4ORBA

Crystal structure of mouse calcineurin
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
462
structure length
377
Chain Sequence
TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSSFEEAKGLDRINERMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit al
publication title Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
rcsb
source organism Mus musculus
molecule tags Hydrolase/metal binding protein
total genus 137
structure length 377
sequence length 462
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4orbA00
5INBA 4V0WA 3AUZA 2WDCA 3QFMA 4IYPC 3IB7A 3HVQA 4UT3B 4H2BA 3H60A 5IOHA 2O8GA 1JK7A 2IE4C 4ORAA 2Z1AA 3IVDA 4H1YP 3H62B 2HY1A 2AHDA 3LL8A 4DHLA 2A22A 1OIEA 3IB8A 4H2FA 5B8IA 5F3WA 3PSNA 4ZX2A 5C1VA 5JJTA 5J28A 2GJUA 2XMOA 4FBKA 3EGHA 1G5BA 3DSCA 4MP0A 4DT2A 3QFNA 3QFOA 4WWLA 3PSOA 4H1SA 1S8EA 1V73A 4I5LC 2KKNA 2NPPC 4V0VA 3THOB 1Z2XA 1SU1A 1S3MA 4TUGA 5DNYA 2WDEA 3JYFA 3ZTVA 4O43A 3ZU0A 1MF8A 2ZBMA 3H64A 2P6BA 2NYMC 4LTYA 3RL3A 3THNA 3H66A 1OIDA 1KBPA 1W24A 4FBWA 2NXFA 4I5NC 4KKZA 3E7AA 3KBPA 2BCDA 3QG5C 4V0XA 1S3NA 4XPNA 4TUIA 3N5UA 3H61A 2BDXA 2USHA 4JA7A 4OR9A 4KBPA 1FJMA 3H67A 4HD0A 4H2IA 4B2OA 2WDDA 2DFJA 3GVEA 3K7VC 4M0VA 1HPUA 3IVEA 1T70A 1UTEA 3K7WC 1Z2WA 2BQ8X 1NNWA 4UT3A 3P71C 1II7A 4UWQA 1AUIA 4H2GA 4J6OA 4JA9A 4FBQA 5JPEA 1S3LA 2JOGA 2IE3C 2Q8UA 2QFPA 4ORCA 4LACC 5EQVA 3DSDA 2YVTA 1UF3A 4LU9A 4MOVA 4O4KA 1WARA 1M63A 1IT6A 3C5WC 2CV9A 2QFRA 1HP1A 2Z72A 5GTUA 1T71A 1HO5A 3V4YA 2QJCA 3ICFA 1S95A 3EGGA 2HYOA 1S70A 4DSYA 4O24A 1XZWA 4Q7FA 1U32A 2IAEC 3E7BA 3AV0A 3H68A 3RQZA 3H63A 1WAO1 2R17A 4MOYA 3T1IA 5HPEA 3H69A 3RL4A 3RL5A 3TGHA 2Z06A 4ORBA 4NZVA 2HYPA 1USHA 2O8AA 4IL1A 4UT2A 3FGAC 2NYLC 3CK2A 1OI8A 1QFCA 2WDFA 3C9FA 1XM7A 3QFKA 4G9JA 1TCOA 4FCXA 3DW8C 5JPFA 4YKEA 4O5GA 1QHWA 4ZVZA 4F0ZA
chains in the Genus database with same CATH superfamily
