PGRB 1PLGL 2NX5D 2VLJB 1AO7B 3ULUD 2ZCLL 1KJVA 1LNUA 4O00A 4ONFL 4RIRA 4R4NC 2BNQE 1L6ZA 4JPVH 4HKXB 1RZGB 4HUKB 4PTUA 4JFPB 1FNGA 3ARGC 4NYLA 1MCRA 4Q2ZA 1V3MA 43CAA 1YYMH 2O26U 4PJEA 5D1XB 1A0QH 4BQ8A 4LVHC 3RBGA 3RWJB 5JLZB 1UA6H 2Y72A 3QHFH 4NNYB 5DC4B 3N1FC 2RFXA 5DK2A 1KCKA 3WFDL 3FZUD 1XF5A 3GSUA 5JA8B 1I9IH 2GCYA 3DX7A 2E7MA 4LPTA 3MFGB 4UT9L 3CLFH 4AMKH 5HHVH 4JRWA 5F7NC 3RDTD 1MIMH 1PG7W 2AQ1A 2GUOA 2QSVA 3D69A 4GRWB 4HIXL 3RZCC 5GRJL 4MVBD 25C8L 5FO8B 3DYMA 2IMNA 4Y19B 4RQQA 3G04A 3W81A 1U8QB 3FFDA 4GSDL 4ZS6D 3ARXA 3H6JA 1D9KC 4MA7H 4YH6A 5IFHL 4XPHH 3ES6A 2NXZC 2UVFA 5T3ZD 4JREC 4OZHE 2JELH 1UB5A 4X83A 2B4CL 4GG6F 4OFIA 4X7TA 5KSUB 4G8GE 3VXQB 4DTGH 4BELD 4GG8B 3AGVA 5A16B 1SYSB 2PYED 3VI3E 1WZMA 4P3DB 1EHAA 5TDOB 2GYSA 1JK8A 3GRWA 3GI8L 2HWZH 5F9JB 2W65B 2YN5A 4G8FB 4P99A 2G5BA 3UZQA 4J2XA 4TUOB 3BZDA 3NA9H 4AL8H 3BH8A 2YA2A 5CKGA 8CGTA 2JE8A 5EPMB 1CF8L 2APXA 4NNPH 1WZ1L 1IGJA 4POZC 1YY8B 2XQYG 5D71H 3NPZB 3HE6C 2QADB 1DVFC 4MJIB 1T66C 3CXDH 2VDLH 3X11A 5I17A 5K33A 2LV4A 5CWSB 5DJXB 5DJ8B 2AJZA 1QFWH 5LGKA 1SYVA 1YJDC 5FKPB 5EZLA 3ZE2E 2BVUA 1YEEL 1AH1A 3TA3B 5B8CB 3UTSD 4Q0XH 3I2CH 2XIDA 1X5JA 2AJ3A 2NY0D 5LGHL 2OBGA 2PO6D 3EFDL 1MCPH 5EO1B 5I1IH 5EBMA 3VE0A 4C4KT 3MRKB 4S2SA 2BRRH 4UIKL 2O5XL 2PR4H 4RSVA 4Q9CA 3MRHA 4ODSH 1FGVL 5GHWH 4AY0A 1SJEB 2BFVL 4FFVC 3KLHD 3CZJA 4YXLL 3HTLX 1O5DT 2JJSC 5D7JD 2FB4L 4XRCB 3HAEA 4LIQH 4IRJD 1FN4B 1A1OA 1QD0A 2NYYC 4F15B 2X6MA 4LKXB 3G9AB 1BAFL 4I2XE 5C9JA 1XGRB 1P2CA 1FH5L 1O7SA 3P30L 2XKNB 3P73B 4O02H 4X98A 5F21B 1OL0A 1MCIA 4GKNB 1CGSL 1LO2L 1SBSH 4PYGA 5MERB 5E2VL 1CIUA 1KCLA 4I0KA 3G6AB 2Q1EA 3ZZ1A 5DQJB 3BKYH 4YQXH 4S1RH 1CFBA 1ZS8B 2WIIB 2NY1D 5C09E 4ZG1A 4PG2A 3I02A 1T2QH 1I1AC 4P57B 3MLZH 4KH2A 3NCJL 2FGWH 2VXVH 1KACB 4JQVA 3ULVC 1RZJH 4M93C 2V9RA 3C5JA 3DHMA 3T77B 4R90L 3VFGL 1I4FB 3OR6B 2J88L 2P5EA 4RFNB 3SE8L 3VG9B 3ZHKA 1HSBA 1GOHA 3SO3C 3T2QA 4NRZA 4D0CA 4ZTPL 1AO7D 3AY4C 1KCVH 2X10A 3CFEB 3I50H 3A67H 1S78C 2P4AB 2H41A 2APBA 2EZ0C 3B6SA 3U0PA 5KW9L 4NWTL 4I3RL 5JMRA 1QLEH 1RK1A 4CAGA 1MFBH 1NC2A 5E2WH 2NQCA 2H3NB 3HI6L 4MA8H 4PLOB 4JO2L 5IMKA 3QULA 3L3IB 1L0XA 1U8IB 1F58H 3TPUA 1P7KA 2DIJA 4P5TB 2BSSA 3EYSL 3DGGB 4XP9H 1PFCA 2ADIB 4YHYB 5E2JA 1FFOA 3JVGA 5C08E 3TBWA 1J1XH 4KQ4H 2GITB 1C12B 1QA9B 3KLSA 2DDQL 5L2JB 2KQNA 3NCEB 1MWAH 1VADB 3HPLA 1D5BB 1BD2E 3ZSSA 2A77L 1A7OL 2YD1A 1FG9C 4IOFD 2D9CA 1BGXH 