4OQFA

Mycobacterium tuberculosis reca glycerol bound low temperature structure iib-sr
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
328
structure length
310
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Protein RecA
total genus 97
structure length 310
sequence length 328
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4oqfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4oqfA01
1KI6A 2C78A 3U4QA 1ZU4A 4HSEA 2CCGA 1SHKA 2HJVA 1GITA 3QSYA 3BFKA 2B21A 2QA5A 5UKDA 1RJ9A 2FGJA 5CDFE 2GZDA 4WW0A 4C0BA 1QHSA 4EPTA 5E3HA 3B82A 3SU8A 2ORWA 4WVFA 3PQCA 1X1SA 4A0HA 3QEJA 4UJ5A 4R9UC 3C5HA 3KUCA 4OHYA 1U99A 4MGKR 1I4DD 3BRWD 2GEUA 3O8CA 1BS1A 5E7IA 5BQ5A 1C9KA 1Q1ZA 4W5HA 5GJBA 3B9QA 2VTKA 4B6EA 3NBZC 1NMXA 1YZLA 2YOFA 4BLTA 4FD2A 4IJMA 2BHRA 4D82A 5JRZA 2GBLA 4HAYA 4P4SB 1P6XA 5K8IA 2R62A 5GJVC 2IYWA 1CRQA 2YJTD 4LV8B 1OPXA 2YKGA 2XSZA 2QROA 3QKUA 4OHWA 3NXSA 2AN9A 1ZINA 3MWYW 2VHUA 3VQTA 4LC1A 3QXHA 3THXB 3RS0A 3D8BA 3AUXA 4QJ5A 1MO4A 4MKFA 1ZJ6A 4NYMR 2W0MA 1P75A 2IUSA 1UDWA 3AF3A 3H84A 4HEJA 1NKTA 3V00A 1KO5A 2EU8A 2NO7A 2PEZA 1YVDA 1NVWQ 2BCJQ 1CULC 1FNNA 2ZEJA 3ETLA 4ZKEA 4DCUA 5FTLA 3VX4A 4M1TA 2Z6VA 4OJKA 4CRWB 3EPLA 4K8OA 2E1RA 4DCNA 3UXMA 4QG7A 5DLQC 2B8TA 5B57C 3KJGA 2IEYA 4CT5A 4IRUB 4QJ3A 2R9VA 4N3NA 2JIZA 1TUEA 2RH5A 2DWPA 1GFIA 3SHWA 4XD7D 4PSVA 5H8WA 3LNCA 4A0RA 3QENA 1DAHA 5JS7A 2F55A 4BFUA 1ZW6A 4UNRA 1R6BX 2A5DA 3BOSA 3SJAA 2Q3HA 1RW4A 3T1VA 4DRZA 4PTLA 1XZQA 1KJYA 4KODA 4A0GA 2ZM5A 2OEPA 1A2BA 4H1UA 4NE2A 4GT1A 1YR8A 2C99A 3WP1B 3AVTA 2PH1A 1V5WA 2R44A 4N1AA 3LFUA 3OFNA 4DT1A 5CK4A 3FFBA 1E2PA 1W5TA 3NC0C 1HY3A 3R9IA 1OH8A 2GXQA 1NP6A 2WJYA 2WICA 4TSFD 1TF5A 1US8A 4NYJR 1VMAA 1P61B 1XMVA 1E3MA 2DFLA 4ESVA 2ZQ5A 3MMPA 1EFHA 1UBGA 4V0LA 1OB2A 1N2CE 2VHTA 3T61A 4ZIRB 3B85A 3E1SA 3GLIB 1TPZA 3PFIA 3ZQJA 4F91B 2OBNA 4B48A 1QVAA 2IW3A 2BEJA 4ZPXA 4XOIA 3F5FA 3SHFA 4D6PA 1QHHB 3K0AA 1NVXQ 1XTJA 1SVWA 2P5TB 5FUYA 1NL3A 4DC9A 3DKVA 2JLQA 3CRW1 4YXWA 2MSCB 3TQFA 1P62B 3KXIA 4MA4A 4U5XA 2IYTA 4W9MC 2J7PD 2QPOA 2ZE5A 2R6FA 3THYB 1IM2A 3NH6A 1X1RA 5DNYB 5J4LA 3UWOA 3QXCA 2IS6A 4LSGA 4TQUS 5FTMA 4WIAA 4Z8YA 3EIEA 4FCTA 4KCGA 2ZRKA 1XX6A 2ZRIA 1II8B 2ZE6A 4OK6A 2Q3MA 1J2JA 3FYHA 4UNQA 2OXCA 1R5OA 4Q66C 5FPYA 4DLUA 3VR2A 1DS6A 4NONA 3U44B 1KKMA 1W36D 3CX7A 4OI2A 1GDDA 4JLOA 1Z0AA 4EPRA 2WWFA 5FBLB 4ZDWA 5EUMA 4BZQA 4F4JA 1Y3AA 2ZJ2A 1DARA 1E2NA 4IEIA 3BGWA 2FFAA 1KZ7B 4O3MA 5TXGA 1XPRA 4MYUA 1WQ1R 1KY2A 1T3LA 4ARZB 2EFGA 3TR5A 3W5JA 1Q3HA 1W5SA 2PL3A 2ORIA 3B60A 3GQBA 1Q1EA 2J0VA 3FKSD 5EP4A 4DUGA 3M4YA 3ONWA 1E99A 1LVGA 3SN6A 3SC3A 1CJMA 4MYCA 2V1XA 2H17A 3AKDA 1N0VC 4P0TA 1UEIA 3EC2A 3OIVA 1FQJA 3QE0A 2RGNA 1XEXA 3VHXA 2ZS9A 3TRFA 4DZZA 4NTZA 1UKVY 1ZP6A 4B74A 4QM7A 4A8JB 2ZS8A 3K53A 5HZKA 3O8DA 3VR4A 5K8LA 4V03A 4V0ME 3AVQA 1ZNWA 2W2VA 3LX8A 2JAQA 4D4MA 2GF9A 4DB2A 5G40A 3ZZ0A 4E22A 1Z2CA 1AS2A 4W5JA 2VBCA 2WMOB 3A8TA 4HATA 2FGKA 1P3JA 2FNAA 1W4RA 4LJ8A 4V0KA 1Z0DA 4NCKA 2AFHE 1T91A 1JALA 2ZS7A 4C0HA 2WHXA 1CJVC 2WJIA 5E7JA 4G1UC 1LNZA 4PPQA 3C8UA 3E2IA 4QKQA 2L0XA 2ZVPX 2ODWA 2ZRNA 3QKTA 1PUIA 4BFTA 4AY2A 1HEIA 3FHCB 2BEKA 2G88A 2WTUA 1NIJA 3ZH9B 4LPKA 5ELXA 3C15C 1E79A 4LGMA 3UKDA 3TKLA 1SXJC 5J40A 4DB4A 1W0JA 1J70A 4XTRA 3R7WB 4HLCA 1IXRC 3P20A 3EPKA 1CU1A 3B5JA 4A9AA 1RPZA 3EASA 4H9GA 3K1JA 5FUVA 2MSDB 4Q48A 1FUKA 2D4HA 1PZNA 4JVNA 1OIVA 2C9YA 2ZRBA 1XWIA 4EJSB 1CBUA 2XTZA 2GK6A 2QN6A 4LJYA 3QF4B 3RS3A 1NN0A 2B6HA 5EP1A 1Z08A 1U0LA 1FFHA 4WA7A 2IF2A 1G3IA 4WZAE 4YDSA 2C77A 5FL7A 4Q5IA 2REXB 2NO9A 5JSZA 4S2EA 1TF2A 3PR1A 1XEFA 4URZR 4EDHA 4JMPA 4N0EA 3QY0A 2XTMA 2I1VB 3RABA 3EZ6A 3UWKA 2N1BA 3GLHB 3PEYA 2ZR9A 4R2IA 2ANCA 4RZ3A 2OO7A 2XNDD 2O5VA 1CJTC 1Q1QA 1ZUHA 4TLCA 421PA 3IQWA 3GJ3A 2FSGA 1EFCA 3U3KA 2EFDB 4DCSA 1M7GA 5J47A 4A6XA 4FW9A 3RRMA 1WBDA 5DIFA 2F1IA 3REFA 3PEVA 521PA 4IW3B 5L3SA 3TW8B 3L2OB 4M1MA 2ZI5A 4NKRA 3LW8A 2OCBA 2O8BB 4KYUA 4BFVA 4HB0A 2HUPA 5C2JB 1JAHA 3H4MA 4A2PA 2DFTA 2QTHA 2DFNA 2B7CA 2OT3B 1E9BA 1OFUX 2HCBA 2WIAA 5EXPA 1U94A 3W8NA 1M6NA 2GK7A 1OYYA 4JVSB 2PZEA 4URWR 1BMFD 1FP7A 5CLLA 5LD2B 2KI5A 3BAFA 2ZR7A 1DAEA 3A36A 4AKHA 3CRRA 1OYWA 3Q9LA 3QF7A 2DBYA 3AVUA 1OB5A 3I62A 3HU2A 2IEZA 2X77A 3QPVA 3CH4B 4P33A 4RD6A 3MUFA 2A3RA 4JL6A 4Q4JB 4MKGA 2RHDA 3FGNA 4QHYA 3SBEA 3K0CA 5BN3A 1DAGA 3LWNA 3AP1A 1HV8A 2Q0HA 1E1QD 2OHFA 1W4AA 1CR4A 2W2TA 2IL1A 2ZI7A 3SFVA 4AYTA 2VL7A 3KKOA 1XTIA 5DE3A 3RYTC 2GAOA 3TUZC 2EQBA 4YC7A 1GOTA 1R7RA 1VYVA 2WKQA 1UEJA 4IKEA 2C9CA 3C16C 3BWDD 1R5NA 1SXJA 2HJGA 1YZQA 3ADDA 2VH5R 3KTAA 3G82C 2GZHA 2QQEA 3KZ1E 1GL6A 4MH0R 2Q21A 3QBVA 2CL0X 2AD5A 3OAAA 4KSBA 1QHIA 3CNNA 1EFRA 1F2UA 2J1LA 1XTSA 5B58C 5HE9A 2GCPA 1MABA 3THYA 2PMDA 1L7VC 2ZYWX 3AQ4A 2O8EB 1E4YA 5DYIA 4PANA 4XTCS 3TUJC 4CEJB 2O8FA 2F1JA 4OQFA 4OI1A 1IY0A 5KPJA 3MJHA 3WXMA 1OSNA 3ICQB 3LBNA 1II8A 1GL7A 2DR3A 2DFKB 2ZJYA 1SQ5A 4RD4A 5CM9C 2JDIA 2ZRMA 5E7MA 1OJLA 3GLIA 5C18A 4MRPA 1WE2A 4HLDA 4QXAA 3CZPA 4HAXA 2JGNA 4WOPA 1QRAA 4HYYA 1PLKA 3QNUA 4PPNA 5FPTA 2W58A 3OEED 2BIFA 3QKRA 4EQ6A 