5INBA 4V0WA 3AUZA 2WDCA 3QFMA 4IYPC 3IB7A 3HVQA 4UT3B 2ZOAA 4H2BA 3H60A 5IOHA 2O8GA 1JK7A 2IE4C 4ORAA 2Z1AA 3IVDA 4H1YP 3H62B 2HY1A 2AHDA 3LL8A 4DHLA 2A22A 1OIEA 3IB8A 4H2FA 5B8IA 5F3WA 3PSNA 4ZX2A 5C1VA 5JJTA 5J28A 2GJUA 2XMOA 4FBKA 2DXLA 3EGHA 1G5BA 3DSCA 4MP0A 4DT2A 3QFNA 3QFOA 4WWLA 3PSOA 4H1SA 1S8EA 1V73A 4I5LC 2KKNA 2NPPC 4V0VA 3THOB 1Z2XA 1SU1A 1S3MA 4TUGA 5DNYA 2WDEA 3JYFA 3ZTVA 4O43A 2YEQA 3ZU0A 1MF8A 2ZBMA 3H64A 2P6BA 2NYMC 4LTYA 3RL3A 3THNA 3H66A 1OIDA 2ZO9B 1KBPA 1W24A 4FBWA 2NXFA 4I5NC 4KKZA 3D03A 3E7AA 3KBPA 2BCDA 3QG5C 4V0XA 1S3NA 4XPNA 4TUIA 3N5UA 3H61A 2BDXA 2USHA 4JA7A 4OR9A 4KBPA 1FJMA 3H67A 4HD0A 4H2IA 4B2OA 2WDDA 2DFJA 3GVEA 3K7VC 4M0VA 1HPUA 3IVEA 1T70A 1UTEA 3K7WC 1Z2WA 2BQ8X 1NNWA 4UT3A 3P71C 1II7A 4UWQA 1AUIA 4H2GA 4J6OA 4JA9A 4FBQA 5JPEA 1S3LA 2JOGA 2IE3C 2Q8UA 2QFPA 4ORCA 4LACC 5EQVA 3DSDA 2YVTA 1UF3A 4LU9A 4MOVA 4O4KA 1WARA 1M63A 1IT6A 3C5WC 2CV9A 2QFRA 1HP1A 2Z72A 5GTUA 3E0JA 1T71A 1HO5A 3V4YA 2QJCA 3ICFA 1S95A 3EGGA 2HYOA 1S70A 4DSYA 4O24A 1XZWA 4Q7FA 1U32A 2DXNA 3FLOA 2IAEC 3E7BA 3AV0A 3H68A 3RQZA 3H63A 1WAO1 2R17A 4MOYA 3T1IA 5HPEA 3H69A 3RL4A 3RL5A 3TGHA 2Z06A 4ORBA 4NZVA 2HYPA 1USHA 2O8AA 4IL1A 4UT2A 3FGAC 2NYLC 3CK2A 1OI8A 1QFCA 2WDFA 3C9FA 1XM7A 3QFKA 4G9JA 1TCOA 4FCXA 3DW8C 5JPFA 4YKEA 4O5GA 1QHWA 4ZVZA 4F0ZA
chains in the Genus database with same CATH topology
5INBA 4V0WA 3AUZA 2WDCA 3QFMA 4IYPC 3IB7A 3HVQA 4UT3B 2ZOAA 4H2BA 3H60A 5IOHA 2O8GA 1JK7A 2IE4C 4ORAA 2Z1AA 3IVDA 4H1YP 3H62B 2HY1A 2AHDA 3LL8A 4DHLA 2A22A 1OIEA 3IB8A 4H2FA 5B8IA 5F3WA 3PSNA 4ZX2A 5C1VA 5JJTA 5J28A 2GJUA 2XMOA 4FBKA 2DXLA 3EGHA 1G5BA 3DSCA 4MP0A 4DT2A 3QFNA 3QFOA 4WWLA 3PSOA 4H1SA 1S8EA 1V73A 4I5LC 2KKNA 2NPPC 4V0VA 3THOB 1Z2XA 1SU1A 1S3MA 4TUGA 5DNYA 2WDEA 3JYFA 3ZTVA 4O43A 2YEQA 3ZU0A 1MF8A 2ZBMA 3H64A 2P6BA 2NYMC 4LTYA 3RL3A 3THNA 3H66A 1OIDA 2ZO9B 1KBPA 1W24A 4FBWA 2NXFA 4I5NC 4KKZA 3D03A 3E7AA 3KBPA 2BCDA 3QG5C 4V0XA 1S3NA 4XPNA 4TUIA 3N5UA 3H61A 2BDXA 2USHA 4JA7A 4OR9A 4KBPA 1FJMA 3H67A 4HD0A 4H2IA 4B2OA 2WDDA 2DFJA 3GVEA 3K7VC 4M0VA 1HPUA 3IVEA 1T70A 1UTEA 3K7WC 1Z2WA 2BQ8X 1NNWA 4UT3A 3P71C 1II7A 4UWQA 1AUIA 4H2GA 4J6OA 4JA9A 4FBQA 5JPEA 1S3LA 2JOGA 2IE3C 2Q8UA 2QFPA 4ORCA 4LACC 5EQVA 3DSDA 2YVTA 1UF3A 4LU9A 4MOVA 4O4KA 1WARA 1M63A 1IT6A 3C5WC 2CV9A 2QFRA 1HP1A 2Z72A 5GTUA 3E0JA 1T71A 1HO5A 3V4YA 2QJCA 3ICFA 1S95A 3EGGA 