4X5LA 1QBLL 2APVA 2M1KA 4LLVB 2R0KH 5D93C 4U6TA 1VSCA 4IS6B 1G7HA 1DEDA 3OKNA 3OKDB 5KZCB 2OQJA 1HILB 4TUJA 4OUUA 2J6EH 4TQEL 4QRRE 3WV0A 3OJVC 5INCB 5BCAA 3ZKXB 2WQ8A 1Q94A 4LSUL 3BZ4B 1ZK9A 4PJ9B 1ED3A 4F7CB 3IDXL 1ITBB 5I8EB 3BP4A 2ED7A 3OR7A 4P2OB 4NZRH 5K9QI 4KJYA 5E8EA 5BO1H 2V2XA 1DQJA 3VFNB 4W81A 3ULUL 3QH3A 2AJXL 1G7LA 1LP9E 2L0DA 3RPIB 3LKSB 4XVTH 2VDRL 3C60A 3GSQA 1N3NB 3G5XB 4YO0B 4MXWH 2X9XA 4TRPL 4H0HB 3GSOB 1DE4B 3WIFA 1CFTA 3QNZA 5F6HI 3C8HA 4IRSC 4ONOA 1FL5A 5A3IC 5JOFA 2ICCA 3OPZH 3VG0L 3V52H 2XZQH 4L8SB 5FUCC 4P23A 2HFTA 2IBZX 5E2UL 5FYLD 3KJ6L 5BZWA 4MJID 4BKLB 4JZJB 4MDIA 2H1PL 4S1QL 1U92A 2DWDB 2YD7A 4P3CL 3NPSC 4RMSA 3TT1H 4OLWL 5IEHA 2D4DA 1ODAA 1Q9WA 4MA3B 4KMQA 1YJDH 3MLRH 2DMKA 2IH3A 5DLML 2ADFL 1TJHL 5CBEB 1JN6A 3AM8C 5CZVH 1TZGH 3TA3D 1I1FA 3I85A 5TDPA 2P5WE 3RVVC 1A6ZB 1HYSD 1TZHB 3L9RB 1MF2L 1MCSA 4ONGL 1MEXL 2YC1B 2APWA 5DMKA 1RK0A 3L95B 4AT6B 4QCIB 3MNVA 1QRNE 1UFUA 1H15B 2E6QA 3L1OH 3PGFL 2VC2L 2NR6C 2IH1B 2QSCH 3NCCB 5I1JL 2ZUUA 2VLLB 2BMKA 1HHIA 2C1OB 1EBPA 4F7EA 3FFCE 3GEWB 1LGVA 4K23L 1E6JH 1FRGH 2D7NA 4V1DA 3TO4A 4CMHB 4HJJH 3LD8C 2OP4H 1B4JH 2IQAA 4WV1C 3FQNA 4C59B 4NQDE 1A3LL 3BE1L 3EO1A 3V95A 4BQCA 1JZ3A 4KWUA 2FHFA 4M6OL 4N8VB 4CVWA 1B6DA 1AD9A 1C08B 1A7RL 4KI5C 3VFRA 3FO0L 2DQDH 2FNBA 1RJCA 2W9EH 4YIQA 1EHXA 4WU7A 4Z18A 3T0EC 2DQTL 1NGQH 3A6BL 4OF3A 3ULVH 3B9DA 4JM2F 4WHCA 4Y1AA 3O8XB 1KB9K 1SJVA 4NZJA 2EXYC 4RGMC 3VRIA 5I75B 1YZZA 4QT5A 3MLTB 1Z9OA 1NMCC 1FV1A 4QYOB 2AEPH 2GSIA 3HFMH 1T1ZA 1IRAY 3QIBB 4FS0A 3BAEH 5I0DA 4LSVH 3KPRB 1RZIB 1IZJA 4IJ3B 5DD5L 4BFIA 3OF6A 4P5TD 2BVYA 5DJYA 3WNPA 3R06B 4BZYA 5HHOE 1YPZE 1QR4A 5DQ9B 2IAMD 1NLBL 2Z92A 4N0CD 4LPUA 1I85C 2DQGL 1G7IA 4AENB 2EDWA 5GS0C 1KFAL 4HKZB 5FDYA 4LIQE 4GAGH 2ADGB 2X4RB 5DA4A 5AWNH 2F8VA 5IQ7H 4QGTA 5HHPB 1BF8A 1H5BA 1LDPL 5DVMA 2NX5A 2IWGA 4RMWA 3O2VH 3H3PH 3BPOC 4QXWA 5MHSE 5F9WC 2A73A 4M5ZL 1M71B 2DKSA 3RA7H 3S35X 3PXJA 1IQWL 1JNJA 3ZKMC 1KIRB 4K07A 3G6JF 3ILQD 5LBSH 2EIBA 4OZFB 1S9YA 3BP6A 2DAVA 5AAWA 3MBEB 2JCCF 4O58L 1DLHA 3MV8B 3N1QC 3WL9B 4KFZC 1CK0H 5DJDA 1YC8A 5J6GB 1W0YT 3MRBB 2Z8SA 1CT8B 1E4KC 2XY1A 5FYJD 3G9VA 4WFHD 4P2OD 4YDLB 1D5ZA 4Y4FA 1MVUB 3JTTA 2D0HA 2YPLE 4HUMB 1EAPB 2AEQH 5CJ8A 3TNMA 3U46A 1VFAB 5DEFB 5IESL 5ICZA 3RDTA 2F54A 3QXAA 1U58A 3G6DL 3VCLB 3CGTA 4Z9KB 3ZKND 1OGAE 3C8DA 3L6FA 4UILL 2PTVA 3KYNA 3TM6A 4DW2L 1RD6A 2NTFB 5BJTB 3EDDA 3X3FL 