4ORGA

Crystal structure of human fab cap256-vrc26.04, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
243
structure length
232
Chain Sequence
VQLVESGGGVVQPGKSLRLSCAASQFSFNRYGMHWVRQAPGKGLEWVAAISYDGTDKYHADKVWGRFTISRDNSKNTLYLQMNSLRAEDTALYYCAKDLREDECEEWWSLPCRKSRGVAGIFDKWGQGTMVIVSSASTKGPSVFPLAPSSKGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP256-VRC26.04 light chain
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 232
sequence length 243
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2014-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4orgA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4orgA01
3IJYB 3V8CA 4L8DB 4KROD 3ROOA 5M94B 3FZUC 5CBEB 3GSUA 3BEWA 3MFFA 5D2NA 4XP6H 4DEPB 4ODXA 5DMGD 1JPSH 2AV1B 1B4JH 3CXDH 1AD0B 3VXSA 1H9VA 1INQA 3GJFK 2XZAH 3AS3A 5FF6B 1KCLA 4OF7A 4CU8A 3GHEL 1MFEL 4OZHE 5LVEA 4H8WL 4KUZH 4PRPD 3SGJC 2Y9RT 4JB9L 4JQVC 5DK0B 4DK6A 4F33A 4X5XA 3T4YA 2ICEB 4Z7VA 1ACYH 4KK6C 2XN9D 4PS4H 2VLJD 1YECL 4NQDE 5B38G 1XGTA 4X8XA 5JOPD 1X5GA 1QYGH 3IXAA 3PGFH 4GRWF 5K9KB 1OT1A 4K23H 4S0SD 1V8HA 4I1NB 1KJ2H 1CDIA 3SDYH 3PV6B 1UVQB 3P9MB 4YFDB 3MLYL 4IRJB 4M1DH 5C0CA 1N7MH 5DJ8B 4UIKH 1MEXH 4X4ME 3VXUE 4L4VD 3MLXH 4KHTH 3REVA 3HRZA 4LAJH 1R3JA 4AM0B 4KKBD 5CD5D 3PHQB 4QEGA 3VXPB 2LVEA 1KGCE 4UB0L 4XBEH 3NFNB 2VAAA 2MQ0A 3P9LA 5FB8A 3N1GC 4M3JA 1WZ1H 2FECL 4MB4A 4X6FB 1A6AA 5E2WH 4U6HB 5LBSH 2MJWA 3FRPG 5EOTA 3OQ3B 4AYFA 5IB1B 1RUAL 3D1MC 5DURB 4NCDA 4E42A 4LSPH 4LCIL 2EDOA 4QOKE 4HKXB 4KI5F 3TH4T 3F62A 5KSUB 3PABB 3BT2H 4RIRA 5IWLC 1C8PA 5E94A 4TUKL 2VQTA 1P2CB 1FO0L 4FOMA 1A1MB 3FTGA 4HIHA 1GH7A 3VD7A 4P46A 3RWJA 4JN1H 1IQWH 5TE7H 5F7MC 3M17B 4O58H 1G1YA 4LKXB 2OR8A 4KKAC 1UENA 5DA4A 1Y6KR 3TBVA 3QUZD 3W81A 2IPTL 3KNBA 4E41B 4MD0A 4ISVA 1P7QD 4RAHA 1P1ZA 3SDXF 1T21B 2YPLB 2A9NL 4XPHH 3G6JE 1J0IA 2D9QB 4OFYD 4EBQL 4B5EA 1OTSD 3BZFA 4L3AA 5IIEA 3GHBH 1C5CL 1ZA6B 4H5SB 3ZKXC 5L6YL 1M6OA 1ULVA 1KT2B 2H2SD 5C8JB 5JR1L 1LEIA 1ORSB 1KJVB 3EDEA 4APQC 5GSRB 5E7BA 3FOLB 4U6YA 3EUUA 5KVFL 3QI9B 2V9TA 1F6FB 3PDGA 1B3JA 4HS6A 1AR2A 3W9EA 2PYEA 5JUEL 1I3UA 1HYSC 1DBKL 12E8H 4KAQH 2I60L 2ENSA 3NH7L 1F58H 1VERA 3RTQA 4ZD3H 3MJ8B 3ET9F 4HIIB 3AY4C 2EXYC 2Q8AH 1FIEA 3RUGE 2O93L 3QDME 4IOFD 1XF4B 5DJXB 1ZHBA 2K7QA 2EE6A 1JRHH 4TUJA 3IDMA 4YC2C 4I5BA 2G60L 4G9DB 5FYKE 4CKVX 1F4WL 2ARWA 4LCCB 4U49A 2HVJA 3QCUL 5KSAD 3MA7A 3WFCH 2W0FB 4JO3L 4JRXE 4YK4B 1IL1A 3DGGA 43CAB 2H1PH 1FCGA 2NTFA 5HHXH 4XGZA 2GAZA 2NY0B 2R1YA 5ETUA 4BSWB 4Z7WA 3RWHB 4M8QB 1XMWA 1M71A 1U8PA 5JXAL 3TA3A 4G6JL 2X4UB 2EE3A 4IDJL 5IMOB 3NMEA 1NFIB 3T0DA 5EUOE 1T1ZB 4K7PX 3JV6B 1BBJB 3IS1X 5KVEH 5T33L 5CCKH 5HHME 2NLJB 3K81A 3LSOB 1TZGL 2JKXA 4GQ9H 5D6CA 2C3VB 3L95B 4YHLH 4KC3B 5HGDB 4UTAL 1YEGL 3GI9H 1MWAH 3AAZB 4UNUA 1GGTA 1T20B 1YEJL 4LLDB 1JTPA 5DD1L 5E6IA 4P5TA 1OP3K 4S11A 5I8EB 1VPOH 1I7UA 4LNRB 5IB4B 1R5WB 2YOCA 3VW3L 2CIKA 4YNYB 1WF5A 2WQ8A 2LFGA 1G7PA 5GRXG 4X7SL 5A2IH 3SDAD 1TTFA 4K3JL 3SDDB 2BVQA 4ODHH 1JNNL 4ELMF 1CN4A 1CD1B 1OM3H 4LPUA 4UV4L 1MUJA 1IKNC 4P3CL 1K4DB 4OI7A 2JB6A 4PJ8A 5GS0L 4N0FB 1ZT1A 2P5WD 3FO9A 3CNKA 4QRTA 1KIRB 3F7QA 4F37K 3FQUA 4Y8DC 2AJVL 3JWOH 4DAGH 4I2XB 3GJEB 1ZK9A 4NWTL 3MUHL 2A1WL 3VWJD 4Z95H 3LKNA 1HHJB 3RWFB 5GRJL 1RURL 2CRZA 3P40A 1F13A 2QSTA 2NY2C 3U0WH 5EA0L 1CICD 2ESVE 1JYWA 1OAUH 5KTEH 3QIWD 5GJSL 2SEBA 1ETZB 4K3EH 5FXCH 5IMLA 3IJHB 2XICA 3G5YB 2BNQB 2VXUH 1MF2H 2R39A 1OAYL 3Q3GB 1DBJH 5DEZA 1OTUD 1JYVA 3RVTC 3TT3H 1QNZH 4J23A 4Y16D 1AY1L 4JVPA 2V2WA 2CLRA 3L5WA 4ODTL 3C5JA 3C8KA 4HJGB 3V4PH 3WNNA 4YXKL 1LK3L 4Q6YA 4BK5A 5IM7B 2W65B 4LHUA 4M6ML 5SX5H 3BKYH 1TQCC 3KYKL 5DJYA 1CIDA 5DJ2A 1MCLA 1N6UA 2EYRB 1OWRM 1VFOA 3SJVD 1W2KT 5GZND 2RAMA 4NO3A 4P2OA 1FV1B 1IC5L 5C0ND 2NPLX 4WI7A 5T1LA 4C54A 2R2HA 2VH5H 4MJ5A 3EYVB 4Y2DB 3VGGA 2Z92A 1FZJA 1ORQA 1I75A 1KG0B 5ANME 1NEUA 5TDPB 4PJCA 1PQZA 2BY2A 4HGKC 1S9VB 4ZAKA 5F9OH 2NXZB 4HEPG 4H26A 2HN7A 3VGBA 4U1NA 2GIYA 1N64H 2Q7NA 5A16B 3CFDA 2A77L 1X5LA 3QUKA 3O81A 1F3RB 2Q7YA 4ZQKB 2YK1L 5FGRA 1KN4L 3VWKA 4KVNL 3NPSC 4FRWA 5BV7L 1F4YH 3PHOA 4QTIH 1T6WA 1KNOB 1QRND 3TBYB 3EFDL 2EDFA 4K3HA 1XCTB 1LO2L 4P3DB 1T4KB 1FHGA 1AGDA 3C6SB 2QLVB 4JFHE 5JXED 1T5WA 4PJ9C 5KANI 1P7HL 5IR1B 1NFDE 4PRHB 5L2JA 5CGTA 4JM2A 1MJ8L 2XZZA 3O6FB 1FORH 2A6DA 3E8UH 2C7UA 5FKAB 3MQIA 1OTTC 4GW1A 5FM4A 2DM3A 5C6TL 5CZVL 1C16A 3DX9A 5FK9B 1S7TA 3H9HA 1RSFA 1HI6A 4OTXH 4NRXB 3BUYB 1U95B 3P4MA 2QJDA 2ICWA 3C2AH 2IADB 3CU7A 5IROA 2JJSC 3DV6A 4DQOL 2H41A 4HPOH 1J5OL 4FQXD 1MNUL 4HXBH 1UKSA 5C09A 5HGAB 2LABA 9CGTA 1IE5A 4PJIF 2QKIA 4XXCA 4DUVA 1KFAL 2Z31C 3N9GL 5FDWB 1J8HD 3WJJC 4YIQB 1IZKA 1KB9K 2P4AB 3ARRA 1N6VA 4KZEL 2ADJA 3RWEA 5JPMA 3BJ91 4ZS7H 1BX2B 2DTML 3QUMH 4L1DA 2MCG1 3V5DA 3TVMB 3JWOC 3J8F7 1KELH 4KROB 1N4XL 3UBXA 4LU5H 1JUFA 2APXA 1LEGB 1X6LA 1JPTL 3T65B 2P8PA 1A7PH 1AP2A 3ARXA 1FNEB 3S6CA 3LV3A 1OW0A 1X6NA 3X11B 3C5ZC 5DJAA 1JIBA 4PRPB 5HDLA 3UJJL 1BQUA 3NFPA 3F12B 1HXYA 5DQDH 1YEFL 1F45A 4NM4L 25C8L 1L0QA 3FQNA 1U91B 4LCUB 4BZ2H 2YKLH 4XC1H 1MAKA 5HHNB 3SQBA 4NHUB 1T66C 3ILPA 