4ORGB

Crystal structure of human fab cap256-vrc26.04, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
211
structure length
208
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSSSNIGNNFVSWYQQRPGTAPSLLIYETNKRPSGIPDRFSGSKSATSATLAITGLQTGDEADYYCATWLTSARVFGTGTKVIVSGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CAP256-VRC26.04 light chain
total genus 35
structure length 208
sequence length 211
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2014-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4orgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4orgB01
3DYMA 4K7FB 4OM0H 3U1SL 3TZVB 4P23B 5IB2A 2IH3B 1I1FA 1X5LA 4OLWL 4PJ7A 1J9CT 3VDBA 2Z91A 3NN8A 3G9VA 5EN2A 3MV8D 5IESH 2CDFA 1A7BA 4HJJH 2BCKB 2QJDA 3DHMA 5EU6B 5I6XB 1WCBB 2X42A 4HPOL 1A0QH 1FNLA 2GAZA 2OTPA 2IMNA 1GH7A 1ZLVK 3CMOL 1QNZL 1CN4A 2HMIC 4X4YB 1Q0YL 3D6GA 3VI3E 4F8TA 3HI5L 3ES6A 4DN3H 1N6QH 1FH5H 2E8YA 2OSLB 4LRNH 3QFJD 4XT1C 4RWYL 4NJAL 3X13A 5I15H 5JOPD 3MRMA 4HT1H 4PP1D 4C56A 3RKDD 2X1XR 3IDYC 4TTGA 4JHZA 2B1HH 3BQUC 2NY4C 1J05B 1GZQA 1ERNA 1YN6A 2Z35A 4F80A 3HKFA 5FGSA 2XTJD 5JDJA 4R0LA 3L5WA 5IFHL 4BQ6A 1KELH 4DAGH 4ZNEE 3VXRE 5CGTA 4Y16D 3CFJB 2XWJB 4KJPD 4JRYB 4XP5H 1A7RH 2P8PB 4GXVL 1AE6L 1UA6H 3H7BA 4YHIB 5DUMH 3T1FB 4RGMB 4R0LB 2VAJA 3UJJL 2HLFC 1S7QA 3MBXH 4R9HA 3SDDD 1YZZA 4GAFB 3HG1E 3K7UA 5CKGA 3ZKNC 4O00A 4QRRA 2DBLL 1HQ4B 1AKJB 1UB5B 4LASL 3EO9L 2PYED 3MBEC 2V7HA 3OR7B 3MOAL 3QIBA 4URTB 5LAXB 1A1NA 4CN1A 2NX5E 4M61A 2V2WB 5DXWA 1N8ZA 4KKBC 4GKZA 4N68A 5HYJD 2OL3B 3C08H 2HTKD 3HI5H 1HE7A 3TA3C 1T1XA 1KCSH 2BK8A 2F19L 5F89B 3NMEA 1KLGA 3SKNA 4ZG1A 1HXYB 4AT6A 4F33A 1BAFH 5TJWK 3VRIA 3QQ9D 1AC6A 1ITBB 4NGHL 2W9DL 1AXSA 5EN2B 2D0GA 2ARJB 4GW5A 3Q5OA 4OZIA 4WW2A 1ZLUH 3HZMB 4FQIL 3LKRA 2BJML 2YPVH 2YD6A 1T7ZA 5EU3A 4OAWB 1J1XL 2X1WL 4BQBA 4HGMA 1PX3A 4LKXB 5DFVD 5IVXF 5SWSD 1X5FA 2FGZA 5D7LA 4NNXB 1N59B 4X9GA 4N0RA 4PJFA 4Y5XB 5IV2B 5E8DH 3E1F1 4MXVF 3IFNH 2L4OA 4X6CE 5DGRA 2Y5TB 3O4LA 4PG2C 3GSNH 3U0PB 1SEQL 3U4EB 4Y2DD 3X14A 1IT9H 3ZT6A 4P3CH 5JPMA 1B0RB 4RA3A 3H7BB 3NIFE 4YHIA 2MWCA 5HYJE 1B4JL 4KGJA 2VR9A 4ZUVB 4D0BB 3NZHH 1NJ9A 3B8YA 4Y1AB 1A6AB 3KLSA 1O0VA 1WBZB 3J7HA 2BXZA 5KSUA 3BJLA 2ARJA 3FRPG 3KJ6L 4KUZH 4LEOB 1K3ZA 4Z0BL 5F1SA 5F70A 5DD5H 5I73C 2J8UF 2OS7A 4RBPK 3VXMA 3PXHA 5AYUH 4FQXB 3S4SA 5E99H 1B0WA 5I6XC 3FFCE 4Q6YA 3REWB 3FO2B 1OP5K 1UXWA 1FL5A 1FO0H 2C9AA 5IEHB 5IFJA 4YUEH 1HEZB 2A6KA 4HXBL 4LGPB 5SWQB 3LAFA 2CK0L 5FCUL 4QOKD 4CRPA 2UWEF 4D0DB 5I1KL 5D7KE 1XGUB 1U8PA 2IH1B 4OKDA 2Z8SA 3UAJD 3OHXB 1KB9K 4LNRA 5LAXA 3ZDYE 5HHQA 5TE6L 1RUAH 1M7DB 2UV3A 4YHZH 2F74B 4P2OA 4D8PA 3F62A 1AR1C 2I9LA 4XWGL 2KQNA 4IOIB 2HFFA 3W81A 1IT9L 5IW1B 2V5TA 3GSQA 2PXYD 1YYLL 2C4FT 2WIMA 5ICZB 1T5WB 4M5ZL 3OKYA 3OWEA 1CICA 1BD2D 1TITA 4KMLB 2FHBA 1SJEB 2Z4QA 5EU7E 3EYQD 4UUJB 4KKCD 1V05A 5HI4D 1RULL 5J12B 1CYGA 2IMMA 4PJGA 4KHXL 2XKNB 4M5YH 1W0VA 1P7KA 4OGXL 3QEQD 1HDMB 5INCB 4Q0XH 1F00I 1M05A 2H2SD 1RZKH 1RZ8B 2UZIL 1YMHB 1WZLA 3WDHA 4MS8D 5JOFB 3V6ZB 3VWJB 3HRZB 3O41B 3WFBL 1TZIB 1E28B 2CMRH 3DETC 4X7TA 4Z7QE 1PY9A 3S37H 4F7MA 5HGGS 5HHMD 3EDJA 3QR2A 1OHQA 1JNHA 3AY4A 3EOBB 3WD5H 3IDNB 3LN4A 2AK4E 3CU1A 1FNEA 1ZA6A 2R0WL 5I1DA 3LQAL 1F6AB 1I8MA 4HWBL 3AM8C 2AEPL 2IALB 3TVMC 1P5VA 5DVNA 1MRFL 5C92A 4FFVC 4K94C 3GMMA 1DZBA 4RMTA 2J7LA 5KSBE 2H2PD 4RMRA 4U6XB 3SDCA 4PRAB 5L9DL 1KN4H 2AQ3A 1KUMA 4QHMB 1JTOA 1FO0A 2JE8A 1UXSA 4ZUUA 5EBLA 3SGJA 5KAQF 2YZ1A 1GC1L 4JGJA 3TJEH 1Q9KA 4GRLA 2ZJSH 1U8LA 3MX0A 3RDTA 4HIXL 2XTJE 3NFPB 3OPZL 3C8DA 4LARL 1QUNA 5FO7B 4I77L 2R0ZH 1JYXA 4UOW1 5I8EB 3GMQA 3QZWB 3KYNA 1TJHL 35C8L 2WBKA 4MXQC 3RVTD 4PJGB 4IBLT 2F54E 2GTWA 1D5IH 3VFUB 3CXDL 2C3VB 1A6AA 3DTXB 5E2TH 5FGRA 5CAYB 5IMKB 2NPLX 2MSPA 3UBXB 1R0AL 1ZGLA 1F4XL 4UT9H 1RIHL 3LPFA 3GJFK 1T3FB 3DVGB 2R9HD 2VZOA 4ODUA 1PYWB 1YJDL 4KKLC 1RUKH 1OTTC 1S7RB 3T4YB 1HYSC 3ARWA 4NQSA 1FDLH 1R6VA 2GTZB 3O9WD 1ZGLB 2AJYH 2EYRB 1AQDB 3DMMA 3EHBC 5D7LD 4I2XA 4Q6IB 1CLYL 4LNRB 4X7FC 5L7XH 4OCLC 4KKLD 4LCUA 5AWNH 1ZLSL 4D0DA 1I8KA 1I1CA 2HWZL 3GI9H 2NW3A 4F9LC 3MREA 2DN7A 5LJYH 3GMLB 2VDKH 3MUJA 3ECBB 4O58L 1IGCL 5F1OB 3B9DA 1P6AB 3VH8G 4PGEA 4Y8AA 2P24A 4ZUSA 3TC9A 5DGQA 2CH8A 4KTYA 2IFFL 4NUGH 4QHNB 1BFOA 3RGVD 4JY4A 3SPVA 1SEQH 3O3DA 4OI9A 4PJBA 1NANI 5T5NF 2DB8A 3HNVH 4M1CD 2ITDB 4LSDA 4NO0D 1PYWA 5B4MC 3D25B 1B0RA 1OT2A 3AXLA 2GJJA 4L3EB 3HE6C 4ODHL 4N90E 5FB8B 5F9OH 2I07B 1ZHBA 2IJ0C 4P2RE 2RHEA 2MCPH 4HX1A 1IM9B 4OUUB 3TCXA 4XHJD 4PJEB 4ODSL 2HJKB 3BPCA 1C1EL 1NGPL 3FFCD 4NFCA 5AAWA 3SKMA 2XRAH 2N7AA 1QSEA 4MNHB 5E94A 1TETL 2CKBL 2ICEB 3RVVC 1AFVH 1MHHB 5FCUH 3FB8B 1MQKL 4CMHB 1I1AD 1L7TH 4MQXD 