1WLHA 1EEUA 1LO3H 5KSAB 3IGAB 3HC3H 4OCLC 4HXAH 1RVFH 4JCMA 4XWOC 5FHBH 1BWMA 5EC1A 1JHLH 4XAWL 3EDKA 3O0RH 4JPKL 4NWUL 4MXVE 2YXFA 4OFPA 4WWKD 3WUWG 4F7MA 5C0RL 2A6JA 1SQ2N 5E94B 5KS9E 5B4MD 4ZUTB 4I8DA 2IG2L 4LFHG 4KK6D 5F89A 4MYWB 1OW0A 5HI4C 3MOQA 2HJLA 2PYEA 1TVBA 2SEBA 2YZ8A 5F6IC 1L7IL 1CLYL 4JFDB 3PGCA 1A3RH 1MJJB 1U8JB 3GKZA 2GJZB 4NQUA 5IJVA 2R23B 4X99B 1BECA 5CCKL 4FQPA 1HIMH 3FQXA 1LO0H 3SKNA 1JWUA 4HWBL 1G0XA 1MCHA 2PTTB 3MJ9L 1QBML 2FJFA 4X7SH 4JKMA 5E95B 3T0DA 2AGJH 4G6AD 1J0ZA 1UKSA 3O3EA 5EUOA 3ROLA 1TZIA 5GS1C 4LLMA 2JKXA 4Z7WF 4KHXL 4OB5L 3HMXH 1KB9J 5I19H 4ODWA 3UTPE 5HD8C 5DEZA 2R0WL 1C1EL 4GW1B 2BVOA 3VXUB 3QRGL 4U1HA 1FIGH 1CDHA 1UJ3C 3FAWA 1KBGH 3IAPA 5HY9A 4Z7VE 3PJSB 1CXLA 1WWAX 3LPFA 4DK6A 4L8BB 3TBSB 4M7LL 1G6RB 1ZGLP 1Q9OB 3QQ3A 1AFVH 3F7YB 3IF1B 4NO0A 2BC4B 2HVKB 1CZ8L 2F58L 4Z95L 1QYGH 4CADB 4Z0BL 3SDXF 3OHXB 1BFTA 4Y8AA 3X3GL 5DT1H 5GZOD 1JFQL 2YEZB 2XACC 5D5MB 4RMQA 5FIEA 4JKWA 3GBML 3HE7B 4DGYH 3O8XD 4M8QB 4X4XA 2ZUQC 4XH2A 3T1FA 2XQYK 4LCCA 3BXNB 5FM5M 1U95B 4KDWA 4ODHL 3NGBC 3JUZA 4M7KL 3GB7B 3ROOB 3O3DA 2Q87A 4OZIE 2H32H 4X80L 3FOMA 3DROB 3KPRD 4JY6A 3SKJL 3GHBH 5L6YL 4WFEE 4C57C 3QZWG 1RZ8B 4KTEL 2DWEB 2Y06H 1JZ5A 1M7IB 2FECL 1H3PH 5DK0A 2WUBL 1MJUL 1Q0XH 2YD3A 1MRDH 2D7TH 5D7LE 4FMFA 1F42A 3QDGE 1OQXA 4NM8H 4Y2OA 3DSFL 5GGQL 5GS0H 1LEKB 1M4KA 2YPKA 4UBDC 1OWRM 1R5IB 4U1NA 5FUZL 3WUWB 3VFSB 3I6GA 3RWCB 1HI6A 1UKQA 4I1NB 4Y5XB 2Q8BH 3QPQD 2WBKA 3OKEA 2VLJA 3QIWC 1E4XL 4MD5B 2G2RB 2YA0A 3T0AA 3DUUB 5GGUB 1RZGA 2JTDA 4JFPA 3MBED 1XMWA 3WFZA 5D1XA 1AGCB 3RWJA 2P42B 5JHLH 1D6VL 5JLZA 4Y16C 5CP3H 3ULVE 4NNYA 5D70H 2X44D 2C7UA 3DXAE 5CSZB 1AHWC 4YHML 4XWGH 5CMAA 5E1AB 2NCMA 1ZE3C 4TNWK 1BFOB 1QLFB 2AJVH 1J86A 4ZNEE 3MLUL 2OI9C 2DM2A 2VDKL 1EZVY 4UAOB 4PRPB 3TIEB 2CK2A 2HT3C 1B2WH 4EI6B 1YNTB 3V5HB 1ONQB 5AZ2H 4F7TB 3IDYB 4MD0B 5IB5B 1YDPB 1WAAA 5DHVB 4Y19A 1QQDB 3X14B 5KSAD 5J7CC 4ZTOH 1U8QA 3RVUC 3LQAL 4X6DA 2ESVE 4AH2B 1LE9A 4G9FE 3S6CA 4HLZG 1F13A 3BN3B 1GRWA 3V8OA 1FNSH 3O6LL 1JGUH 1DLFL 1YQVL 1FYTB 2EDTA 2PW1B 3MR9B 5KSUA 2F74B 1U8NB 4G8IB 4U31A 1JNHB 1MCFA 4PJHE 4GG8A 5A16A 1BVLB 1SYSA 4X6CB 3QWQB 4P3DA 5IT2H 4XVUD 5TDOA 4GLRI 5F7FA 3N9GH 2W65A 4G8FA 4PJIF 1OAXH 1XF3B 4TUOA 1NMAL 5EWIH 3UBXG 4X6BB 4KJQC 3LRSB 1LE5B 3E2HC 5DUPH 1C5BL 1JWSB 3WLBB 2J8UB 1I7RB 3ULUF 1GH7A 2IANE 5BRZE 3U9PH 4UDUB 4MJIA 1A6TB 3ZDYE 2FHBA 4Y88A 3ZKSD 2OM5A 