3QP3A 3PWPE 5EWIH 3LD8B 2GJ6D 4HJJL 1G84A 1A3LH 4PD4K 1A6WH 4L4VB 3LS4L 2I9TB 1X44A 5T1KD 3RIAK 1RIVL 2VERN 2DQTH 4LEXL 5KOVC 2FIRT 4X6EB 4HFWB 4PUBL 3ZTNL 2UZIH 3N06B 3EO9L 4F7MA 2ATPA 4YXHL 2EDTA 1TNMA 3MRBA 4NKDA 4PJIB 3STLA 2O5XL 2OXHA 3QDJD 3ZE2F 3MR9A 1EX0A 3M1BA 2G5BA 3IYLW 5LWYH 2NZIA 2AGJH 2IPKA 2VABA 3F65A 4MDIA 3ZE0F 1SMAA 1CLYH 2CH8A 4KZDL 3VJ6A 3WSQH 4JZJA 3AREA 3LPWA 4KDWA 5DS8B 2CIIB 5A40E 5F72S 4PJ5A 5HD8D 4PG9B 1RZIA 1WCBB 3QDGA 2YMXH 5DVKA 3SKMA 1NUNB 2A74A 4X9HA 4ZFGL 4JG1L 5BS0A 5JLZA 1EFXD 3HLAA 3LB6D 4OSUH 2X4PA 1TVDA 4CMHC 1RK1A 2VLLA 5KJRL 3LQMA 3KYNB 5J13B 1AGFB 4Z5RA 2E8YA 3TJEH 4YUEH 3UTPD 2HKFL 4NSKB 5JIPA 4HD9A 3PL6D 1BZQK 4WNQB 3QUZB 3RL2A 1SBBA 4F37F 4JFQB 4KJWC 1JGDB 4XP5L 4QY8A 4CU7A 1C1EL 4F58H 5MI0B 5FGBC 3RVVD 5DJ6B 1ZLWK 4HG4J 5ITFA 1TMCB 1HWGB 1H3WM 2H9GA 5I71C 3F7YA 2EO1A 4KDTC 3CZJA 5JO5B 2I26N 4YH6A 4NQSB 5F7DB 1BFSA 1UA6L 3QEQE 3FO0L 3BP6B 4Q2ZB 1TFHA 1J1PH 4XZUA 5ICZA 3U7WH 4KXZH 4DKFH 4NDMA 5B38B 4ODWA 1Q9OA 1HKFA 3UO1L 4WRLA 4JHWH 2HAZA 3BHBA 3MRCB 4Q97A 3W0WA 3ARDD 2IH3A 5DEFA 3HR6A 1BIHA 1RJZA 5FYLL 1PVHA 2W92A 4RZCA 4UT6L 1E4KC 1LO0H 3HE6D 5HHVL 4NKIL 1BFOB 4LCWD 5EORL 1BBDH 2CKNA 3O6LH 4UQ2B 5HI3C 3WNPA 5C0GA 4L9LC 2J8OA 2F19H 1RIHL 4ERSH 3O4LE 5IFAL 2F74A 2GSIB 1A64A 4NZTL 1RZ7H 3VDBA 3MJ7A 4K8RH 4LRIA 1EUUA 4OAWB 1FJ1A 2VSDA 2BRRL 2VDOH 1TETH 5C0FA 4ELKA 4MX7B 4W70A 3PQYD 2VXVL 5ELIA 4I8DA 2FJFA 1IAII 2VKWA 4EVNA 4OCMC 4K9EH 2I24N 3EBAA 4ZFFA 4PRBA 2NW3B 5B3JF 4G5ZL 4BK4A 3BGFB 3MCLL 4DN3H 4WV1B 3KDMB 4KMTL 4NNYA 3WS6A 4AENB 3IF1A 4J1UB 1TJIL 2FYYB 4OF6A 4PJDB 4NHCL 5ESQA 5LGJA 1HILA 2AJUH 1RHHA 3RNKB 4N8CH 1YN7B 3RHWK 1RAMA 4ZUWA 2B2XH 3CVHB 4P23A 2VR9A 1HXMB 2APWA 4RGMC 5I1HL 4MA8H 1UXWB 5I75B 2EEDA 4G9FA 1PDKA 4X98B 1BVLA 4NZRL 4JY5L 1CL7I 3GBMH 4GOSA 2DYPD 3TZVA 3SPVB 2W91A 3KYMA 1D5IH 5IT2H 3SQOH 3V7AE 4FQ2H 3MRNA 3ULSB 1H3PL 4WWKD 3ME0A 5ICYA 1KJMA 3LKOA 4GG6F 4XPFH 1MFNA 3V95A 1J1XH 4MCYA 2EDBA 4M7KL 3SDAB 1VKXB 1AIFB 1I1FB 3ZDZE 4W4OC 1MPAL 2HJLA 4EXKA 2ZCHL 5TGBB 4AG4H 3Q5OA 3U46B 3U7AA 4CMMA 1QUNA 3NCFB 4KK9C 2CKBH 3ULUL 3HE7C 3GMNA 1WUNT 1Q9WB 3N50A 3WJLA 4Y0GA 5E2UL 2ZUSA 5SWZA 3QWOB 2P5WB 4YAQB 4X7DC 5D1ZA 3LIZH 4M7JL 5ALBL 1DUYA 5HVHC 1JTTA 2PF6A 1EEYA 5BOPA 3QIBD 5TQ2H 1H3XA 5DHXB 3QCVH 1AQDA 3NZ8A 1JVKA 4UQ3A 5ADPH 4N0YL 4OZFA 1NLBH 5D5ME 3U6RB 4NKMA 2X41A 2QL1A 1X5FA 2PW1A 5F9WB 1CT8A 1CICB 4HUKB 2EDWA 4GAJL 5SV3A 1UACH 3TPUA 3S4SB 3QIWB 1UFUA 3CH1B 3KPOA 2GT9B 5EB9A 3ALWA 1FL6B 3AGVA 4O02L 1SQ2N 3T0AA 3DIFA 2HT3C 4MA1B 3FOMB 1ES0A 1QQDA 1F97A 2DICA 3CIQA 5IOPA 1U3YA 4Y16B 4G80B 4EDWL 4DGYL 3V6ZA 1G7QA 1ZHNA 3TJHD 3BD4A 1R24A 4R96B 4Q6IC 3D0LB 2B0SH 5GGQL 5F96L 3U4AA 1IGJB 3KPMA 1E6JL 1TPXC 1UH4A 1UWEH 3MXWL 1RZFH 3UTQA 4UZGA 3QPQD 4LVEA 3WUWA 2WWKO 2X4NB 1HDMB 2UWEF 1HH6B 2LU4A 3LCYA 3SJVB 3WIHA 2ZZUT 1I85A 3MPCA 3S3JA 4BM7A 3H42L 3DRTA 4AJ0A 4HWZA 5D96B 3HAEA 5HDQH 3CCHA 4N1CA 1FBIL 2QV2A 2FBOJ 4K8RC 2EDKA 3U4BL 2BDNL 4Y4KC 5IB3A 1H0DB 3RX5A 1T0NA 3CFJB 1MLCB 4Y7MA 3VA2C 5C08B 4GUPA 4K9EC 3WNKA 2MCPL 4QYOA 2LU3A 2X9WA 1U2HA 1FFRA 5F1NA 3S7GA 3AS2A 5CEZH 3BZEB 5FO7B 1F90L 1QRNB 2XRAL 3P11H 5DUPL 4NO5B 1SJHB 4LSQL 4NCC1 5DD3H 3RFZC 5T3XL 4DWHA 2VUOA 2OS7A 2WMPA 3I02B 4XAWH 2ZCLL 5GRZA 3TN0D 4MHHG 5I18H 4BZ1L 3IDUA 4NQXB 3O2VL 4RFEA 4XVTL 2EKSA 3H7BA 3DVNB 3QULB 4MNQA 2HG5A 3U1SL 1PKQB 1FDLH 2MOVA 2NY3B 2WWMC 2PTTB 1CVRA 3SDCC 1T0PB 1JWSA 2V17L 4XPAH 3UTZA 4NYLA 3EYSH 3ZL4L 4I18C 1FFOA 1YPZE 4HS3B 5IMMB 3RY4A 1VENA 3OKYA 3IU3A 3WIHH 1DBAH 4IRSD 2Y5EA 3QCTL 3INUH 3QQ9C 4IMLB 4Q0XL 1GOFA 4O2CB 2UWEB 4FQXB 4POZD 3TIEB 5DFVC 5L7XL 5K9OB 4G43B 1DJSA 3MSPA 4W6XB 3UTSD 3MLRL 4OFIA 5IMKB 2QR0A 5DZNA 3F58H 2X2YA 5BXFA 2ATKB 4HKJB 4GKOA 2Y07H 5D1QC 4AL8H 3MRJB 3BSZL 4HLZH 5BQ7A 1CFSA 3PWNA 1CD9B 1P6AB 2DKSA 3FRUB 5LAXB 3DARA 3DJ9A 1XIWC 4RFOL 5I2IB 1EHLH 1F8TH 3B3IB 4UV7L 4YBQC 4PJBE 3VFPB 2AEIT 5KN5B 1BZ7A 1NAML 1PFCA 1JFQL 4PYGA 5D7SH 3REWA 1NGQH 5A3ID 5C07B 5ILTL 4F7PA 1U6AL 5LXGH 5HJ3A 4NUGL 4ZUTB 3EOBB 5C6PB 2EICA 2VIRA 1I7RA 1RJYA 3L7EB 3MA9L 5I6XC 1QA9B 2ZUTA 5KSBF 5CEZE 3OGCB 2YD2A 5IF0B 3X3GL 3LEXA 3B9KD 5JNYA 1FFNB 2FZ3B 3FB6B 4PV8A 2YPKB 3NA9H 4S1RL 2Z9TA 1Q9KA 4LLWB 3OKNB 3QEHA 1R3HA 5CEYB 4UINH 5H94B 5HHOB 4OZHA 3JWDC 5C2BL 5JHDB 2P5EE 4XMKL 1JHLL 4ODBD 3GMLB 3TO4A 4EN3A 4K94L 1SBSH 5D7LD 5D71H 4L3EA 1JGUH 1L0YA 4CNIA 5T1KB 4JPVL 2NXYC 2IH1A 5E00A 2HP4A 3T2NL 5KG9B 4L5FH 3MLTB 3VFGL 2FLRT 3ZYJA 1WBZA 3RKDD 4F57L 4U1SB 1XF1A 3GMMA 3SBWC 4D8PA 4X6BB 5GGVH 3IVKA 1WVZA 1H8NA 4X4MA 1QFWI 1DN0B 1FAIL 3QWRA 3WN5A 1D3CA 1Q1JH 4CN6A 4DGIH 2HMIC 1FZMA 3QDJB 3KPSA 4G6FD 3ARBA 3K46A 3BRGC 4EEEA 4NKQB 5GRUH 5E99L 1UADC 1ACZA 4RGND 1UCTA 1QKZL 2KQMA 3O0RL 4MDJA 3DTXB 4YDLB 5D7JD 5I9QC 2OI9C 3HG1E 3QFDA 3BAEL 2R23B 4MCZA 3C5SB 5A2JH 4TYUA 1SEBB 3FN0H 1EFXB 1X7QA 4NZUL 1YNKH 4Q9CA 1MJJB 2EDRA 1EO7A 1F11A 3V2AR 3BKML 3S96B 1N59B 5HYQB 3EJYD 1KLGA 3IDYC 4F8QA 3MNVA 5JW3H 5I76A 2K9UA 4JKPH 1YNTA 3PL6B 4JG0H 1T1XB 4JY4A 4Z7OE 1EMTL 3DXAE 1MLBA 4Q9QH 4UDTA 1CFVL 5JOFB 3FL7A 2P48B 1AR1C 