2BSTA 1A3LL 1I7ZB 5DRNA 4HEPG 1HYSD 3I6LE 3ISWA 5T1KD 1AD0A 5E24E 3LQAC 5BJTA 3QB7C 1ZA3A 3V2AR 5DO2C 5IF0B 2CDGA 3L5HA 3C09B 1VHPA 3RUGE 5KVFL 2H3NB 1J11A 5FOBA 4L3AA 1JF6A 4PJHA 1IQDB 1IEBB 2JIXA 5DEFA 4LVNB 5TPWH 2AI0L 4KDWA 5BZDA 2DL9A 4KVNL 1MJJB 1YNLH 2VUYA 5DJYB 1BF8A 1NDMA 1N64L 2NY5L 4PG2A 4IDJL 1ZHKA 2A0LD 2WIIA 4PJ9D 3FAWA 1EUTA 1A6ZA 1MJ7H 3VXOA 1U41A 1VENA 3FQRA 1T1WA 2VLKB 2F54B 3AFLA 1YEJL 2NXYB 1VFBB 2EEAA 1HOCB 1Z0MA 1VADA 2VLMD 4HS8H 5HHME 4HW6A 4OQTL 4J4PD 5I1AB 2FB4H 1U8QB 4ONFL 1NAKL 1V3LA 1TZHB 4OJFH 1BZ9A 1CFVH 1XF5A 3MGAA 4P49A 2CD0A 4MLSA 3IFLL 4N9GB 5I1AA 1PG7X 3IJYA 4WTXA 1S8DB 4TVSa 4U3XA 3Q0HA 4Q6IC 1OM3L 1QRNE 5HYFA 4FQCL 2ENYA 5GS0D 3QFJB 3BEVA 5I73B 1CLZH 3P4NB 5JLZA 3RVWC 3WIFB 2VOTA 5C0CE 1UEYA 3WKML 1P1ZB 5IJVB 1IM9D 2JLLA 1H5BB 1MJ7L 4WUKH 4F57L 1FPTL 1XF4A 4XWOD 2APWA 5DWUH 5IQ9A 4WHYG 2LAGB 4LKCB 4PRBA 1VACB 4YFLI 3MJ9L 2I27N 3OPZH 3U0WH 3WJLC 3WXVH 1MWAL 2AJ3B 5IR1A 1ZANL 4ZO7A 2IWGA 4M6OL 2IBGA 4WU5B 2X7LB 1DLHB 3FCTA 3OKNB 4K9EH 4L8SB 5HXMA 5GJSH 3U1SH 2W0FB 4RFOL 2EC9T 4LLMB 3G6AB 1UVQB 2X9WA 5I74C 5T1MA 1EHNA 1TPXB 5CJOH 1RIHH 2X9XA 1A2YB 3L9RA 1IAKB 5D7IA 4GBXB 4JRWA 5KSAA 2NY0B 3SKNB 3TN0C 4YBLB 1Q94B 4MDIA 5EO9B 2IF7A 4I13B 1J88A 2IAMA 4GLRI 1U8KB 4NWUL 2V7NB 3ZKND 4DN4L 5CIPA 5IB5A 3WYRA 4KDVA 3MV7D 1WUNT 2EXYC 3PGDA 5B39A 1UFUA 5DWUL 1RJZA 2CRYA 4QRRB 4XP6H 1NCAH 4NC2B 3IRPX 5IVZA 2HWZH 3GI9L 4F7PA 4QWWC 5ESVA 3PP3H 2WW8A 1Q94A 4WNQB 1G7HA 2DQDH 4NHCH 3MLYL 1MCFA 4Q9QL 2HT3C 1IAIL 5C08B 1MCOH 5DJXA 2WSKA 4JZNB 1T89A 4J23A 3C6LA 5BV7H 4PLJD 4HWUA 1M71B 1QG3A 1HHGB 4RRPA 1U3JA 4KK8C 4NNPH 1BECA 5HBBA 2DLTA 4WFGE 4BFGA 5E8EA 1HHIA 2FSEA 1JHTA 3RI5F 4OGYL 1CVSC 1FZMB 4PJXB 4NQEE 1XR8B 5DZLA 5I76A 4JJ5B 2G5RA 4P9MH 1QSEE 2W60A 4IOSD 2M1KA 1INEL 1DQQA 3ZMRA 1EFXA 3FQRB 1U42A 2Y5EA 2X10A 5CUSH 5GGVL 3LZFL 2FIKA 3KWWA 4G8GE 1MHEB 3BP4B 1JYVA 4M48L 1HNGA 1ULVA 2XZAH 4V1DA 3DVNB 1ZT4A 4UB0H 4L8CA 1KBGH 3ARUA 3MRNB 1PVHA 2NX5B 2W38A 4NC1C 4YHPB 3ZKSD 4X98A 3TBVA 3T4AA 1BBJB 1R3KB 3CFKA 5E9DB 3MLRL 1T6WA 1CTOA 3KDMA 1D5ZB 4MJ4A 1UQSB 3QI9B 3ZL4H 1KB5H 5C0BB 4XNQA 2IADA 2YPKB 3L5JA 4FMKA 4Q74A 2EH7H 3MTRA 3FN3A 4KKAD 3SGKA 2J8UB 3MO1A 3U7WL 4E41E 3SKJH 4C59B 3WUWA 1WWWX 1S7UB 3RKPA 3GJFB 1P4BL 1ZT1B 1BQUA 4MB5A 5ITFB 3S5LG 4EOWL 5FO9B 3W0WD 3QPQC 5CZXC 3GUTB 4LIQH 1CT8B 3QXAB 4QHMA 1CFNA 4YFDB 5IBLD 2R69L 1W0VB 5J8OA 4KKAC 3SE8L 4A2MA 2VDLL 3QFJE 4QXUL 3WN5C 4H5SA 1DANU 5DMGD 1S9WA 4Z7UA 4RAHA 2V5SA 5JDSA 4EN3D 2BOCA 3G5YB 4YXKL 3HG1B 1NGWA 1T0NA 1KPRB 2VLRB 4LCWA 5DT1L 2VXTL 4E9LA 3G9AB 3AREA 4UNUA 1UCBH 2OJZH 2R2BA 3KNBB 4YUEL 4OF3A 1U8NB 1WFUA 3UO1L 1S9VB 4G7YL 1C7TA 3C6SA 4Y5YA 2ZG2A 3OKKB 4C54A 4XCFL 4LQFL 4PJCE 5C0IA 4UNTA 4U05A 4ELKA 32C2A 4M7KH 4TULL 3HI6H 3KPRA 3R06A 2MOVA 2IANB 1TVBA 1HHKB 5ID1A 3IDUA 2E7BA 3GSWB 3LKNA 2DQIL 2ZOKA 5HYEA 4Q58C 2FL5B 1T0MB 3MZTA 5TQ2L 1G6RL 3QDMA 1A1MA 2PYEA 4LIQL 2PYFA 2ZPKL 1CGSH 2YKLL 2EKSA 5FM5O 1UQSA 4P2QB 1PY4A 4XGZB 1LMKA 5C09B 2A77H 3WKNA 1RUQH 1OF2A 1KG0A 2ZKHH 3TA3D 4XTRC 3WHXA 3ARFA 4K3EH 3V5HA 1L0XA 3E3QC 5C08A 5CFHA 4L4VD 1JPSH 1T0PB 3D25A 3U30B 1F58L 5C0EA 4X6CB 4XXDA 3LEXA 2I9LB 1MHCA 4RAUB 3D48R 1DVFD 4G7YH 4H1LH 3T3ME 3FO9B 3DECA 3SPVB 3PF2A 4H1LA 3FQWA 4W6YB 4O9HL 4L4TD 4LAQL 5SV3A 5C0IB 3PGFL 4NO2B 1A14L 5HYJB 1T7WA 4TULH 2P4AB 3CSBA 1MCIA 1FCCA 5DTFA 5EUOE 2OXGA 4U2ZA 3OGOE 3FL7A 3UZQA 2UWEE 3E6HB 4NHUB 2CLZB 1J0ZA 3WXWL 4P2CG 1FZJB 3QWOB 3O2VL 4P2RD 1B6UA 1G6RH 4EIGB 4X6CF 5A40E 2R8SL 3MACH 3VWJC 3CFIC 1JUFB 4HWEL 4PJ7E 4NN7C 1N0XL 2ESVA 3RVTC 3IVKA 2ED8A 4NO2A 5HYJA 4HUXA 5DJZB 1QO3B 2I5YL 3VXSB 3UYOD 3WV0A 4NKDA 1A7NL 2FEEI 1KV3A 2E27H 1RZFH 25C8L 3O6KL 4D0BA 4ENEC 4JKKA 1MFCL 4LF3A 3QI9C 1U91B 1MLCB 4F37K 3BKYL 4NZJA 3ZKMD 4Z78B 4OCWH 3BE1H 5BZWA 3UX9B 2Y36L 3WE6B 1NC4B 4ZUWB 5SX4I 3F5WA 3QBTB 4UDTA 5IMKA 1HXMA 43CAB 4MAYA 5E4IA 3ZE1F 2DQEH 4MNQA 1NCCH 2OTWB 2RGSA 4LHJB 4XNQB 2ADIA 3PGFH 4FQLL 2OR9L 4NO3B 4FXGB 3QXAA 4HCRL 3L95A 1ZS8A 1BGXL 1O7VA 3FO0H 3HC3H 1ACZA 4JRXB 4LKXA 3ARVA 4QTHB 1H5BC 3QO1B 4E0RA 1OAQH 3E6FB 3L3DB 2V5RA 5D93B 1AR2A 4LBEA 3HZVA 4U1LB 1S7UA 2ZUVA 4LRNL 4RWYH 3ULVL 4UQ2A 3C60B 4OTXH 3VH8A 4IOFD 1IAKA 1ZK9A 4R90H 2M2DA 4FXLA 3L5WB 5FHAL 1MPAH 4MJ6A 5D1XB 2FO4A 4LCIH 3CVIH 1UVQA 3QUXB 4WI9A 2DLGA 5SWZA 3QNZA 4YGVB 3RZCA 1OARH 1U8NA 4HK3J 3UJTH 2DKMA 3B9KC 2JJSA 4YHMH 5IHZA 4KWUA 5GJTH 3GO1H 3O3EA 1CICD 4XP5L 2QHRH 2Y36H 4Q97A 1N5YL 1OAYH 3VXMD 1EVUA 2VDKL 3MV8E 1FE8H 1EO8L 5IW6A 4OZ4A 4LHUA 3RWEB 1HINL 1HQ4A 2DWEA 4HS3B 5IVXA 3H9SD 1F8TL 2CIIA 3TBTA 2VZTA 1Z0NA 4HKBA 3V0WH 2YR3A 1I1FB 2HKFL 3BAEH 1FBIL 1P5UA 3IS1X 5IBUG 2AK1H 1HKFA 4ONHB 1MJJA 