3N1GC 3T0XA 2CR6A 2YPVL 2E9IA 3WIHA 3F6IA 3ARSA 4UTBL 3VXUD 2ZUWA 4NQEE 1YMMB 5CWSA 5DJXA 4JFYA 5DJ8A 1ZLVK 3CVHL 3HG1E 4EQ3A 2B0SL 5T1KD 4YHOL 1FAKT 4TTGA 3CK0L 3TA3A 5B8CA 2UY6A 1N5YL 1QSED 2FJHB 3CFBB 4P49A 5IB3B 2HMIC 4K7FB 4MNQA 4OF8A 5EO1A 5L9DH 3UJTL 5IFAH 4OLXL 1CD1A 4LGRB 1OPGH 2W07A 5HPOA 1ACYH 2CO7B 1ZHNB 5ADOL 2HFEB 4Q6IB 1SJEA 3HE7D 4BYHA 4DKFH 3HMWL 5DJ6B 3SJVE 2AW2A 5DDHB 4L4VE 3DRQB 4OLZL 1FN4A 3HUJB 4NJAH 3R4DA 3DJ9A 1Y18B 2DLFH 1M1SA 1RQ5A 1XGRA 1YEJL 1MAML 2XI9A 4J6RL 5FO9B 5FA3A 2VH5H 4FQHA 1ZT7B 2DQHH 2KZWA 2XKNA 3P73A 3UTTB 3RJQB 3GSNB 12E8L 1EPFA 4GS7C 4GKNA 4FFWD 5B3JF 5MERA 2J4WH 4JKPH 5IF0B 3KWWB 1HHGB 2F5BH 3C9NB 1IEHA 1ZS8A 2WIIA 4XPGH 1AY1L 5B39B 4UOJA 3ZYIA 4P57A 3H42L 4JDVB 3T77A 4LEXH 1HKLL 3RRQA 5I8CB 4R8WH 3BPCA 4XX1G 4L1HA 3U82B 1IAIM 2LVCA 3OR6A 2CK0H 2ZUTA 1UWXH 4LFHD 4OZGE 1MPAL 1AGDB 1ZKAA 2E6JA 5L0QC 4DAGL 2EYRB 3SN6N 4KI5E 1CFQB 1GZQB 5GISH 2W9DH 4QRSB 2ZOKB 3LV3B 3T0EE 3VXNA 3L3IA 1UCBL 1U8IA 5GGVH 4ODXB 4P5TA 2VQUA 3DGGA 4NO3A 2ADIA 2AJUH 1EAJA 1BBJB 4XNXL 3DMMB 4E41B 2GITA 1QA9A 2QBWA 5DQDH 3QISA 1PZ5B 2H9GB 5D96C 1D5BA 1QOKA 4PRPD 3H9HA 4JGJA 4OZHB 4UQ3A 1IC5H 4WU5B 1KOAA 2ICWI 1J12A 1T2XA 4G8GB 4LLVA 5H37H 2E7CA 3ZTNH 2X9YA 4IS6A 2WINB 3GSVB 4JY4B 1GC1H 4Z7OE 2FX8H 1HILA 2I07B 3EO9H 1PG7H 1A64A 4KMLB 4PJXB 1Z9MA 2NZ9D 5INCA 5JOPE 1FYTD 4KHTL 5EA0L 2YUVA 3TIDB 5T3XH 4PJ9A 3LEVH 4F7CA 5I8EA 2HT2D 2CIKB 2AQ2A 5F7EL 4CJ1A 4N90D 1E6OL 3VI4E 4HSQA 3B9KC 3MUY1 4CKVX 1UADC 1H0DB 1KJ3L 2PW2B 3S37H 1MAKA 4EXKA 5J1AB 3W0WE 5T33L 3RPIA 3LKSA 2BHYA 4LL9A 1UWEL 1XF2B 3G5XA 4XNZB 4YO0A 1DE4A 4JB9H 1EVUA 5CEXB 3IFLH 3RWGB 5JIHA 5SV4A 1ND0A 1FBIL 3V4UL 4LU5H 4C58B 1S5HB 5C0ND 4J3XA 3ORJA 5H35B 3QDAA 2L4OA 3QUMH 5CJOL 4BKLA 5I1HL 5C7XL 4JZJA 4XVSH 4RDQG 3ZTJH 4P2QB 4ZYKB 3SOBH 4QEGA 1OCWH 3F58L 3KYKH 4O9HL 1YMMD 4JO1H 3RX5A 3WDJA 2C3VB 3PWJB 4MA3A 3U7YL 2EXWD 3MACL 5DMGC 1CBVL 4BH7B 4IBLT 2XRAL 2ITCB 4YHIA 1A6ZA 3L9RA 3VXTB 4M1GL 2YC1A 2ZJSH 4LOUD 1TXKA 4YZFF 3P0VH 3L95A 4KKAD 4QCIA 4I3SL 3Q5YA 3WXVL 4R2GC 1JNLH 1GJIA 2AI0L 4FQJL 1A1NB 4FQQA 4JR9L 1H15A 1AGFB 2R4SH 3RPKA 4WW1B 4BA8A 2IH1A 4N5EC 2FR4B 2VLLA 3WD5H 1A1MB 1GHFH 2C1OA 3UDWA 4OQTL 1DFBL 2ORBH 2VUOA 1TJIL 3MV7D 3GRWL 3ZT7A 4PG2C 4WUUE 2PETA 3D2UB 1NLDH 4JQVC 1FAIL 5D1QB 1AXIB 3RNQB 1RUAH 4WGWB 1DUZA 5C0CA 3GMNA 4N8VA 1AI1H 1X5XA 1C08A 2FZ3A 3LMJL 4UT7L 5CGMA 3JUYA 1F4AA 3NMEA 3C8KB 