2ZRFA 2O52A 1HE8B 5IT5A 2REBA 4HAVA 4K81B 4Q4JA 3ZJYA 2ZAOA 4XSHA 3EZ2A 2H18A 1Z0JA 2UKDA 5K8TA 5DI3A 2J59A 2CHQA 2VP0A 3U3JA 4PQFA 1I4LD 1EXMA 4BASA 4MGYR 1DTSA 1E2MA 3LBHA 5KUTA 3WYFA 3AGPA 3NEJA 3EPJA 4OQMA 2JLUA 5D3QA 1P9NA 3V4RA 3I73A 2YWGA 3GD7A 3LO5A 1KK1A 1P2VA 2XXAB 1NN3A 4DKXA 1HE1C 4KHZA 1AGPA 5DO9A 3SYLA 3Q72A 2DWQA 1XP8A 3QQ5A 4FMDF 5AJXA 3A1WA 3T06B 4B47A 3P26A 4LJAA 4ESHA 3WHLA 2ATXA 1F2UB 4MYHA 3W5IA 3BE4A 1PV4A 2V1UA 1XMSA 4TT3A 2G6BA 1G5TA 4NCJA 2OM2A 3FKQA 5L3QB 1DOAA 5HTKA 1MR3F 3W3AA 2OLKA 4C0LA 1R0XA 4TTQA 2D3WA 1F6BA 4CYMA 4US2R 2PJRA 3FMOB 1E6CA 1B23P 2A2ZA 2H16A 1G64A 2FU5C 1BH2A 3B7GA 1EWRA 2WJVA 2J5XA 1ZYUA 2YWFA 4UNNA 4EPWA 1CJKC 2JASA 1KO1A 2Z4RA 3IKJA 2O8CB 3GLFA 1KK3A 3MFYA 4CEJA 1PLJA 2B7BA 3EC1A 5BYKA 3NBFA 1Z63A 3E70C 4DDUA 1UJ2A 2QAJA 4JSYA 2A78A 5KOYA 4CF7A 3NTUA 2PX0A 2FN4A 5FTJA 1Z29A 1IAQA 4OHXA 1Q0UA 1N25A 4HB4A 1Z6GA 4DDWA 3O47A 4TN1A 1G4AE 1WMSA 4D0GA 4NH0A 5CYPA 1E2GA 1SHZA 1WRBA 2GKSA 2EYUA 2FG5A 2VSOA 3BH0A 3CRQA 5DH9A 1VCNA 1YRAA 2O0JA 2G9NA 1RC8A 4TMTA 4FN5A 3IHLA 3WMFA 4GRAA 2VA8A 1G8HA 4EUNA 1RYHA 1E0JA 1WA5A 1BKDR 2VP4A 3AF4A 3QIAA 5EZ6B 4ZV4A 1F2TB 1D8TA 1KYIA 3Q5EA 1W44A 1TNDA 2V7QA 4QBFA 2JJ1D 5IK2A 3V9PA 1RZ3A 4OHZA 3AVYA 1XEWY 2ZJ8A 1FX0A 1I2DA 4EIWA 4GL2A 1ZM3A 3WP0A 4NYIQ 4KI0A 4OI0A 1Q12A 1TU4A 4Q00A 1R8SA 4Q9IA 5AR1A 2JJ2D 2WSSD 3P4YA 1CTQA 3HR8A 4BFZA 3X1DA 3P27A 1E1RA 3AKYA 3AH8A 3BXZA 4EJSC 3KQLA 1XF9A 4DCVA 2WOJA 3GJ4A 3E5HA 2QTFA 4TLAA 1IOZA 3TSOA 3H1TA 3IEUA 1Z6AA 3GLGB 4PZZA 4P4SA 2BC9A 2F9MA 2VYFA 1LW7A 5GVRA 4A1FA 5EZ5A 3L0SA 2OCPA 5BN5A 4PAQA 1N3BA 4IEEA 3GLHE 5JWRA 3I5XA 1RKBA 1IXSB 1HYQA 2F43A 1CR1A 4TWZA 5EXSA 4BPBA 1VCOA 4ZO4A 1QHNA 2J7KA 2VIIA 1YZNA 2XSZD 1XZPA 2D74A 1S9DA 4OK3A 3P1JA 3OEEA 2OXRA 4HDCA 3Q7PA 3A4NA 4KSCA 4HUTA 3LVRE 2XOKD 2OFXA 5F3WB 4HZUA 2AXPA 1N5LA 1HQCA 2IYLD 4D4LA 2ASEA 3JZAA 2IK8A 2QAGC 3Q85A 3UK6A 4FMCF 5BYJA 3B1WA 3DZDA 1R4AA 3U2QA 3N70A 4JSTA 2P2LA 2GVDC 2RGAA 2Q9AA 1KOFA 2J0UB 4RJLA 1Z83A 3TUIC 1W49A 4Z51A 1K8RA 2GA8A 2N42A 3CZQA 3QVVA 4OQNA 1TL7C 3KB1A 5JSZB 1JNYA 1H8HA 3R20A 1AK2A 1TEVA 3HPQA 3PEUA 5F98A 2QORA 2QRNA 2CMKA 3CBQA 2G77B 3EIHA 1IN4A 3L8YA 2JCSA 1MO5A 3LX5A 1W36B 4IVRA 3KKMA 2WM9B 1CXZA 1RE0A 4URVR 2GJKA 3A58B 1Y63A 5JCPA 1F2TA 1NLYA 2O8EA 2BMJA 4OL0A 2GXSA 2O8FB 4DIEA 3U6KA 3EG5A 4B6FA 1KDTA 1K6MA 5GADl 4JBXA 1ZBDA 4R98A 4IDPA 2WWGA 2IXFA 3QG5A 4MGIR 1NBME 5CJ2A 3KKNA 2GAAA 2KBEA 3KDSE 1XXHB 1QHXA 4QHSA 1NRJB 2YOGA 4JVLA 4NP6A 4NPHA 3SYNA 4PSAA 1XPOA 3BERA 3U3RA 4M2LA 1AN0A 1N6IA 4JLPA 5C1BA 4UXJA 2DCUA 4IOMA 3RRYA 2JLYA 5D3MA 3U6BA 4Q9KA 2CEAA 2I4IA 4PC2A 2QG6A 3EA0A 2HF9A 2VEDA 2WOOA 4E03A 1AM4D 2GVZC 4GSYA 1GG2A 3P32A 4Q4AA 1JAIA 2OBMA 1XJ0A 3OF5A 1HURA 3RNLA 4YXWD 5JFGA 3I8SA 4PC7A 4URUR 2F43B 5DISB 3ASYA 5JHHB 4GP7A 4W7SA 2ZI6A 3K9NA 3TMKA 4CVNA 1XEWX 2IBMA 5KNDA 3IBYA 3K9LA 3GJ8A 5FL7D 1IN7A 4P4UA 3T5GA 5JEDA 4DLXA 1ZVQA 2GTPA 1H65A 4G3XA 2Q9BA 4ON9A 1PVOA 3GLGA 3FB4A 5JLJA 1G7TA 1YKSA 1FUUA 4IOJA 1NLFA 1QF9A 4KBGA 2PX3A 3QG1A 1X8KA 2J7PA 2WPDA 3GCGA 1WB9A 4Q7MB 3EWAA 1S9HA 3QBTA 3D3QA 4L15A 1KI2A 1YQTA 4PZYA 1KKLA 2Q6TA 3W90A 2VF8A 2P67A 3K0EA 1T0JB 2JLZA 3K8YA 1TADA 1OKKA 2ZSAA 4B2IA 4C0JA 5TARA 3I8XA 2FX3A 5G3YA 4URYR 4D25A 4TYYA 1YR7A 1ZMXA 2ZI4A 1KO7A 5F2EA 2RB4A 2B92A 2ZREA 2Q3FA 4V0MA 4ASUA 2ZRLA 1T8UA 5EE1A 1P2TA 4Q1EA 5AUQA 4B34A 3LXRA 1OXVA 4AI6A 4C2TA 1TF7A 2WJHA 3DKPA 3NHAA 4HLUA 3EX7C 5ANRB 2HCJB 3A1VA 1G21E 3GLIE 5DHFA 4GOXA 4QC2A 4TMXA 2ZUCA 2AR7A 2A30A 1QHGA 1BO6A 621PA 2ZJZA 3I72A 2BM0A 4Q7LA 4NL4H 3MLEA 2CNWA 1JR3E 2GRJA 3GEIA 4M8NE 3KL4A 2LKCA 1JBKA 4WZBE 4B71A 5SZIA 3RRZA 3EW9A 3OESA 4G5RA 1G16A 2XOKA 3CX6A 2G1JA 4A8JC 3U7HB 3GFTA 2V54A 1GSIA 4AK9A 4TL7A 2HV8A 1MH1A 2XAUA 4KFSA 1XPUA 1JQJC 2J41A 1E0KA 1SVKA 1VG0B 2X1VA 1KMQA 2CCJA 1G3UA 1JR3A 1R0YA 5FTNA 4JLKA 1M34E 4D4JA 1ESMA 1HT1E 1Q57A 2V6IA 2PT5A 2XXAA 2AK3A 1IJFA 3UG6A 3WMGA 2PLFA 2R6DA 4EPXA 1EFRD 3BB1A 2C2HA 5KO2A 3J81k 1W46A 3TAUA 3ZZTA 1A82A 3SS8A 1S2MA 5DYGA 4ACAA 1OFTA 3BBPA 3GLHA 3IO3A 3LVQE 2XX3A 3ZZUA 3MGCA 1E2KA 4IXNA 2CCKA 3CPHA 5L3QA 2ZJOA 1E2QA 1G8FA 3I32A 3OHMA 4LJ5A 4ZCIA 2BM1A 1A1VA 2YC2C 1W4BA 1T8TA 2G3YA 1KDOA 3ZQ6A 1VCIA 1ZCBA 4LDJA 4B43A 2FH5B 4G5QA 3WNBA 4LC0A 3T5DA 2NG1A 1GIAA 2ZU0C 4PHHA 4RFSB 1XNJA 3DOFA 4YMWA 3AV0B 3ADBA 1XJCA 3U60B 3RC8A 5FBRB 1MRNA 2VO1A 3BJIC 2AKYA 3EIQA 3BD9A 4PX9A 2JLVA 3H86A 1NI3A 3AVVA 2B8WA 4TZ0A 5SZHB 2HYIC 2XGJA 4PAOA 4UQOA 4M22A 3X1ZA 3RS4A 4TYPA 3RWOA 2ERXA 4LV6A 4ZIRA 3LQQA 1UBFA 1E32A 2QM7A 1U8ZA 4JBWA 4TL6A 4Z1MA 4Q4HB 3PG5A 3CUEF 4YDHB 2QMHA 1TEXA 4Q1BA 3MRSA 4JLBA 5AWFC 2A5JA 4TSFA 4X8MA 5FBWB 5G41A 3AP2A 4M9SA 4X8HA 4OKSA 4RY2A 3AKCA 3DZ8A 1U2RA 3CONA 1JPNA 4FCVA 2IYVA 3MD0A 2ANBA 3HR7A 2AL7A 5P21A 3VKWA 4ZKDA 3CR8A 4RCZA 2RGGA 3ADCA 1FPMA 2BV3A 4C4PA 2V7QD 4I1VA 4LPSA 1S8FA 121PA 5LDDC 4RCYA 4A2QA 4FMCB 2OAP1 4CEHA 4MYTA 1W2GA 3FVQA 4A8JA 1MKYA 2AWNA 3THOA 2CHGA 4JIMA 2XJ9A 3UIEA 2IXEA 3BORA 4JT2A 4BZXA 4DJTA 2NO6A 4DDVA 5KTYA 5C4MA 3KJHA 1S3GA 2VHQA 1GILA 