4ORBA

Crystal structure of mouse calcineurin
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
462
structure length
377
Chain Sequence
TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSSFEEAKGLDRINERMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
rcsb
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit al
source organism Mus musculus
molecule tags Hydrolase/metal binding protein
total genus 137
structure length 377
sequence length 462
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4orbA00
3CK2A 5B8IA 5JPEA 5IOHA 4MOVA 3E7AA 4V0XA 1U32A 5C1VA 3THOB 3DW8C 3DSCA 2USHA 3H64A 4TUIA 4ORCA 3RQZA 2HY1A 1WAO1 1S3LA 3KBPA 1T71A 4FBKA 2O8AA 3JYFA 2CV9A 4IYPC 1S8EA 4KKZA 1NNWA 1QFCA 4DSYA 1OIEA 2WDCA 4LACC 4M0VA 5DNYA 4UT3B 2BDXA 3E7BA 4JA9A 1IT6A 4H2GA 2WDDA 4V0WA 2ZBMA 1Z2XA 3DSDA 2XMOA 2HYOA 1S3MA 1WARA 4O43A 4FCXA 4NZVA 1XZWA 4JA7A 1XM7A 2IE3C 3C5WC 3PSNA 3FGAC 3QFKA 4IL1A 4OR9A 4ORBA 5EQVA 4UT2A 3RL5A 2R17A 4ZX2A 3ZU0A 3IB7A 2BQ8X 4O5GA 4UT3A 3H61A 4V0VA 3H67A 2Z1AA 4XPNA 1G5BA 5F3WA 2WDFA 3K7VC 3QFNA 5J28A 1II7A 3RL4A 2QJCA 4DHLA 2IE4C 1S95A 4MOYA 3THNA 4Q7FA 3P71C 1UF3A 4DT2A 2O8GA 3H69A 4FBQA 3C9FA 4LU9A 1M63A 4O24A 4UWQA 3N5UA 1QHWA 4J6OA 1HO5A 2NXFA 2NPPC 2IAEC 4H2BA 4ZVZA 3EGHA 4FBWA 1UTEA 4H2IA 2BCDA 4O4KA 4H2FA 2Z06A 2P6BA 2WDEA 3H66A 3H60A 3HVQA 2NYMC 4KBPA 3H63A 4G9JA 3ZTVA 4LTYA 3T1IA 4F0ZA 1FJMA 1HP1A 3ICFA 3RL3A 4HD0A 4MP0A 4ORAA 5INBA 3EGGA 3V4YA 5HPEA 4YKEA 1OIDA 3QG5C 3GVEA 4H1YP 5JPFA 1T70A 3AV0A 4WWLA 3TGHA 5JJTA 1TCOA 2AHDA 3K7WC 1HPUA 1KBPA 3QFMA 3IVDA 1Z2WA 4I5LC 5GTUA 3IVEA 2HYPA 2NYLC 2KKNA 2YVTA 3IB8A 3QFOA 2DFJA 1S3NA 3LL8A 2GJUA 3H62B 2QFRA 1W24A 3AUZA 1V73A 1S70A 3H68A 2QFPA 1SU1A 1USHA 2JOGA 1OI8A 2Q8UA 2Z72A 3PSOA 4B2OA 1JK7A 2A22A 4TUGA 1AUIA 1MF8A 4I5NC 4H1SA
chains in the Genus database with same CATH superfamily