1T89C 4F15C 2DI9A 3VWKB 2F19H 1GGBH 3P4MB 4OLVH 4MNGB 3REWA 3WFEL 1IGTA 4YJZL 3KS0J 5ESVB 4KJWD 2XTLA 3IFPA 1JGUH 3K2UH 3CZFA 5EU7C 5DRWB 2PTTB 1NCWL 3CFCH 3WLWC 1VGEH 4R4BB 1BFTA 4GO6B 1OARL 1SYVA 2B4CH 4IRZL 2QSCL 3T3PE 4JZNA 1C1EH 4DZ8B 4JFFB 3BSZL 4KQ3H 2XKSA 1VGKB 4D9QD 3F6LA 2OZ4H 5JIPA 1A21A 2EH8H 2H2PC 1YNTA 1RZKL 4L8DA 4Y16B 3B83A 2F53D 1X5HA 1JCKA 1KEGH 1L0YA 4JB9L 1IQWL 2YPLE 2P7TB 1HINH 1TQBC 4CL7A 2P45B 2ADFH 3UTZB 3NCJH 1MCDA 3ARSA 5HVHC 4XPTL 2X4OA 4FQJH 4L3EE 3OQ3B 5FKPA 3TO4C 3GGWB 4X8XA 4U6YA 1MY5A 5FB8A 1W0YT 2Y72A 4OIIH 3AMLA 3DX6A 4S10A 3ZYOA 4HXAH 4PGZA 4OLVL 1G7QB 2CR6A 3GHEL 1UH3A 5BVPL 5D71L 3MV9B 3ARBA 3QCVL 3MXWH 1BJ1J 2EYTA 1FORH 1ORQB 1A02N 3UTSD 4UTBL 4FTVB 5IQ9B 3QHZH 1S7SB 4I1NB 2IQ9H 3INUH 4GW5B 3QQ3B 5F6IC 5GGTH 5A16A 5HJ3A 4EDWH 5TDPA 3KPSD 2D4DA 3BXNB 1UZ6F 2OX5A 2WINB 1C8PA 3B6SA 1EGJL 3N9GH 1HHHA 4JN1L 3SDCD 4K8RD 4HXBH 3K8MA 3RX7A 3SY0B 2OQJB 2A6JB 3D3VA 3WN5A 1NC2D 5F7KC 4OLYL 2GCYB 5I17B 2XWBA 2P48B 2LABA 5AYQA 4PD4J 2DKSA 4YHZL 2BNQD 3L6FB 5L8KB 2QQKL 4BZ1L 1KNOA 1D5IL 2W65B 3SO3C 1QPXA 5BRZD 3GSOA 2JELL 1C12A 3AVEA 1KTDA 4Y5YC 5ACZB 3SDXE 1OM3H 5KSAB 3HI1B 2ICES 2B1AH 3P40A 3I2CH 1WBXA 3IXAB 2DQFB 3HC0A 4PJFE 3G6JB 4U0RC 5D1ZB 5MHSD 3RUGB 1MCEA 1PSKL 2GI7A 5BQ7B 1ZHLA 1X5XA 3AB0B 4KHXH 4MCYB 1A6ZB 3PHSA 4N0UE 5D9SA 1H8OA 4UAOB 5T33L 2P44B 4U1MB 4MAYD 2CIKA 4RX4D 2EDRA 4L8SA 4H88H 2QQLH 4GLRH 3VG0H 4EDXB 3RIAF 4I3RH 1G7QA 5C8JA 1T20B 4QCIB 2UZIH 1P4LB 1Z3GH 2YWZA 4Y0GA 4TSCL 2O61B 1JGVL 4K3JL 4OGZA 5D1QB 1NBQA 5DFWH 4W6XB 5I0DA 5ID0B 1AD9A 4XVSL 5IF0A 1A9EB 5KSVA 3ZHDA 1PG7H 5F9WC 4HDIA 5TGBB 3TCLA 1WF5A 4APQA 3TESA 3DX8A 4PBVC 1I9JH 1EX0A 3MODH 4Y8DC 4B0MM 3BMVA 4IHOB 5DYOB 5C0EB 3BUYB 4JHBA 1FV1B 2E3VA 2R4RL 3JTSA 4G6AC 2P46B 4ZXBB 3PQYE 2OMBA 4NKMA 3O4OB 1VGKA 2D2OA 3I2CL 1WZKA 2B5IC 1QPPA 1I4FB 4QY8A 4N8CL 5A2LH 3UBXG 2P5WA 1ACYL 2DICA 1JWSA 1IC4L 1I8IB 2IPUK 3QXDA 5EORL 5J9PA 4OKVB 4WHTA 1ETZB 3ZE1E 4YHML 4MNGE 2FO1A 3SE9L 3OJVC 3QUKA 4Y19B 3R1GL 1MWAA 3P9MB 4JQXC 1ED3A 4PLKD 4JPVH 1A7QH 3P73A 3RWHB 4AG4L 1W72A 2ZOKB 4CUCA 5GRZA 2BP3A 5A1AA 2R23B 2XXMB 2CO6B 4K3JH 1U36A 1ED3B 1IFHH 2B7DT 2Y07H 4WO4D 4PS4L 4NQTA 3NGBC 2XICA 2IFGA 3RWEA 3HNTH 4K71C 1FSKB 5FK9A 4GAYB 5KS9E 4Z7UE 2VDQL 4XXCA 4J4PA 4NNPL 4NO0B 4QT5B 4O02L 5HHNB 4PJDA 3VFOB 3DI2B 4OIAA 2FX7H 5J57B 4M43L 1VEMA 4P2RA 2Y25A 1QYGH 3C60D 1MLBB 4ESKA 2B4CL 2JIXD 5E8PB 3RWCB 5MEND 1S5IH 1VEOA 2WM0A 4XVTH 1CFNB 1E28A 3R1GH 4MXQD 1M7IB 4LGSB 4QTIL 3CVHB 3C09C 4WTZG 3RWIB 2W9EH 3KLAB 4OF5A 3ET9F 1HIMH 4PGDB 5I1IL 1CXLA 3TWCH 3A6CL 2VXQL 4ZTPH 3WL9B 4UZGA 5JPNB 2JJSC 3BIBX 5CS7A 2W92A 3EBAA 2DYPB 4G3YH 2HJFB 4YHKH 2N56A 4JZJA 4WWKA 5HHVL 4RISL 1JV5B 2ED7A 4I0PD 3DUSA 1S7WB 1L9MA 4LAJH 4OFPA 4PJAF 3TP4A 3F8UB 3VFGH 4OCRL 1IGMH 1VCAA 3IJHA 5JPMB 4LF3B 3VG9C 4DZBA 5ICYA 3ALPA 5ESQA 1V3MA 3W5MA 1MELA 5I75B 1J5OH 3D0VB 4CDHA 1NC2A 5TDOB 4EN3B 4MQTB 4ORZC 3VMOA 4XVJH 3RL1A 4FTVD 5CIPB 3MCKB 3LH2L 2RCSH 2DQJH 1WISA 3QZWG 4HEME 4U6XA 4AEEA 4J2XA 1P4LA 4U6HA 3RAJL 2W9EL 3G5VB 1I3RB 2BVEA 3BT2H 1ODAA 1S7VA 1HSAB 5CEYA 4ZTPL 4M6OH 3IDJA 4LCUB 1IAIM 3B3IB 3VXUA 1YEFL 1DUYB 4M3KB 5MP6L 4G3YL 1NC2B 2VXSL 1HWHB 2G75A 3VWKC 1JZ7A 3P0GB 2R1YB 2QSQA 3JV4B 3MNZA 3UO1H 4LSPH 1CFQA 2IQAB 3N50A 3CSYA 4Q2ZB 5DJXB 1XGPA 1FVCA 2YSSB 4R97C 3QUYA 5I16B 3E3QE 3BRDA 3OKOB 4KVNH 1EJ6A 1C5BH 5IR1B 5BRZB 1N64H 2A9ML 3G04B 1ZMYA 1ORSA 1LDPL 5T3ZD 5DQ9B 3B5HA 1Q1JH 5DMYA 2XV6B 3PQYA 3EFDH 5IOPA 4Z8FL 1ZVSA 1ZLWH 1W2KT 4AEHH 4XBPB 3DO3A 5JXAH 5L0QB 3OXRA 4YX2L 4MDIB 4S11A 1PZ5B 4UT7H 3T1FA 4JO2L 1LE9B 3BPLB 4OZIF 5ALBH 3CDFA 3VFTB 2A6IB 5E6IC 1NCDH 5FM8A 4GW4A 1T2QL 4NQCA 3MPCA 3O45A 4OM0L 5GRWA 4R8WH 3OKKA 4QHUB 4POZC 1GGCL 4JAMA 43C9B 1RVFH 3O6FB 3Q5YA 4GOSA 4S1QH 5CZVL 3C8HA 1XGRB 1GAFH 3VD7A 4AENA 4CMMA 1I75A 2R4RH 3JVGC 5FEBA 3GSRB 4I4WA 4GS7C 1IGTB 3QRGH 3LHPH 3B8SA 3OKMA 1LD9B 1SY6A 2VB5A 5J3HD 1YECH 4JFEE 5C09E 5SWQA 1DEDA 4POZD 3RBGA 4F37F 4R4NC 1C5DA 1MCCA 5EORH 4HD9A 1OAXL 2WNGA 3MRPA 5DK0B 15C8H 1R3IL 3EFDL 2F74A 4P2OB 2FATL 2VISB 5GSRA 4DK3A 4WWID 1JWSB 5EO1B 5AWNL 1QBAA 4D9RD 2X4RB 3UJIL 4KVCL 2ZOLA 1A7NH 5JW4Q 4BFIB 2DQFA 4PRIA 4Y16A 1E4XH 1XIWD 1A6WL 2DMCA 3SHSA 4HIIA 3MFGB 1IRAY 3JWDH 1WFOA 5EZOH 2JJTC 4MHHG 1WWAX 2RBLA 1QLFA 1P7QB 5GGQL 3MA9L 3MNWB 3HE7A 2C5DC 1L6ZA 5L88H 3LIZH 3TLRA 3IDIB 4LSSH 1NGYA 5AZ2H 1OB1B 2K3TA 4LPYA 3QDGD 4NZTL 2XZQL 4TSAH 3U6RB 4YXLH 1DL7H 4PJFF 1MCNA 1Z9SA 3MFFB 5MEPA 3QUXA 4RFNC 3VJ6A 3HNVL 1FLRH 4QF1A 4OQ1A 5GGUA 3RHWF 5FV2A 3MRRB 1OP5H 3FT3A 2WWKO 4PJ5A 2YHGA 3F7QA 1IKFL 3QWRA 4JANB 5DJCA 4PV8B 5JHDE 5EU6A 4QXWA 3HAEG 1NCBL 2FWOA 3MRQB 3U7YH 4Z77A 4OLEA 