5I1JH 1N2RB 3IT8D 3VI3F 3HFMH 3LVEA 3GSNL 4X4XA 4BUHA 3VGAC 4P2QD 4ZXBC 4GO6B 4XRCB 4DOHE 5FGCB 3RWCA 3KPRE 3KS0J 1VHPA 3QXAA 1A02N 3G6AA 1EVTC 1GVIA 5DJDA 4ZOBA 3CLFL 5C9JA 4QT5A 2DWEA 2IPUG 4JRYD 3V0VB 4XP4H 1QSFD 3KWWA 2JK5A 1CU4H 5F1IB 4GKNB 3G6JA 4B41A 4BFBD 4PJXF 3TV3H 4LPVA 2LTQB 3IDNA 4PJFA 3VXNB 1A7OL 4ODUA 1P5VA 3P30L 4NOFA 1GGCH 1G1CA 1K3IA 3ARDB 5LQBH 5K9JH 5EOCL 3C09B 3FKUS 3EYOA 4TQEH 4XCEB 5FOBB 4F8TA 2XI9A 1DQQB 1M7IB 2B5IC 4ENED 1KCSH 5HYJA 3ARFC 3HE6B 4UT7H 4LCWB 1FAKT 2X4RB 1UQSB 2A2QT 3DOSA 4Y19E 3RGVD 4D0BA 3G6DH 4YHZL 3TCXA 3TNMA 1I7ZB 3LRGA 1CGSH 3GSXA 1BD2A 1JPGB 4PV9A 2NY7H 4WCYL 2N1KA 4P9ML 1FL5A 1VCAA 1A21A 3HMWH 5JHLH 3PQYB 4DTGL 3QG6A 1JF6A 2JCCB 3RBSA 5C0IB 3X13A 3CFCL 3VI4E 4PTTA 4GMTL 5IBTL 1P4BL 4UTBH 5C0BE 3ZTJH 3QDMA 3MCKA 5J1SC 3BIKA 4BA8A 2ICWJ 4XBPB 3OZ9H 1PSKL 1ZHKB 4P49A 3VFMA 5EBLB 1HCFX 3QQ4B 4O51B 3MRGA 1T2QL 5J57B 3VXSD 3I50H 2XFXA 3ISWA 3OKKA 4J6RL 4ALAL 43C9A 1DQMH 2ADIA 3IFLL 1W72L 1UXSA 5L2KE 5CINL 3LAFA 1B4RA 1CE1L 4ZYKB 1OSPL 1KCVH 2X7LB 3CDGB 3I6LD 3DYMA 5D2LF 1IAKB 2V2TA 5JZ7D 2CDGA 4PJXB 5FGSA 1A1OA 3GB7B 4WEBH 1KOAA 1U8IA 5FEBA 4WWKB 1ZEAH 4MD5B 4U3HA 1P53A 1JWMA 3X14A 2B4CC 4HUXA 4XC3H 4S1SL 5C0CD 5KVDH 2FB4L 5J6GB 3PWUA 4R4BA 2F58L 1CF8H 3IETA 4F80A 1NFKA 4JAMA 1KTRL 3DI2B 4K2UL 1NBZA 4U0RC 4FTVE 3U36A 4EQ2A 3QQ3A 5GRVL 2BCKB 4PJHA 4BQCA 5I0ZA 5GISH 1KLUA 1T1WA 5IFHL 3HUJF 4FN0A 5FAAA 4WHCA 4XAKD 5EIVA 2DLEA 3F6IA 2VXSL 3BP5A 3QIBB 3L3OA 2V7NB 3FB8A 3HS0A 4YO0A 1K8DA 4FFWC 4HZAA 3FB5B 1BJ1J 1PG7L 4H1LA 2BERA 4ZTPL 4R4FL 4KRPD 1WBYA 5I1IL 1Q94A 3S37L 4HC1A 1WFOA 4NN6C 2AQ1A 3W82A 3L6FA 4HGWB 1DQLL 1CZ8L 4NQVA 3PWLB 1BGXL 4X9GA 5EO0A 4QO1A 4XVSL 5HTSA 3GMQB 4MJ6B 1C12A 1YMHA 4S2SB 2Y7QA 3WXVL 3R06A 4X6CE 5I15H 1ADQL 1VFBB 2VR4A 4P46D 2ZUQB 5JDSB 2CQVA 1DUZA 2ESVA 1AHWA 5KS9E 2Y72A 2ID5A 3QB7C 1UC6A 4PRNA 4UUJB 5C0JA 5JW4R 1OAKL 3ZKND 4WY7L 2VUYA 5D2LB 4MXWH 5T1DH 5DRZA 2J8UE 3GI8H 4LVHC 5F6HJ 4G8FB 2Z4QA 3LQAL 3FQXB 4H25A 2GJZA 4PP2A 2OK0L 4XP9L 3F5WA 2J6EA 4N90E 3RDTB 2XPGB 1ZVHA 4JVUA 2R56L 1E4JA 1YJDH 2FGWL 3Q6GH 4ZPTB 2ZSVB 1WK0A 3ZE1E 5DD5L 5AWNH 2AXHA 4F9PA 1URLA 1KSRA 3GSQA 3MNWB 1TTUA 1W0WB 4NP4H 2NNAA 1IGTA 5TQ0L 3ZDYF 2PYFA 5CZXD 3IFOB 5E56A 5GGRY 1S9YB 3SE3C 1I4FA 4Y5XA 4XCNA 3T8XB 1G6RL 4MAYA 3KPQA 4H1LH 5EU4B 5H2BB 4PGZA 3HUJB 2PYED 4QHMA 3TH2T 5E6ZA 3BVNA 5B3NA 3LH2L 2AJSL 3RTQD 2EYTB 1AQKL 5E8DH 4U6TA 2NY4C 4P57B 1YUHB 3S36L 1GHFH 5JMRA 3UXFA 4KY1H 1KC5L 2WUBL 3V5KA 4QHNA 3OB0K 1DTUA 1W8OA 4HS8H 5CGMA 3TN0B 5AAMA 3DUSA 1FZKA 4YQXH 3RVWD 3WHXA 4JPIA 3QXTA 4JFZL 4U3CA 2XQBL 3VCLA 1HQ4A 3MLSH 5DHVB 4JPKH 3FFDB 3FFCB 3HR5B 2OP4H 2R0WH 2V2XB 1DEEA 1CE6A 4LHUG 4ZO9A 4N1EA 4ODSH 1LDPL 1X5HA 3TA3D 4IRSB 4NT6B 5EU5B 2VXQH 4XMLL 3GSOA 1MRDL 3HPLA 1ZLVH 2J6EH 3VGDA 4C58B 1LE9B 2GITB 3T0EB 4JFFE 1JGLH 1N6QL 1CDCA 4GRLC 1KIQA 4P4KC 4AIZA 5E6YA 4C56E 4JQXA 3UTSB 1DBBH 2WBJD 3LRHA 4O2FB 4Z7QF 4PP1D 4PY8I 4NOBA 4ZO6A 4MXQD 4NRYB 3O9WC 4MB5A 3IB4A 2ZSWA 4P5TD 3MXVL 1U8JA 2YSSB 2OL3A 4G3YH 1T83C 3P0YH 2R1WA 4RAUB 1CLOL 3QPXH 3BZ4B 3ULVE 4HZLB 5CKGA 5BJTA 1DDHA 5F97E 4W6WB 5T1MB 4YHMH 4YFLF 1G9MC 3CK0L 2WIIB 1IARB 3JSSA 3KJ6L 4TSCL 3GMOB 5HVWA 2YN3A 3DRQB 3UJIH 1T89C 2IF7A 5F6IC 3RWIB 1RZKC 4HX1B 1MCKA 4JR9L 2AEQL 4PJ8D 4YLQT 2VLKB 5HYEA 4TTGA 3UTTE 4N9OB 1A9EB 3HN3A 4TRPH 4X8JA 3MUJA 2VJXA 1T1YA 1IC4H 1LO4H 4OUUA 3BPLC 2CRYA 3TBWB 1FG2A 5ERWB 4N0UA 3LKPB 1ED3A 3DX6A 2HVKB 1I1YB 2W9DH 3O11B 1RJCA 1YEDA 1V3KA 4NIKB 4FQJL 2CMRL 2AQ3A 2C26A 1DE4A 1IT9L 3PF2A 2FGZA 3FQWA 4GAYA 2QQQA 5DTFA 5C0EA 1U41A 1ZLUK 2HFEB 1NGPL 5IQ9A 3MLVH 4PJAA 2ADGA 3O4OB 1EJOL 3QXVA 4YHPB 4FFVC 1YJDC 3KYOA 4QTHB 5EBWB 1D9KA 3IU4H 5GGTA 2M8XA 4QXTB 1FE8H 2R4RL 2Z93A 5IQ7L 1I1AA 4S10A 2WSKA 1MY7A 3OR6A 4G6FB 3KAAA 2Y5TA 1U8HA 4LHUD 3CZFA 4WI2A 4LBEA 1S9KC 4LLMB 4LLQA 4RGNB 4MNHA 5JA9A 5KBNC 3PV7A 4KJYB 1P4LA 5D7JB 4GH7B 3UBXG 4GRWH 4P2OD 5J11B 3SO3C 3STZA 4ZFOA 5T1LD 1J7VR 3FONB 2D03H 3B43A 3LN5B 1NL0L 2DN7A 5E4IA 3V5HA 3P77A 2OTWB 2AV7A 2YD3A 1ZT4A 2X09A 4ZAKD 3NCJL 2MNUA 4LARH 2R2EB 1SJVA 2H32B 3OHXB 4HFUL 5I1DA 1XF5A 4LP5A 5I8OH 1AH1A 4YHIA 5ESVA 2VLMD 4UU9A 1INEL 5AZ2L 4EUPA 5GRVK 3C08H 5MENB 2LE9A 1YEIL 4UOW0 5CEXA 3VWKD 4JVWA 3CUPB 4XB8A 3O8XA 4P2QB 4EIZC 2FIKA 1DQTA 3K1DA 5B39G 3TGXA 4YC2B 2VE6A 2PO6C 4HCRA 2DLFH 5HDOA 3R0MA 1FNSL 3Q6FB 1EV2E 1LMKA 1QSFB 4DEPC 1XGYH 1ZHLA 1U92B 4JM2D 2DIJA 4JJ5B 3W11D 3QEQA 4M1CC 5DEGB 4YPJA 1KCUL 3B6SA 4KUCD 4R9HA 4HH9A 4FFZL 3HC4L 4NQCE 4OCYH 1V3MA 4DZBA 4FQ1H 3SKNB 1Q0YL 3RVUC 4I3SH 4WU7B 3WXWL 3KYAA 3RGVB 5I16A 2C1OA 4M61B 4ZUSB 1R5IB 3MODL 3V8OA 5EU6A 4A6YB 3GFUA 1VGKB 5DSCA 4HPYH 1PYWA 1G9EA 1J0ZA 5C09D 1K2DB 3OXRB 5IB5B 2DBJA 2HJKB 3PWJA 4I4WA 4IRJC 4IHOA 4E41E 2DQCL 1CGUA 1OGTB 3NCBB 1KB5B 1H3UA 4XPBH 2UY6A 2YPLE 4JANA 2DQHL 3BWAA 4MA7H 3UROR 2WP3T 3O4LA 4OB5H 3IAQA 1RU9L 1LE5B 4M5YL 4TVPL 1QVOB 4OZ4A 1AI1H 3F8UB 5FYJL 4MVBC 2F8VA 2HFFA 3ROOB 1TVHA 3GSUB 3MFFB 5D2NB 5I1LA 1YC7A 2EH8L 3SKOA 4GAFB 1GJIA 4FP8L 3O2WH 3VXSB 1INQB 1G9NL 2D7MA 2A0LC 2EZ0D 2A73A 3ARWA 2DQJH 4F33B 