3CK2A 5B8IA 5JPEA 5IOHA 4MOVA 3E7AA 4V0XA 1U32A 5C1VA 3THOB 3DW8C 3DSCA 2USHA 3H64A 4TUIA 4ORCA 3RQZA 2HY1A 1WAO1 1S3LA 3KBPA 1T71A 4FBKA 2O8AA 3JYFA 2CV9A 2ZO9B 4IYPC 1S8EA 4KKZA 1NNWA 1QFCA 4DSYA 1OIEA 2WDCA 4LACC 4M0VA 5DNYA 4UT3B 2BDXA 3E7BA 4JA9A 1IT6A 4H2GA 2WDDA 4V0WA 2ZBMA 1Z2XA 3DSDA 2XMOA 2HYOA 1S3MA 1WARA 4O43A 4FCXA 4NZVA 2DXLA 1XZWA 4JA7A 1XM7A 2IE3C 3C5WC 2YEQA 3FGAC 3PSNA 3QFKA 4IL1A 4OR9A 4ORBA 2ZOAA 5EQVA 4UT2A 3RL5A 2R17A 4ZX2A 3ZU0A 3IB7A 2BQ8X 4O5GA 4UT3A 3H61A 4V0VA 3H67A 2Z1AA 4XPNA 1G5BA 5F3WA 2WDFA 3K7VC 3QFNA 3FLOA 5J28A 1II7A 3RL4A 2QJCA 4DHLA 2IE4C 1S95A 4MOYA 3THNA 4Q7FA 3P71C 1UF3A 4DT2A 2O8GA 3H69A 4FBQA 3C9FA 3D03A 1M63A 4LU9A 4O24A 4UWQA 3N5UA 1QHWA 4J6OA 1HO5A 2NXFA 2NPPC 2IAEC 4H2BA 4ZVZA 3EGHA 4FBWA 1UTEA 4H2IA 2BCDA 4O4KA 4H2FA 2Z06A 2P6BA 2WDEA 3H66A 3H60A 3HVQA 2NYMC 4KBPA 3H63A 4G9JA 3ZTVA 4LTYA 3T1IA 3E0JA 4F0ZA 1FJMA 1HP1A 3ICFA 3RL3A 4HD0A 4MP0A 4ORAA 5INBA 3EGGA 3V4YA 5HPEA 4YKEA 1OIDA 3QG5C 3GVEA 4H1YP 5JPFA 1T70A 3AV0A 4WWLA 3TGHA 5JJTA 1TCOA 2AHDA 3K7WC 1HPUA 1KBPA 3QFMA 3IVDA 2DXNA 1Z2WA 4I5LC 5GTUA 3IVEA 2HYPA 2NYLC 2KKNA 2YVTA 3IB8A 3QFOA 2DFJA 1S3NA 3LL8A 2GJUA 3H62B 2QFRA 1W24A 3AUZA 1V73A 1S70A 3H68A 2QFPA 1SU1A 1USHA 2JOGA 1OI8A 2Q8UA 2Z72A 3PSOA 4B2OA 1JK7A 2A22A 4TUGA 1AUIA 1MF8A 4I5NC 4H1SA
chains in the Genus database with same CATH topology
3CK2A 5B8IA 5JPEA 5IOHA 4MOVA 3E7AA 4V0XA 1U32A 5C1VA 3THOB 3DW8C 3DSCA 2USHA 3H64A 4TUIA 4ORCA 3RQZA 2HY1A 1WAO1 1S3LA 3KBPA 1T71A 4FBKA 2O8AA 3JYFA 2CV9A 2ZO9B 4IYPC 1S8EA 4KKZA 1NNWA 1QFCA 4DSYA 1OIEA 2WDCA 4LACC 4M0VA 5DNYA 4UT3B 2BDXA 3E7BA 4JA9A 1IT6A 4H2GA 2WDDA 4V0WA 2ZBMA 1Z2XA 3DSDA 2XMOA 2HYOA 1S3MA 1WARA 4O43A 4FCXA 4NZVA 2DXLA 1XZWA 4JA7A 1XM7A 2IE3C 3C5WC 2YEQA 3FGAC 3PSNA 3QFKA 4IL1A 4OR9A 4ORBA 2ZOAA 5EQVA 4UT2A 3RL5A 2R17A 4ZX2A 3ZU0A 3IB7A 2BQ8X 4O5GA 4UT3A 3H61A 4V0VA 3H67A 2Z1AA 4XPNA 1G5BA 5F3WA 2WDFA 3K7VC 3QFNA 3FLOA 5J28A 1II7A 3RL4A 2QJCA 4DHLA 2IE4C 1S95A 4MOYA 3THNA 4Q7FA 3P71C 1UF3A 4DT2A 2O8GA 3H69A 4FBQA 3C9FA 3D03A 1M63A 4LU9A 4O24A 4UWQA 3N5UA 1QHWA 4J6OA 1HO5A 2NXFA 2NPPC 2IAEC 4H2BA 4ZVZA 3EGHA 4FBWA 1UTEA 4H2IA 2BCDA 4O4KA 4H2FA 2Z06A 2P6BA 2WDEA 3H66A 3H60A 3HVQA 2NYMC 4KBPA 3H63A 4G9JA 3ZTVA 4LTYA 3T1IA 3E0JA 4F0ZA 1FJMA 1HP1A 3ICFA 3RL3A 4HD0A 4MP0A 4ORAA 5INBA 3EGGA 3V4YA 5HPEA 4YKEA 1OIDA 3QG5C 3GVEA 4H1YP 5JPFA 1T70A 