5C0AB 1D5MA 3DV6B 4JVUA 5HDQH 2VXQH 1HKFA 1G6VK 3WIIL 3WJJC 1ZT4B 1QPPA 2V7HB 1NAKH 2LE9A 1W8OA 5JHDB 1JI2A 4XNUL 3EUUA 3S4SA 5FYKU 3MLTA 3U9UB 4JGMA 4U7SA 4QYOA 3KS0H 3O3AB 4A2LA 5DSCA 4Z7UB 5CKAA 3BGFC 4TOYH 3VXMD 3QIBA 2CLRB 3KPRA 1RZIA 3ABZA 1R6VA 2CKBL 3MROB 5GRYA 3QEGL 4OIIH 5EU6B 3HC4H 3QUXC 4GG6E 2GY7B 1LMKA 3R06A 2GTWB 1JIBA 5DQ9A 4AENA 1NL0H 4E41D 4KI1A 3WFCH 1K2DB 3EFFB 4HKZA 2QSTA 4UV7H 2ADGA 2X4RA 4HC1H 4QRRB 1YEHL 4PJAF 4RAUA 3NVQA 3JWNC 3ARDD 3MRFB 3KPOB 5HHPA 1UG9A 1FNEB 4XHJC 4KUZH 4FQXB 4G8GD 3UP1A 4PJ7F 4PJFA 5C71A 1T4KB 2RB8A 3JXAA 5A2KH 5FEBA 3T04D 1MCNA 1KIRA 1WWWX 1F6LL 1RU9L 4OZFA 4WHYG 2Z91B 4ZXBB 3MBEA 4MSWB 5IBTL 4TPRH 3QQNA 2X9WA 1XGTB 2JK5B 4M48L 4XP6L 3MV8A 3WL9A 5EFIB 3RFZC 5J6GA 4P46D 4U6VL 3MRBA 1CT8A 2AJSL 4NO2B 5GXBB 1FFPB 5D2LE 1J05B 1MVUA 2FO4B 4MNHA 4XNMB 1GPOH 1EAPA 3UYPA 1VFAA 4P23C 5DEFA 4WO4B 4TVPL 3DARA 4XXDA 3CIQA 2NW3A 2HRPH 4LARL 4PJ8C 1BQLH 2DQUL 5HSFA 5BJTA 1GGIH 3L3OA 5J13C 5KSAA 3IGAA 1MNUL 3PP4L 1IQDB 5FO7B 2BSED 3PF2A 2LQRA 5J11C 2P5WB 3OXSB 4P2QD 4KXZH 3DVIA 1JVKA 3OTTA 4ZUTA 3BIAX 1V3JA 3CC5B 1BFSA 2QQKH 4DFHA 4RMVA 5F1NB 1A6UH 5I76B 5HI3D 1XT5A 2CPCA 4JFDA 5AYQA 1MJJA 1U8JA 3FFCB 1DSFH 4D9RD 2GJZA 5I1KL 2R23A 4X99A 1MJ7L 4ODVL 6FABH 5DA0B 1OGTB 4JFHE 4R7DA 4NQDB 1EJOH 1OP5K 3QDME 5E70A 1AGEB 1PLGH 2ZCLH 2FL5B 5E5UB 5C6TL 1IGYA 3ZLQC 5J06A 2A0LC 4ONFH 1IAOA 3LRGA 5DVOA 3BMWA 4MB4A 4OCRL 2R2EB 4JDZB 5IW3A 3PL6C 4GW1A 2R9HD 4ZOCA 2LAAA 2P47B 1SJHB 3QUKB 4FQCL 3CU1A 3D2UD 1KLGA 3PJSA 5D1QD 2DIBA 3WFDH 4JRXB 3TBSA 2RAMA 1BVZA 4GLRH 1E4WL 1G6RA 2C3WA 2D0FA 3F7YA 3IF1A 2BC4A 1MRFL 5D8JH 4D94A 1BVKB 4UT9H 2VMFA 4WDIB 5KANG 4CADA 1OAYL 3H7LA 2FWOB 1T21B 3OHXA 1MREL 5C0AD 1I7ZA 5AUMA 2YEZA 2K3TA 25C8H 5K9KA 3PIQA 5D5MA 3BPNC 2R0ZL 3TN0B 1MY5A 2HTLD 3OG4B 4X9IA 2VL5B 4R97B 5T1DH 4GSDH 5JHDD 3AFLA 1GVIA 5HHOB 1YPZB 5CJXA 4M8QA 3QUYC 4NKIL 5IV2A 5IFHH 2A9ML 3AC0A 4H1LG 3F7VB 3STLB 3BXNA 1ZOXA 4PJCE 4TNWF 5FOBB 2A1WH 3GB7A 3O6FB 5ESQB 2W1NA 2B4CH 4CDHA 1ZVYA 3DROA 3LOWA 2ATKB 5EU6D 3AS3A 2NY2B 3LPGA 1M7IA 4WENB 3S9DB 3ULUC 3JZ7A 4U1KB 4LNVA 3RWIB 3GI8H 1CR9L 3G08B 4QRUB 2DMCA 1X5LA 1LEKA 3BPLC 3CCHB 3AU1B 3DYPA 3UO1L 1CGVA 1IM3A 2UZYB 4XCEB 1CGYA 2YKLL 1CF8H 3W11D 1WJ3A 3C09B 3VFSA 2FGZA 3TGXA 3D0LB 1NUGA 3RWCA 4Y5XA 4FQXD 5BQ7B 1HSAB 3FZUC 4I18C 4XI5D 2G2RA 3U4EB 3KGRA 2XZZA 5HVHC 1WZKA 5K9OB 1A4KB 1MI5E 4M6AA 3RDTC 4FG6D 4O2EB 4O2CB 