4LHUB 1R24A 5F7UA 3MRGB 2C7UA 5KW9H 4GG6A 2AQ1A 2QL1A 4ZFZA 3V6OE 1KFAL 1J0YA 1CG9A 1INDL 2MPAH 1KCUL 1WSST 2Z0BA 1WEJH 5KS9F 1MUJA 3DX9B 2ADJA 3PGCB 4PJ7F 2YPVL 3GMOB 5I1LB 4CMMB 5I1HH 1XF3A 4XHQA 1D6VL 1MLCA 3BHBB 3BZEB 3EYSL 1ZHLB 2IBZX 3OAZK 5EBWB 3KPNB 3FB7B 3PV6B 3CDGA 5I2IB 2FZ3B 3IF1B 1LWRA 4U7MA 3HC0B 4I9WE 4M7KL 4R3SA 1HCFX 4V2CB 3QEHB 1ZHNA 5E8NB 3WN5B 4HIHB 3W11D 1MNUH 4ZAKD 2ADGB 4Y4FD 2EC8A 4LLWB 2LU3A 4HBQA 4X99B 3FFDB 4PJIB 3X14B 4LCCC 3MR9A 3E6HA 3CVHL 3RQ3A 3TYFB 4IRSD 4CW1B 1QR1B 5D2NA 5JW5A 1ZWIA 3GRWL 5HJ3B 3PV6A 4LFHD 3ZDYF 1A6TA 3CX5J 5FAAA 2BNRB 5EU5A 1F3JA 4HX1B 2Y23A 1NLBH 4Z7QF 1CGWA 3CD4A 3FQTB 1QSVA 3PWLB 4GBXC 5HDBE 1JPFB 1NLDH 2H8PB 1JHLH 5CSBA 3CH1A 1T22A 1WEJL 4Z7UF 3QDHA 5HPOA 2ADJB 1BFVH 1S7RA 3V6FB 2A73B 3S7GA 1HHHB 2J8HA 4XWOC 3TM6A 4QOKA 5FHBL 4OFVA 2DTML 3QPXL 4XNUL 3K2MC 1OTUC 3FTGB 4OZFH 4U3HA 3QIWC 1WJ3A 3TBTB 5F96H 1PKQE 1MCWM 2BXYA 4OUOA 4UOJA 4D94A 4KJPC 4ZPTA 3TPUB 3ECBA 4JPKH 4IRJC 1EHLH 3L3HB 1YPZF 1NEUA 1MHPH 3L5XL 4MGXA 4HMCA 3Q3GB 1H3UA 1LD9A 2BNRD 2ID5A 2OK0L 4JZJC 4G5ZH 3B2UD 4WWKC 1FH5L 1YYMH 4L3CA 4IMLA 2X89D 3BKCH 4PJ9B 3RDTC 1JYWA 3EYFB 4OFYA 5KVGH 5C7XH 4DGIL 4R4BA 1HILB 2NY7L 1PQZB 5SWZB 1YC7A 3TBSB 3PP4H 5K9JL 1U58B 1KGCE 3VCLB 1DBBL 4XAWL 4DZBB 5ICYB 1I1RA 4OIBA 4N0YL 3CFBA 1FRGL 1IAOB 1Z9LA 5L2KD 4JRYA 1NCDL 3BUTA 1IC5H 4GRLD 2VXUH 4UU9A 3QDME 3DUSB 4O2EA 1QLRA 4ODTL 2Q7YB 3F7YA 4NT6A 2BSSB 1KLUA 2GITB 5DFTA 2QADB 2YEZB 4JO3H 1QSEB 4MNHA 5C6TH 1J05A 1GZQB 1YN6B 4RMWA 3OAZH 4RRPG 2BSED 1SJVA 4BSWB 3BPCB 4XP4L 3BZFB 1FQ9C 2OR9H 3C5SB 1OSZA 4YHOL 3U46B 4CADA 1KLUB 4XMPL 3UTTD 1YECL 4P57B 3ME0A 1XGQA 3VWKA 4EN3C 4OZGB 4HQQH 1YEEL 2BVQB 1AY1L 2CKBB 5TQ2H 3ZDZF 3MLPA 2H2SC 3OR6A 1D6EA 1AGEB 1VFAA 3CU7A 1G7JB 5J1TC 4LLUA 3MUZ1 3RIFF 3CX5K 1AD9B 4UUJA 4D3CH 3TBVB 4RDQF 4P4KD 1GGIL 1F13A 5A3IC 1KPVA 3LEYL 3LPWA 1B0GB 3RDTD 5HI3D 3ROLA 1UM4H 3QO1A 3DXAE 4A2LA 3WLWD 1I1AB 3PJSB 4XAKD 4ZFGH 1NMCC 1IL1B 3OB0H 3QNZB 5FA3A 4M8QB 4M03A 2XY2A 1WAAE 4BKLB 4K3DL 3LKSA 2BVYA 4XP4H 3UMTA 4YIQA 1BVLA 5CJQL 5E6IA 4N0FB 3MRBB 2B0SH 3RY5A 3IXAA 4U3CA 5B3NA 1EEQA 3W39A 1CE6B 2DOCA 3MODL 1EO7A 3MA7A 4U6VL 3BISA 4IIQB 3O2VH 4LFHG 1UXWB 5IFJB 3PDGA 2G5BA 2AAVA 1T3FA 3DVGA 4F8QA 5I15L 2FBJL 4OCSH 1HDMA 3K80A 4YHNA 3VXRA 1EZVY 3QO0A 1QO3A 2F5AL 3T2PA 3DGGB 4XGZA 3D9AH 1J10A 5JA8B 5C0FB 4R2GD 3QIUB 1V5JA 3NCFB 4UDTB 3GDBA 4KRPD 2DLEA 1S7XA 4GUPB 4Z78A 1UM4L 3HRPA 2EIBA 4Z0XB 1I7RA 6CGTA 4U7SA 4AG4H 5CP3A 3VD5A 3EYSH 3LDBC 4DWHA 3JBG7 2B5IB 5FYKE 2BRQA 3B6SB 5F72S 5C2BH 1N2RA 5DTFB 3ZKXC 2XNAA 3ARRA 1FO0B 1XF2B 2QKIB 5K59F 2EIZB 1KB5L 3RVUC 5TE6H 5FYKL 1ZLVH 4B50A 3QISA 2JJTA 1QA9B 5HHXL 1T1ZA 4KFZC 3BHBA 3QUML 4S1DC 2IGFH 3WBDA 1WTGT 1H3GA 4N0UB 1OD9A 2IG2H 4PG9A 5HI5D 3I6KB 4JFPB 3UDWA 1NGXA 1RMFH 4GRMB 1A2YA 2FGWH 4LSRL 5FXCH 3GZKA 4K7PL 4C4KO 4HGWA 4HSQA 4NQVB 3QCTH 3I02B 1CQKA 1F4WH 1KXTB 3ARBD 3QNXB 3W5NA 3QULB 4WW2F 3GIVA 1JMZA 3GSUB 5HGAA 1DQML 1XIWA 2F5BH 1S3KL 3D39E 4BYHA 4HS6A 2E7CA 5C2BL 5ERWB 4YE4H 1OQOA 3KLHD 1T03L 3A6CH 3QJFB 5FUOH 3EYOB 2A9NH 3ARZA 4FP8H 1CDHA 3AMKA 2JF1A 5DQDH 5ACMA 4TUJA 2DQIH 2A6JA 2FL5A 3W9EA 2AXHA 2PW2B 4G9FA 5E2UL 3JTSB 1KGCD 2NY3D 3FKUS 3WFEH 4FQQA 5HYIA 1U6AL 1NBZB 1G0XA 2YPLA 3C5ZB 5ADOL 4NUJA 3VRJB 4JY5L 2CLVA 1RFDH 2FGWL 3LKRB 5IW1A 2VQ1A 3WJLA 3IYLW 3VI4F 2ZCLL 2X4RA 5HHPB 4NPYB 2APTA 5F8RC 2QSCH 4ONGH 3BZEA 5HPMB 2R9HC 3GMMB 5CIPH 1IJ9A 3ARPA 3C8KB 3WS6A 4Y4HB 1RZIB 3HMXA 1I3GH 4GMSL 4I18A 3IDXL 4ODTH 2F5BL 5E8OA 5BMFH 2NR6D 4KROC 1QHPA 5D5MA 4K8RL 3PNWA 5D2NE 3GGWA 4Y4HA 1RIUH 5F6HI 5D1XC 5KSAC 4JDZB 3PWNB 4D9LH 2FWOB 1HKLL 4HS3A 5IVXB 5C0BD 2E7LA 5BQ7A 1VA9A 4XWGH 2E9JA 1WBZA 2QQNL 2FO4B 1A9BA 3ZDXF 5IMLA 4GKSB 4U1HB 3MRNA 4HQQL 4JFDA 3KR3L 4OCXH 3BH8A 3P4NA 4RFNB 3KVQA 1ZT4B 5KSAD 2EDDA 3DVNA 3QIWA 4PUBH 3T0ED 5L2JB 2VAAB 4HT1L 4HF5H 1PLGH 4XB7A 3VFNA 1IEBA 1IQDA 2JIXB 5HGBB 4APQD 1XGTB 1CBVL 1LO5A 4XBPA 4JZOB 4LEXL 4LMQE 4DVRL 3ZSTA 4OBSA 4IRJA 1NUDA 4JKMA 5IROC 3P77A 3MLWH 2BX5A 1U93A 3NOIA 3O6MH 4Y4KC 2MHAB 1MH5B 2X70A 3IFPB 1GGYA 3EJJX 3X13B 5F7WC 3KPLA 1PFCA 2YC1A 3MBED 3O2WH 2ENSA 4JN1H 4Z8FH 4S1SL 5IIEA 1WAAA 1LEKB 3U4AA 3Q1SL 2NXYD 1MWAH 4G8IB 1S78C 2BY3A 2P5EB 3ARDB 4HIHA 2NY3C 1Z9OA 4UNVA 4ZXBC 3QUYB 3P11H 2GIYA 4KU1A 4CVXB 2GKIA 2VLLA 1CXEA 3MRPB 3B9VA 2GQHA 4R4FL 1DUYA 1HH6A 3TBYA 3VXPB 2ZSVB 2R0WH 3BGFC 1QRNA 5E0QA 1BF2A 2J88H 3DYPA 2JELH 1J0IA 5E8OB 5CEXB 4K9EC 3ULUE 4HUKB 3WEXA 3WS3B 2C3WA 1RZIA 5IJKC 3WFHA 3STZB 1UC6A 4NM4L 1QYGL 1PSKH 4RMVA 1OWWA 4LCCB 4RBPH 3RWGB 1UWEH 2EDQA 1KN4L 4EN3A 1WT5C 3QEQE 4WVRA 3GO1L 3TN0B 5F6HJ 3VG0L 1WAAF 4Z95L 3Q48A 3MGOB 2DKUA 3MR9B 3Q6GL 4HS6B 