3AV0A 4WWLA 3TGHA 5JJTA 1TCOA 2AHDA 3K7WC 1HPUA 1KBPA 3QFMA 3IVDA 2DXNA 1Z2WA 4I5LC 5GTUA 3IVEA 2HYPA 2NYLC 2KKNA 2YVTA 3IB8A 3QFOA 2DFJA 1S3NA 3LL8A 2GJUA 3H62B 2QFRA 1W24A 3AUZA 1V73A 1S70A 3H68A 2QFPA 1SU1A 1USHA 2JOGA 1OI8A 2Q8UA 2Z72A 3PSOA 4B2OA 1JK7A 2A22A 4TUGA 1AUIA 1MF8A 4I5NC 4H1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK2 A;  5B8I A;  5JPE A;  5IOH A;  4MOV A;  3E7A A;  4V0X A;  1U32 A;  5C1V A;  3THO B;  3DW8 C;  3DSC A;  2USH A;  3H64 A;  4TUI A;  4ORC A;  3RQZ A;  2HY1 A;  1WAO 1;  1S3L A;  3KBP A;  1T71 A;  4FBK A;  2O8A A;  3JYF A;  2CV9 A;  4IYP C;  1S8E A;  4KKZ A;  1NNW A;  1QFC A;  4DSY A;  1OIE A;  2WDC A;  4LAC C;  4M0V A;  5DNY A;  4UT3 B;  2BDX A;  3E7B A;  4JA9 A;  1IT6 A;  4H2G A;  2WDD A;  4V0W A;  2ZBM A;  1Z2X A;  3DSD A;  2XMO A;  2HYO A;  1S3M A;  1WAR A;  4O43 A;  4FCX A;  4NZV A;  1XZW A;  4JA7 A;  1XM7 A;  2IE3 C;  3C5W C;  3PSN A;  3FGA C;  3QFK A;  4IL1 A;  4OR9 A;  4ORB A;  5EQV A;  4UT2 A;  3RL5 A;  2R17 A;  4ZX2 A;  3ZU0 A;  3IB7 A;  2BQ8 X;  4O5G A;  4UT3 A;  3H61 A;  4V0V A;  3H67 A;  2Z1A A;  4XPN A;  1G5B A;  5F3W A;  2WDF A;  3K7V C;  3QFN A;  5J28 A;  1II7 A;  3RL4 A;  2QJC A;  4DHL A;  2IE4 C;  1S95 A;  4MOY A;  3THN A;  4Q7F A;  3P71 C;  1UF3 A;  4DT2 A;  2O8G A;  3H69 A;  4FBQ A;  3C9F A;  4LU9 A;  1M63 A;  4O24 A;  4UWQ A;  3N5U A;  1QHW A;  4J6O A;  1HO5 A;  2NXF A;  2NPP C;  2IAE C;  4H2B A;  4ZVZ A;  3EGH A;  4FBW A;  1UTE A;  4H2I A;  2BCD A;  4O4K A;  4H2F A;  2Z06 A;  2P6B A;  2WDE A;  3H66 A;  3H60 A;  3HVQ A;  2NYM C;  4KBP A;  3H63 A;  4G9J A;  3ZTV A;  4LTY A;  3T1I A;  4F0Z A;  1FJM A;  1HP1 A;  3ICF A;  3RL3 A;  4HD0 A;  4MP0 A;  4ORA A;  5INB A;  3EGG A;  3V4Y A;  5HPE A;  4YKE A;  1OID A;  3QG5 C;  3GVE A;  4H1Y P;  5JPF A;  1T70 A;  3AV0 A;  4WWL A;  3TGH A;  5JJT A;  1TCO A;  2AHD A;  3K7W C;  1HPU A;  1KBP A;  3QFM A;  3IVD A;  1Z2W A;  4I5L C;  5GTU A;  3IVE A;  2HYP A;  2NYL C;  2KKN A;  2YVT A;  3IB8 A;  3QFO A;  2DFJ A;  1S3N A;  3LL8 A;  2GJU A;  3H62 B;  2QFR A;  1W24 A;  3AUZ A;  1V73 A;  1S70 A;  3H68 A;  2QFP A;  1SU1 A;  1USH A;  2JOG A;  1OI8 A;  2Q8U A;  2Z72 A;  3PSO A;  4B2O A;  1JK7 A;  2A22 A;  4TUG A;  1AUI A;  1MF8 A;  4I5N C;  4H1S A; 