4M1KA 4DHEA 1EESA 3LBIA 3K0FA 4PHFA 4CW7A 2QNRA 2JJ8A 1E4VA 4EFMA 2JJ1A 1S3SA 4L4UA 1N6LA 2R6CA 2XB2A 1WCV1 2VLIA 1RJ9B 2VF7A 3GEHA 2EW1A 3IDQA 4BRWA 3IIJA 2NTYC 5HR5A 4GOJA 3VR6A 4PQRA 1BYUA 2CXXA 1E9EA 4HDQB 4C30A 1KDPA 1KJWA 1S0UA 2P0EA 3W9YA 3EAQA 3QPUA 2PZFA 4IVPA 3VTKA 2GF0A 4RSGA 3AP3A 1IHUA 3AEZA 2CNWD 3O8RA 3U7GA 1NY5A 3MG9A 1E9SA 3IILA 3R7WA 1AZSC 4OJQA 1Q22A 4P31A 1VG1A 1X6VA 2UVQA 3KJEA 4NCHA 3ND8A 1ESNA 1FOEB 4GMDA 2FV8A 4D2IA 3BFVA 2IS2A 5JBQA 3I4LA 4JKIA 2FA9A 4PC1A 4KFRA 1GL9B 4TL9A 2V9PA 1FL9A 2RGNC 4RD1A 1NMYA 4GFDA 2LWIA 4HI0E 4I1OA 3T1QA 3IGFA 4H1VA 3TH5A 3A1TA 3ZVLA 5J4HA 5DI3B 3QF4A 3HWSA 4LI0A 3FTQA 2O8DA 4HAZA 1SKYB 1F3OA 4M1YA 3FE2A 3ZVNA 1P2UA 4NHOA 4AKEA 1GRQA 1G20E 2CE7A 2DWOA 3VFDA 4TMWA 3W3ZB 2BBOA 2GEVA 4FWIB 5BN4A 3B8HA 3PVSA 3AVXA 821PA 2FPKA 2E9SA 4GOKA 1E0SA 2VPPA 1CEEA 4ZDKA 4AG6A 1AZTA 5KNBA 3D31A 2V3CC 2F6RA 4US0R 2EYQA 4BFWA 5SZKB 4DDTA 4TL8A 3FHOA 1G41A 3B1XA 3L0IB 4K46A 4M53A 3C7KA 4PC3A 3A4LA 3PJRA 4LOAA 2GXUA 2D2EA 5H70A 1D2NA 4X8LA 2Q9CA 1MRSA 3CO5A 4IOKA 2REOA 4LCBA 4LYAA 5CJPA 1W7AA 5HCIA 3ZYCA 1G17A 4JLAA 4UNSA 2ZVQX 5G3ZA 1Q20A 3SE0A 1ZRHA 1KO4A 2PLRA 4NYMQ 1Z47A 4LZZA 5LPNA 3KFVA 1KIMA 2NZJA 4PFSA 3NWJA 2ZTSA 2XNSA 3CRVA 1N0WA 4YMVA 1E0AA 2WJGA 3GJ0A 4PO9A 5JEEA 5L3SB 3MWJA 2OSBA 1OFHA 5JJIA 1W48A 2VHJA 5DI9A 3U61B 2A5YB 3JZMA 3GP8A 1GM5A 4Q47A 3PV0A 5FOUA 3VR3A 2EVWX 1Z0IA 2LKDA 3CPJB 1NN5A 1COWD 2QTVB 4QNRA 1A4RA 4XVRA 2ZRGA 3LD9A 4RD0A 1DE0A 4KV9A 1XMIA 1KO8A 2TMKA 1OIWA 2ZRDA 1P2SA 4QGAA 3K0AB 4DCTA 2ZSBA 1MO6A 3RVBA 1KSJA 5CIWA 3PUZA 1FX0B 721PA 1O3YA 1EWQA 2J3EA 3OEHA 4FMBB 4UXIA 3GLFE 4NCNA 4JL5A 5EE3A 2ZYVX 2CHVA 1U0HC 2OFWA 5C4GB 1XD8A 1N6RA 1W2HA 1RRPA 4Y0AA 5GVSA 2FE4A 2DB3A 2C5LA 2QGZA 2ZAMA 1SVLA 4TQAA 2KB0A 3IBGA 3GEEA 2QBYB 1T5LA 4QL3A 4UNPA 5A4JA 1AS3A 3FMFA 4XWAA 2PZGA 1TUIA 3NVAA 4FI3C 3REGA 3VU9A 4B2PA 4DWJA 4TYWA 1GNPA 2IUUA 3KX2A 5FL3A 2BWJA 3MSXA 3QI2A 4XWOA 1T3HA 1M7BA 1XD9A 2CDNA 4Z54A 4Q4LA 1X8LA 2CVHA 4I1SA 4Q03A 2YINC 1ZC3A 1GTVA 5A5GA 3EZ9A 2PBRA 1G3QA 5IDVA 3QJYA 1BMFA 1E69A 2QMEA 3B9PA 5L3RA 4TYNA 2Y8EA 3LW7A 5FPHA 1TU3A 4JBYA 5KPDA 1U8YA 2ZSEA 4AWXA 2GXAA 3K70D 3WMEA 2R6AA 2YWHA 1GNQA 1ZNZA 1OT3A 1ZNYA 1E98A 1ETUA 1UDXA 2RHMA 4LBYA 4AYXA 4PR0A 1TMKA 1RYFA 4EPYA 4A36A 1JI0A 1NSFA 4BLOA 4GZMA 3CWZA 3SBDA 4MUBA 1G5RA 2AXNA 4ASUD 2BVNA 1YHNA 2I3BA 4BRUA 3A6PC 5AJZA 3QXSA 1G19A 1KI6B 1FP6A 2OBLA 1IBRA 4D0NA 2W83A 2FOLA 4B3CA 4B3XA 3N5CA 1E2JA 2PT7A 5HKKD 2CK3A 3VX3A 5IRCD 2D62A 4RD2A 5M04A 2FF7A 3MWLA 1W1WA 3DM5A 3OIWA 5EUQB 1XCPA 2P5SA 4KLNA 1IQPA 2ZR0A 3W34A 1CR2A 1JECA 2E87A 2XJ4A 4F7WA 1II9A 4Q18A 4BLSA 3KQKA 1XBTA 2QM8A 4WZ6A 4IHQA 3S1AB 1XXHE 3SI7A 5IF9A 4ABYA 1JQLB 1Z3IX 2CJWB 1FNMA 1JEDA 3BIFA 1P73A 4JLMA 1ZU5A 1JJ7A 1UAAA 4R71A 2FDCA 1KMHA 2Z4SA 3FKSA 1UM8A 4XSGA 5LBIA 3K0FB 3EPHA 2ODEA 5JECA 5CIQA 4C3ZA 1ZNXA 2WV9A 1O87A 3QXJA 1U9IC 1DVRA 3UANA 3VKHA 4S35A 3R9XA 2J0UA 5FPKA 3Q5DA 4HDOB 1UKZA 4HUQA 4EQ6B 5FOXA 2R65A 2F9LA 2VRWA 3K9GA 2VQSA 2K5UA 3IPXA 4A0FA 3I5YA 5KSZA 4N0DA 4G01B 4Q1DA 3HU3A 1IONA 5FFMA 3LQRA 1MOZA 4B3BA 1XJQA 4WXPA 1SKQA 2F3TA 2JIZD 1DBSA 4PO1A 4KVAA 3GPLA 1LS6A 2BJVA 3IIKA 1KNQA 2ZUBA 3N2EA 1J99A 2W6ID 1C1YA 1J8YF 1ZAKA 2AX4A 2OCAA 3LH5A 1NNEA 2NMVA 1NVUQ 1F48A 1M2OB 4UKDA 3NHBA 4G5GA 1I4TD 1D2EA 2FEOA 4LJ7A 3QEOA 3SYKA 3F3YA 3GFOA 4C0QC 4AIIA 3GJ6A 2R6GA 5AJYA 2VP5A 2GEDA 3RLFA 1JR3D 4ZCLA 1EK0A 2JA1A 1N0UA 3G0HA 3T34A 3AVPA 2H7VA 1DEKA 3C41J 1T4GA 4GZLA 3LDAA 3K0SA 4LRWA 1F5NA 2FWRA 3RANA 5TMPA 1GKYA 2R2AA 4AURA 2ZYTX 4LJ6A 2BMFA 4QM6A 2C9OA 4IDHA 3VNVA 2O8BA 4GDFA 4IDOA 1QHYA 3LV8A 3GLGE 2FJUA 2GWHA 4A82A 4KLZA 4Q02A 3KUDA 3WRYC 1TQ6A 1KI1A 3K09A 3KKQA 2DY1A 2NOAA 3SR0A 4CEIA 1G7SA 1AKYA 2GILA 2F1RA 2YZ2A 1CLUA 3AM1A 1RVDA 2J87A 2QPAA 2HYDA 3QPWA 4FIDA 4GBMA 1JR6A 2G1KA 1DO2A 3LAWA 4OBEA 3U7EB 4JS0A 5AUNB 1CKEA 2CBZA 1GRRA 2IYZA 1GKIA 1DAFA 1ZM9A 5EP3A 4WAUA 3CB4A 1P9RA 3IQXA 4PXAA 1E2HA 2OAQ1 3VR1A 5KNCA 5K8UA 5HE8A 4D26A 2PMKA 2WIBA 1CF4A 2WAXA 5TV2A 2J45A 4DXAA 3LRPA 2VP6A 4TMVA 1XTKA 3SZRA 4KBFA 1L4YA 4HUQB 1VPLA 4LHVA 5SZJA 3WNCA 5CB6A 4F4IA 1IJEA 5KDOA 1CS4C 3BB3A 3FMIA 1G8YA 1U9IA 4NU0A 1KZGB 4AC9A 1NVVQ 2IHBA 5FOTA 1OV4A 2CL6X 1JEEA 4LX0A 3RHFA 4NYIR 4HZIA 3NBXX 1UBCA 4BE7B 1PJRA 2YV5A 4US1R 4ZCMA 2NO0A 3WYAA 1CIPA 2JLWA 1D9ZA 2BDTA 2ZPTX 4QBHA 3LY5A 1QHHA 4KO8A 4P4TA 4Q21A 1XFAA 5GJWC 3VKGA 2IXGA 4MGZR 1X86B 3CKLA 4JT4A 1GKUB 2FZ4A 4R7ZA 1AS0A 2V4ZA 3U3OA 4E5UA 1XU4A 2WBLC 4QHTA 1L2TA 2P6UA 4RKEA 1IY2A 2A5FA 3HJNA 1NBMD 2WWIA 4U7DA 3CM0A 4JL8A 4PZLA 3B78A 2QU8A 3DMDA 4MRSA 1DG3A 2A7QA 1HT2E 8OHMA 3HYRA 4Z8XA 3TR0A 2F7SA 2ORVA 1E9DA 2QP4A 2RKOA 3C5CA 3L43A 2XB4A 3QKSB 5DN6A 5CM8B 2FSFA 3A1SA 3KB2A 1BIFA 5CITA 3W6OA 1E2DA 4O25A 4M0LA 1SVSA 3IPYA 1DAKA 1ZC4A 5FOVA 1KAGA 4B35A 4TZ6A 4FWTA 4KU4A 1FTSA 3BH7A 5C46F 5IHPA 4Q9LA 1DAIA 4KYIB 2DHRA 4MKHA 4TMKA 4TQ9A 2QL6A 4Y0VA 3L0OA 4L9SA 2XZLA 2FFHA 2HEIA 1A2KC 3U5ZB 4TTPA 5EXXA 2RCNA 2SHKA 3ND9A 1W0JD 3SJCA 1Q21A 5FOWA 4DEXA 1KGDA 2HF8A 4E09A 1MT0A 4Q4AB 