4X5XB 4NJ9L 3T4YB 5ID1A 1I9EA 4Z7VB 1DLFL 1XGTB 4PTUA 2OR9L 5EIIA 4RWHA 3K8MA 3O2DA 3ZYOA 2GJJA 3PGDB 2AI0L 1U3HA 4JPWH 4IMKA 4ELMA 1X4XA 4U2ZA 5C0CB 2BSED 3LEYL 2UUDH 2VXTL 3EOAA 5D1XD 3O41A 4JDTH 3REVB 1R3JB 3A67L 1M7XA 4OJFL 2Y36L 3JVGA 3VMNA 4NFBA 3K7UA 1S9XA 3S98A 3DETD 5AYUH 4AEIL 1NCNA 4TOYL 3HNVL 5E2VH 1MFAL 1T7WA 4GKZB 5DC4B 1A6AB 4QXWA 4M9OA 2ZCKL 4LQFL 5EOTB 1VFUA 1X4YA 1ZVSA 5I8KH 4XTRD 4HUWA 2AERT 3RU8L 3GJFA 4KRPB 4XI5C 4E42B 1JV5A 1YYLH 2C3HA 6FABL 3ARED 4LRNH 1HINL 1OLZA 4PJ5D 5CGYC 3QI9C 1UM4H 1KYOK 1Q0XL 3QDGD 4RIRB 4RMWA 5E94B 5BS0D 5JIIA 2F53A 4D0DA 1TCRA 1NC4A 3FTGB 4HIHB 4P46B 3RWJB 3MROA 3O2DH 3CVIH 3PP3K 1A6UL 5CHNA 1CCZA 1W0VB 1E6OH 4O4YH 3U4EA 1Z9MA 5ISZA 1MHEA 3TBVB 2X9YA 1F3DJ 3IFNH 3KNBB 1L7IL 3E0GA 4MD0B 4ISVB 4RX4A 5J1AA 1P1ZB 1JK8A 1BHGA 3CAFA 5I1GH 2QSCH 1FSKB 4LCCC 1QFUH 1X5XA 4Z6AT 1NMCB 2CUIA 3G9VA 4GFTB 4YK4C 1EGJA 1RUML 1RFDL 3ZT6A 1LP9B 3BZFB 5IIEB 3BKJH 1I8KA 2ADFH 1GC1L 2NY0C 1OL0A 5C0AD 3RY6A 1CS6A 3VFRA 4EQ3A 4D9QE 4OGYH 4RMTA 5GGUA 5T5FH 3VH8A 1LEIB 1GGBH 1MHCA 1IGML 2Y6SD 3S5LA 1MWAB 3W0WD 2J12B 1XGUA 4U6YB 2YD1A 1DQDH 2QQKH 1IEAA 5EO9A 4GBXA 4HS6B 3P73A 4MQSB 3MTRA 3GJFH 4MA3A 2OZ4A 2PYEB 4XCYA 1LQSR 2BNQE 4I3GA 3RVXD 1SM3L 3WFBH 3BKCH 4ZO7A 3RTQB 2NQCA 1BVKA 3LMJH 4N5ED 3NIGE 1KLFA 4B7IA 4WUKL 5DMKA 1HIML 1XFPA 1ZHBB 2O5YH 4TUJB 3IDMB 2Z31B 1S3KH 4I5BB 3BPOB 2B1AH 5E2TL 2HVJB 1U0QA 5BVPL 3SDDC 1N8ZB 4PG2A 2VDQL 5JA8B 1IL1B 1XR8B 2AEWA 3DGGB 3MACL 5IVXF 3F7PC 5FA4A 4JKKA 5K93A 1RJLA 3QAZB 2NTFB 4FG6D 2XA8L 3SOBH 2CK0L 2MHAA 2GAZB 5ETUB 4Z7WB 4HBCL 5IP4A 3NZHL 1V7NH 1M71B 1U8PB 3TA3B 2XYCA 1EGJH 3DGCR 4Y4HA 1SEQH 3C5ZB 1GZPA 4MLSA 1MQKL 2DIBA 1EPFA 5TPWL 2FCBA 4YBLB 4P23D 4XBGA 3BDYL 2VDPL 1YPZA 3LS5L 1AGBA 3HAEG 5CUSH 4TSAH 5ACZA 4KKCD 1RZJC 4G9FD 3X3FH 1KULA 3OV6A 3LQZA 4M62H 1YA5A 4MJIA 1CGWA 4P5TB 3NFSH 3N1MC 5E6IB 4X9BA 4QRQB 3TZVD 1WIPA 4PPTA 1A6PA 4HLZG 1WGOA 4ODVL 3IGAA 2O61A 2HLFC 4XXDA 4R26L 2YXFA 3WFHA 2CIKB 2PUQT 4RNRA 4DKEH 1G7PB 2MPAL 1CD8A 4PJCF 3OG6B 4PRHE 2E7BA 1DVFC 4KMLB 2BVQB 4FABH 3MOBH 4RGOH 1D5ZA 1MUJB 3MJ6A 3PP4L 1I3GH 5DUML 2JB6B 4HJ0D 4PJ8B 1X5ZA 5CJQL 3ALXA 5SWZD 1ZT1B 2YA1A 3FO9B 2BVYA 4MMZC 4QRTB 5D1ZD 1FLTX 3HZVA 4JO2H 2ARJB 4Y2DC 3FQUB 2AJYL 1PAMA 4OLUH 4OZGF 4CBPA 1KIUA 3LKNB 3QEGL 1F02I 3VXRA 2FEDC 2NXZC 1X5IA 2CRIA 3OBAA 4X7FC 4LF3B 3WYRA 4OZIB 4WUUA 4CAGA 2SEBB 4KKLD 2YHGA 4GQPH 4XT1C 3UYPA 5IMLB 4UAOB 5D93B 1UJTA 3DX8A 1RD6A 2VNCA 2EKJA 4OKDA 4WW2A 2KUTA 3BMWA 2P1YA 4X83A 4KUCF 1U8OA 3L5WB 3C5JB 3C8KB 4HXAH 2CO7B 1GZQA 5SWQA 4G8GA 3O3AA 3TO2A 5JQHC 4P5MA 1U8KA 2OCFD 1UEYA 5KW9L 1TJHL 4LHUB 1MIEH 2FR4A 1NANH 5DJYB 5DJ2B 4PRPE 1IGCH 5DRNA 3O6FC 1A2YA 1K85A 4NO3B 1YEEL 4P2OB 5T1LB 1JPSL 2R2HB 4MJ5B 5JOPE 1IEBA 1G7IA 2Z92B 1EA9C 1FZJB 1ORQB 3WIFA 1MRCL 1A4JB 1NQBA 4PJCB 4ONFH 4IS6A 3V4UH 4JHBA 3UJTH 1PQZB 1IAIH 3LEVL 3D2UB 4ZAKB 4WHTA 5FO8B 5CIPA 3VXMA 2EDJA 4ZNEE 3GSRA 4H26B 2HN7B 3C87A 5EH1A 4YHKH 4LOUD 1FNGA 2ZNWA 4L29A 5LG1A 4U1NB 4M8VA 3PGFL 4L4VE 4Y89A 3W5MA 4K23L 3CFDB 5LGHH 4AMKH 2VN4A 2OTUA 1KJ2L 2Q7YB 3SDYL 1CDYA 1S9WA 3GBNH 3OAYK 3VWKB 4M1DL 3MC0A 3GIZL 3PHOB 4LK4A 2Q6WA 4JDVA 1MEXL 3IFPA 1FC1A 3MLXL 4KHTL 3TVMC 4MQ7A 1G6VK 4PJIE 4KROC 4DFIA 4OLZH 1OP3H 2EIDA 4S1QL 1AGDB 1T5WB 2C1PA 3B5HA 5DMGC 4QXGH 3ABZA 5J9PA 2I5YH 1EXUA 4JM2B 1NKOA 4MNQD 4OI8A 2A6DB 5MEOA 2C7UB 3KPRA 4GW1B 2JTDA 5LBSL 4LSSH 1C16B 3DX9B 5L88H 1S7TB 1NPUA 4LFHD 3H9HB 3QHFL 1HI6B 2BMKA 5JW4N 1DBMH 3P4MB 1N5AA 3VWJA 5FYKL 2ICWB 1MJUH 3MYJA 3L5HA 4LASH 3DV6B 4GS7B 3WHE0 1JMXA 3MOAH 4PB9H 3MLZH 1CR9H 3WNLA 1F4AA 3LD8C 5C09B 5DD0L 1QO3A 4RMUA 3DURA 5K59E 4L9DA 2QKIB 4XNUH 1VGEH 1K8IA 3DWTA 4MWFA 1ZGLP 1UWXH 3CVHH 1OHQA 3RP1A 1F6LL 3MX0A 4KKBC 2ADJB 4JFEB 5CD5C 3ARQA 4O58L 5JPMB 2BY1A 2WINA 5D72H 4F7EA 2XWJA 3V5DB 4X6DA 1D5MA 3ZTJG 5D7IA 4JO1L 1PBYA 3FCTB 3UBXB 2BRQA 4F15B 5JTWA 1JUFB 3DROA 4XPHL 3AC0A 35C8H 2P8PB 1AP2B 1MFBH 2W07A 2CDFA 3LV3B 2I9LA 3CDYA 5C0BA 5DJAB 3U9UA 1MFEH 3GHBL 1BQLH 3IKKA 4H8WH 5E7FA 1FO0A 1HXYB 4JB9H 3FQNB 1PEWA 2Q8BH 4GG6A 3P0VL 3WKNA 2EH7L 4F9LC 5E24E 1FN4A 3A6CL 3VD9A 4Z9KB 2X5PA 4FNLL 5TFSL 3ILPB 5J13C 3ZE0E 5I1KL 5L2KA 1T5XB 5TE4H 3MLYH 3RGHA 1MCBA 3TO4D 1C08A 5B39B 2W9EL 2WNGA 3UDWC 3QUZC 2D0GA 1F58L 1B2WL 3GBLA 4K3DL 3BPNB 2BSTA 4WJ5A 5C0RL 1OQXA 5MI0C 4HUVA 4PYHA 2PTVA 1Z3GH 1A7QH 1HH9A 2PCPA 4PJGF 4F7MB 1OTSC 4TPRH 3MRBB 2YZ1A 4DVBA 2H2PD 4NKDB 1UJ3A 2EDDA 4PJDE 3D85A 3WFCL 3STLB 3KPSD 5F7EL 3MR9B 2IMMA 3M1BB 3ARBD 3NVQA 1KGCD 2G5BB 3PUCA 4RRPG 2H2SC 4YGVA 2IPKB 2VABB 3ELAT 4MDIB 1RUAH 5HHXL 3VJ6B 4JZJB 3AREB 2FWOA 2WUCL 3FB7A 4LCIH 4PJ5B 4JQIL 4U7SA 1RZIB 3QDGB 1LILA 3DVGA 3SKMB 2A74B 2JJTA 5BS0B 5B8CB 5JLZB 1FG9C 3RJDA 4TUKH 3HLAB 2X4PB 4WFHE 1FO0H 5KVEL 4CL7A 1RK1B 2VLLB 3UC0L 5CCKL 1QSEA 3HC0A 1V7ML 1T80A 4Z5RB 1U58B 3D87B 5D7KD 1QTYT 2UZXB 4PRIA 3S34L 4Y4KB 4YHLL 1L6XA 1ODAA 4KPHL 3VXTA 4IOFC 4JKLA 1KPVA 2R29H 3RL2B 3BYTA 4U1MA 4MXVF 3MLUL 2R2CA 2IPTH 3MRLB 4KV5E 4QY8B 4I9WE 4PGDB 1VPOL 4X6CA 1UM5H 2VDNH 5ITFB 4BQ6A 2A9NH 3F7YB 2F8XC 5KS9A 4U1JA 