#chains in the Genus database with same CATH topology
 3CK2 A;  5B8I A;  5JPE A;  5IOH A;  4MOV A;  3E7A A;  4V0X A;  1U32 A;  5C1V A;  3THO B;  3DW8 C;  3DSC A;  2USH A;  3H64 A;  4TUI A;  4ORC A;  3RQZ A;  2HY1 A;  1WAO 1;  1S3L A;  3KBP A;  1T71 A;  4FBK A;  2O8A A;  3JYF A;  2CV9 A;  2ZO9 B;  4IYP C;  1S8E A;  4KKZ A;  1NNW A;  1QFC A;  4DSY A;  1OIE A;  2WDC A;  4LAC C;  4M0V A;  5DNY A;  4UT3 B;  2BDX A;  3E7B A;  4JA9 A;  1IT6 A;  4H2G A;  2WDD A;  4V0W A;  2ZBM A;  1Z2X A;  3DSD A;  2XMO A;  2HYO A;  1S3M A;  1WAR A;  4O43 A;  4FCX A;  4NZV A;  2DXL A;  1XZW A;  4JA7 A;  1XM7 A;  2IE3 C;  3C5W C;  2YEQ A;  3FGA C;  3PSN A;  3QFK A;  4IL1 A;  4OR9 A;  4ORB A;  2ZOA A;  5EQV A;  4UT2 A;  3RL5 A;  2R17 A;  4ZX2 A;  3ZU0 A;  3IB7 A;  2BQ8 X;  4O5G A;  4UT3 A;  3H61 A;  4V0V A;  3H67 A;  2Z1A A;  4XPN A;  1G5B A;  5F3W A;  2WDF A;  3K7V C;  3QFN A;  3FLO A;  5J28 A;  1II7 A;  3RL4 A;  2QJC A;  4DHL A;  2IE4 C;  1S95 A;  4MOY A;  3THN A;  4Q7F A;  3P71 C;  1UF3 A;  4DT2 A;  2O8G A;  3H69 A;  4FBQ A;  3C9F A;  3D03 A;  1M63 A;  4LU9 A;  4O24 A;  4UWQ A;  3N5U A;  1QHW A;  4J6O A;  1HO5 A;  2NXF A;  2NPP C;  2IAE C;  4H2B A;  4ZVZ A;  3EGH A;  4FBW A;  1UTE A;  4H2I A;  2BCD A;  4O4K A;  4H2F A;  2Z06 A;  2P6B A;  2WDE A;  3H66 A;  3H60 A;  3HVQ A;  2NYM C;  4KBP A;  3H63 A;  4G9J A;  3ZTV A;  4LTY A;  3T1I A;  3E0J A;  4F0Z A;  1FJM A;  1HP1 A;  3ICF A;  3RL3 A;  4HD0 A;  4MP0 A;  4ORA A;  5INB A;  3EGG A;  3V4Y A;  5HPE A;  4YKE A;  1OID A;  3QG5 C;  3GVE A;  4H1Y P;  5JPF A;  1T70 A;  3AV0 A;  4WWL A;  3TGH A;  5JJT A;  1TCO A;  2AHD A;  3K7W C;  1HPU A;  1KBP A;  3QFM A;  3IVD A;  2DXN A;  1Z2W A;  4I5L C;  5GTU A;  3IVE A;  2HYP A;  2NYL C;  2KKN A;  2YVT A;  3IB8 A;  3QFO A;  2DFJ A;  1S3N A;  3LL8 A;  2GJU A;  3H62 B;  2QFR A;  1W24 A;  3AUZ A;  1V73 A;  1S70 A;  3H68 A;  2QFP A;  1SU1 A;  1USH A;  2JOG A;  1OI8 A;  2Q8U A;  2Z72 A;  3PSO A;  4B2O A;  1JK7 A;  2A22 A;  4TUG A;  1AUI A;  1MF8 A;  4I5N C;  4H1S A; 