4F38A 4I81A 2EWWA 5KSOA 3ZVMA 2BKEA 1W0KA 2NGRA 3W6NA 1N6OA 3PUYA 1DADA 2YYZA 2ZJBA 3TGPA 2JLXA 4TT3D 4V0OA 1CP2A 3MCAA 1NJGA 1W0KD 4JLNA 2CL7X 1UBEA 3RC3A 3AGQA 1FZQA 3AKEA 1TX4B 1NKSA 3NG1A 1G7RA 3I1FA 5EE5B 5J4VA 3M6AA 5J4KA 1R2QA 2QUZA 4CEHB 4GMXA 3OE7D 1ZIPA 5JS8A 4EFLA 2H92A 2I1QA 2FPMA 5L8VA 4DSOA 4LHXA 3I3SR 2W2XA 3DDCA 4LHWA 4C0AC 3ZD7A 1R0WA 5FR2A 1C4OA 2AFIE 3GJ5A 3FPAA 5LB4A 3VU9B 4XWKA 5J4YA 5JHGB 1HQYE 2AHOA 1VYUA 2VSFA 3ZLJA 3CPEA 4UJ3A 5G53C 3T15A 3TVDA 2KSQA 2IYQA 4URXR 1LY1A 3HYTA 1YZGA 3AF1A 5HCNA 4C0SA 2V6JA 4QNMA 2GJAA 4M4SA 4BWYA 5B64A 3TVTA 2NPFA 1NN1A 2HLDD 5EE0A 2WJJA 4Q01A 1ZUNB 3ASZA 4B3GA 4TLBA 1G3MA 4GP6A 3DHWC 3I61A 1Z0FA 1NG1A 2XZPA 1WP9A 3BH6A 4JKYA 2ERYA 2HLDA 5JWOA 2ZRHA 3T1TA 5JJKA 1GNRA 1D9XA 1OE0A 2QMOA 1TQ4A 2MMGA 1RIFA 4LJ4A 4LYHA 3IIMA 4MRRA 3FDIA 1HH4A 6Q21A 2IYUA 1Q3TA 1W36C 4AKIA 5JJLA 2QPTA 1KI9A 1NIPA 5BXQC 3PEWA 4KXFB 4TTRA 3NH9A 3Q3JB 4PHGA 1CR0A 1N6HA 3U7FB 4ZDIA 1K5DA 3TSZA 2QGNA 4LV5B 3AF0A 4DIDA 5H1YA 3RAPR 1L4UA 2ZRCA 1DELA 4RZUA 1G6OA 2WKPA 2Z0MA 1GAJA 4M9QA 4LYFA 1B0UA 3IUYA 4IXMA 1UPTA 1S1CA 4LBZA 4BFXA 5HKKA 3FHTA 3TJZA 5FBQB 1OW3B 1V43A 1XDBA 4QFMA 2ZJ5A 3S1AA 3OIUA 3TBKA 3PIRA 4AD8A 2RGEA 4RZXA 3K0CC 3M0EA 2QT0A 4RFVA 1ZD9A 4Q1AA 4P3YA 2BMEA 4POAA 1S4QA 1E79D 1J7KA 4FCWA 3R9WA 1OFIA 2W6JD 4D4KA 3T1OA 1E1QA 3TW4A 1PLLA 1TQ2A 3SJZA 1T3SA 1AIPA 2F1HA 2QEQA 1ONBA 1EFUA 3CRMA 2EWVA 1IN8A 4NYJQ 2IC5A 4BEBA 1AKEA 4NCIA 4QGHA 1OXUA 2ZITA 3DEFA 4M1OA 5EE9A 2ODNA 3WNDA 4DLWA 3VR5A 4CIDA 2WVJA 3B13B 2OESA 2BBSA 2GCOB 1MO3A 1WDTA 2RGBA 1KSGA 5CLQA 2H1LA 1G4UR 1GUAA 4A2WA 4TLDA 4L16A 5AUPB 1VKJA 4MRVA 2QP3A 5HZHA 3U4QB 3C14C 3X2SA 4EKDA 3KFXA 1ZCAA 3Q8XB 3DL0A 4TMZA 1R8QA 4FMDB 4V0NA 2YOHA 3MAAC 2OLJA 1N5JA 2GCNA 3EZ7A 3U44A 2IA5A 2ZU6A 4BLRA 4NMMA 5BWMA 2A5GA 1EGAA 3NDPA 1P5ZB 4JYCA 2JATA 3KJIA 4B75A 2A9KA 2Z5FA 3WRXC 2RGDA 4XVQA 2V55B 4JLJA 4LBWA 5DN6D 1Z6TA 2YNMA 4LJ9A 2C04A 3THXA 1LFDB 1SZPA 3GJ7A 3H0KA 1G1MA 2DPXA 4XIGS 4JYBA 4G5OA 4QJ4A 4KITB 1R0ZA 4B73A 5BW8A 1L8QA 1BOFA 3GFPA 3HP1A 2BCGY 1U81A 3PUWA 3NIBA 2QSYA 3D7MA 3O8BA 4YMTA 5HPYB 1Q1BA 1ZD1A 5FI0B 1OLOA 2RMKA 1GRNA 2QQ0A 4B33A 3KQNA 2RAPA 1TQDA 4DLYA 2H8KA 2GZAA 2FFBA 4DEYA 4MDFA 2F3RA 2W6IA 1I2MA 4M9ZA 3BC1A 3NEYA 1GWNA 4DVGA 3GJXC 4AG5A 1WF3A 1GVNB 1SVOA 4BLQA 3ADKA 1OXSC 4XVUA 5KYKA 1G6HA 1XXHA 3ICEA 1E96A 2ECKA 3BS4A 2FMXA 3PCRB 4YLGA 3WYGA 3K9HA 2UZ3A 5TB5A 4B3FX 2WZQA 2BBTA 4DLSA 1IY1A 4QOSA 2J0SA 4F4CA 3K09C 2QY9A 3A37A 1W4CA 4A15A 4E07A 4EPVA 1Z6YA 2WMNB 1J90A 3JVVA 1SULA 4PO8A 2WSMA 2G83A 3DPUA 2WKRA 1Z8FA 4LUCA 2CLDX 3OFND 3RS7A 1NSTA 2QAGB 1KJZA 1KNXA 3KKPA 1VTKA 4LWZA 4OQLA 2GJ9A 4OQXA 5FTKA 2OE2A 3B1VA 3PUVA 1IN6A 3BFXA 4KAXA 4C0KA 1YE8A 3PUXA 1FMJA 2ZRJA 3ZS8A 2OZEA 4J0QA 2NPIA 1XD2A 4ITRC 5D3MB 2XZOA 2GDJA 4HAWA 1K5GA 1YZKA 2QI9C 1DG1G 3Q7QA 5DGXA 5B2ZA 2GETA 3HPRA 1G18A 2GBLC 3FWYA 4IVQA 4C7OB 1N6KA 3AF2A 5EXTA 1T0HB 2G0NA 4II7A 4Q7KA 4BQSA 3BB4A 1CJUC 4Q1FA 5EQTA 3AVWA 5JI3E 2QT1A 5FR1A 2PEYA 5LB2A 4F92B 1OH7A 1E9FA 2BMDA 2Z43A 4EJSA 2VP2A 3LA6A 1D5CA 4ILEA 4Q4HA 2FZLA 3EXAA 3CNOA 1J8MF 1VHTA 4Q7JB 1G7CA 4DLVA 2O8CA 3H2YA 1S1MA 1VHLA 1Z6XA 1ZM2A 4X8OA 3X1YA 2ZUDA 1AJEA 4LHYA 2HXYA 1SVIA 4PPGA 2CJWA 4PC6A 2CLSA 3QOFA 3K70B 4RKFA 1N5IA 3LLUA 4BGDA 2ZI3A 2J0QA 1VECA 3EARA 2D7DA 1T6NA 2FEMA 2VP9A 4CDGA 1AA9A 3L82B 4RD3A 4JJZA 2IUTA 4LY6A 2W0SA 4AYWA 3T12A 4Z1MD 1W47A 4ZDJA 2KBFA 5KSYA 1NBMA 1U90A 5FUWA 4D81A 3B1YA 4OI4A 1KMHB 4DT1B 1JB1A 3PXGA 3RWMB 3OAAD 3A4MA 4G0NA 2ZRPA 2C03A 2IF0A 2J46A 2QE7D 4XJXA 4YMSA 4BFYA 1RRGA 1Z5ZA 5TVKA 2X2FA 4G5SA 4BEJA 1XTQA 2ZSDA 4CGZA 2WPDD 5AJWA 2QAGA 2BOVA 5AK0A 1DPFA 5KDDA 1RFLA 4KVGA 3FOZA 1A5TA 2JLRA 2Z83A 2XTNA 4KJZA 1QVRA 4OYHA 1E1RD 5EP2A 1KAOA 4OK5A 4YONB 1E2EA 1ZIOA 1DAMA 4BECA 1CRPA 1G3RA 4MQBA 2ZXUA 4QBGB 2CK3D 4DSUA 2ZETA 3MWKA 5LD2C 2QE7A 1II0A 5FI1B 3B6EA 3U3MA 2ONKA 2C98A 1VIYA 4HAUA 4B2LA 3OE7A 3SQXA 1KTVA 1Z07A 4QGGA 1KHTA 4I1UA 4JLVA 1Z28A 1X8JA 5J5CA 1YR6A 1PUJA 2IS4A 1BYIA 1YR9A 3B2EA 4UXHA 5L3VA 2C8VA 4ARZA 2QMUA 3OZXA 3UG7A 2AK2A 4DLRA 4W5WA 5TY0A 4B76A 1E2FA 3MJRA 1VIAA 1EG7A 1H8HD 5FUXA 4ZI2A 2P6NA 3R8CA 1XCGB 2H57A 2EFEB 2NZ8A 3QKRB 1NJFA 4A92A 2NIPA 5KHOC 1AGRA 4O0MA 4LK2A 4P32A 3SJBA 3KTAB 2J9RA 3I92A 2HT6A 1UF9A 1A7JA 2PCLA 3EA5A 5JWHA 1SGWA 1NF3A 1KI7A 1HTWA 2GHIA 2QBYA 1XMJA 2FSHA 5E4FA 2CLCX 3G5UA 1Q44A 2ZROA 1Z22A 1ODFA 3IEVA 4PPFA 1MABB 1NG9A 2JDID 3A1UA 4JLDA 3KXKA 3RS5A 2NO1A 5FH9A 2IX3A 4GI7A 1XRJA 2GNOA 4M9XA 3TLXA 1UKEA 1OXTA 2IYXA 1KSHA 1XEXB 3BK7A 3TSWA 4Q1CA 1OH6A 4DLZA 1G9XA 4HZUB 4JVMA 1LF0A 4PSKA 4MRNA 2HT1A 3RS2A 4V02A 2H5EA 1E9RA 2X8AA 2IT1A 3W8RA 2X19A 1R10A 1T5IA 2ZYUX 4L8GA 4FINA 5JCZA 5IK2D 1VDZA 1N5KA 1OH5A 1H8EA 3CF6R 5A0FA 4IDQA 3CIOA 4HLQB 4F93B 4WBSA 1QDEA 4U00A 2YC4C 4PHTA 1LS1A 1ZM7A 5FBVB 3KQUA 2NQ2C 4U02A 1QZXA 221PA 4M1SA 3VHLB 4BZPA 4JZKA 4BUJA 2QRZA 1KI4A 3TE6A 3THWA 1S96A 3B1ZA 3CR7A 5EJEA 1KSFX 1Z06A 3WBJA 1E9CA 4ERNA 2IWHA 2RGCA 4XD7A 4GPTA 3TQCA 5CB8A 1P4SA 3SOPA 3ZDQA 1D6JA 2WWHA 1VYTA 2DYKA 2ZE8A 