2Z9TA 1GOFA 3GSXB 4F8QA 3ARGB 4K7PL 1AGCA 1OGAB 4MVBC 2GI7A 2I25N 4PREB 1YEEH 2XT1B 4PGEB 3LZFL 2FECI 5LGHH 4PY7A 1QFUH 4XVJL 3EFDH 5E1AA 4ZS6C 2X42A 4Y8DC 1BFOA 1OTTD 1QLFA 3QXTA 2ITDB 2FIKB 4UIKH 2O5XH 5IUSA 4WO4D 4PRPA 3C6LB 4WRLA 1M05A 4GO6B 1MWAB 3WO4C 5KS9B 2VIRA 4EI6A 1JJUA 3V5HA 1FGVH 3VD5A 5HGHB 4IMKA 4F7TA 1OP9A 3FQWB 3DNKA 2BFVH 5IB5A 1YDPA 5J12B 4ODBD 5DHVA 4YFLF 1T1WB 4YXLH 3X14A 4MAUL 2VZSA 3UZVB 1FNAA 3U1SL 2FB4H 5E24E 2FATL 3LS4L 4OF0A 1FL3A 1VB9A 1DBAL 4FTVD 5DRXB 3E3QC 4KKCD 1BAFH 4UI2A 4OD1L 1DUYB 3AAZA 1FH5H 3P30H 1GGBL 4M1DH 2NXZB 2O61B 1FYTA 2PW1A 3MR9A 5TE6L 3FKUS 1UZ8B 4IDJL 5DTFB 3WHXB 4URTB 1CGSH 1LO2H 3RVXD 2F74A 1U8NA 4UNTA 4G8IA 2VDQL 5E2VH 3BHBB 3V4VL 1BVLA 1NEZA 3CX5K 4XPTL 4YNYB 2DL9A 3FFCD 5IJKC 3NCJH 1XF3A 5FK9B 4N0UE 5I74C 5DRZB 4X6BA 3LRSA 3VFGH 1LE5A 1F11B 4NQDD 2J88H 1WEJL 4Z7VB 3SE8H 1JWSA 4ZTPH 1I7RA 1JV5B 4LQFL 4UDUA 3SDCA 4NWTH 4I3RH 5ECJE 5KW9H 1VFBB 2NY0C 2P8PB 3OXRB 1EGJL 2PO6C 5D2NC 2X4PB 3T2NL 5I1EH 1DVFB 3HI6H 1F4XL 5HGDA 4JO2H 4KUCD 4W4NA 3NFNB 4D2NA 1U36A 5AAMA 3BW9A 3EYSH 3HLAB 3W5MA 2BOBB 4KDTA 1ZLSL 4RGOL 1MCLA 4MQTB 5C0BB 4Z7QF 4JRXD 5ESAB 2O93L 4QXGL 4LHQB 1UYWL 5ID1B 2DTSA 2DDQH 4Y5YC 2FJHA 3CFBA 4JVPA 5D7JC 3MNWB 1FE8L 1X6NA 3GKWH 2FRGP 4IRJC 1XZ0B 3NOIA 5DC0A 4YHPB 2A77H 1A7OH 2GEEA 2WSKA 3U0WL 4OZIB 3SGKC 1QBLH 4PRAB 2EDNA 4O5LL 3TN0D 5EIIB 1ZHNA 4TUKL 3I75B 1URLA 4KTDL 3B8YA 3D3VE 4WEUD 2DI7A 5HHOD 1U6AL 5DJ6A 1IC4L 2VN4A 5D7LB 5DDHA 3DRQA 4G9DB 1NCBL 1ROWA 3HUJA 2NY1C 2AEWA 5J0BA 2EIZB 3O6FD 5SWSE 5HXMA 4PV9B 1NMBL 4JQXA 1WK0A 4LSUH 3GBNL 1AD0B 1UKTA 2BHZA 1GGTA 2JCCE 5FO9A 5KVGL 3IDXH 4GBXB 3UTTA 2NY2D 2XZCL 4HIIA 4MAYD 5IF0A 3FCTB 1HHGA 3C9NA 1TCRB 3CNKA 5MHSD 1MFNA 2AJXH 3U2SA 2BNQA 4BQ6A 2VABB 2VDRH 2P1YA 2YMXL 3D85D 4TRPH 3QNYB 4HS6B 2YN3A 3UYRL 5DEGB 4MLIA 3MZGB 5I8CA 5ICXB 3VG0H 5I73B 4MJ2A 2ATPB 3DXAB 5I16B 5E2UH 5AG8A 1BQSA 2EYRA 4FZEL 3C6SB 4S10A 3L7FB 2H1PH 3MLSL 3BRFA 4S1QH 1CFQA 2C3HA 4P3CH 1GZQA 1YEKL 4QRSA 3HPJB 5BS0E 2FSEB 4NP4H 4U6YB 2ZOKA 3TP4A 4OLWH 3LV3A 4RA3A 1UVQB 3IDNB 2BX5A 2HA1A 5EO0B 4IOFC 3MCKB 4ODXA 1OGAD 2ADFH 3KPLA 5BW7A 4QRQA 1TJHH 2DB8A 4H0IA 5J1SC 4WEMB 1ZLWH 1BBJA 5HPMB 3LIZH 3DMMA 3IFNL 1MF2H 2ESVB 4ONGH 1JPSL 1MEXH 3PNWB 4G9FB 4KRMB 3CX5J 2H9GA 3C6LD 3Q0HA 4XTRD 4LQ1A 3VDBA 4OZHA 3PGFH 2VC2H 4WU5A 1PDKA 5I1JH 4G8GA 3T2PA 3TPKA 3I9GL 4PJHB 1YYLL 5CZXD 4K23H 2WINA 4N5UA 3GSVA 