1NCAL 2WZPD 3SCMC 5E1AB 4LQ1A 1IGYA 2WWMD 4LARH 2NY5C 3LS5L 2VL5B 5HGAB 2B8OT 4TUJB 1IE5A 1YEIL 1MIMH 1R5WB 3QP3A 1MCPH 1EZVX 4CU6A 4HUWB 1NAMH 4L4TB 1IAIH 5D7JB 3PG2A 3MA9H 1G7PB 4XVSH 1U95A 3RU8H 2Z35B 4LVNC 3OKEA 2EDLA 1A1OA 2OTUA 5ECJE 3KPMB 2X1OA 3QUMH 5KS9A 4YHKL 3S9DB 1R0AH 3FT2A 1M6OB 3CLFL 3F5WB 4YDKH 2X7LA 2BERA 4PJDE 2F58H 4PJ8D 4X0KB 1NFIA 4Y4FB 3UPRA 4M7JH 4HPYH 2X4SA 2H26A 3BD5A 3EJZD 4OCRH 2BOBB 3LD8C 1T80A 1S9XA 1NCWH 1FFOA 1IKFH 5LWYL 2LV4A 4EUPA 4OZIB 2P1YA 1H5BA 4FOMA 5CLTA 4QRPA 4BZ2H 1VKXB 5KVEH 2E5EA 3NABH 5CP7B 1IL1A 3I6KA 3ILQD 5FDWA 5ISZD 3GMQB 5HYQA 1BPVA 1S3KH 4OQTA 1RD6A 4MJID 1JNJA 1IGCH 5ICXA 4JG0H 3GB7A 1FAIL 3B9KA 3CPLB 4ELKB 1EH9A 3LQMA 1P1ZA 4JAMB 5IJVA 4CBPA 3UC0H 1FHGA 1YDPB 2ZCHH 3U36A 5HHOA 3V8OA 4MA7L 4MB3A 2PR4L 5BCAA 4NQSB 4AL8L 4RFEA 3KS0H 4RQQB 5GPRA 1JZ4A 1TVDA 3D85D 5FGCB 2PW2A 2AJSL 2VDOL 4G6MH 1S8DA 1TJIH 1JF5A 5LWYH 1FGNH 1JGDA 4EOWH 2FHFA 1D5XB 4X5WB 2IPUG 2P5EE 1T6VN 3T2NL 1DBKL 4P2QD 5LG1A 4JFXA 1JTPA 2HRPL 3L7EB 5C3TA 4IDLA 2LFGA 5J3HC 4ELME 4F9PA 1UM5H 4M6AA 3TV3H 3UDWC 3GMPB 3T0DA 4YC2B 1I8LC 1KCKA 1U0QA 3G04A 3ARFD 4U1KB 2SEBA 4M6NL 4O2EB 1B9ZA 5TQ0L 3VE0B 1RZJC 1Q9KB 3MLZH 2NZ9D 4GRLB 5K9OA 4X5XA 5F7DB 4PJHB 2VXTH 2GAZB 1QSED 4X6DF 5DZNA 1RHFA 2XIDA 3SKUD 1HKLH 3R8BB 5J6GA 4KPHH 4WGWB 3H9SB 1JK8B 2EEBA 4DTGH 4Y5VB 1MRDL 5EOQL 3N0PB 3FZUD 2WIIB 1MJUH 4HJGB 3VI4E 3KR3H 3OG4B 2DM7A 5T3XE 4GW1B 4OZHE 4HLZH 2E7HA 2MKLC 3SGEH 4QLRA 3VFTA 2YS4A 1T04A 5D70L 1NFKA 2DRUA 2PO6D 3AROA 3DUHA 4NQXA 2EDBA 3PUCA 1WIUA 3JV0A 1I3RA 1T7VA 3K1KC 4JO1L 4P48A 4ZFFB 3TH4T 1OQXA 3T0EB 4YBQD 2OK0H 4PY8J 1I1YA 4TQEL 1Z6JT 2J6EL 5TDOA 1R3IH 2E6PA 3GNML 4XVJL 2O5XH 4XBEL 2XKUA 3MRDB 4UQ3B 1AQDA 5B22A 3IKCA 5I1GH 1P7HL 1O5DT 5F44A 1HXMB 43CAA 5E2VL 4NC1E 2BSTB 3SDAD 1J0JA 3DIFA 4YNYB 1YMHA 2R0ZL 1MOEA 3KG5A 3ULUC 5F9DC 3PWPE 4XPHL 2HKHL 3NPZB 5EZOL 2XYCA 4S2SB 4JKWA 1A6VL 1FVDA 1YN7B 3H8NA 1EAPB 1DN2A 2IADB 1RJCA 1TZGL 3BD4A 3WS6C 3VXMB 1DR9A 1DLFL 4NQEA 5HD8D 1G7MB 3ULUD 4KJYB 4JM2B 3IETB 1RZGA 5FIEA 5JPNA 2EDWA 4PRNB 2X6MA 1B90A 3BX7C 5DJ8B 4IMKC 3UTTE 4ZD3H 2GY5A 1YNKH 3DWTA 1I7TB 3MLUH 5DK3A 3DGCR 3H3PH 1DP0A 1A47A 4ETYA 4KDTA 1TJGL 4NN6B 2E7LC 4RGMC 1CDUA 5HD8C 3RBSA 1R5IB 4LNVA 3MCKA 3MRLB 4L8BB 3T0WA 1VKXA 1XAUA 1MAMH 2R2EB 2DWDB 3RNKB 1HILA 3WLBB 4PJBF 1FPTH 1SJHB 4HMEA 4BKLA 3P4LA 3RWGA 1A3RL 4G6JL 1QSFA 1A3QA 2A38A 4PRDB 3RVXD 3FB6A 1FZOB 1U8KA 5HVFB 3LQZB 4OD1H 4KC3B 4O51B 4HKXA 2XQBL 2EYTB 2VLRD 4MAUH 1UB6A 1MFDL 4JKLA 1KCVH 1LNUB 1MIML 4P0DA 4GQPH 5GRJH 4BA8A 4QRPE 2AXJA 3LRHA 4G6AD 4WUUD 4V2BA 5ALCL 1CI5A 3JTTA 3CFEA 1EMTL 5IKCB 1JGLL 1P9MA 3NAAH 3VFUA 2HJLB 3X12A 1U95B 1DN0A 3MLRH 4KJQC 1K3IA 3T8XB 2IAND 4M1DH 1OAZH 5L6YH 3MOAH 4OI8A 1YNKL 5JQHC 3HRZA 3GRWA 1R3LA 3MROA 3ZE0E 3NFPA 1N4XH 3MMEA 1KIPB 3P0VH 3FT4B 4MXWH 5DHYB 4MQXC 3IKCB 4KRLB 3GBML 2R69H 3L3OB 1HNFA 4LLVB 4CN6A 4F58H 4Y5YB 3LSOA 4XPBH 4QYOB 3BZ4A 4GAJL 4QRQA 3BWAA 3CVIL 2WWKT 4Z7WE 1DDHB 1N59A 3VMPA 3ORJA 3MNWA 4RGNB 1I4FA 1BQHA 4QY8B 4OSUL 1CWVA 3T65B 5L2JA 3MYZA 1MIEL 3U7AA 3TO4A 1SYSB 1QRNB 2XWJA 3CFBB 5JHDA 5JDSB 5ELIA 1UKSA 5EA0H 5IGXH 1FGVH 2FD6L 5CCKH 1OAYL 3GK8H 1EEZB 2ZUUA 3BO8B 4M1GH 2CDEA 2YUXA 1FE8L 4UDUA 4M6MH 3H9SA 5J13B 3KYOB 3MV01 5E8DL 2XFXB 1OD7A 5L0QC 5E08L 3D69A 3DV4B 4JANA 2R23A 4MD5B 4QRTB 3M1BB 5JOFA 3PNWB 2VDPH 4ORGB 1PBYA 5H35B 1FNSH 4G6ML 4OZGA 4PJ5B 1XR9A 1FL5B 3OF6D 3L5XH 4PTTA 4G43A 4LU5H 4WEMB 4X9FA 5DJAA 4E5XB 5C0GB 4FQXA 4LVHC 1ONQB 3TZVC 5HPMA 4F58L 1X5ZA 1YPZA 5D1ZD 3U30C 4AIZB 1D5XA 1INQA 4X98B 5HHPA 4F15B 5F7EL 5DK2B 2GUOA 2P5ED 3ARDD 5D8JH 4YPGA 4YFEA 4TNVF 4JM2C 2DM3A 3FN0L 2LTQB 1OGAB 1CLOL 5I66B 2WLZA 5KOMC 1FV1A 4HS8L 3WFCL 4M3JA 2DDQL 3BUYA 4P46D 1U8IA 4H26B 1Z5LB 1QFWH 1FO0L 1W72L 2GUOB 3D3VD 4IOIA 5I1CL 2ZNWA 5D2LA 5J1AA 3SDDA 4NN6C 3TBSA 5DRXB 1K6QH 3I85A 5CILL 3ARDC 4KQ4L 3DXAA 3U6RA 4QRQB 1WV7T 2ZG1A 2Z31D 5EBGA 1HHJA 5KN5A 3NCEB 5IESL 1A6TB 4DCQA 4LOUC 3ZKMC 5IV2A 5E08H 1IM9A 4OUUA 3LN5A 5GS2D 3RI5K 3RWDB 5GGVY 2IBZY 2H45A 4CW1A 2Z93B 3IU4H 1CQYA 1IEHA 3KJ4B 5JTWA 2XZZA 1EFQA 3FT4A 3QHTC 3WXWH 4Y2OA 4PJCF 5FDWB 2K9UA 5CMAA 3SDAA 4EDXA 1N6QL 1U6AH 3LB6D 3UTTA 5L8JB 2BCKA 2N4IA 5DVOA 4X9BA 1U2HA 3SE8H 4U1SB 4LEOA 4O5LH 4ZFOB 4KRPB 2D0HA 3W0WA 1T83A 4P23A 1UENA 4NCC1 2YD9A 2DM2A 2V5MA 3I50L 4XMKL 4GMTL 5FYLE 2F8XC 1AO7B 1QFWL 3THMH 3HE6D 1GZPA 4WFEE 5DDHA 2VITB 1M4KA 3B2VH 5I8KH 4F7PB 3C5ZC 5BMFL 4MSWA 2P43B 3UJJH 3ZE2F 1GOGA 5EUKA 5JMRA 3MBXL 1OW0A 1MVUA 2BVOB 3S96B 5D93C 4K3DH 4PY7A 5E5RB 3VD4A 3HUJA 4PBXA 2QKIA 5DS8A 3UROR 1U8MA 2AGJH 2V2TA 1IILE 4G8GB 3E6FA 5K59E 4OAWA 1I7TA 4U49A 4OGAD 3U4EA 1TVHB 2XQYK 3NACH 