3PGCA 4B7LA 4EBQH 5KSVA 32C2A 2P5WE 4PBWD 2XG4A 4O2EA 4XZUB 4ODHL 5ICZB 1C5CH 1CFTA 3BGFC 1RPQA 4NDMB 4WV1C 4ODWB 1OM3L 1J10A 5L6YH 1Q9OB 1IM3A 3QDAA 3Q2CA 5JR1H 4RBPH 3BHBB 2DLGA 2V6HA 3BWUC 3W0WB 3ZYZA 2IH3B 5DEFB 3JWOL 4XNZB 4PRAA 3DV4B 5I75C 2UZYB 4WTZG 4Z95L 5JUEH 1I8MA 4H1LG 4XNXL 4RZCB 5HYJD 2V7HA 2I60H 3NH7H 4JCLA 2VTFA 5C0GB 4RMRA 3UAJD 1EBAA 5KTEL 1BD2D 2F74B 2CO6B 5HYIA 3MJ7B 3VFWB 2VXUL 1MF2L 4S0TD 5D1QB 1S7SA 4ELKB 2G60H 5C0FB 3QUYA 2VKXA 3SDAC 2PNDA 3TT3L 1BEYH 4EVNB 1T83A 4EI5A 3SJVE 5GGRA 3QDMD 2DI9A 4KK8D 1MHHA 4ZFFB 4PRBB 3QZWA 1A1NA 1HWHB 4QRUA 2OL3L 3BKYL 2Y4SA 4JFOA 4NNYB 1VSCA 4RQQA 3IF1B 5ESQB 4G6JH 4RMSA 1RVFL 1HILB 3TLRA 4IDJH 4ZUWB 5D70H 2IGFH 3HI6L 4P23B 1KXQE 1M7DA 2FH8A 5F9WC 1CICC 5CMAA 2VL4A 1TZIA 2ITDA 2MFNA 7CGTA 4UTAH 2IC2A 5DJZA 5C08E 3QIWC 4YR6A 4G9FB 1A6ZA 5J56B 1Y6MR 1BVLB 5DD1H 2EEBA 5T5NG 1OTUC 4MA1C 3TZVB 3WFEH 1FVEB 3KYMB 2A6IA 5CSZA 4C56A 4Y16C 1RZ8B 3MRNB 4L4TA 5ICYB 1KJMB 3VW3H 1F6AA 3LKOB 5H37H 5TDNA 3PE9A 5KSBA 3UTOA 1MI5A 4MCYB 4WU5A 4X7SH 4K3JH 1B0WA 3OL2A 1KJ3H 5DGRA 1EDQA 3DHJA 1PKQE 1JNNH 2R0LL 4CMMB 2IBBA 3V6FA 2E6QA 3GMNB 2AJXL 3PNWA 1BZ9B 5GZNC 5SWZB 4TTDD 5C0NC 5FYJU 5D1ZB 5EC1A 3BE1H 5DZOA 1DUYB 3MNZA 1NJ9A 2AJVH 5E8EA 1FORL 1AQDB 2A1WH 3NZ8B 5D96C 4UQ3B 1RMFL 5I1AB 2Y1VA 3PWVA 4OZFB 4U7MA 4CVXA 5GRJH 2UWEE 1MCHA 4NKMB 4P2YA 5J8OA 1RURH 2PW1B 3MYZA 5HSFA 1CT8B 1U42A 3TPUB 1KCKA 5EA0H 2YC1B 5FA3A 3I2CL 4YHNA 2YA2A 3KPOB 3NCCB 3VMOA 3T77B 3RZCA 4BELD 1KBGH 1YDPA 3N1FC 4HPOL 4TN9A 1KTLA 3DIFB 3HZMA 4ZPVA 5HGBA 1ES0B 5IOPB 3AFLA 1JHTB 2ESVD 1AY1H 3V6ZB 1G7QB 1ZHNB 1RUQL 1R24B 3IRZA 2BSRA 4YXKH 1LK3H 3BH8A 2IPUK 3KLAA 4NC1C 3KPMB 4XWOD 5JXEC 5C07E 3H9SA 3UTQB 1FLRH 3CJJA 2VMFA 3QUML 2GCYA 3E2HB 3WUWB 2JB5H 4N9GA 3VFOA 5DRXA 3UCRA 3WKML 2ILLA 2UVFA 5CBEA 4LU5L 5IVZA 1IC5H 4Z76A 2XZCL 4KQ3H 2DWDA 1AGEA 1PD6A 2AXGA 2ZPKH 3DRTB 3O3BA 4ORZC 4RDQG 3HAEB 5D6DC 5DC0A 3CCHB 2ZOKA 5IESL 5HHOE 1DLHA 1UYWL 4TNVK 3L7FA 4OQTH 5JHDE 2EXWD 1AXTL 2XKSA 3WIIL 3ZLQC 4BZ2L 3OKEA 1H8SA 4FQXC 4XVUD 5IB3B 1ITBB 5LKNA 1T0NB 4XC1L 2B5IB 2BJML 4MAYD 5EU7C 2YZ8A 3WS3B 1I9JH 4GUPB 4OIAA 1EAPA 1WT5A 4QYOB 5DXWA 1C5DA 5F1NB 5HXMA 1KN4H 1A0QH 4PJEA 5BV7H 2XT1B 1K5NB 4HIXL 2VLRA 1A6WL 4UOW1 2K3TA 5SWSA 1LO2H 3BMVA 2DM7A 2DQTL 4K7FA 3B5TA 3QDJE 2XY1A 4RFEB 4OZHF 2EKSB 5IW1B 3H7BB 4MNQB 4XNYH 2HG5B 1MJ8H 3ZHDA 2BFVL 4MZ3A 3CXHK 2DAVA 5E95B 1TCMA 1JWSB 5J3HD 3UTZB 2NTSP 3CX5K 3VGHA 1FFOB 5LWYL 2AGJL 3VG0H 3IU3B 3QNXA 3WSQL 3TT1H 1JZ8A 1FIGL 1FGNH 5F7LB 3UTPE 2E7HA 4G6KL 5FECB 4EI6A 2JLLA 1WV7T 1MNUH 4NQCA 5F93C 1LK2A 3WDHA 2QR0B 5BXFB 2C4XA 1KFAH 4XWGL 3N9GH 4NO0B 4C59B 1WQVT 5BQ7B 3M17A 1CFSB 3PWNB 4YDVA 4LCYA 4LKXA 5FGCE 3HNSL 1PX4A 2CPCA 1AFVL 1OSZB 4YX2L 1QFOA 5LGKA 3IAGC 2JIXA 3K3QA 1UCBL 4F58L 2O26U 3QXUA 5JPNA 4X0KA 3BDXA 1FPTH 5IJKC 2ZKHL 3FN9A 4RCAA 4F7PB 5HJ3B 2EDXA 4R6UA 1QEWA 1I8LA 1T6VN 2VIRB 1I7RB 1RJYB 1M05A 2FJGA 3U7WL 1V3JA 1YEFH 4TNWF 4YZFE 4NM4H 25C8H 4YDLC 4DKFL 5HD8C 3PIQA 2IBZY 3LEXB 3PJSA 4PV8B 2RBLA 1CXLA 2AK4E 4ZO8A 1ORSA 4LCWE 3FT4A 1JE6A 3HHRB 1R3HB 1E4XH 4OZHB 1MCOH 2R1XA 3HZKA 3UYRH 1FNLA 1LWRA 1SHMA 4XB7A 3TO4B 4EN3B 3PL6C 3PQYE 5GS2H 4L3EB 2AW2A 4CNIB 2JCCE 1BBDL 3O6LL 2IH1B 5EU3A 5E00B 3G6JF 1RIVH 4ERSL 1J0KA 2YUXA 4PJFF 4LEXH 3RVVC 5SX5K 2J4WL 3SGKC 1WBZB 3WNOA 4PUBH 4LKCA 4K8RL 5DJXA 4D8PB 1JPST 4NKOA 1EEUA 1TETL 5IGXH 3MRKA 4D9LL 1KXTB 1D9KD 4KI5D 4YXHH 1E27A 2F5AH 3WN5B 3OAZH 1I1AD 4LLYB 4EXPX 3EIFA 5BZWA 4WO4A 3TFKD 1FZMB 4K9EL 3KPSB 2P24A 3UPAA 1NCBL 43CAA 3WNMA 2BHYA 3SE9L 4GLRI 4PGCA 2LTQC 3ZMRA 2DJSA 2OYPA 4MDJB 3ARDC 3QFDB 3C09C 4MCZB 1VESA 1X7QB 4N8CL 4JG1H 5FO9A 1QR1A 1T1ZA 3KXFA 1BBJA 2B2XL 4OQ1A 4HK0A 1F11B 3TCLA 2XNAA 3HE6C 5ITBL 5KANG 2NR6D 5T3ZD 1KLGB 5HHPA 2HKFH 5I76B 1UB5A 2NY6D 1YNTB 4JY4B 3K74B 1DEDA 1MLBB 4UDTB 5CBAA 5K9QI 4NNXA 3AAZA 2ENYA 2GUOA 1P9MA 2FJHA 3T3PE 5IT2L 4DFHA 4YGAB 3TM6A 1NBVL 2HH0L 2PXYA 4X4XB 2QHRL 4FQ2L 1BJMA 2NY4B 5IB4A 4ZDHA 3VFTB 1J1XL 1OPGH 3RWCB 3QXAB 1UA6H 4ORGA 2B20A 3G6AB 1A47A 3FO0H 4LLAA 4Y1AB 5DJDB 3Q5YA 5C9JB 3OSKA 2VZ3A 4QT5B 2DWEB 4Q9RH 3NOIA 3QUXA 5EUOF 4JZOA 3KWWB 2JK5B 2OX5A 3G6JB 2CKBL 4PJFB 3IDNB 1S78D 1IGIL 4ODUB 4P2RA 5L9DH 1N26A 4N0FA 4AQ1B 3LKRA 1ND0A 3QEQD 5IHUH 3LIZL 3EYOB 3RY5A 3V0AC 1FRGH 1YNLH 2FD6H 3B9KA 3GJEA 3A6OA 2FSEA 5C2UB 5FYLH 2IG2L 4AH2A 1NLBL 5DHYA 3RWFA 5DHVH 5HYJB 3AXLA 5AZEH 4Z7UA 2DJ4A 2KL6A 5EORH 1UACL 3TNMB 1R3KA 1BD2B 2Y06H 5EU6D 1RIHH 4PV9B 1CDBA 2Q3AA 3H3BC 4NZTH 1H15A 5TH2A 1ETZA 2NY1D 4WWKC 1FL5B 3IJHA 3QG6B 5D2LE 5IEKA 1JZ2A 5IW3A 1REIA 5EPMB 2E9WA 3X13B 4TNVF 3O3EA 4PTTB 1IBGL 1N0LA 3GKWH 3M45A 3O4LD 3JWDL 4LSTH 4WVRA 3P4OA 3BIKB 1TTGA 5IBUG 4L8CA 4J3TA 1UWEL 2YRZA 5IHLB 4CDGC 1GOHA 2HLAA 2ZNXA 3EDDA 4R3SB 1NUDA 4B0MM 3VFMB 1AC0A 3MCLH 1YQVL 4KMTH 3MGOA 3MRGB 3QIBC 4NHCH 5KOMC 3SKJH 2XFXB 1CGYA 1G7HA 43C9B 2ADIB 4ETYA 1BM3L 1UXSB 2EYSA 5FUOH 2C5DC 5TDPA 5I1HH 3RKPA 5HDQL 5CJXA 3RI5F 1S9VA 4V1DE 5SX4H 2XG5A 2V2TB 3L5JA 1U3HD 3S5LG 2CDGB 4YHOH 5FYKU 1A1OB 2ZP0T 3V6BR 2A83A 4PLJD 2ZUQC 1U8IB 5A16A 