4I99A 1QBKC 1XB2A 2D7CA 2P65A 4PQYA 1KI3A 1TAGA 4DUGD 1VG8A 1E2LA 1OKKD 1KK2A 1YZUA 3NBYC 1US8B 3NKVA 2ONJA 2PJZA 1P9WA 1HUQA 1YU9A 1T9HA 2LCFA 3D6TB 3L8ZA 2C95A 3DMNA 3VNUA 3JVUA 3ZVRA 3P4XA 3TAHA 3ZIAD 2ODBA 3TNFA 3SEAA 1IN5A 4RVCA 4O2RA 2GESA 1OXXK 2CVFA 4TLEA 5F9HA 4B32A 1YJ5A 2KWIA 1WBBA 2ZANA 2O8DB 3EWSA 2WWWA 1SXJD 2VSXA 5JI2E 5JRJA 2WAYA 3M1IA 3LXXA 4DLTA 2W6JA 2WWXA 2FFQA 4GNKA 3VAAA 3RRNA 2FPLA 2G0TA 2UZIR 1JJVA 1KI8A 3WHKA 2JLSA 2D06A 2R8RA 1QG2A 4C2UA 2IHYA 1JPJA 2RGXA 2N46A 2OILA 4D0LB 2YWEA 5B30A 2OFOA 1M1YE 3WY9A 3C4JA 1JXOA 4EFNA 3K70C 5KSPA 5CK5A 2MMCA 1M7HA 1XD2B 2GJSA 2KE5A 3R8FA 4IDNA 3ZIAA 2VHCA 3WBKA 1UADA 4NDZA 4ACBA 4OHVA 3SNHA 3GLFB 2JEOA 3DVLA 5F9FA 4C7OA 2IS1A 4AKGA 1LF5A 2PCJA 3GMTA 1E9AA 1F60A 5FPSA 1UKYA 1N6PA 1FW6A 2IYYA 3T35A 4CT4B 2OCYC 1P60A 3HDTA 2WWYA 3KQHA 4HLUC 4QRHA 2XEXA 4MITA 4RZ2A 1KK0A 2HXSA 5CDFA 1SVMA 1Z2AA 3AB3A 2IYSA 3ZS9A 3CWQA 4JJKA 3OIYA 4KFUA 4ZI3A 1FMLA 3UMRA 5JZVA 4M1WA 1UFQA 3F8TA 2JJ2A 2WSSA 2W00A 4I4LA 2HDNB 2QP9X 1P7CA 4DBLC 1LV7A 1ELOA 1KDRA 2ZI9A 1P72A 2P6RA 4DSNA 1DO0A 1G8PA 1FQKA 4YMUA 1NLZA 1OIXA 2D2FA 4WXRA 4Q19A 4PAMA 1GP2A 1SXJB 3HU1A 4QBIA 2MSEB 4Q9HA 2OG2A 2IWRA 4MKIA 2O0KA 2FSIA 1RRFA 5GJCA 3L0PA 3V4FA 1AQYA 5E95A 1E94E 1EX7A 1XCMA 3X1WA 2ZJAA 2IYRA 4HB2A 3CX8A 2YVUA 3FFAA 2AWOA 3UATA 3W6PA 4B44A 4A6PA 5AUOB 1KY3A 1VCMA 3N2IA 4MDEA 1SXJE 3ECCA 4BFSA 2ZIAA 4MUAA 3IHWA 2CE2X 1OHHD 2OV2A 1M8PA 2AD1A 3ZGXA 4LHZA 3CLVA 3DOEA 3UPUA 3THWB 3QXXA 2O0HA 2BJWA 1U0JA 4RFSA 4FXPA 4HB3A 1OHHA 2GJ8A 2P3SA 1EFTA 1IXZA 1G291 3CH5A 3VMFA 4CZ2A 1SKYE 2XITA 5JMTA 3QVUA 3NDBB 2QSZA 2EFHB 4D80A 4R2HA 4IOLA 3F0TA 4QGFA 4LBVA 1HA3A 1D2MA 4NZYA 1GZSA 1NMZA 4L5BA 1JXMA 1LB1B 3PENA 4C9BA 1EX6A 1ANKA 1R5BA 2ZRAA 2EFCB 4NBSA 4EAQA 4LYJA 1RRCA 1G5PA 4TYQA 4CEIB 2QZ4A 1AQUA 1ZD8A 1N6NA 1OF1A 4O2LA 3CW2A 4XH9B 3UMFA 4IFBA 5DSZA 3SFZA 1M74A 3EZFA 2KJQA 3FMPB 2ATVA 3OEHD 2C96A 4KFTA 1QG4A 5CYOA 4DSTA 2ZSFA 3IO5A 3DO6A 2BKUA 3RSLA 5DHAA 1ZUIA 3TIFA 3AUYA 4A4DA 1NVVR 3RSOA 5KU1A 1COWA 1H8ED 4L9WA 1NY6A 1Z0KA 3DM9B 3QUSA 3NC1C 1X3SA 1XTRA 2BBWA 4YQFA 3SQWA 4IFEA 2ZE7A 3RDPA 5AJVB 4M21A 1G8GA 1ZM4A 3CF0A 1FTNA 2V8OA 2OUKA 1LTQA 5TDHA 3QKSA 3LLMA 3UMSA 3CNLA 2QENA 2YHSA 1WXQA 1YRBA 3SDZA 4BLPA 1AA3A 1U8AA 1MV5A 1YZTA 2X2EA 3PITA 5FOSA 3X1XA 2AKAB 3KXLA 5H68A 3TK1A 1U98A 2GCOA 4B3DA 1E2IA 1VG9B 5KDLA 2XNDA 3AVOA 1TTTA 3ZD6A 4Q9JA 3CF2A
chains in the Genus database with same CATH superfamily
1GQOA 2CLKB 3TQSA 2K87A 3IALA 4RPCA 2C78A 4XPIA 3UAYA 4BNJA 3DDHA 2Y1XA 2DJ5A 1EXWA 3JQPA 3OJLA 4H7EA 4YIHA 1Y5LA 1GAEO 2OFPA 1H6DA 1YL5A 2WIDA 3I28A 4LGYA 1GQSA 3FLEA 3QSYA 3ZCRA 3DBOB 2IV2X 4A7PA 1V1MB 2GNPA 4R3WA 1A7UA 1C81A 1Q0SA 4YN3A 3TDKA 4L4SA 3ZWMA 2UVPB 4EPTA 2IHJA 5JIBA 1EDBA 5E7QA 1UMCA 3B82A 3T3DA 1P0MA 4A0HA 4UFOA 3QEJA 4UJ5A 2E4WA 3M9LA 3C5HA 4OBWA 1M6YA 1SMKA 3E9MA 3G13A 1IIRA 2XCIA 4JOQA 4KPUA 3LZCA 3NONA 1BS1A 4MKRA 3FCOA 3C6QA 3F5SA 1Q1ZA 4G2NA 5GJBA 2JFWA 2JLBA 3B9QA 4OU5A 5G4KB 2X5XA 3HA7A 3NHFA 1HETA 3L9WA 3T5CA 2OV1A 4MUFA 1HDZA 1NMXA 3DF7A 1SM4A 3PF8A 3QUQA 2JH3A 3EIUA 4FD2A 4LXUA 3UV3A 2VPIA 3E0XA 4P4SB 3TZLA 4UW9A 1P6XA 4A23A 5BWBA 3GAZA 5GJVC 4Z4EA 2C2KA 5HYVA 4Q93A 5IZCA 4QG3A 2VJDA 4OHWA 1KWKA 4CFYA 1B1AA 3SSNA 1XRSB 1QVZA 3DS8A 5DJ5A 2VHUA 4OTZA 4HVCA 4NQZA 3S81A 5IEBA 1TT5B 2WQ6A 1XTUA 2FW7A 3QXHA 3RS0A 2P2SA 1TA0A 2QTAA 5JMWA 1G2OA 4OHUA 5HIAA 1JSRA 5A71A 3IE0A 4QJ5A 4NCXA 1WMFA 1H2RS 4MAMA 4DJDC 1E3JA 1UDWA 3AF3A 1PWZA 3HJTA 4HEJA 2VG8A 2XA9A 1NVTA 3GFRA 1VBFA 1USUA 2YHBA 3AHDA 5IXYA 2NO7A 3EBLA 4J16C 4EKIA 1WETA 5L6MB 1YVDA 3ETLA 2ZEJA 1E7RA 1QGUA 1U5CA 2M9MA 2RFLA 1NW4A 3VX4A 3I01M 2OL4A 4F5YA 4MVJG 3ZQKA 2PZLA 4K8OA 4C43A 3L84A 4DCNA 5DLQC 4H3KB 1FJXA 3LHFA 4HWOA 4BMPB 4F45A 1T6BY 4QJ3A 2R9VA 1G9SA 2EGGA 4LY9A 3LOUA 3LP8A 2CVQA 1UP4A 2DWPA 4RK7A 4JKOA 2RC6A 4S0ZA 3BRQA 1HQDA 3UYLA 4S04A 1U9YA 2XKKA 3L07A 1M34B 1ZL2A 4ALKA 1K8XB 5DW0A 2F55A 1B3BA 3GUUA 4DLLA 2LDBA 4YP9A 2QB5A 3BOSA 1LC0A 1FIUA 3GARA 4WXEA 2R7AA 4LI3X 1YIOA 2EV9A 2JHFA 1QLHA 3AR7A 3NJ8A 4YAGA 3ESZA 3T1VA 1SC1A 1Z75A 4KGDA 3ESRA 1EFKA 4D74A 4I08A 2AMJA 2ZM5A 3PGA1 1H1TA 1RMQA 5HW0A 1A2BA 1OILA 4H1UA 1I5EA 4GT1A 1GNTA 1B14A 1YR8A 2C99A 4HP8A 4OHFA 4E51A 3VO8A 2ZB4A 3OFNA 1UR5A 3RU9A 4BNNA 3ELDA 5C8YF 4BVBA 2Z98A 5I7UA 2I4OA 2WJYA 5BURA 1CK4A 2OD9A 3LK7A 4Q9DA 4TSFD 1TF5A 3RR2A 4HNQA 3OLZA 4NYJR 1P61B 3W2GA 4ERXA 2ZM6B 1ZHFA 2FN9A 1JTEA 2YIVX 1EFHA 3ZV6A 4HMOA 1V5FA 2ZBVA 3VHXB 4KREA 1ADFA 3O3CA 4OJMX 4PYRA 1EU1A 1SOUA 5J5VA 1TPZA 2BFEA 2NW6A 3PNYA 4F91B 1QVAA 1D4FA 1JEOA 2IW3A 3VPGA 1A9OA 4DMKA 1ODCA 1QHHB 1XZKA 4K5QA 1NM5C 3PGJA 4G0MA 4KO1S 1XTJA 4AZTA 4HUJA 3IHTA 3PFHA 2PWBA 5FUYA 3DLAA 1J5EB 4YJGB 2E37A 4YFYA 2D2IA 3CRW1 4MQLA 1H42A 4YXWA 3ZE6A 2PMEA 2PTGA 4U5XA 3KXIA 1O94A 5LJIA 3FH0A 4TWJA 2DJIA 2IYTA 5EJ2A 1USIA 4DCOA 4CKCB 4OEHA 3DBRB 2X86A 2NZWA 3TZKA 1X87A 1CZOA 1QAMA 2I7DA 1W35A 3OCVA 3LUFA 3P9KA 4ZZIA 3UWOA 5J4LA 4TQUS 3BE8A 3WGHA 4OXRA 1JJFA 1SHLA 2VHEA 4WIAA 4FCTA 2YVKA 3NKLA 2ZRIA 3ESBA 