4JY4A 1NCNA 4Z7WE 5CJQL 2EECA 2I07A 1A3LH 1BBDL 3RX8A 3BE1H 2NXZD 5F70A 3NCYS 3TIDA 5LXGL 4LBEB 4M6OH 1KN4L 2CIKA 3GNML 3BGMB 1H3VA 3FO0H 2IANB 3RY6C 1OLZA 2ZG1A 1H0DA 2DQTH 3UTPD 3MXWH 2VDML 3KHOA 2PW2A 3A6BH 5J1AA 3BJLA 3GMPB 4NQEB 3SDXE 3TNNB 3QFJB 1CU4L 3HG1B 5CEXA 1H3WM 3RWGA 1NCDL 3ZE0F 1YUHB 3DX6B 3GJFK 2OZ4A 4ZO7A 3GSWB 1T5XB 3TA3C 5B8CC 5H35A 2MKLC 5F7HA 4OUOA 3Q6GL 3H9SB 5L7XL 1HYSC 4ZYKA 4MJ6B 4ONHB 1I9IL 3PDDA 5DD5H 2I26N 4LSSL 4L3AA 2R2BA 1G84A 1NLBH 2FIRT 5C0BD 1ZT1B 3B5TA 2DQGH 2HFGL 1LQSR 4JN2B 4K3JL 1XGPB 2E6PA 4ACPA 1KFAH 5CAYB 3SJVB 4L4VB 4QHMB 3OAZK 3MRNB 5E6IB 2ITCA 3VWJD 3BQUB 3QJHA 4NOFA 3DPBA 3T08A 3D39E 3PGDA 1CGUA 1Z2KA 4X9FA 4F15C 4WW2B 4I2XA 2CLVB 4P5MB 1M7DA 3FOLB 1A1NA 4JCLA 1AGFA 1FP5A 4WW1A 5BVJB 4LSQL 4M5ZH 2FR4A 3B3IB 1F4HA 1A1MA 1IQWH 2MCPL 2IBZY 5DJ0B 5C09A 5HVFB 3MLPA 2CQVA 2Y36L 3VH8G 3TF7C 5EZIL 3F12B 2IFGA 4O58H 3LD8B 3QWRD 1AGBA 3D2UA 2Q76B 1G7QB 2XNAB 5DUBB 3RNQA 2DQEL 4GBXD 2CD0A 4LPXA 5F7DB 1JTPA 3C2SA 3VXSE 4RFNC 5JOEA 3VG9C 2EDJA 4OZGB 4X6CF 4K9EC 1B0WA 3EIFA 1T1YB 3VFUB 3C8KA 3B2VL 3G6DH 1ULVA 4U1JA 3DV6A 4APQA 3WIHL 5GIRB 4DW2H 3BFOA 5F1SA 3U79A 3T0EB 4A6YL 3X3FH 2AK4E 1ZT4A 1VPOL 5CLWA 2V7HA 4O51B 3L3HB 3TT3L 2O5ZL 4P5TC 4KDVA 4LLWB 4GKOA 3SE9H 4KZDL 4ZFFB 4XAWH 2IAMC 3DXAD 5CD3A 4YHYC 3G5ZB 4JPKH 4N0CC 2VZ1A 3O3AA 2P44B 1EO8L 4UDTB 5C0RH 1H3GA 2MWCA 2FH6A 2K7QA 4KKLD 2CLRA 1MHPL 1EO5A 1CDGA 1XIWD 1BD2A 4AIZB 2DQCL 3MROA 3WSQL 1F90L 3R0MA 2H32B 3F5WA 3NCBB 1CL7L 3RWFB 3B5HA 1QO3A 1FG2B 2Y1VA 4YJZL 4UZGA 1L7IH 4YGVA 1CLYH 5I1LB 3W2DL 4PGZA 5CCKH 2ESVD 3FO9A 1K2DA 3EFFA 4G9FD 5GSVB 3ILQC 1KIQB 4QRRA 4HDIB 5IR1A 4HWBH 3MYZA 3MJ9H 1QBMH 5K9QG 1QFHA 2VZUA 2Z93B 1H8OA 3MRFA 4HFUL 4ZQKB 3KPOA 1FNEA 4X0KB 3WNMA 3IDUA 4FQXA 1AP2B 5FM8A 1INEL 4KHXH 3BD4A 4OB5H 4P2OC 2HRLA 1T4KA 1OSZB 2R0WH 3ULUE 2VZTA 1C1EH 1YMHA 3ULSB 4KJPC 3MRCA 3QRGH 3ZT6A 2Z91A 4MJ5B 3RVTC 5FOJA 4ZXBA 4MSWA 1LP9A 5A2LH 3W0WB 1XGTA 2JK5A 4U7KA 4YQXL 1EO7A 5DO2D 2AKRB 5EFIA 3DECA 5IVXE 4M7LH 1N59A 4NO2A 4POUB 1CZ8H 1FFPA 2F58H 4Z95H 3UROR 1XR8B 1CI5A 5T5NG 3FB5B 1J05A 5I1DA 4N1CA 2FO4A 4XNMA 3RY5A 1RUML 1A2YB 2IAND 4L8SC 4Z0BH 3OKLB 5BXFB 4QHKJ 2VDOL 4WO4A 3X3GH 4PRHE 4WWKC 1JFQH 5IBLD 1TNNA 1KIPA 3FN0L 3WKML 5B4MC 3QFJD 3GBMH 1IGCL 2EEAA 1U8MB 3L5IA 5BV7L 1KCSL 4KK6C 3VFTB 1T04B 2BY2A 5D7IB 5FECB 1UGNA 2UY7A 2WV3A 1IQDA 2R1WA 2W91A 5FO7A 3KPQB 4ODHH 4M7KH 1IAII 