#chains in the Genus database with same CATH homology
 3CK2 A;  5B8I A;  5JPE A;  5IOH A;  4MOV A;  3E7A A;  4V0X A;  1U32 A;  5C1V A;  3THO B;  3DW8 C;  3DSC A;  2USH A;  3H64 A;  4TUI A;  4ORC A;  3RQZ A;  2HY1 A;  1WAO 1;  1S3L A;  3KBP A;  1T71 A;  4FBK A;  2O8A A;  3JYF A;  2CV9 A;  2ZO9 B;  4IYP C;  1S8E A;  4KKZ A;  1NNW A;  1QFC A;  4DSY A;  1OIE A;  2WDC A;  4LAC C;  4M0V A;  5DNY A;  4UT3 B;  2BDX A;  3E7B A;  4JA9 A;  1IT6 A;  4H2G A;  2WDD A;  4V0W A;  2ZBM A;  1Z2X A;  3DSD A;  2XMO A;  2HYO A;  1S3M A;  1WAR A;  4O43 A;  4FCX A;  4NZV A;  2DXL A;  1XZW A;  4JA7 A;  1XM7 A;  2IE3 C;  3C5W C;  2YEQ A;  3FGA C;  3PSN A;  3QFK A;  4IL1 A;  4OR9 A;  4ORB A;  2ZOA A;  5EQV A;  4UT2 A;  3RL5 A;  2R17 A;  4ZX2 A;  3ZU0 A;  3IB7 A;  2BQ8 X;  4O5G A;  4UT3 A;  3H61 A;  4V0V A;  3H67 A;  2Z1A A;  4XPN A;  1G5B A;  5F3W A;  2WDF A;  3K7V C;  3QFN A;  3FLO A;  5J28 A;  1II7 A;  3RL4 A;  2QJC A;  4DHL A;  2IE4 C;  1S95 A;  4MOY A;  3THN A;  4Q7F A;  3P71 C;  1UF3 A;  4DT2 A;  2O8G A;  3H69 A;  4FBQ A;  3C9F A;  3D03 A;  1M63 A;  4LU9 A;  4O24 A;  4UWQ A;  3N5U A;  1QHW A;  4J6O A;  1HO5 A;  2NXF A;  2NPP C;  2IAE C;  4H2B A;  4ZVZ A;  3EGH A;  4FBW A;  1UTE A;  4H2I A;  2BCD A;  4O4K A;  4H2F A;  2Z06 A;  2P6B A;  2WDE A;  3H66 A;  3H60 A;  3HVQ A;  2NYM C;  4KBP A;  3H63 A;  4G9J A;  3ZTV A;  4LTY A;  3T1I A;  3E0J A;  4F0Z A;  1FJM A;  1HP1 A;  3ICF A;  3RL3 A;  4HD0 A;  4MP0 A;  4ORA A;  5INB A;  3EGG A;  3V4Y A;  5HPE A;  4YKE A;  1OID A;  3QG5 C;  3GVE A;  4H1Y P;  5JPF A;  1T70 A;  3AV0 A;  4WWL A;  3TGH A;  5JJT A;  1TCO A;  2AHD A;  3K7W C;  1HPU A;  1KBP A;  3QFM A;  3IVD A;  2DXN A;  1Z2W A;  4I5L C;  5GTU A;  3IVE A;  2HYP A;  2NYL C;  2KKN A;  2YVT A;  3IB8 A;  3QFO A;  2DFJ A;  1S3N A;  3LL8 A;  2GJU A;  3H62 B;  2QFR A;  1W24 A;  3AUZ A;  1V73 A;  1S70 A;  3H68 A;  2QFP A;  1SU1 A;  1USH A;  2JOG A;  1OI8 A;  2Q8U A;  2Z72 A;  3PSO A;  4B2O A;  1JK7 A;  2A22 A;  4TUG A;  1AUI A;  1MF8 A;  4I5N C;  4H1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...