5AW0A 4RKYA 4JLWA 1LVUA 2VK2A 1OQAA 2W48A 3IOYA 2Q9UA 4P93A 4FFVA 2PGXA 2GPSA 3A4TA 3VYUB 3WB2A 1QVWA 4KIWA 4YRKA 5C3MA 3TF5A 3VR2A 4NONA 4G0UA 4KUHA 3PE3A 1NR1A 3CX7A 1X7GA 3CCCA 1AU9A 4OI2A 5DGTA 4E7OA 4EPRA 2ZBQA 1Q6YA 5FBLB 4EATA 3EXHA 5A4FS 2ZJ2A 1E2NA 2DGDA 5TXGA 2FSPA 3KVYA 3BK2A 3R7DA 3UT5A 2Q4BA 1WQ1R 4WOBA 3KHTA 4WOKA 3SIWA 3W2EA 3Q40A 1N4DA 1I7PA 2DHQA 3FW1A 3RTCA 3TR5A 1S7GA 3LTEA 1RWNA 1Q1EA 2X3UA 1A9QA 4J9VA 4JC0A 1ZA2A 3M4YA 5HS4A 1XLUA 1MNAA 3FRJA 4DMLA 1XNRB 3I37X 1KQGA 3SC3A 1Y80A 1YB5A 4JXKA 5AVTA 4UULA 1RQRA 3WLNA 4DQUA 5DBFA 5LVAA 2V1XA 4BCDA 3IUJA 2HB6A 3OMXA 1XDGA 2WJ6A 3I2HA 1FQJA 3OIVA 3GPCA 4J4BA 1T1EA 1XEXA 2QI9F 3T6KA 5EINA 2F3UA 4UUOA 3RVDA 4NTZA 2GEFA 2LBPA 2CNKA 3AESA 1WSAA 2HA2A 4J0CA 5AKJA 3L06A 4QSHA 4FJ0A 1YA8A 3O7WA 2ZS8A 5CW1A 2C2WA 1J2UA 2PRSA 2O4UX 1FP4A 3RYHA 4X6XA 5ALEA 4EO9A 5K8LA 4XI9A 2W2VA 1WHSB 4OYRA 4D4MA 3TZCA 3L8CA 4AO7A 4LFAB 3CUVA 3VDNB 3EB9A 1G6KA 3ZZ0A 5JH7F 4LNHA 1HZJA 4JU8A 4D98A 5IABA 5HFAA 1QB7A 4A8HA 2HHHB 1QF6A 3BEOA 1Y9AA 4RA6B 4PG7A 1G0OA 2QRQA 3A8TA 4NZPA 4HATA 5JO9A 3WIDA 4BVAA 3QMVA 3QVMA 4LJ8A 1Z0DA 4NCKA 3S2FA 3DSRA 3RBAA 2I76A 4H08A 4CDMA 4IIYA 4BP9A 2WJIA 3RH0A 5E7JA 4MW7A 1HYHA 4D0SA 1LNZA 3WLIA 2F64A 4PPQA 1ACLA 2PO7A 3FPEA 2VT7A 2ZIXA 1HEIA 3IVMA 3KE8A 4BFTA 1CE8B 5JNLA 2WTUA 3WDKA 4UZSA 5ELXA 1F2DA 1U0TA 1C4XA 1E79A 3VZBA 3A2NA 3G9UA 3TWOA 1DOHA 1DXYA 1RD4A 2IHKA 1Z36A 3BBLA 4PLYA 4DN6A 3EPKA 1PR1A 4LZAA 2IU4A 2ADFA 1YACA 5TQ0A 5J3JA 1O95A 4RMGA 2R85A 5B12A 4QULA 2BEWA 2D4HA 1DQPA 1PZNA 2R1ZA 4BYGA 5IAGA 3WGLA 6YASA 4JVNA 3N2GB 4P7FA 4L8VA 2XUAA 4R9SA 4EJSB 2OAEA 5EIBD 5JVDF 2AOTA 3GAMA 1F17A 5E9AA 5LP1A 2C0QA 1EB8A 2I4TA 4ZV9A 1NF8A 2WD7A 1RQLA 3FIUA 3WLLA 3QX8A 5ALOA 5JAMA 2WLTA 3GRZA 4CTNA 3O4HA 4UEQA 1KMCA 2ZTVA 1IZYA 2FPSA 4UHBA 1I1OA 1L7BA 2JVJA 3Q41A 4WA7A 5FL7A 4S2EA 3N9IA 3RGWS 1XEFA 2SNIE 4KQWA 4RKWA 4E31A 1XROA 1YB2A 3QY0A 1B00A 2XTMA 1GHTA 2I1VB 1T9GS 2J67A 2Q4DA 2UUOA 1TJ5A 3A2LA 2PKWA 2V6GA 1YTUA 4WGGA 1PTKA 2A9FA 2QIPA 2ANCA 1NVFA 3EEQA 4QYIA 1W4LA 2DU8A 4RZ3A 4XWYA 2VCEA 2QYTA 2IYEA 1CJTC 5T3UA 421PA 2XUFA 1UJMA 2OB2A 2FSGA 4G89A 2EFDB 3V9AA 3EGIA 1M7GA 1NWCA 3DV0A 4X90A 3PRHA 1WBDA 4FW9A 1JAZA 3WIEA 1KBZA 4ZYTA 3LPAA 3AJEA 4O1HA 4TUYA 1IHDA 2L19A 4FHZA 1OU0A 4NU6A 3TW8B 5EUBA 4DNOA 2XMSA 4YO8A 5LBUA 2VDWB 2H2WA 4DYHA 4KYUA 5JBIA 1IXYA 4HB0A 2HUPA 4B09A 5C2JB 3FPGA 1JAHA 3WWPA 3DDNA 4ZZ1A 3AEUB 4G8BA 6ABPA 2PUWA 3QA9A 3C3YA 3QPDA 4L2IB 2X2PA 5LQNA 1Y4UA 2I7VA 4XUEA 4AMYA 4UHKA 1GV0A 4BQEA 2HCBA 1N7HA 3W8NA 1CE8A 3OE1A 5IUJC 2GK7A 3NMUF 1F0PA 1BMFD 4P5EA 2WSYB 3H9QA 3F47A 3BAFA 5ARDA 4YCAA 4J0GA 4FHCA 2ZR7A 1K5PA 1KZ6A 3F8WA 3CRRA 1LPBB 3Q9LA 2DBYA 3UT6A 1OB5A 1D5WA 4GGPA 1I2CA 1RXSA 2X77A 3BXHA 4RKQA 2W4IA 5ESDA 5CLFA 3LDGA 4C22A 5L53A 4KQKA 1JLMA 4P81A 4BO3A 3J81A 2I67A 3IAEA 2A3RA 4Q4JB 1JDUA 4C7XA 4QHYA 6LDHA 3K0CA 3KEOA 1MRZA 4G4SP 3S2UA 3AP1A 4GLLA 4CM7A 1HV8A 3W1VA 4JCCA 4AS2A 4BO8A 1W4AA 3O75A 2IL1A 5LSAA 3KR0A 2ZI7A 3L4BC 3Q3VA 3SFVA 4O4IB 4MCAA 3NKFA 5IC6A 4AYTA 3RYTC 3OZGA 5JSHA 1P4GA 2GAOA 4Q1VA 4C29A 4PW0A 3QWAA 1DQYA 4YC7A 1VYVA 3C6YA 1H3NA 1T8YA 4FGLA 4M0KA 4EX6A 5DZSA 3C16C 3MNFA 4QUGA 5J63A 2WMDA 3QLTA 1PT6A 1D4AA 4AL4A 3DBVO 1Z16A 2GZHA 2O3TA 4F96A 2QQEA 1A95A 1JILA 2VH2A 1MGOA 1WF6A 3QBVA 4NZOA 2AD5A 2JIBA 1R9MA 2NZYA 1PZFA 2OHJA 1QHIA 2OQ2A 4KSBA 1EFRA 1KJQA 3B70A 1VBKA 2Q1WA 2HM7A 2F67A 3W5AA 3P4UA 3UMMA 1MABA 1YZ3A 4RAQA 2FZGA 4U2KA 3KVRA 2H4WA 3RT7A 2O8EB 2QXUA 4WVLA 3MTEA 3EEYA 4XTCS 1AKWA 2ZT6A 3H4IA 4YI5A 2E4AA 3ICQB 4K6MA 3WXMA 1OSNA 3NPMA 1U4SA 2O5RA 2JW5A 2WF5A 1Z74A 4UPVA 3WRXA 1QXSA 1YOVB 1GL7A 2AFVA 3I3OA 3OQOA 5D86A 2V9CA 2WM2A 2ZRMA 2BI4A 2R1TA 3QU2A 5A4AA 4KQCA 2HQRA 1QYWA 1N9ZA 3EXEA 5DNDA 2DH6A 1WE2A 4HLDA 2FUG1 4E33A 3E27A 2FQXA 4KIGA 4H1TA 2BGGA 1EM8A 3QNUA 4DXDA 2XUOA 4PPNA 1ZR4A 4ANFA 4P80A 1R88A 1BVHA 2VC2B 3LT5A 4MWEA 2PU5A 3FPLA 2EHJA 3NOVA 2ZRFA 2O52A 3N39C 1YASA 3PR2B 4DJJA 1HE8B 3F74A 5FI3A 2QNIA 4HAVA 3GPDG 3IEXA 4N9WA 3V1NA 1Q74A 4OP2A 2HRZA 4X3PA 4NABA 2BFBA 4REQB 4WCFC 5H82A 3W77A 3ZDEA 4BNZA 1E1LA 1TO2E 3F6EX 4Z9YA 2J59A 3B48A 2C7RA 2VP0A 4PQFA 8GPBA 1V8DA 4IM7A 4BASA 3PVCA 4MGYR 2PG3A 4CG3A 3ZY4A 3JQ8B 4B3IA 5DMXA 5ADWA 4KWCA 3ECAA 1XQXA 4Y1EA 3EPJA 3DFMA 4KV7A 3ZIUA 3SYRA 5D3QA 1P9NA 3R7SA 3G0BA 4BMXA 1KS2A 1E3DA 3EIFA 2ETXA 1KEEB 3AW8A 3PFKA 2MSNA 1A5BB 1KK1A 2OV4A 2XXAB 2AJCA 1T4DA 1U1GA 2FWNA 1JSXA 1V71A 1PEYA 4KHZA 4H3HB 5AJXA 2BRUC 3PTLA 3V8NA 3A1WA 2X6RA 4X61A 3JCZA 3IYLW 3OJFA 1AMNA 2ZBEA 2YZKA 4ZCTA 2Z1MA 1W6UA 4QU5A 4NNPA 3WHLA 5ITWA 2EGUA 3FR7A 2HY7A 4RTPA 4M7PA 1PV4A 3AOEC 1HC7A 5EESA 3B6MA 1FMCA 1H1LA 3DC7A 3OD1A 4NCJA 1JF8A 3LUCA 4WRRA 3U4MA 3BXPA 5L3QB 1ITZA 1E5LA 3K6SA 3D4NA 3W3AA 4MS3B 1KJJA 3LUBA 3SBOA 1PCXA 1FSFA 4R68A 3TPZA 5FA6A 4HAOA 4C0LA 1R0XA 3OPQA 5IAOA 3CVXA 1YMVA 3EXIA 4G1EB 4TTQA 1Y1KE 2D3WA 1J20A 1F6BA 2DY0A 4WJLA 4DCPA 5FUBA 3CVUA 2C2YA 1XZ8A 1XLTC 3NOXA 2X0IA 3ETDA 2B99A 4QU8A 1B23P 3KLPX 3CBGA 1D0VA 1WR8A 2A4KA 1JG6A 4E4YA 4JBNA 2FU5C 1MOPA 