5E08L 1G0DA 1H3PH 1JWMB 3TJHC 3X14B 4GSDL 1A8JH 2HT3D 3THML 4M7KH 1PX3A 3PWUB 4R4BB 4GMSL 3QXDA 1P5UA 5CZKA 3KPLA 5CEZL 1RIUL 3IETB 5HGHB 3P11L 3GGWA 4JAMB 1UKQA 4M48L 3QPQC 4IDLA 3U36B 2XKNA 3ROLA 3QIUB 3FFCE 3W2DL 3DSFL 4PJHB 2WWKT 5GIRA 1KLUB 3C6SA 3OPZH 2EE9A 2CLZA 2XZQH 4M7JH 3SKUD 1PJ9A 1FDLL 3AM8C 4OCXH 4OLEA 3FB8B 3HS0B 4G42A 1K8DB 3ARTA 3T0EE 4H1LB 4N0YH 1WBYB 1WIOA 1Q94B 2R9HD 3UTSE 1F4XL 3MREB 2B7DT 1NSNL 1KB9J 3L6FB 1PGRB 1DBAL 2R69H 1P4IL 2NZ9D 4NQVB 7FABL 3BIBX 5EO0B 3TIDA 4O02H 2F53D 3D39A 1C12B 1YMHB 2Y7QB 4FA8A 1NC4D 3R06B 1KACB 5ESAA 5HGAA 3V4VL 3ZDYE 2HRPH 4EDWH 2ESVB 1AHWB 4DGYH 1YYML 4G6ML 1IAMA 5I1CL 3QFJE 4PRNB 5BRZA 5ISZD 5MP6L 2FNBA 5GGQH 5F96H 3TYFA 1NFDF 3DO3A 2H32H 2J3SA 4RX4D 3MXWH 4ETQA 3TN0C 1TITA 1LGVA 4QCIA 2ED8A 1C7SA 1EHLL 1F8TL 4I77H 3CU1A 2Z4QB 3RNQA 3JTSA 2VLKE 4H25B 3RIFK 2GJZB 1CFNA 3ZKMD 3F5WB 1FNEA 3H42H 3L3GA 3SE8L 5MHSD 4U33A 3X11A 2F54A 2VB5A 5F1OB 4PJ7B 5GS1A 1FBIH 4PD4J 3LRSA 2OJEA 3GSQB 4IRSC 3VMPA 4X9IA 1WBXA 2NNAB 4XP1L 3L3IA 2PYFB 1JRHI 3T0EC 4AEEA 4POZC 3NABL 3U4BH 1JNHB 4KQ4H 1I4FB 4Y5XB 3NA9L 3GUTA 4GBXD 5BW7A 4MAYB 3KPQB 3U9PL 3QQNA 4UINL 4QHMB 4RDQF 2MCPH 3BVNB 5DR5H 3MRRA 5IVNA 1FCCA 1QOKA 5E8OA 3ES6A 1L7TH 4ONOA 3CSPA 1NAMA 1A6VH 1F90H 2Q76A 2XRAH 5D71L 2P8MB 4JREB 2I9TA 1OP9A 3N1QC 4WI9A 1MCCA 3MOQA 4QHNB 2B1HL 3V5KB 1A5FH 2YBRA 4ZSOA 4A6YH 3MUY1 3I3DA 4GG8A 1CK0H 3DUSB 2B8OT 4MS8D 4BZ1H 3GK8L 3WHXB 4FQHA 5A3IC 4G8IA 4RGNE 4JPIB 5GGVL 4FXLA 3U1SH 1NLDH 1JN6A 1KB5H 3VCLB 1HQ4B 4BSVA 3T1FA 1JGEA 1Q1JL 2W1NA 2DQDH 2V17H 4DGIL 4P99A 1TLKA 2B4CL 1DEEB 3ZL4H 1CE6B 2A38A 4AY0A 2BY0A 2M2DA 4Y4HD 3GSOB 3HPLB 1QLRA 3EYQD 4PJAF 1E0OB 3BN9D 3OKMA 4Q0XH 3K2MC 4PG9A 5FM5M 3BDBA 1WFTA 1OT2A 2OJZH 5I8CA 1KIQB 3FN0L 4AIZB 5L7XH 2CJUH 5FHAL 1YNKL 3MLRH 3ZSTA 3WHE1 5MENE 2X4OA 1AXIB 1VB9A 5DC9B 3K4ZA 4HMDA 5JW3L 2ZSWB 4MJID 4KRMB 1U8JB 3QRGL 4Q9QL 3RKDC 2VISA 3H0TB 2YD5A 3O4OC 4RFOH 5I1JL 2BVOA 3QO1A 5E5MA 2R1WB 2CDEB 3HFML 5CSBA 1HCVA 4BYHA 5BJTB 1DDHB 3L3JA 1NAMH 1NGWA 3GO1L 3SCMA 3DVIA 2ZG2A 1UM6L 2XIDA 4GRWB 4HIJA 1G7MA 4PR5A 1UB6A 1N3NA 3KG5A 1JGVL 2DOCA 4NUGH 1AO7A 3BP6A 3QJHA 4RGNC 4P4RA 3P4NA 3L3KB 3EOTL 2E7LA 2Z8VC 5D7JC 2YEZA 4XP4L 5J11C 1CU4L 1D5XA 3P0GB 4X8JB 3TV3L 1T1YB 4BFGA 1DP0A 1UH2A 4OUUB 4S1RH 4NO2A 4Y4FA 5E1HB 1FG2B 1GGCL 5LQBL 4LGPB 4HWUA 1PEZA 5JIKA 4N0UB 3WE6A 3VXRD 4BUGA 2X05A 3EJYC 4XMKH 1JHLH 1YEDB 1H3TA 4WUUD 3GSNA 1R0AH 1KCSL 4PB0L 3CSYA 3DUHA 4UT7L 3VRLE 3OJMB 1Z9OA 3FQWB 3QJFA 3G6DL 4JPVH 4GAYB 4HLJA 5I74C 3T2NH 1HK6A 1HE7A 5DTFB 5C0EB 2GSIA 1K4CA 4HQQH 4PJAB 2ADGB 3S4SG 4F57H 2FATH 5JHLL 2OTPA 3KYOB 1D9KB 1II4E 3S3SA 4G8GD 5D2NE 4YE4H 2Z93B 1OB1A 1I1AB 1JI2A 2JELL 4PGEB 3W9DA 1IGFH 3OR6B 2BZDA 3VXSE 2VC2L 2Y5TB 1U8HB 3CZFB 2XWTA 4QGYA 4LBEB 2RQ8A 4PLKD 4LLQB 1Z5LA 4QRRE 2BSSA 2FBJH 4MNHB 2NW3A 3FO1A 4WFED 1QKZH 2M1KA 1S5HB 3O0RH 3O6ML 4Z7VE 3STZB 4ZNCD 4ZFOB 1RZGA 3I6LE 1UT9A 5AG9A 3EKCA 4U1LA 1IILE 5EBGA 3V5HB 4NZUH 3P77B 4ENEC 2AV7B 3SDXB 1ZT4B 5E9DA 4RMVA 5IFJA 3VXMD 3RGVC 3BKMH 3KJ4B 3V6OA 2NY6B 3I6KA 1A3QA 5I1DB 2WBJA 1QFWL 4MNGA 2H3NA 4OLVL 8CGTA 1EMTH 1F2QA 2F5BL 4YHIB 5ESVB 3B2UD 4UU9B 4KH2A 4R7DA 3N85L 3B2VL 3AB0B 4CGTA 4BQ8A 4WEBL 5CEXB 3GSNH 3O8XB 4HKZA 1ZEAL 5BVJA 1IFHL 1UG9A 1GSMA 3AMKA 2FIKB 4QHKI 3MV9A 2VE6B 4XAKE 1MCWM 3GMPA 4PRDA 1CF8L 1J1OH 4M00A 5D2NC 1W72A 2GSGA 1ZA3A 1ZHLB 1Q9WA 3P30H 3KPRD 5EOCH 4Z77A 3B6SB 1HHGA 1X5AA 4HH9B 3WD5L 1QHPA 1IC7H 4DZBB 4HDIA 2VN7A 1YN6A 1G9ML 2C1OB 5I16B 1NEZA 4YHZH 2JJVA 4Z0BL 5EU6B 5JMOC 5DSCB 1P84K 1RZKL 1PYWB 2ZUWA 2GT9A 3RIFF 1GAFH 5IVXA 2NY1B 3BESR 3PWJB 4I4WB 3ZDZF 4GXVL 4IHOB 5F88A 4KK5D 1BREA 3BW9A 2FRGP 4DTGH 5I15L 2GKIA 4JANB 3QNZA 1A7RH 3BWAB 3OGOE 3CFCH 1A4KB 4GMTH 1H8OA 4E0RB 5DJ0B 4R96A 3NCYS 5IBTH 1NMBH 1P4BH 1LP9E 4HWEH 2DQGL 4JFYA 1TVHB 1PSKH 4MXWL 3MBEA 5I1LB 1DVFB 5AG8A 4X99A 2DLHA 5EUKA 2WANA 3GI8L 3SKOB 5D5MF 2QHLA 4UDUA 1T2QH 1DANU 5ENWA 2AABH 5C0BD 4J6RH 4ZOCA 4UBDD 1LO5A 4KRPC 2A73B 3BP4A 4MD4A 4ALAH 5B4MD 3IFLH 1MVUA 1W72H 5GHWH 5ID1B 5CINH 1CE1H 5AWNL 2PYEE 1ADQA 4QWWD 1OSPH 4PTUB 5EIIB 2IAMA 3ULVL 1ZS8A 1U3HB 4YWGL 2V5TA 2UYLA 1CXFA 5FUCE 4ELMB 4P46C 5ALCH 3WLBA 3CFJA 5KZCD 5L2KD 3C2SA 1H5BA 2E8ZA 1MLCA 3OJ2C 3JTTA 2KBGA 3EYUL 3GSVA 4J4PA 2D0HA 3EOAB 4S1SH 3O41B 5DYOA 5ADOL 5H37G 3C60A 3UBXI 4DW2L 2F58H 5E8DL 5EZIH 1CYGA 4PBVC 2VITA 4OZGA 4N0CD 5GSVA 2FX8H 1FSKC 1GHFL 1S9XB 1NMCC 2NW2A 4K2UH 4KY1L 5GRYA 3ZZ1A 1MH5A 1EFQA 4O9HL 4I0PA 4HT1H 1VFAA 5F8RC 4HS8L 4M6NH 1JBJA 4Z7WE 3OKOA 4NQEA 5JIHA 1UKTA 4UT9L 1QBLL 4NQXA 3GKZA 3AS0A 2VXSH 3D85D 2EC8A 3U0TB 1PKQA 1ZVSB 3C8HA 4HUWB 4XPTL 2VO5A 3U7YL 3GJFB 1G6RA 4ZTPH 5DLML 4P3WA 4NZJA 1JV5B 5I1IH 3CMGA 5CZXC 4ONHA 4JFXA 4XHJD 1DQLH 4G7VH 4DZ8A 2VXQL 2H6PB 4PY8J 2F53B 4XVSH 4D0DB 1TCRB 2QBWA 1MRFH 3D3VA 3EAKA 1HHKB 1NC4B 1MCRA 1QSED 2XKUA 3BEVA 5DRWA 1JF1A 1ADQH 2DQEL 4K71B 2X1QA 3RTQC 3JXAA 3MROB 4PRID 4D9RD 1U3ZA 5FUCC 4AZ8A 3KS0H 3U4EB 4KXZI 5ISZB 3WFZA 1MHEB 1QRKA 1J87A 4Y5VA 2JJUA 2JJWA 5IBUB 4WI4A 4WHYH 1KUMA 1OAKH 5TDOA 3MRJA 4NM8H 5J1AB 