3QEHA 4JQXA 3KPPA 4OD3L 1F4AA 2Y5TA 2HVKB 2B1AL 3EDKA 4R2GB 4EQ3A 1DSFH 2HJFA 5K9JH 3PDOA 4J3OC 3S34L 3QEUA 4EBQH 1S9KC 5IW3A 2HTLD 2XI9A 1BZ7A 4WW1A 2JK5A 1REIA 5F8QC 1PW3A 2BJMH 1KLGB 4DQOH 4I0CC 4XMKH 1QLFB 4RCAA 4KUCD 2E9IA 3VFVA 5I75C 5H2BB 1QBLL 2ITDA 1UB6B 1F11B 1CVRA 2COQA 1JN6A 4U0RB 2D7PA 3Q1SH 5GQBA 4XXCC 5ANMA 2FBOJ 2MMXA 1WITA 2D31A 3KPRB 3R06B 4PRIE 2UWEA 2Z9TA 4KY1L 2J1KA 2GTWB 2EDTA 1W8OA 3TJHD 4U6TA 2E9BA 4G80B 3P9LB 3UTTB 3GFUA 3L3KA 4BSVA 1QOKA 5IQ7H 3MRHA 3IS0X 1AJ7H 1NMAH 1Y18A 5IWLC 2VZ3A 4G43B 5T3ZL 3NA4A 5DJ0A 3IGAB 1GCFA 3O6LH 3I84A 4KI5F 5DD0H 5GGUB 5KZCB 3F6IA 1B0GA 3MACL 2ZWLT 3RWJB 1ZA6B 1CLCA 3HR6A 2CJUL 5JNYA 3MJ8B 4L4JA 1LO4L 3JVGA 3ARTA 3ZDXE 2DD8L 1KEMH 1YMMD 2XTJB 3S34H 4K7PH 1ZVYA 3GSXA 3MJ6A 3A6BH 5IB4B 5KANI 1INDH 1D9KD 3CX2A 3SDCB 4JY6B 2VQ1B 1KELL 1IC7L 4O4YH 2FDBP 5L7XL 5ISZB 1VADB 3NIDF 3EDEA 1LP9B 1SM3L 4X4ZA 1DQMH 3HLAA 3T65A 1C16A 3MRKB 4BQ9A 2GSIA 4X6DB 5C07A 4PJAE 3P9WB 1JWMB 4M93C 4Z7WA 1RU9H 5DD1H 4QRUB 4RZCB 4P5MB 2ICWI 1LO2H 3F58L 3PL6A 4CADB 4WO4A 4YE4L 3BPLC 3PQYB 3UTPE 5IQ7L 3I3EA 1QZ1A 5GRXG 2IH3A 2VDPL 1ZTXL 3IFOA 5MEOB 2AK4A 3V7AE 5GS1A 3MRIB 4RIRA 4HAFA 3STLA 3HE7C 3BYYA 4U6VH 1Q72L 3C2AH 1CGTA 5FF6B 3GSWA 4ORGA 4XPGH 4U1NB 5ID1B 3ULVH 1CFBA 1KJ2L 4N8VA 3RJDA 3NGBB 1FL3B 5L2KE 4G8EB 2EDJA 2CJUH 4MJIE 5CHNB 5D71H 2ICWB 4FQHB 1AGCA 4PTUB 2W9DH 3KYMB 5T1DL 4F7EA 1NLBL 3KWWB 4MA1C 4DOHB 5EZLA 2W0KA 1ZA3B 4JFEA 4XVUC 1M7DA 5H94A 4FQHA 5JUEH 4PJ8C 5DRNB 3B3IA 2EDOA 5KVMC 2O61A 3DXAD 1XZ0A 2J12B 1X6NA 2WBWB 4G9DA 1NGWB 1BZQK 2B20A 5H8DA 1RK0B 1XFPA 2GT9B 4LVOB 4N90D 1JHTB 3LD8B 1I8KB 5JW4M 1K6QL 5CILH 1J7VR 5KSBF 2NY6D 2HFFB 1MAJA 2ZNXA 4P59L 1J87A 1KPUA 3NPSB 3NH7H 4LLVA 2DQUL 1WGOA 2CMRL 4KMTL 2BHZA 4LIQE 1RJLA 2DS4A 3D3VE 2XA8L 1ORSB 5DMGC 2AK1L 4MJ2A 4QWWD 4YHYB 1GGBL 3IJHB 1RV6X 2X4SB 1M05B 3REVB 3BKCL 1DE4A 2L0DA 2NYYC 1NBVL 1NMCB 5JW4R 1MFBH 4JFDD 3H9HA 3IETA 4KROB 3QEUB 2XACC 1D5ZA 4GQ9H 4U1IA 5DJZA 4UTAL 1A7PL 2RJMA 3T0EE 3D5OF 1CGUA 4ZMAT 4LDOB 5KVDL 5KBNC 5LXGH 5JW4N 1GL4B 3EOTH 4E42A 1TMCB 1HSAA 5CEYB 4IRJD 1E4XI 4IJ3C 1HI6A 1UZ8B 3UTQB 4ZOCA 2A83B 3HE7D 1U9KA 2CK0H 3DNKA 3UYRH 1CD9B 4R7DA 4JO3L 5E1AA 3IJSB 4PGBB 2Q87A 2BDNH 1N7MH 2YXMA 3C5JA 3P9LA 32C2B 4NRZA 5E7FA 3NCJL 3SO5A 3CFDB 1RUPL 3CMOH 4CVZA 1MVUB 2BSRA 3BGMA 1AXSB 2MCG1 3MQIA 4U2YA 4P2RB 3D2UA 3KPRE 4G8EA 4ZTOL 3HCVA 3WJJC 2VDRL 4B5EA 2C1OA 5D70H 5BVPH 5EU6D 5DJ8A 3CSPA 5BXFB 4NYLB 1S7WA 4POUB 1N0XH 2EDHA 3G5YA 4PREB 2CK2A 3WNMA 1VACA 1WTLA 1LDPH 1RULH 2NY6C 4PJDF 5JQ6L 4U1GB 1F42A 4AQ1B 4LP4A 3U2SA 4YZFE 2O5XL 4XBEH 4QRUA 3S88L 3DOSA 1UT9A 4YR6A 4LLWA 4X99A 3MLXH 5JA9A 4K8RH 3GJFH 1BX2A 5F1IA 3KPSA 1K2DB 3VXUE 4MD4A 1T83C 4WU7B 2HT4C 5D96C 2V7HB 3OR7A 5DD3L 2XKNA 5E8PA 4Y5XA 5C0DB 1S9VA 1T2JA 4XI5D 7CGTA 1S5HA 1UACL 1RVFL 3V9FA 4GAGH 5LBSH 3CMGA 3BKMH 4KRPC 3QIWB 4ZAKB 4NRXB 3BPNB 3LHPL 4PJ5D 4X80H 5E6ZA 5GSVA 3CK0L 4HG4K 1Y18B 4H5SB 1XF1A 4LVOC 4F7MB 5KSVB 3IAGC 2EXWD 2BHUA 3D85A 4WCYL 5GGRY 3PWUB 1V7NL 3FQNB 5HHQB 1G6VK 4MJIB 1JF1A 4KTDL 3WMSA 5SX5K 3KYKH 2Y6SD 1TENA 2BFVH 5D4QA 2YBRA 2BOBA 4TTDD 2RQ8A 2KUTA 1P53A 1MQ8A 4G6FB 4MMXC 3FO2A 1NFIB 3JWDL 4JPWL 4PRPB 4X7SL 5GGSY 3QXVA 3E0GA 4XNXL 2X4OB 1NC4D 1H8SA 5JR1H 1FAIH 4OKVA 4WHTB 4OZFB 3RZCB 3KGRA 3MYJB 4I5BA 5L88L 3IDIA 2XG5A 4RZCA 2FJHB 3G5ZB 4P3CL 5D2NC 5HGBA 2LU7A 1QLRB 4EI5A 5KSBA 2P8PA 4ZAKA 5K9QG 1B2WH 3ESVF 4P5KB 3FOLA 3ULVD 4CJ1A 4ODVL 2W91A 5GISH 4LLYA 5IMLB 5C0AB 3RVVD 3S6CA 3CH1B 5J89A 1MF2L 2H8PA 2AJYL 4TOYH 4DW2H 1YDPA 4N8PA 4OZHF 1INQB 5DLMH 3A0OA 4NO3A 4Y7MA 5MEQB 1JL8A 2FLBT 2IPTH 3CDCA 1G7PA 5B4MD 1W0WA 5EUKB 4UIKH 1FFNB 5TE4H 4F3FA 1ZHBB 5I18H 4DFHA 4GG8B 3Q5TA 4KK6D 4NJ9L 4TYUA 4RWHA 5CINL 4ZOEA 3T2OA 4JFFD 5C1MB 1CK0H 1BOYA 2DLIA 1IQWH 3BT2L 5CJXA 2YD4A 4XH2B 2R0KH 3C8KA 4X9IA 3CC5A 4HWZB 1XGRA 4XPFH 4OQTH 4XNZC 3TBYB 1X5JA 2IPKB 4PJXE 2LQRA 3E8UH 4WW2B 2FD6H 1YEDA 3GM0A 5CCKL 4EVNB 3V5KA 2NY2C 2NLJA 3SGDI 2X9YA 4NP4L 1FFPB 1NDMB 2WUCH 5DC0A 3SQOH 3STZA 4FQQB 5IB3A 5H2BA 4ALAL 4Y4FA 4XH2A 1F2XK 3GMLA 4I3GA 2N7BA 4FQCH 3GSOB 4CN4A 3EO1A 4ODVH 1CFSB 3HCVB 4JRXA 5IHZB 4UT6L 2ZSWA 4ZO9A 4JO1H 1LEKA 2X4QA 2MCPL 4P9HL 5SWSA 4ZUTB 1IKNC 1T1ZB 2OR8A 3SEPA 1AQKH 1AKJA 3L3IA 2AJUH 4NQDA 3CCHB 1YMMA 1DQDH 1I3GL 4LCWD 5TE4L 2VJXA 5GIRA 3JUZA 5CINH 3C60A 5GRUL 4JN2B 3QG7H 1BQHG 1JHLL 4IM8A 4AQOA 1QSFE 1LVEA 3FN0H 4JRYD 4J1UB 1A3LH 1ES0A 4NO5A 4U33A 5GIRB 5A2IH 3BXNA 1QSFD 1AC0A 3MUY1 4QF1B 5FHBH 2QHLA 1AO7E 1FNHA 3QIUA 1N26A 4UOW0 3L3IB 3QQ3A 4XBGA 3X12B 2VZ1A 3MFFA 5MEPB 5A43C 1EK3A 1JFQH 5BS0D 5ETUA 4P5TA 4YK4B 4AL8H 5FYJD 5DJAB 5FDYA 3Q2CA 4LPVA 2AI0H 3DI3B 4WI4A 2V9QA 2QEJA 