2HYOA 1S70A 4DSYA 4O24A 1XZWA 4Q7FA 1U32A 2DXNA 3FLOA 2IAEC 3E7BA 3AV0A 3H68A 3RQZA 3H63A 1WAO1 2R17A 4MOYA 3T1IA 5HPEA 3H69A 3RL4A 3RL5A 3TGHA 2Z06A 4ORBA 4NZVA 2HYPA 1USHA 2O8AA 4IL1A 4UT2A 3FGAC 2NYLC 3CK2A 1OI8A 1QFCA 2WDFA 3C9FA 1XM7A 3QFKA 4G9JA 1TCOA 4FCXA 3DW8C 5JPFA 4YKEA 4O5GA 1QHWA 4ZVZA 4F0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5INB A;  4V0W A;  3AUZ A;  2WDC A;  3QFM A;  4IYP C;  3IB7 A;  3HVQ A;  4UT3 B;  4H2B A;  3H60 A;  5IOH A;  2O8G A;  1JK7 A;  2IE4 C;  4ORA A;  2Z1A A;  3IVD A;  4H1Y P;  3H62 B;  2HY1 A;  2AHD A;  3LL8 A;  4DHL A;  2A22 A;  1OIE A;  3IB8 A;  4H2F A;  5B8I A;  5F3W A;  3PSN A;  4ZX2 A;  5C1V A;  5JJT A;  5J28 A;  2GJU A;  2XMO A;  4FBK A;  3EGH A;  1G5B A;  3DSC A;  4MP0 A;  4DT2 A;  3QFN A;  3QFO A;  4WWL A;  3PSO A;  4H1S A;  1S8E A;  1V73 A;  4I5L C;  2KKN A;  2NPP C;  4V0V A;  3THO B;  1Z2X A;  1SU1 A;  1S3M A;  4TUG A;  5DNY A;  2WDE A;  3JYF A;  3ZTV A;  4O43 A;  3ZU0 A;  1MF8 A;  2ZBM A;  3H64 A;  2P6B A;  2NYM C;  4LTY A;  3RL3 A;  3THN A;  3H66 A;  1OID A;  1KBP A;  1W24 A;  4FBW A;  2NXF A;  4I5N C;  4KKZ A;  3E7A A;  3KBP A;  2BCD A;  3QG5 C;  4V0X A;  1S3N A;  4XPN A;  4TUI A;  3N5U A;  3H61 A;  2BDX A;  2USH A;  4JA7 A;  4OR9 A;  4KBP A;  1FJM A;  3H67 A;  4HD0 A;  4H2I A;  4B2O A;  2WDD A;  2DFJ A;  3GVE A;  3K7V C;  4M0V A;  1HPU A;  3IVE A;  1T70 A;  1UTE A;  3K7W C;  1Z2W A;  2BQ8 X;  1NNW A;  4UT3 A;  3P71 C;  1II7 A;  4UWQ A;  1AUI A;  4H2G A;  4J6O A;  4JA9 A;  4FBQ A;  5JPE A;  1S3L A;  2JOG A;  2IE3 C;  2Q8U A;  2QFP A;  4ORC A;  4LAC C;  5EQV A;  3DSD A;  2YVT A;  1UF3 A;  4LU9 A;  4MOV A;  4O4K A;  1WAR A;  1M63 A;  1IT6 A;  3C5W C;  2CV9 A;  2QFR A;  1HP1 A;  2Z72 A;  5GTU A;  1T71 A;  1HO5 A;  3V4Y A;  2QJC A;  3ICF A;  1S95 A;  3EGG A;  2HYO A;  1S70 A;  4DSY A;  4O24 A;  1XZW A;  4Q7F A;  1U32 A;  2IAE C;  3E7B A;  3AV0 A;  3H68 A;  3RQZ A;  3H63 A;  1WAO 1;  2R17 A;  4MOY A;  3T1I A;  5HPE A;  3H69 A;  3RL4 A;  3RL5 A;  3TGH A;  2Z06 A;  4ORB A;  4NZV A;  2HYP A;  1USH A;  2O8A A;  4IL1 A;  4UT2 A;  3FGA C;  2NYL C;  3CK2 A;  1OI8 A;  1QFC A;  2WDF A;  3C9F A;  1XM7 A;  3QFK A;  4G9J A;  1TCO A;  4FCX A;  3DW8 C;  5JPF A;  4YKE A;  4O5G A;  1QHW A;  4ZVZ A;  4F0Z A; 