3OWEA 2P5WA 3H9SD 4JHAL 4X80H 3O2WL 5B22A 4PJGF 3IJHB 3SKJH 2X4TB 5L6YH 1NBYB 2DN7A 3OGCB 4KTEH 5T3ZE 2WUBH 1MJUH 1QRNA 2LAGB 1G9MC 2R69L 4JO4L 5L88L 3DI3B 1S7UB 3O6KL 3AS2A 3MUGB 5FGBA 2Y7QB 5F1NA 3BZEB 1J5OL 3MA7B 1MLBA 5B3JE 5GGQH 3DSFH 4RFEB 1S8DA 3FFCA 4L4VD 5F1KC 2ZWLT 3PG2A 3UDWC 4ELMF 5F6IB 5E6ID 2OTUB 3BQUD 3UPAA 5FUZH 3E3QE 3MRDB 1VFOA 5EG6C 4LK4A 1IFHL 4NQDA 4MQ7A 3IJSA 4R6UA 1LK2B 1AGEA 2NY3B 3ARBB 1BF2A 3IXTB 2OL3H 1A5FL 1E4XH 3ESUF 3KPPB 4HIHA 3UMTA 3D9AL 4NNXB 2NR6D 4N0RA 4EIZC 4FQLL 3ARFD 4BH8B 2R2EA 4JDZA 1KEML 1V8HA 3ZYOA 1DBKL 2H26B 1IL1A 5GZOC 1D6VH 4PRIB 2B1HL 3QUKA 1GIGL 3IKKA 5EBWB 3ALWA 2ENSA 3FTGB 4YHMH 3O8XC 2J3SA 1A3QA 1EDQA 1BVKA 4WDIA 3MLUH 1R3HB 2VDKH 3UTSE 1W72A 5J1TC 2FWOA 1EEYA 1K9TA 2W60B 5D2NE 4IDLA 3NABL 1A7QL 3P9WB 1T89A 3HRPA 2VL5A 3V9FA 4GMTH 4JFXA 3LQAH 5HHOA 1YPZA 3SCMB 5FYKL 1S7SA 1G9NC 4K3EL 3F7VA 3STLA 1QVOB 2JB6B 3MLRL 1AJ7L 2EXYD 4PY8I 1FZJA 1N5AB 3O6LH 3QXDA 5D6DA 1DLFH 3UPRB 5FOBA 1YQVH 3O6FA 4PJ5E 5ESQA 2Q6WB 3U0TB 4QRPE 1CTOA 2ATKA 4IMLA 1VESA 3QPQC 2ADJB 1U8KB 2PTUA 5T1LA 3VXOA 4G3YL 1ETZA 3QUZB 4DVRL 5FV2A 2X4NB 4U1KA 5GGRY 4Z78A 2J2ZA 1LO4L 3C2AL 5F8QC 3MZTA 3G08A 3L1OL 4HMDA 4U4BA 3V5DB 1NFIB 3CCHA 3AU1A 3ZTJG 1NMAH 1OF2B 2BY0A 1UENA 5CJ5A 4XCEA 3MBEC 1C5BH 1NSNL 3D0LA 3V6BR 4QRTB 1JI1A 2AXJA 3HZYB 3RIAK 5BQ7A 2CO6B 3BZFB 3DRTB 2CGRL 4HAFA 4YDLC 3UAJD 3U4EA 2YPLA 1AO7E 2YPVH 5C0EB 2DM7A 4LMQI 4UTBH 5K9OA 2IFFL 1A4KA 1CVRA 3CVHH 4O2EA 1U8LB 2M8XA 4X7CC 4O2CA 4TVSa 2B0SH 3TBTB 3BEVA 3W0WD 3GSXA 3ARGA 4YHOH 1OGAA 3IJYB 4PREA 3SDAC 1HH9B 4UT6L 1W2KT 4MDJB 4PGEA 3CVIL 1OAKL 1FJ1A 1N5YH 1MLCB 5KSAC 2V9QA 4J7RA 3IFOB 1AHWB 3N06B 4HWUA 3VXPB 3UJTH 2ITDA 2FIKA 2R2CA 4N8CL 4OLXH 3C6LA 2FO1A 5BZDB 3B43A 5KS9A 2CDEA 2V6HA 4YZFE 5C2BL 5ADOH 4WTZA 5F7UA 1V7ML 3FQWA 4UUJB 3RZCA 3HMWH 1T1WA 1J0HA 4YE4L 4HUVB 1P1ZB 1CXEA 2DQFB 4JAMB 1NGXA 4OLZH 3EYFA 2WMPA 5LAXB 3LKNA 4XVUC 5DRXA 1WVZA 3ZDXF 4Z7UF 4FQIL 1DUYA 1YEJH 2HVJB 1MAMH 2ZSVB 2J6EA 4XBEL 5INDB 3V5KB 12E8H 4AEIL 3WHXA 3QDMB 1KF9B 1WBXB 3BHBA 1EFXD 3VD9A 1F2QA 3CFKB 3VD3A 3WYRA 4YNYA 1INDL 3DBXB 1AY1H 5HI4D 1HK6A 3H42H 4R4FH 5FK9A 2CSPA 1HXMB 3JV4B 4WTWA 5MEOB 2L7JA 4A2MA 1HKLH 2VLRB 5IM7B 1JF1A 4RDQF 1F11A 4XNQB 4XC1L 4Z7VA 5MEND 1MPAH 2NY3D 3ARBD 5IMOA 3QG6B 5DZOA 4DAGH 3X12B 5JW3H 3PXHA 1NBVH 1P5UA 1QBAA 1VFBA 3OXRA 3HE6A 3QUMB 2X4PA 1DVFA 5DWUL 4EBQL 4H88L 2ZCKL 3NFNA 1UCBH