4YGAB 1OT1A 4GBXD 3C5ZD 4ONHA 3DO7A 1CZ8H 3CVHA 4XP1L 3VXPA 5M95B 2YD1A 3W0WB 1JYNA 1OTSD 2AJZA 4HUMB 3T77A 5JQ6H 4J3UA 1RJYB 3EYUL 4LCYA 4XCNA 1YYML 3UTZA 5DURB 3VFPA 3KHQA 1CL7I 1FG9C 1CFTA 2Q8BH 5F9JA 2DQTH 1S7QB 2B39A 1MI5E 4I3RL 3RPIB 3NA9H 4M9PA 5ENWA 5I71B 4NUJB 4N0CC 3VRJA 2GYSA 3AREB 1JHKH 3NTCL 3CFJA 3QUMB 5FYJH 4Z7WF 1BQHB 2VXUL 2IANE 4PGJA 4JO4L 4NKOA 1AXIB 5J06A 3BP6A 4PJ5E 1UACH 4OF7A 4OF6A 1I9JL 4OZIE 4WUUE 2HVJB 4AM0A 1KB5A 4B7LA 4PLNC 3O41A 3T4YA 1FL3A 2YUZA 3GM8A 4ZOBA 4YZFF 1K8IB 1G1YA 3FQUB 3BH8B 3RGVC 4L3ED 2J6EH 2YPKA 4OD3H 3T0XA 4W4OA 3D0LA 1I3VA 1CGVA 1GVIA 2DQTL 5HHOE 2VR5A 3W11C 1J86A 5D72L 4E5XA 1KC5L 5IB2B 3HZKA 1A7OL 4MAYB 4G8FB 1RK0A 3UBXI 1UCTA 4O2FB 5EO0B 1JHKL 3GMNB 5HVGB 1MCPL 4Y4KA 1KPVB 1DUZA 2AXFA 1WCQA 3BZDA 4X6EB 1WZ1H 12E8H 4PJEF 5H94B 1YY9C 3ELAT 4DKDC 3QAZB 1KCRH 1QTYT 4NPYA 1JNNL 4QNPF 1MCJA 4TVPE 4YBQC 3WLBA 1KJ2A 4P46A 4ZO8A 4FQLH 2XZCH 4XCNB 1J8HE 1K2DA 5JXED 5JNYB 3QRGL 4ZO6A 4PLKC 1GPOH 1FZJA 3FO0L 3HG1A 5SWZE 2DI7A 5B38A 4ODHH 1P4BH 4Y5XC 4P57A 3OXRB 2ZUWA 4LRIA 5IEKA 1KYOK 2AV7A 4LU5L 1ZVSB 5E8EB 3X3FL 2GK0A 3C5SA 3SKMB 5HI3C 1TTUA 2EO9A 4TNWF 3TFKD 4JG1L 1R3KA 3ESUF 1NKRA 4WU7A 2EE3A 1I7UB 3EOAB 3RPKA 5ERWA 2PW1B 5AD0B 2F54D 3F7YB 2H9GB 4Y2DC 1D3CA 4FQXD 5C08D 1EA9C 4XPAH 4PRPE 4NO5B 2VH5L 3HPJA 5T5FH 4I48B 2J5LC 1LEGB 3VDCA 3DMMC 3V6FA 2E7MA 4P4RB 2H41A 4PP2B 5ALCH 1S7XB 4GUPA 5HDLA 3QNYB 12E8L 1B6DA 4NZRH 3ROOB 3O3BA 3ULUF 4CVZB 1KG0B 5JZ7D 5KS9B 3OSKA 2ZCHL 3LMJL 4H20H 5HYSG 2DJ4A 5F7NC 4HBCH 4NZUL 3IFNL 5IB5B 2HT2C 4HV8B 2DLFL 3NCBB 3HI6L 3T0AA 4R7DB 5BXFA 5ICZA 3PJSA 3O8XA 2YK1H 1GPOL 2AJSH 3IDYB 4LL9A 1IBGH 4IDJH 3K3QA 5SWZD 4ZPTB 1WWBX 4XPGL 3TPUA 2C3HA 1JTTA 4S0TD 1AQKL 2XT1B 3T3MF 1BBDH 2ZPKH 4I18C 3JWOC 1ZV5A 2DQCL 3IF1A 2HAZA 3DURB 3JZ7A 1F5WA 2YD7A 3ZKQD 4I8DA 3ARGA 3KJ6H 1ZE3C 1YEJH 5IMOA 3QIUD 5T3XD 2X4QB 4XAWH 3HA0A 1FN4B 5CGYC 1KCUH 1DLHA 1XR8A 3FCTB 3OKNA 1KTLA 3NCMA 1LEGA 2QADD 2D7TH 3KXFD 2I24N 4NQDE 4ZS6D 4NO0A 4HUNB 5D2LE 3DUUA 4MNQD 1OAUH 2KZ1B 1WZMA 1F3JB 1DQLL 1IM3A 3MRJA 4JM2F 2KKQA 3SKOB 4YDLC 5D7KD 4WFED 2D3VA 3V6BR 2I60L 1BJ8A 3CC5B 4HWZA 4PJ8B 4OT1L 4K3GA 5DA0B 2Y6SC 4HZLA 3PHQA 2BVQA 1G9NL 1OTUD 3Q6FA 4M4PA 3EYUH 3VGBA 5EBLB 5IIEB 4N8VG 2YC1B 3HAEA 1LILA 2CR3A 3EFFA 3GHEH 4NJAH 4PY7B 1CGYA 5ADOH 5CJ8A 1FYTE 1NBVH 5FECB 1SYVB 4Y4FC 1BD2B 1DQJA 4OLXL 5FUCE 3MJ9H 4CU8A 1RZ7H 5DRWA 3CXHJ 4PJHE 4WU5A 5DT1H 3EUUA 2DI8A 1ADQL 3OXSA 2R2CA 3VU2A 4HIIB 4WV1B 1AR1D 1GOFA 2DIJA 1KJ3H 1NCUA 4L5FH 2BC4B 1HH6B 5T3XH 3V4VH 1OAUL 1HSBA 4FXKA 1T1WB 3C60C 5LKNA 4LLUB 5HYSA 5CZXD 5DMIL 4LHUG 2R1WB 1CF8L 4FQ2H 5F3BA 4WO4B 3M17B 3GBNL 4PJ9A 5GGRB 4P5MA 1P6FA 4OT1H 3KPQA 2B4CC 2KQMA 4JGUA 3QG6A 5GSVB 3CGTA 1UYWH 4WV1A 4MHHI 1IMHC 3S98A 4ZTOH 4KJQD 1L7IL 4GG8A 1MWAB 3IXTA 2AEQH 2HT4D 4ZS6C 3HTLX 2AK4D 4BSWA 5FHAH 3D85B 1KIRB 2K7PA 4Y19D 2ORBL 4ZSOA 1DBBH 4MXVE 3CZFB 1VFOA 4BK5A 5INDB 1IVLA 3MSPA 1EBPA 4HUWA 4HWNA 5CP3H 1DBJH 4L8CB 2AJXL 1MEXL 1A6UH 1ADQH 1FNFA 5JIIA 3ULSA 1U3HA 4JDTH 4FTVE 3VXNB 3B9AA 3UPCA 5IHUH 3DX8B 4JM4L 4YO0A 5GRYA 3GSXB 5GSRB 1KNOB 1A14H 4P4KC 3EYVB 3CCHA 4HJJL 2ZUYA 2M26A 4Q9BA 5D1QD 1CL7L 5E1HB 5L6YL 1ZHKB 3PHOB 4JFDE 4Z9KB 5FKAA 4XTRD 5IM7B 1JVKA 5TE7L 2UZXB 4P2YA 4KXZH 2F54A 3OKOA 2P8LB 2CUMA 1B4JH 8CGTA 1AGDB 4LPWA 1OY3B 3EJYC 3PWVB 3VXSD 5IMOB 3BPOB 4A6YB 4MCYA 4EQ2A 3DYOA 3HHRB 1CDGA 5T1MB 5A2FA 4JLRB 1K8DB 2HN7A 4NQVA 3D39A 1IGIH 3QCTL 4FXKB 2QQQA 4QHKI 4ACPA 4XPAL 4ZUVA 3NVQA 3IAQA 4WI2A 4XC3L 4K7FA 2LAAA 2IAMC 4QOKB 1CLYH 4NOFA 1DJSA 5C6PB 3TO4B 3ARBB 1K85A 2EIDA 4GXVH 1IZKA 1ZLSH 1RPQA 3QWOA 3VXTB 2EH8L 5F7LB 1MUJB 3PGCA 3UP1A 1MREH 5FOBB 2OL3A 4NHUA 5KJRH 3LS5H 4ZFGL 4JB9H 5I1KH 3AAZB 3RVWD 4XHJC 4X7SH 2CDGB 2OTUB 2GJ6A 3ALWA 3ZTJH 1RUMH 2H1PL 4ODBD 2IAMD 3IT8D 3CFDA 4PJEA 5D7JA 1EEUA 3SCMB 3MV7A 2EDYA 1MNUL 1H15A 4P3DB 3HNTL 5D2LB 4HWBA 2NR6C 5J1AB 1JP5A 4UILL 4ZOAA 1QFHA 3LVEA 5BRZA 1CFSA 1P9MC 3V7MA 2CUIA 3C6LC 3BH9B 2ADGA 3OTTA 1BIIB 4XP9H 5JO5B 1U91A 2X05A 4HIJA 4RMSA 4F9PC 4M5ZH 3SOBH 2NXZD 2HH0H 4HG4J 1I8LA 1QFOA 1AGFB 5E00A 5EBWA 1J1OH 4LPXA 4RNRB 5JIKA 4OZGE 3A6BL 2HLAB 2IPKA 4EZMA 5A2KH 3U48A 3UJTL 1E4JA 4P2QA 4HK3N 4JFPA 3QXTA 5FA4A 4NSKA 4MQSB 1FYTD 2KDGA 3KYNB 2RR3A 2YA1A 5I1LA 3TF7C 5DJDB 3DX7B 1UCBL 2OJZL 3N9GL 4PG9B 3W2DH 2NQCA 3MJ9A 1TXKA 4J6RH 4ELMB 3K81A 1KTLB 1QFWM 4NJ9H 1B3JA 2X4TB 4KTEL 1AFVL 3UYRL 2DIAA 5DD6B 1DANT 3N1QC 1A1NB 1QSFB 4JJHA 5CD3A 2ZOLB 1Y6NR 4LLQA 1MCHA 4Z77B 1XT5A 4PR5B 4UINL 5SV4A 3OJDB 4MX7B 5DJ6B 2VWEC 4C83A 2NXYC 4OFYD 5LGHL 1I1YB 4AEFA 3QH3B 4JPIB 1IARB 3WD5L 5IG7B 1S78D 1D5MB 3AC0A 3BP7A 3GI8H 4BH8B 1IAII 3OKLA 3VFWA 2R29L 4J3WA 