#chains in the Genus database with same CATH topology
 5INB A;  4V0W A;  3AUZ A;  2WDC A;  3QFM A;  4IYP C;  3IB7 A;  3HVQ A;  4UT3 B;  2ZOA A;  4H2B A;  3H60 A;  5IOH A;  2O8G A;  1JK7 A;  2IE4 C;  4ORA A;  2Z1A A;  3IVD A;  4H1Y P;  3H62 B;  2HY1 A;  2AHD A;  3LL8 A;  4DHL A;  2A22 A;  1OIE A;  3IB8 A;  4H2F A;  5B8I A;  5F3W A;  3PSN A;  4ZX2 A;  5C1V A;  5JJT A;  5J28 A;  2GJU A;  2XMO A;  4FBK A;  2DXL A;  3EGH A;  1G5B A;  3DSC A;  4MP0 A;  4DT2 A;  3QFN A;  3QFO A;  4WWL A;  3PSO A;  4H1S A;  1S8E A;  1V73 A;  4I5L C;  2KKN A;  2NPP C;  4V0V A;  3THO B;  1Z2X A;  1SU1 A;  1S3M A;  4TUG A;  5DNY A;  2WDE A;  3JYF A;  3ZTV A;  4O43 A;  2YEQ A;  3ZU0 A;  1MF8 A;  2ZBM A;  3H64 A;  2P6B A;  2NYM C;  4LTY A;  3RL3 A;  3THN A;  3H66 A;  1OID A;  2ZO9 B;  1KBP A;  1W24 A;  4FBW A;  2NXF A;  4I5N C;  4KKZ A;  3D03 A;  3E7A A;  3KBP A;  2BCD A;  3QG5 C;  4V0X A;  1S3N A;  4XPN A;  4TUI A;  3N5U A;  3H61 A;  2BDX A;  2USH A;  4JA7 A;  4OR9 A;  4KBP A;  1FJM A;  3H67 A;  4HD0 A;  4H2I A;  4B2O A;  2WDD A;  2DFJ A;  3GVE A;  3K7V C;  4M0V A;  1HPU A;  3IVE A;  1T70 A;  1UTE A;  3K7W C;  1Z2W A;  2BQ8 X;  1NNW A;  4UT3 A;  3P71 C;  1II7 A;  4UWQ A;  1AUI A;  4H2G A;  4J6O A;  4JA9 A;  4FBQ A;  5JPE A;  1S3L A;  2JOG A;  2IE3 C;  2Q8U A;  2QFP A;  4ORC A;  4LAC C;  5EQV A;  3DSD A;  2YVT A;  1UF3 A;  4LU9 A;  4MOV A;  4O4K A;  1WAR A;  1M63 A;  1IT6 A;  3C5W C;  2CV9 A;  2QFR A;  1HP1 A;  2Z72 A;  5GTU A;  3E0J A;  1T71 A;  1HO5 A;  3V4Y A;  2QJC A;  3ICF A;  1S95 A;  3EGG A;  2HYO A;  1S70 A;  4DSY A;  4O24 A;  1XZW A;  4Q7F A;  1U32 A;  2DXN A;  3FLO A;  2IAE C;  3E7B A;  3AV0 A;  3H68 A;  3RQZ A;  3H63 A;  1WAO 1;  2R17 A;  4MOY A;  3T1I A;  5HPE A;  3H69 A;  3RL4 A;  3RL5 A;  3TGH A;  2Z06 A;  4ORB A;  4NZV A;  2HYP A;  1USH A;  2O8A A;  4IL1 A;  4UT2 A;  3FGA C;  2NYL C;  3CK2 A;  1OI8 A;  1QFC A;  2WDF A;  3C9F A;  1XM7 A;  3QFK A;  4G9J A;  1TCO A;  4FCX A;  3DW8 C;  5JPF A;  4YKE A;  4O5G A;  1QHW A;  4ZVZ A;  4F0Z A; 