2Z8XA 3AEYA 1EWRA 2WJVA 3A31A 3BCSA 3RJTA 2PA3A 4C0XA 1LLQA 2Q1UA 3P0HA 1CJKC 3VR0A 1KEPA 1WD7A 1EK5A 4Z4HA 1VHDA 2NP7A 2H29A 3NRCA 3IKJA 4U8HA 5L95A 3L0BA 1NE7A 1WHSA 3RUIA 4AZSA 2VJMB 2B7BA 3GLFA 4CEJA 3REOA 5KAPA 3NBFA 1Y7HA 2HLHA 1FTYA 4YX9A 4DDUA 2QAJA 2PO5A 1YE3A 2A78A 1C3EA 4MPDA 4DIBA 3VYWA 3U09A 3F2VA 1Z29A 2X0NA 4YCCA 1O9HA 1U31A 2J9YB 2VNAA 1BQ3A 1JLLB 5TPWA 1E3EA 4MJXA 3MCVA 4NH0A 2NZUG 4UDYX 3Q7EA 4AWAA 4D0GA 4TS9A 4UM9D 4BZZA 2EYUA 2FG5A 4WADA 1DKOA 5DH9A 5LZ7A 3VYRB 4DREA 1YRAA 2G9NA 1XCJA 4R6WA 5JATA 5FP0A 1PWXA 3UV6A 1AKVA 4HZGA 1RYHA 1E0JA 2XCOA 1H6BA 2AJDA 1TT7A 1MIOA 3TZ6A 2OY0A 4ZV4A 3ENQA 3SIRA 5KTSA 1M5UA 3IJPA 4XDGA 4R9RA 3EGWA 2W6PA 4QBFA 4U2DA 2Y1GA 4U7TB 2CDCA 5DGDA 4U9HS 2FMHA 4WERA 3JRXA 4CXMA 4GL2A 3OKAA 2IZ0A 4S05A 4LKOA 3TINA 3LVFO 4E15A 4MVJP 3TG2A 3H9CA 1I4OA 1GADO 3QJ5A 4Q9IA 5JS1A 2JJ2D 1MU0A 3D4LA 2BSAA 3KTDA 3HR8A 4BFZA 3KOWA 3X1DA 4G1CA 3P27A 3TBHA 1RS0A 3OCZA 3TLZA 2IZOA 3WK8A 3WK4A 1ZGGA 5JVDB 3M6VA 3A1EA 3AIIA 1GZ3A 1LDEA 1QBGA 5EN4A 5LC1A 1RJGA 1NQWA 3ROXA 1BQEA 4BNUA 1XF9A 3WGUA 1BVRA 4DCVA 1SD1A 1BEEA 2WOJA 3KD3A 3GJ4A 4BAZA 4Q9NA 3KSRA 3K6SB 3K2BA 3IEUA 2IYOA 4P4SA 1EX1A 1JLSA 1VKRA 3RSZA 4Q16A 1EZZA 3UW3A 4LW8A 1WDLA 4JI5B 3ZDRA 2C5HA 4PSUA 3RARA 3F6PA 1J6UA 4EHLA 1LW7A 4KUGA 5GVRA 4A1FA 4S0XA 4JWTA 2ACKA 2X4IA 1N3BA 1BA3A 1SU6A 3C1OA 4EG3A 5JWRA 2QTZA 1RHQA 2GM3A 2HHLA 3GLVA 3I9V1 1CR1A 4GX1A 3T4PA 2OXIA 5GZ3A 1ZLYA 4CF6A 2VYVA 3JQ7B 1I5OA 2PQMA 2D74A 2Q3CA 3G2OA 1Q2XA 3NGXA 3AEQB 3JQAB 1ISRA 3M5DA 3RVJA 1SBZA 3OEEA 5H4GA 3IP3A 5I5GA 3Q7PA 5GM2A 3KE9A 4DS3A 4R9NA 1GGHA 3BIXA 1KJIA 3LVRE 2YR0A 2OFXA 3WYCA 1QQ5A 1N5LA 3QLVC 2Y2UA 2Q8PA 1M1NB 2AMYA 3D9QX 1USKA 1JFLA 3QK7A 5BYJA 3LXUX 4MW5A 3U2QA 2C1EA 1SG9A 3MMZA 3DMYA 4QLOA 1MH9A 4OP3A 5EHXA 1KJ8A 1YFLA 4JJGA 2QVXX 2NPOA 1I24A 2TSYB 3DE7X 2OAGA 4I5GA 3KB1A 1QGYA 3FLAA 1MX9A 1AK2A 1TEVA 2BFDA 1IPFA 3FYUC 4BUCA 3WFIA 1FXWA 2ODQA 2TMDA 3BGOS 3FI9A 3PZRA 4NENA 4DY6A 5F98A 2CMKA 1ONNA 2YV2A 3CBQA 2WHQA 4IVNA 1ZZGA 1ZSYA 4S1TA 3TI7A 1NQUA 4N3AA 2JCSA 4MCIA 2VF2A 3KKMA 4C5AA 3M6IA 1N4AA 3E5NA 1CXZA 1RE0A 1CEYA 1Y63A 2B78A 5FWNA 5JCPA 1TI7A 2O4CA 1NLYA 2X8BA 5FLYA 4BMDA 4IZ6A 2D4AA 4DDHA 1CFJA 3U6KA 1YQWA 5ESWA 3H04A 1IH8A 1CNMA 1K6MA 1ZBDA 4IDPA 2WWGA 3F4LA 3FI0A 2X0EA 4KRXA 3CLUD 2ZYAA 4MGIR 4CCAA 1KZ4A 4REMA 2HJSA 2GD1O 3A6FA 1A7KA 4P4LA 1DV1A 2H63A 5K3BA 5BUSA 3FOEC 4JVLA 4V1CA 3ZU6A 2WJ4A 2ZJ3A 2Z8YM 1XPOA 3U3RA 4EGSA 4ZOBA 4LDNA 4XJVA 2YVLA 2LR0A 3PFWO 4JLPA 4OL9A 4I19A 4IDAA 4YRGA 5C1BA 3HKCA 2P62A 3HBMA 4EGCB 2VNSA 1JG1A 1P18A 3D3JA 1PVDA 4Q9KA 5D3MA 1ECBA 2JBWA 2W2OA 1H0SA 3W04A 4UDOA 2BCEA 1YCHA 2G9QA 2VEDA 2WOOA 4JN6B 4UHCA 3T5BA 1W34A 2H1VA 3PCXA 5E0OA 3USZA 4DV5B 1GG2A 3KG2A 4P3XA 4ZXPA 2P9TA 4ZYYA 4HDMA 4Q4AA 5TE9A 2OBMA 4DQLA 1Q6ZA 3FHJA 3WGKA 2R66A 3KT8A 2YN2A 1L7EA 4XVHA 3RNLA 3WYBA 4NJEB 3L4KA 1Z5NA 4PC7A 2FWPA 5AW2A 1MJFA 2F43B 1BDHA 1AXGA 1A27A 4RW0A 1UC5B 5JHHB 2GPTA 3II6X 1UP6A 3K9NA 3TMKA 4CVNA 2AKEA 1PL7A 4KUEA 4IZOA 1EFAA 3KCNA 1E3MA 4N48A 2RHBA 2Y0PA 5K3FB 3SP1A 1VC2A 1I8TA 2WG1A 4PRZA 5H4HA 3R5SA 3CR3C 3V1YA 5JLJA 5F3DA 1D1PA 1YKSA 3I4CA 4IOJA 1W1IA 5AVKA 5B3KA 1QF9A 2HIAA 1U9JA 2C3UA 2ZTLA 3KLOA 2IGTA 1ZJ5A 2PX3A 4E7PA 2WPDA 4HNGA 2Q6IA 2VP3A 2FPPA 4PNHA 4Q7MB 5AXCA 1Y7LA 1S9HA 3LPNA 2YRWA 1I3LA 3ZKWB 1YQTA 4N41A 3LCVB 5JXIA 2FMUA 2BD0A 4GHWA 1TCVA 3T7CA 5DTRA 2JI4A 2VF8A 1JSCA 3E4CA 4BDSA 2FP4A 1QC5B 1QOPB 1HL7A 4K9SA 1HYGA 2TECE 2DM6A 3NP9A 4QQRA 3DJYA 5KMGA 3TG8A 4AQYB 3ZDDA 1TADA 5LDHA 4J7AA 1CF9A 1T36B 4GE0A 5TARA 3UFXA 2FX3A 2ORED 3W5VA 4URYR 4DLKA 3HN2A 4DR1B 1YR7A 4B79A 1ZMXA 2UVPA 3CFYA 3WL7A 1RCUA 2Q3FA 2IELA 1T8UA 3PYLA 1TIKA 1VKZA 2C00A 4Q1EA 1YKFA 4C7BA 4R8SA 4C76A 2WJHA 1KAEA 3LUAA 4EEXA 1PFUA 4JAVC 4PPYA 5DHFA 2M32A 3PQEA 1H0KA 1B3RA 4CV0A 1CY2A 3LHIA 1J2EA 3QIVA 3CKMA 4OLJA 4MVJD 2KPOA 2BM0A 2ZXFA 3T5MA 2FJ0A 2JI7A 3AOEA 3WTCA 2QLFA 1NVMB 4ZTBA 3VPDA 2AYYA 4MPJA 1QUFA 2ZIFA 3IIEA 2FSVC 3SQNA 1N0IA 1R6UA 4B71A 4WZBE 1I1QB 3DYIA 4YCDA 4MV6A 2RARA 3EGDB 2XOKA 3CX6A 2XKJE 2R68A 1P4RA 3HY3A 1F5SA 5GIOE 5B6PA 4B4VA 1QOQB 1KDVA 4AK9A 2HV8A 3K1AA 3H11B 3D6NB 3OTQA 3S8MA 4DOMA 5CVTA 3WJ7A 2YBEA 4K1XA 3KT3A 1UKBA 1KMQA 1MX5A 1ZDMA 2AEFA 3E3OA 3PHIA 5A3RA 1HT0A 1EXDA 2F8TA 1VPEA 4W1QA 4JCOA 2ZJ1A 1CQPA 4L95C 5AHRA 3W1WA 1Q57A 2V6IA 4RHCA 3UCXA 4YRQA 3UAGA 3LQ4A 2R8EA 5EWLA 3VPXA 1QP0A 1X1EA 2J5RA 4XYMA 1B76A 1FY2A 3T4XA 2K6GA 3HL4A 4X71A 4FFSA 3EMKA 4IH4A 4CI9A 1M6WA 4ZAXA 5KX5A 5M29A 3H8VA 3OZDA 2R6DA 4EPXA 1ILWA 3HM2A 5EIFA 4HCJA 3O3MB 3SVZA 2JD0A 2OOKA 1STOA 3DE5X 1WZNA 1E3WA 1S2MA 4PGFA 4Q3KA 4YJ2B 3GLHA 5DYGA 3D7KA 3R5HA 1VI5A 2LZ0A 3DP9A 3BWEA 4OOEA 4WXYB 3SX4A 3R9XB 2CCKA 2P9YA 4BO4A 4NXNB 2JK0A 4U6NA 5IUKC 2HHJA 3AONB 4JENA 1G8FA 2PPLA 4YUWA 3I32A 4LJ5A 4URFA 2WEKA 4A10A 5EJMA 1XKXA 4X5OA 2YC2C 1T8TA 3GUVA 4GBJA 1VCIA 1JE1A 1X80B 5HM8A 1G20B 3BT7A 5HF9A 4ZV7A 5HIIA 1JFTA 5KYUB 4R41A 2OQVA 2E5WA 2FP4B 2ZU0C 4BNDA 3EXHC 4RFSB 1XNJA 3DOFA 4UPDA 3AV0B 4YMWA 5DIZA 5JJBA 1XJCA 1LZLA 3RC9A 