4NQUA 4OLWL 4WY7H 1JK8B 3BPOC 1NMAL 2EIZA 2IANA 4LEOA 2KZ1B 3RVWC 5DF0A 1EH9A 1QLFA 2FEEI 3IDGA 4KRLB 3NIDE 5F7FA 3QPXL 4FXKA 5FHBL 4K3GA 3LQAH 1YPZF 5KN5A 4MJ2A 2BNUA 4XP9H 3QAZC 4LSVH 5I66A 1AKJA 5DUBA 1I8KB 2FGWH 4OKVA 4R90L 1S7UA 5GGUB 3TA3C 2BVTA 1RUKL 3H9YA 3VH8B 1MHCB 2APVA 5TQ0H 3S5LB 1QP1A 2VDKL 4QHUA 1XGUB 4OZIE 3OG4B 4YBLC 4TRPL 5IBLD 2IQ9L 1FFNA 1IEAB 2XN9B 1IC4L 2VLJB 4GBXB 5EO9B 3P73B 5J06A 1LO4L 2NY5H 5JW4Q 4MA3B 2HRLA 4R0LA 5E8NA 1CGVA 5HHOA 4PP1C 1MAML 4MXQC 3V9FA 5JHDA 4NWUH 4GRLD 3RL1A 2AJSH 3AS1A 4P5TC 5E6IC 1BVKB 1AQKH 1HSAA 3FT2A 4PJBF 2BX5A 4M7ZC 4G7YH 3S36H 1N0XL 5D1XA 2WUBH 1T03L 2BOBB 3FQRA 3QUYD 3L3HA 2H8PB 2EDYA 3PDOA 1EZVY 3MLVL 1OGAE 5GS0D 4U1SA 4NNPH 4EI5D 1WEJL 2EDHA 3VDAA 3IU4L 5E4EB 4JFZH 2XQBH 1SJXA 1TVBA 1FE8L 3E6HB 5FA4B 5TE6H 2IBGA 1RJLB 5EZLA 3QWQB 2MHAB 4PJ8C 4I48A 4E5XA 1IGYB 2E6JA 5HGGS 1EAJA 5C7XH 2H45A 4MAUL 4PJCE 3TBSA 1BJ8A 3I85A 2FHFA 3MV7E 1LDPH 1CXKA 4Y4HB 4QNPE 4OF0A 4M4RA 4ZMAT 1GZPB 4WW2F 4XMLH 1MRDH 4LPTA 4QF1A 5EZOL 2D03L 4L8SA 4XBGB 1N6QH 3NIFF 3BGMA 4HUUA 2VLME 5IV2A 1YPZB 1AGBB 5INDA 2QSQA 5ACZB 3FJTA 2P45B 4HEME 3U0PA 2IMNA 1N59A 3UPRA 3LQZB 3H2WA 4UAOC 5D93C 4MJIB 2G2RA 2XV6B 3OMZA 5C71A 4R4NC 1T1XA 1YEHH 4OV5A 1UZ8A 2DMKA 2HFTA 3IGAB 2HTKD 2O61B 4C56D 1YQ2A 1S5IL 1TNNA 3L5XL 3WFHB 3C08L 4L4TD 4RNRB 2X42A 3MRHB 3ZKSD 4Z78A 1MI5D 3A6BL 1P7QB 4M43L 1U3JA 3CK0H 4JFDA 1OAZH 1BJ1H 3KJ6H 4TSCH 5CP7B 3WV0A 1N5YL 1D5ZB 1HOCA 2DLFL 2BOCA 5F89A 3HI1A 1FYTA 1T0MA 4M5ZL 4Q58C 4JR9H 2AEQH 3ULVD 2Z8WC 4P2OC 1KEGH 1NGZA 4NN5B 3HZVB 5C0AA 1YMME 3VDCA 1WAAA 3VXNA 5DDHA 4OGXH 2A6JA 4HWBL 4ZAKC 3VXRB 4Z7OF 15C8L 1BFVH 3PG2A 1U8NA 3CFKA 2PR4L 4P0DA 5C09E 4OCYL 4PJGA 4WUUB 2CMRH 2E9BA 4I3SL 4N68A 1IT9H 2AK4A 4U1HA 3RZCD 1J11A 2X4RA 1LEKA 2APTA 3CX2A 4JFEE 3DX8B 3HKFA 2A6KA 3M8OL 5HVGB 3BQUA 3VWKC 4WW2B 3STBA 3K8LA 4JN2A 4Q74A 1EJOH 1U8OB 4Z8FL 5SWQB 5HDBE 1ZXQA 3O3AB 4G8GB 4XPBL 3TO2B 4P5MB 2JCCA 3WFDH 2ARJQ 3T08A 1B90A 2R4RH 1U8KB 4PY7A 4MA7L 4OB5L 4Y5YA 1HYRC 2AJ3A 5KSAB 4OCSL 2FR4B 3H9SD 4LSRL 1AI1L 1OCWL 4JM2C 3L1OL 4P5KA 1SY6L 2NY5C 5DRNB 1A2YB 2DBLL 3W11C 3IXTA 1IEBB 3V0WH 1G7IB 3O2WL 3WIFB 4KTDL 3EZJB 3MJGX 5AUMA 3ARZA 4IS6B 4WHTB 5CIPB 2VYRE 4YEEA 3VXMB 2DQJL 4DUXA 1FL3A 4X6DF 5IROC 1FGVL 4GS7C 4KHXH 5H8DA 1OP5H 1FNGB 5D7IF 4L29B 4HFUH 1A3RH 1UH3A 1SMOA 4HUNB 4X5LA 3RVUD 4Z0XA 3MBXH 3KLSA 3OX8A 4IRZH 4XXCC 1INEH 3VI4F 2OTUB 1BWWA 2G75A 1S9WB 1WFUA 2X1PA 2FDBP 4RAVA 2Q6WB 4JDVB 2VLRD 2G5RA 1I3VA 3IFPB 3EHBD 4UILH 4MQ7B 4IEFB 2QADD 2NX5A 3DMMA 1FVDA 5SWSD 5L0QB 4ONGL 5HYFA 2Z8RA 1RZJL 2Z91A 3S9DB 2C1PB 4F15C 1ZSDA 2N7BA 2EO9A 4C4KT 1T2JA 1MCWW 1FH5L 1OW0C 5MEOB 3NTCL 5INCA 1M1SA 1CLCA 1PG7X 2EZ0C 4PJ5E 3QDGE 3HC4H 5BS0E 4KWUA 2BMKB 4JFPA 1N5AB 3MCG1 3VWJB 1YYLL 2X70B 1IEHA 3MYJB 4QRPA 4WI6A 4LRNL 5GS2D 1BOGA 4IIQA 4U2YA 1TQBB 2NYYD 3IDIB 5IJVA 1UM4L 1NCCL 1QO3B 1B88A 2ITCA 3DURB 4NQCD 1MY5A 3D25A 3MLWL 1K8IB 2DQCH 3GMQA 4MWFB 5F1SA 2UY7A 3BPNC 1MHPH 3D6GA 5HYSA 3SE4A 1E6OL 2WINB 4O4YL 2VQ1B 4F7EB 4XCFL 2DDQH 2XWJB 4M5YH 4X6DB 1D5MB 5FYJH 1Y18A 3LN9A 4RISH 5D7IB 3ZYIA 4JHAH 2JIXD 3FHQA 4LP4A 2BNRE 1ERNA 1QFUL 3DROB 1D6VL 3DUUA 2YPLD 2EH8H 2HKHL 4EKXA 2CDFB 4X5WB 5EO1A 2I9LB 4XTRC 5DK2A 1S7QA 2GI7A 3BKJL 1FO0B 3MV8A 3RDTA 1W8NA 4YXLL 4JZJC 2ADFL 3AREC 5IK3A 4LSDA 1BQHA 2HJFA 3B8YA 1ZGLM 4OGYL 4GG6B 4WHDA 1GGBL 2PETA 3RIAF 1FN4B 1MQ8A 4X6CF 5F3HB 1W0WA 5B8CC 1INDL 1HSBA 1JWUA 1U93A 3IFOA 5KS9F 3C6LA 1MREH 5KZCB 1A6TB 3O6KH 5EULV 3HNTH 4N1HB 3ARGA 4LIQH 4OZFH 3LEYH 1Q72H 3V52H 4V1DA 3S36X 2J8UF 2BSTB 2APBA 3A67H 3LMJL 4HWNA 4WJ5B 4C83A 4OJFH 2Y36H 2EECA 4HUVB 1JNLL 3RX7A 2O5YL 4V2BA 1B0GA 3JZ7A 1HH9B 2ZOLB 2PCPB 1XT5A 4HW6A 3HNVH 2B1AL 5DGQA 1GGIH 3ZE1F 4DVBB 4MXVE 1UJ3B 1AE6H 1L6ZA 4WO4D 4LQFH 1KF9B 5MEPA 5EFIA 4D3CH 4YGVB 1ZTXH 3RU8H 5IW6B 3SOBL 3FFCA 2Y6SC 5FYLD 1KPRA 1CQYA 2FWOB 6FABH 3EOYG 3FB7B 3P3YA 1R6VA 1V7NL 4AT6A 1HKLL 4G9FE 4HGMA 3DVGB 3WBDA 1NH6A 4XNZC 1Q0XH 1MCIA 3BH9A 1LE9A 3SGJA 1X3DA 3RVXC 4JQVA 3KXFD 2IFFH 2MKWA 1QSEB 4PLOB 3HC0B 4GW4A 2XA3A 1V05A 1DFBH 4ZS6D 3H3KA 4PRIB 4N5EC 3HAEH 5EOCJ 1A6UH 3ILQD 1Y0LA 3VXTB 4FFYL 1KPVB 4ZUVA 4U1MB 1QBML 4BFEA 4LRIC 4NRYA 1J8HB 3JWNC 3NFSL 4AEFA 3WLWD 4FQLH 3K1KC 2YSSA 2PXYD 4J8RA 1JZ4A 5IEHB 5KS9B 4RWYL 4U1JB 3PGCB 4DKEL 3QFJA 3BZ4A 5KSVB 4WFGD 5SWZE 3TPKA 32C2B 4KVCH 1AC6A 4FG6C 8FABA 1ZGLB 3IRPX 4M6OL 4O2EB 4FABL 1CFTB 4HMCA 1GC1H 3QUXD 1IM3B 4LIQE 3WS6C 4MZ2A 4U6VH 1IGMH 4P2RD 2VLKA 2E7CA 2GTWA 4JO2L 4NC2B 1WC7A 4P23C 4PRAB 2WW8A 2GFBA 4KKCC 5DO2D 1IM9A 4OCWH 1I8MB 2OM5A 3S88L 5DJCA 1PZUB 3ZHKA 2R0KH 1I1YA 2CK2A 3JBG7 2HT4C 2D9CA 4MYWB 2R8SH 1NCUA 1QR4A 2GJ6B 4ZG1A 5IWLA 3TNNA 1AGCA 3TZVC 3K4DA 3ULVF 4WUKH 4J3SA 1HIMH 1PLGL 4NQDA 4PREB 1V3LA 1BWMA 1IKFL 5CSGA 2N56A 1S7SB 3QUYB 3MRPA 3TC9A 3ULUD 5E2TH 1NC2A 4WIQA 4LMQI 3RHWF 1BAFL 4W68A 3T3MF 4XCCL 1VACA 2VDQH 5GGRB 5EBWA 2HTLD 5D8JL 2ZJSH 5TF1L 3MACH 1MHHB 3VXUA 1F5WA 4F2MA 3HC3L 3QZWB 1A1NB 2XA8H 4HJ0C 4QRUB 3WJLC 2O5ZH 1SYVA 1XGQA 4N5UA 3U2SA 2XQYG 5D1ZC 4JFOB 3NZHH 2X44D 1KPUA 3VXQA 