#chains in the Genus database with same CATH homology
 5INB A;  4V0W A;  3AUZ A;  2WDC A;  3QFM A;  4IYP C;  3IB7 A;  3HVQ A;  4UT3 B;  2ZOA A;  4H2B A;  3H60 A;  5IOH A;  2O8G A;  1JK7 A;  2IE4 C;  4ORA A;  2Z1A A;  3IVD A;  4H1Y P;  3H62 B;  2HY1 A;  2AHD A;  3LL8 A;  4DHL A;  2A22 A;  1OIE A;  3IB8 A;  4H2F A;  5B8I A;  5F3W A;  3PSN A;  4ZX2 A;  5C1V A;  5JJT A;  5J28 A;  2GJU A;  2XMO A;  4FBK A;  2DXL A;  3EGH A;  1G5B A;  3DSC A;  4MP0 A;  4DT2 A;  3QFN A;  3QFO A;  4WWL A;  3PSO A;  4H1S A;  1S8E A;  1V73 A;  4I5L C;  2KKN A;  2NPP C;  4V0V A;  3THO B;  1Z2X A;  1SU1 A;  1S3M A;  4TUG A;  5DNY A;  2WDE A;  3JYF A;  3ZTV A;  4O43 A;  2YEQ A;  3ZU0 A;  1MF8 A;  2ZBM A;  3H64 A;  2P6B A;  2NYM C;  4LTY A;  3RL3 A;  3THN A;  3H66 A;  1OID A;  2ZO9 B;  1KBP A;  1W24 A;  4FBW A;  2NXF A;  4I5N C;  4KKZ A;  3D03 A;  3E7A A;  3KBP A;  2BCD A;  3QG5 C;  4V0X A;  1S3N A;  4XPN A;  4TUI A;  3N5U A;  3H61 A;  2BDX A;  2USH A;  4JA7 A;  4OR9 A;  4KBP A;  1FJM A;  3H67 A;  4HD0 A;  4H2I A;  4B2O A;  2WDD A;  2DFJ A;  3GVE A;  3K7V C;  4M0V A;  1HPU A;  3IVE A;  1T70 A;  1UTE A;  3K7W C;  1Z2W A;  2BQ8 X;  1NNW A;  4UT3 A;  3P71 C;  1II7 A;  4UWQ A;  1AUI A;  4H2G A;  4J6O A;  4JA9 A;  4FBQ A;  5JPE A;  1S3L A;  2JOG A;  2IE3 C;  2Q8U A;  2QFP A;  4ORC A;  4LAC C;  5EQV A;  3DSD A;  2YVT A;  1UF3 A;  4LU9 A;  4MOV A;  4O4K A;  1WAR A;  1M63 A;  1IT6 A;  3C5W C;  2CV9 A;  2QFR A;  1HP1 A;  2Z72 A;  5GTU A;  3E0J A;  1T71 A;  1HO5 A;  3V4Y A;  2QJC A;  3ICF A;  1S95 A;  3EGG A;  2HYO A;  1S70 A;  4DSY A;  4O24 A;  1XZW A;  4Q7F A;  1U32 A;  2DXN A;  3FLO A;  2IAE C;  3E7B A;  3AV0 A;  3H68 A;  3RQZ A;  3H63 A;  1WAO 1;  2R17 A;  4MOY A;  3T1I A;  5HPE A;  3H69 A;  3RL4 A;  3RL5 A;  3TGH A;  2Z06 A;  4ORB A;  4NZV A;  2HYP A;  1USH A;  2O8A A;  4IL1 A;  4UT2 A;  3FGA C;  2NYL C;  3CK2 A;  1OI8 A;  1QFC A;  2WDF A;  3C9F A;  1XM7 A;  3QFK A;  4G9J A;  1TCO A;  4FCX A;  3DW8 C;  5JPF A;  4YKE A;  4O5G A;  1QHW A;  4ZVZ A;  4F0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...