3ON5A 4BGIA 2VO1A 4G5XA 4GZ5A 4PX9A 3DCJA 5A5VA 4PX5A 4YQZA 5IEJA 2ALJA 3OQJA 2B8WA 3GP3A 2CWWA 4BFCA 5IKPA 2VQ6A 4UQOA 1MW8X 3E22A 4C03A 3RS4A 2ZYRA 5BT8A 1E7YA 4MO2A 4EBFA 5HDQA 3PC7A 3S3TA 4ZIRA 1GFZA 3LQQA 1QV7A 1UBFA 1QZ3A 2VDWA 2OA0A 4JBWA 1U8ZA 3V34A 4NBKA 1HFWA 3VR3D 4DIFA 1DIRA 5JQWA 3CSDA 2QMHA 1TEXA 4JLBA 3O73A 1I9CA 3BREA 5DFAA 4ZRMA 4PE5B 5FAKA 1ZUWA 4XFDA 4RIEA 3FTEA 4M9SA 1X1TA 1A2OA 4HFNA 1U2RA 4FCVA 2IYVA 4BLWA 2AL7A 5LFAA 1QIGA 2YRXA 1FPMA 2BV3A 1K27A 1MEEA 4EVRA 4C4PA 3QELA 4I1VA 4ENRA 4J94A 4KXNA 4LPSA 4YRRA 3ESXA 5GONB 121PA 3AI2A 3NAMA 3P8ZA 1DQNA 4ND8B 1J1ZA 2XF8A 4GE3A 2Y1KA 4YALA 4ZVPA 4A2QA 4F71A 2OAP1 4LOHA 5BUZA 4TMYA 1W2GA 4CEHA 4A8JA 1SK8A 5CLGA 3THOA 2P2ZA 4JIMA 1YS2X 3WISA 1J23A 3BORA 1T8WA 3W3AD 2HRBA 3LMKA 1L0BA 2MR5A 3CUSA 2IU0A 3HO6A 4CW7A 2GHQA 3WNQA 3VI4B 4ZEMA 2DTEA 1ZH4A 4QIHA 1XN4A 3HY4A 4Z7NB 4ZAZA 4DQDA 3EZLA 3E18A 1ISJA 3I8OA 2ZZMA 2JJ1A 1K6XA 4IF6A 4QDOA 5K0NA 5KNDD 3AHJA 4IWYA 5KOHB 3V7FA 1PT9A 4ARAA 1DG9A 5GTDA 2EW1A 3LECA 3IAS1 2ICAA 2NTYC 2D1RA 3EDYA 3I6ZA 1M6EX 2O1SA 3VH1A 3ACBA 1BYUA 2PIDA 1BW9B 4Z9AA 2OFFA 3TJMA 4EY7A 6REQB 3J7AC 5EMLA 2G80A 1L4FA 3W9YA 1YJ8A 4EMTA 3QPUA 1CX9B 3C5WP 4EF4A 5HKOA 2P9GA 2WJAA 1FPQA 4P4GA 4K6GA 2CNWD 4JQCA 1A77A 3O8RA 2B98A 1ID8A 2NUBA 3KSAC 1J42A 1B8NA 4P31A 4OJQA 1Q22A 1QK5A 1J8VA 3CZ4A 1QVVA 3I2IA 2UVQA 4J07A 3BSSA 2QGFA 4BQRA 1UPUA 2CD9A 3WOVA 1ZMOA 2P0AA 4JX9A 5EFOA 4YUVA 1Z7GA 5I48A 2IS2A 5FQOA 1E5VA 4YAUA 4QEKA 1XHLA 3ROQA 1ZGBA 4TOIA 2D2XA 1GL9B 3L7KA 4TL9A 3BMXA 4G5FA 3V55A 4CV2A 4Z53A 2P1ZA 1NMYA 2ZPUA 1AH2A 3MQ4A 5HF5A 4CM3A 3HHPA 4N5HX 1Z82A 3VZPA 2YX1A 2LDXA 4H1VA 3LZDA 1KWGA 4CQNA 3HM9A 3RVPA 4ZOLF 2LTAA 2HTFA 2PYIA 3HWSA 4NK5A 5DBOA 2O8DA 4P0QB 2QUJA 3HB1A 4D9KA 1SXIA 2CV0A 1H93A 1SRRA 3FCUB 4NHOA 1LBEA 4GR9A 5DEIA 3WGYA 3ZWWA 2PDAA 2DWOA 4TMWA 1Y3HA 1C7JA 3LA8A 2GEVA 3LCJA 3M3PA 4ITVA 1QK4A 2AUNA 3IDZA 4ZVNA 4EB8A 4PNEA 3D3NA 1HLPA 3G49A 1QE0A 2DLCX 3SS7X 3AFNA 3EGXB 2F3PA 1IBCA 4FT4A 5I9NA 2E9SA 3ORFA 2EKLA 3CU5A 4EA6A 1E0SA 1CEEA 4WY5A 5C4IA 1X7WA 1YQ9A 1OZFA 3GA0A 3QTBA 4KIUA 3KEQA 2V3CC 5SZKB 3O4IA 1XDSA 2ECPA 2OZVA 1G41A 2RJNA 3HR4A 4Y6PA 4EHDA 1V16B 3C7KA 5LP6F 4F21A 4LOAA 3VVMA 3HXMA 3ZBTA 1OAOA 4XX0A 4B2YA 4QA9A 5H70A 1P2FA 2C59A 1IOVA 1MRSA 4IOKA 1KH3A 3GA5A 1D7OA 2O2JA 3CT4A 1IN1A 4YAWA 1N8SA 3H1FA 4EB3A 1S7CA 3OICA 3SE0A 4KQXA 1KO4A 2Y92A 4MYSA 1T8PA 1IRIA 1Z25A 1LJ8A 1Z47A 1WHTA 2WZCA 3DQQA 4RIFA 4N0PA 3KFVA 4XYGA 2NZJA 4A3SA 2HADA 5LPNA 4FWBA 4F1JA 2GN0A 3ZGZA 1TC1A 2ZAYA 3AZPA 4MNTA 1N0WA 4UREA 5HGXA 1N2EA 4QPZA 2WJGA 3GJ0A 1D04A 4XGKA 4ZVUA 3DXZA 3DT9A 5I6DA 1E0AA 4D3DA 3BXEA 5ISMA 4ZVSA 2VHJA 1KXZA 5DI9A 4EYSA 2OPHA 4IDFA 3JR3A 1GM5A 1PKEA 5BVGB 2PVPA 4TRRA 2O59A 1NPDA 1Z0IA 3GI1A 2IYAA 2LCIA 4P53A 3ZV5A 3TCNA 2RKWA 4JR0A 4QNRA 3QGMA 1NUAA 2P0YA 4GMGA 1DIBA 4YGXB 2ZRGA 5IKEA 3RAEC 1DQRA 2AVDA 3NBUA 1A69A 2GPJA 1P2SA 2GRUA 4E1AA 4P5DA 4C3UA 1NVBA 4WXHA 4CKZA 1YQXA 3GUYA 4CNQA 1ZD5A 2YV3A 1S2NA 2NYVA 1FX0B 3T9FA 4AY4A 721PA 3OEHA 1JIVA 4UMEA 3C1AA 4UXIA 3F7OA 3ZWPA 5I8PA 2QD1A 4L4XA 2ATIA 4JL5A 4L5YA 3FRHA 1SPBS 4CN9A 1SK9A 2B5WA 5C4GB 1W2HA 1RRPA 2C7BA 3H2SA 3MXOA 3RC1A 3P2JA 1KMNA 2FPIB 2FEWB 2G71A 4FBMA 4HKTA 2Q5JA 4J4HA 3IKMB 1N9GA 1C0KA 5K4HA 2QD2A 3IBGA 1NV9A 1LBIA 1T5LA 2IZ5A 3LCRA 4IV8A 4MWCA 5A4JA 3MTBA 2PZGA 4R54A 4RWZA 3REGA 5F35A 3WWOA 5BY2A 5AM3A 1GNPA 4TYWA 1JXQA 1PJLA 4JGBA 1PJCA 5AI9A 2PX8A 4HNHA 3OQ1A 2J4CA 1SU4A 3WQRA 1JZTA 1K7FB 3Q4GA 1I9GA 3QVLA 3F4BA 2G9UA 3JWIA 3R6DA 4GPZA 3HJRA 4IZIA 5JRDS 4KGVA 5A62A 1KP2A 5IMBA 3Q8KA 2CGEA 4LY0A 4AX8A 3FCSB 4PFKA 3MAJA 3CEAA 1SOVA 1ZXXA 3AR2A 3UMVA 1WQ3A 5IDVA 4AXBA 1HMYA 3IIIA 2C9ZA 3E35A 2C54A 2Y8EA 3MTAA 4RADA 3HLTA 5FPHA 3KOXA 4JLUA 3T1NA 4BMOB 4F2HA 2A9QA 4O29A 5KCMA 3WADA 1Y34E 2G06A 4AWXA 2GXAA 3E23A 4JQZA 3DH0A 2BGRA 4ADSG 1FLAA 4XPZA 2R6AA 4AY5A 1SA0B 1Z4NA 2GFQA 1HDOA 1ZNYA 4QODA 3RJZA 3ZDFA 1T1GA 4MQFB 2BGLA 2F17A 5HILA 4AYXA 1TMKA 2PY6A 4G81A 4A36A 3ND7A 2BGNA 1NSFA 3WRWA 4FJ2A 2CZCA 2J3JA 4TWAA 3S5JA 5M7EA 4PHCA 1UPAA 3O6VA 3SBDA 1EFVB 3DXYA 1G5RA 4MO9A 4MUBA 4ASUD 2IYFA 3BIWA 4MR9A 3HV2A 3WRYA 2CXQA 2I3BA 1QYXA 2XQVA 4DM3A 1FDVA 3QXSA 4PIMA 4HBZA 1SNYA 4ZAWA 2FOLA 5CCEA 1O6CA 1Z8NA 1TIPA 4GC5A 4OB6A 3F6RA 4RA9B 2P2CA 1AB6A 4RD2A 3OPYI 2BMVA 4ZCSA 3MWLA 3SSAA 1Z9BA 1W1WA 4X20A 3HXTA 2Z2XA 3A3OA 3OIWA 1QV9A 4RKRA 1PGPA 4MS1B 1IQPA 4PCLA 5GWXA 4F6RA 5SY9A 3TX2A 3W34A 1CR2A 5ILGA 3TD2A 4WZ6A 4EBBA 1MMFB 3V2IA 1XXHE 5IF9A 5DEOA 2F3SA 4ABYA 1Z3IX 1EUCA 4Q9AA 3BIFA 2FXIA 2FPIA 3Q6IA 4NIMA 5CDSA 1EVQA 4DABA 1JJ7A 5H0IA 4E13A 2Z4SA 2IFTA 4HDKA 1UM8A 2HSEA 4QUIA 4RXMA 3PDJA 4UCFA 4BZWA 1TJ3A 3PT5A 5EJGA 1H4TA 5HFNA 2BSXA 1NUTA 2WV9A 5DYTA 3OD5A 2D1QA 1E60A 1C8VB 3NT2A 4NV0A 1S8AA 4ZJPA 2FSUA 2HLPA 3QHPA 1D1SA 3QUCA 3PJDA 4R2LA 4U3JA 4XJTA 3ZHOA 1E63A 4D4IA 4F6CA 5JTUA 2ES4A 3FBTA 4C6SA 1MCZA 4IDGA 3SEQA 5ALVA 4GKKB 1GZ5A 4PTZA 4YRPA 2FG6C 1QKIA 1Y6ZA 5FORA 2VQSA 3ZLVA 2K5UA 1O5OA 2UUPA 1EXNA 5CFRA 4J7CA 1G63A 3A6EA 1IONA 4ZHQF 3RUEA 3LQRA 1FCJA