4RQQB 1X5JA 4NBXB 3DLQR 3JV4B 1T04A 1MQKH 1KEMH 3WEXA 5M7QA 2D0FA 2DIAA 2EE2A 2CR3A 4FZ8H 1PKOA 5TPWH 4H20H 1FNFA 4B53A 2YA0A 1Z0NA 3OR7A 1TJGL 1UGNA 5CMAB 2ITDB 2VDPH 4ONFL 3LS5H 4I3RL 3V4UL 5DJZB 2OTWA 4YR6B 1A6ZB 2UUDK 4KKLC 4APQA 4YHKL 4QOKA 2A6IB 5CSZB 1OAXL 1WJ3A 4R26H 4L4TB 5H35A 4U0QB 5EIQA 1F6AB 5TDNB 1IMHC 5MENA 3DSNA 3HB3D 5KSBB 3RA7L 1MI5B 2MPAH 4WU5B 4QXUL 1EK3A 1RULH 5CD3B 3NACL 3AY4A 4MGXA 4LSUL 5ACMA 3KPNA 3QH3A 4MNQE 1CBVL 2P44B 1NDMA 1AJ7H 3E2HC 1LNUA 5GQBA 3CSBA 3V6FB 4X7CC 2ERJB 4FQCL 1SJEA 3PP4H 2Y23A 1BQSA 3PNWB 4OLZL 5F70A 4ZUUA 5CJQH 1I85C 2LAAA 4P2CG 2ZUYA 2QQNL 5GGVY 3MNZB 1NJ9B 5E8EB 2HA1A 2OBGA 2P8LA 2DQIH 4PJEF 4Q9BA 3PWVB 5DMYA 2COQA 4CVXB 3QEGH 4XPGL 4LSSL 5L88L 2PW2A 2XY2A 1KJ2A 3DVFA 4A2MA 5GGSY 5FA3B 5MERB 4LOUC 3CMOL 1DBML 4YHNB 2HFGH 5BV7B 1F3DH 5KVGL 4X80H 4P48A 3RZCB 3G5ZA 1YDPB 3MUGB 4NCC2 4U1IA 3PDDA 1QFHA 1CG9A 3D39D 1KTLB 3HZMB 3V79C 4ZPVB 5HGBB 5T3XD 4DKDC 3AU1A 1CFQB 3IJSB 5HI5D 4EDXA 2HJKA 4XNUL 1MELA 3EJJX 4OD3H 1J0JA 4BJLA 2BSRB 4HV8A 3CVHL 1MJ7L 5BRZD 3KLAB 3BH8B 2A9MH 1I8IA 4JY6A 4LVNB 4NJAH 4BH7A 5KW9H 5D72L 3I6GA 3H9SB 1TJHH 5J0BA 2GCYB 4DN4L 3CFEA 4N9GB 4YDIL 3VFOB 5DRXB 1BPVA 3RUGA 1ZMYA 1XAUA 5IVZB 5K33A 1YEEH 4LVOB 5IVOA 4Z76B 2CXGA 35C8L 1YEKL 3GIVA 5IKCA 1MFBL 2DWDB 1AGEB 2AXGB 3O3BB 1IKNA 1MRCH 3LZFH 2ZOKB 2F54D 4JRXA 1DLHB 1BQLL 1HHHB 4QRRA 3LEVH 3L7FB 1TZHA 2Q8BL 5IHZA 3OKEB 3SGEH 3DX7A 1RUPL 4K07A 4L3EE 4M9PA 4M1GH 4OF5A 2XTJD 3PGDA 5I19L 2E27L 1XCQA 3BPCA 1EAPB 2CGRH 3D18A 4BSJA 1C5DB 1VEOA 4U1KA 5EUOA 1CXHA 1IQDA 1T7YA 2DYPB 3BJLA 4PJEB 5TE4L 4GRMA 1MCJA 3GIZH 2VLRB 2ZUVA 3N0PB 2QADB 5SWSB 2D4DA 2VQUA 1I7TA 4K7FB 5GS3A 2CXKA 3KPSE 4S1QH 1MAJA 1Z3GL 2AVGA 5A2FA 1A7QL 2QSVA 4GAGL 1HZHL 2WK2A 3HMXL 3RQ3A 1KYOJ 1RK0B 2WQRA 4GKZA 2W59A 4TPRL 1ZLSL 2VZUA 2J7LA 3QHFH 1A7NH 4C55A 4OCLC 5BO1H 3LY6A 3QNXB 3OTTA 1XF3B 5FYKH 5D7KE 1MCPH 1BECA 4EI6B 3K8KA 1FFPA 2YWYA 3T4AA 4NQCB 1LK2B 5DD0H 4TULL 3TO4C 4EN3C 5DT1H 1HN1A 4XNMA 1CD0A 1KCRL 3R1GL 3VXOA 2HT2C 4YDVB 1W0VA 4LCYB 2LVCA 2R29L 2KZWA 4J3UA 3SN6N 5I30L 3X12A 4Y1AE 1JYXA 4XMPL 2JIXB 3EO1A 2YUWA 4JO1H 4LMQE 3VFUA 5JPNB 3B5GA 1UM5L 2VDNL 3WN5C 2H2PC 4WWID 4X0KB 3SCMD 4PJFE 4OGZA 5BOZG 3ARBC 1U8QA 1LP9A 5DI8A 3VE0A 1QEWB 1AO7D 3O3DA 2FJGB 1M05B 4PJ9A 5C70A 1S7VA 3PIQB 3VRIA 2GTZB 3PJSB 3P0VH 2EH7H 2D31A 5HYJE 1OLLA 3FT4B 4FQPA 3A6CH 1U8LA 3MJ9L 3QSKB 4Y4FD 1MWAA 1JZ7A 1L9NA 4FNLH 2VDRH 3RAJL 1BD2E 1RQ5A 5TFSH 5J6HA 2Q3ZA 2R1XB 3HZKB 5I1KH 4NBZB 3QR2A 4LPWA 3ZT7A 4CDHA 1P7KA 1S7WA 5ANMA 2VDLH 1CXEA 2W9EH 2JJSA 1I9IH 2G9HA 1RV6X 1UZ6E 3HPJA 3DECA 5EU3B 4K3DH 1B2WH 2X4SA 4HC1H 1DSFH 1NEZG 4M03A 1M4KA 5C0RH 2D7TH 2DKMA 4NFCA 1E4WH 1OF2A 4IOIA 5AD0A 1B0RA 4LKCB 1EBPA 5BMFL 4NKOB 2Z31A 1A9BA 4P59L 3WJJA 3MRKB 4LL9A 1XEDA 1JZ6A 1E27B 3TWCL 1BEYL 3GNML 3GM0A 3OAUL 5BZWB 1N8ZA 4WO4B 1CXIA 2P24B 2VL5A 4FMFA 2Q86A 4Z7UF 5F7EH 1XR8A 2KQNA 4PGCB 5FOJA 2QQLL 5B22A 3BO8B 2WUCH 4AQOA 1R5VA 4JQIH 2DD8H 3ULUF 3C5ZA 3S35L 1NFDA 3IAPA 4KMQA 2J5LB 2OMBA 5FO9B 1QR1B 4LAQL 3KXFB 5D70L 2IGFL 3NIGF 4HK0B 4N8VA 3TCLB 3UC0H 2XNAB 1V7MH 5E9DD 3RX8A 3UAJC 3S34H 5HHPB 1NAKL 1UB5B 4KPHH 3MRMA 4OCRL 2AXJA 1MFCL 3FT3A 5DQ9A 5CBAB 3AROA 4NNXB 3MLUH 2GUOB 4WFHD 2FJHB 3WFEL 1JZ5A 1EHXA 4WHYG 5JQ6L 4QRQA 2PXYB 2DI7A 5E70A 4ZDHB 2R2BA 2EDQA 2VDML 4PJHE 2HWZH 1UWGL 4G6AC 5FV2A 1UEMA 4KK8C 4ORGB 3LHPH 3MV9D 1KJ3L 1NGXA 4OF8A 4I9WD 4JZNA 4HHAA 3QUXB 4JZOB 1VFMA 1NCDL 2Z35A 3X17A 4P2RB 4N0RA 3TP4A 2H26A 1ND0B 3LKRB 4OM0H 3BE1L 5EBMA 5F9JA 3NCMA 2ARJA 3G04B 3B9KB 2FSEB 3B9DA 4LHJB 5IG7B 4AH2B 5DHYB 3AXLB 1UWXK 4XNXH 1BIIA 4Z7UB 4X4YA 1R3KB 4LF3A 4OZIA 3QHZH 3BP7A 3B9VA 1H15B 5TH2B 1KBGL 1C5BL 5D7LB 3ETBF 2RFXB 5C0DA 3O45A 3H8NA 5IEKB 1DCLA 3G5VA 1EUTA 4TSBL 3O3EB 3G9AB 3PWPA 3BXNB 3G08A 1OVZA 1SYSA 4JDZA 4XVJL 1NBYA 4KU1A 2MTPA 4S1DC 3K2UH 3P4OB 1CLZH 2WBKA 5FFLA 4L8CB 3CDFA 1CGXA 1S7RB 3QIUC 5FGBA 4G8EA 1TENA 4GXUN 2HLAB 4H88L 4Z18A 1D5BA 4TTDC 1FLRL 2OL3H 3MBED 1H3VA 4KDTA 2JB5L 1OGAA 2E7MA 3MGOB 2W0KA 4PJ7E 1RVFH 2CSPA 4WFFE 5CLTA 3QG7H 4KJQC 1G7HB 4KDVA 4O5LH 4XH2A 1NCAL 3HI6H 2FL5A 3L3DA 4KQ3L 2EYSB 2ZPKL 1A4JA 5LCVH 4R2GD 3MV7A 4ACPA 3D2UA 4OQTL 5FO8A 2IAMD 1C7TA 1T22A 2DQUL 2RB8A 1GPOL 2A83B 1I9JL 1J05A 1JI1A 1AHWC 4DVRL 3QUMA 3Q5TA 4J4PD 1E4KA 4OLXL 1Q8MA 5C08D 4IJ3B 4BKLA 5I74B 4L9LA 1A0QL 4BFIA 2VOTA 3QXDB 4EOWH 1Q9LA 3C60D 3KPLB 4XWOC 4W4NA 3RBGA 5CWSA 3GGWB 2R0LH 3MRIA 5F71A 2XKNB 3ROLB 4I0PD 4HF5H 2AJXH 4YPGA 5GIRB 4YHYB 3T1WA 4NQED 3V7MA 1S7XA 3G5XA 3LDBB 4JRYB 2CLZB 3IDXH 2E9JA 2JE8A 1MFDL 4XNYL 4G42B 5GGTH 4ZTOL 1WSST 2NY3D 1RMFH 4F9PC 2P7TA 2EXWC 5EZJA 3QA3A 2GK0A 2ZG3A 3VG0L 3I2CH 4XVUC 5HPMA 4R7NA 1YMMA 2Q1EA 3H3PL 4Y5XC 4DUWA 3TT1L 4MAYC 3OKLA 4FMKA 1FGNL 3TIDB 3D39B 2ZG1A 3D3VD 5ESAB 3F6LA 4ZFZA 2R0ZH 4HKBA 5DMIL 1RUQH 1GOGA 5CJOL 5BRZB 4WI8A 4JREC 3TYFB 5T3ZH 2AS5M 3QRFM 1F00I 4DCQA 1FP5A 1ZVYA 2ZUUA 4GRWE 4JFEA 4ETQB 1OAQL 4QCIB 2FO4A 2IAND 4CADA 1DR9A 4RBPK 3Q48A 4EUPH 1NUFA 3RNQB 5HPOA 3JTSB 3WKMH 3FCTA 1QLEL 1CFNB 4W4OA 2YPVH 5J3HC 1K3ZA 5JW4M 1FPTL