2VC2H 1IAMA 3O4LD 1UEMA 4HFUH 4NRXA 4FQ1H 4AY0A 1H3WM 1T21A 2VDRH 1CGSL 2AEPH 1V8HA 2WLYA 5TPWL 2UYLA 3WNPA 4HV8A 1FNEB 4YEEA 3VJ6B 5C0FA 3D2UD 5D7SL 4Q9CA 3CFCL 2YOCA 4FFWD 5IT2H 1RZ7L 3TT1H 1TZHA 3C6LD 5IFAL 4OCYH 1ONQA 1AGEA 5FFLA 1LO5B 3WIHH 4LOUD 4NQCB 2OLDA 2ZG3A 3N1GC 2QQLL 3W9DB 4U7KA 4HC1L 5F7DA 1X5AA 2BVUA 1MI5B 4BH7B 4XNMB 3RAJH 4HIXH 2APVA 4KV5E 2VTFA 3QG7L 1Z3GL 2GSGB 3ARGC 1DEEB 3K8KA 4QOKE 5DMJB 1T03H 3QDJE 3IFOB 4ONOA 5DMIH 2DQUH 4KMTH 2ATPB 1U8JA 2DYPD 5DD3H 5J4MA 4G9FE 1CFQB 2IQAA 4Q2ZA 2NZIA 5FA3B 2Q6WA 1I8IA 4M7LL 1D5BB 1BM3L 1SBSL 4N0CD 2R2BB 4OIIL 3H0TB 3I6LD 4NQXB 4XVUD 1G9MH 2PO6A 2XOTA 1G7LA 2AJVH 2ZUQB 4LDEB 4LHQB 1W8NA 4X80L 4WFHE 2Q7NA 5SX5H 5C0RH 3LQZA 3AUVA 3V4PL 4X8JA 5FK9B 3RHWK 3U36B 1S9YB 2Q6WB 1A7PH 2JB5L 1U3HD 1WQVT 2HTKC 4M5YL 2NY0C 3AGVA 4HUXB 1G1CA 4YBLC 4YK4C 4Z95H 4KK9D 1XGUA 4QRRE 1KIQB 4XCYA 1UA6L 5JHDD 3PHQB 3NA9L 1NBYB 3GHBH 3L1OL 3BOVA 4HK0B 4X5LA 1QFWI 4JM4H 2R1XB 3VFVB 3MRIA 4RIRB 1ADQA 1RIUL 1VDGA 3EZJB 1FZKB 4LP5A 3LRGA 3L3KB 2VNCA 3E2HB 1CL7H 3PIQB 1BLNB 3OMZA 1FL6B 1OP3K 4DUWA 3K0WA 5I8CA 2UWEB 3SQBA 2Q8AH 2OM5A 1E27A 3S35X 2G60H 1MHCB 2I9TA 4KZDL 5I71C 1G9ML 2BVTA 3MMEB 4XNMA 2BNQE 1OW0C 1Y0LB 1GGTA 4WNQA 1MRFH 4YH6A 5I16A 1FN4A 2FX7L 3KLDA 1FIEA 4XNYL 2R56H 1SY6L 1P7KB 4LEXH 4DVRH 1CXKA 3RX5A 2FH6A 3K1DA 3LRSA 5EC2A 2CUHA 5D6DC 4EEEA 5B8CB 1T66C 2F15A 3NZ8A 1U8HA 4WV1C 5T33H 3ULVE 3GSVA 3SBWC 5CD3B 4H88L 4S1SH 1J1XH 4L1HA 4UIKL 5DD6A 5I18L 3KPPB 4L9LA 3S88H 2BMKA 1JWUA 4M9OA 2AQ2A 3GHBL 3L1OH 3TPKA 5FYJU 4GRWB 3VXTA 1X4ZA 2H1PH 5DJ6A 3JWOL 3OJDA 5GGQH 2G9HA 4ZFOA 4LLQB 3BRFA 2XA3A 3AS1A 1J0KA 3ARXA 2CGRH 1JNNH 1NPUA 3OR6B 1EJOH 1RHHA 2PXYB 4KZDH 3QDJB 5EWIH 4MAYC 3MV9A 1HH9A 4OFIA 1Y0LA 2G2RB 4XMLH 3MLSL 4L4VA 1FAKT 3HPJB 1G84A 1AXTH 5FF6A 1RMFL 2JJWA 4P9ML 5IVZB 3G08A 4JM2A 4KUZL 1DFBH 2NMSA 5IWLA 5I8CB 1IEAA 5EU4B 5B39B 2C7UB 4W4NA 5T3ZE 5AYUL 1Y6KR 3GJEA 5DJ2A 2UZYB 2VDNL 4L4TA 2EYSA 4S1RL 3FB5B 2ZUXA 5E99L 3I6GA 5CUSL 3I3DA 1F97A 2LU4A 3KYKL 1FVDB 2RCSL 2ZCKH 4JG1H 4J6RL 1YY8A 2R1XA 2P5EA 3ARDA 4IIQA 1CXFA 5TQ0H 4MB4A 3WFZA 1F4HA 1YC8A 2VH5H 4JPWH 4FN0A 4WUUB 1TVBB 1DCLA 4ZUUB 1Z2KA 4I0KA 3L9RB 4NQCE 3K4ZA 5FO8B 1KBGL 4ETQA 4NQDB 1YUHA 2HN7B 4LLMA 5EIQA 2ZUTA 1F90H 4K8RC 2W0PA 2BY0A 2FRGP 1R3JA 1WBYA 4PJFB 3SDAC 2C26A 2Z31A 4RMQA 3PWVA 1EJOL 1MJUL 3TIEA 3S35L 1U8QA 5D1QA 4ENED 4HBCL 3SJVA 4Y2DB 3T09A 3FO1B 2ZP0T 3PL6C 4WO4C 4XMLL 5K9OB 4NFDA 2VLME 1H3VA 5DC9B 2F53A 5K9KB 1I85A 1E6JH 3VFWB 1A4JB 2VLJD 4ZQKB 3BGAA 4F2MB 5C0CD 3KXFE 4P23C 3NIDE 4YXHH 3GKZA 1E4KC 2EO1A 1OOAA 3TT1L 5IFAH 3DJ9A 4DGYH 1MAKA 3R0MA 3MRQA 3D0LB 3QIBD 1NCNA 4H25A 1KF9B 1ZGLM 4MZ2A 4WUKL 4F57H 3EOTL 2VUOA 1U92A 4YO0B 3WIFA 3RA7H 5ACLA 3IDXH 2CKBA 2EECA 1BD2E 5DQJB 3TEUA 5GGSA 5CKAA 3DO7B 4XAKE 5GRVK 1EEYA 4QRPD 2D7OA 4R96A 3P9MA 3KPLB 1MI5D 1OSZB 5EPMB 5K33A 1M6OA 1T4KB 1W72H 2QQKH 1TQCB 3ULUH 3KDMB 1J18A 1M71A 3UC0L 4X4ME 1C7SA 2RB8A 2D7MA 2Y7QA 3OG6B 4KQ4H 3UPAA 3UYPA 4OI7A 2A6DB 3KPOB 3TO2A 3RZCD 2W59A 2VZVA 1MFEH 3HAEB 5I74B 5LQBL 1ZEAH 4HZAA 3V4UL 3ZHKA 1PLGL 3BQUA 3O6FD 3TYGL 4PJIA 4IHOA 5ACZA 1PAMA 4UT6H 3GSQB 2CXGA 3V4PH 4R0LC 4XI5C 4MS8C 4G42B 1MHEA 5CP7A 5E94B 4M7ZB 1XH3B 2DWEB 5GZOD 4IS6A 3TT3L 1YA5A 2FATH 1K4CA 2D7NA 5AUMA 1H3PH 1EFXB 5D72H 5GRUH 4YWGH 2V2XA 4OLZH 5EOCH 1E4XL 2OZ4A 5DDHB 3BWUC 4N0YH 3P4OA 1TJHH 4NHCL 1XGYL 3GSUA 3VWJD 4FFZL 3MOBH 4HHAB 1JF1B 2FB4L 4HKXB 3LKOB 4FFVD 3CLEL 2GHWB 3RGVB 1FFPA 2VXSH 3QNXA 1WFNA 3NN8B 3RFZC 4R4FH 4TSAL 1CTNA 3UTSA 4QHNA 5LBSL 4R4ND 4DKEH 4K94H 4GW4B 4AEIL 5IKCA 4GKNB 5EZJB 1S7TA 1AP2A 1QRKA 3FMGH 5J6HA 1OCWH 2BNRE 2R4SH 1G6RB 1NCTA 3P3YA 1TNNA 1JBJA 1IC4H 4TQEH 4PRNA 5F3HA 5GXBB 2EYSB 1QA9A 1QKZH 4L4VE 4YHYC 4KJYA 2MFNA 2PO6C 3WJJA 4BK4A 3NZ8B 4X6BA 3EFFB 5DHYA 1N2RB 1QVOB 5MI0C 4GSDH 4JO2H 5IFHH 1OL0A 1U8IB 2AJXH 1LHZA 5IBLC 5JW3H 2X5PA 2DMBA 2ITCB 1A7RL 5EUOB 5SWSE 1I9RH 1GOHA 4JFYB 4WJ5B 5GS0C 2IFFH 4NUGL 3QDGB 3KPOA 5IHUL 3MRJB 5DHVB 3PWPA 2DQEL 4M1GL 3DSFL 2VDQH 2YUVA 1NDGA 1EDQA 3MV8B 4PJHF 4S1QL 2DYPA 4K94L 3DUUB 4YDKL 1ORQA 2DBLH 3PWNA 2GJZB 3D18B 1PEWA 4H8WC 3PP3K 4LASH 6FABH 2EDKA 3IXTB 1B2WL 5D2LF 1T1XB 4AIOA 1KULA 1MJ8H 1NQBA 1VPOL 2DTSA 3LV3A 4GKZB 4YNYA 1KIQA 5EFIB 1AHWA 1XZ0B 4MD5A 3MOQA 3CVHH 3QEGH 4QRTA 2BSRB 4P2OD 1QKZL 1JRHI 3U4BH 2VDNH 4S1RH 4BUGA 5KVEL 1KLFA 4M7LT 2EIZA 1OGAD 4JGMA 1C5CH 5D5ME 3QRFM 4AK1A 5I9QC 5F1NB 2EDEA 2KH2B 5TH2B 1A64A 5ITBL 1RQ5A 3TH3T 2EICA 2WAHA 4PRHA 1I7RB 4NNYA 5FYJE 1J1PH 4JQIH 4K2UH 2P42B 3VE0A 3HMXH 4RSVA 4K23H 3V6OC 1C08B 1WZ1L 1EMTH 2NXZC 2YXFA 1MREL 2AEIT 4FZEH 4GW1A 4ODWA 3KPRD 4JZJB 3T08A 5JORA 3N1FC 3BWAB 5E4EB 1CD1A 1DQLH 3JXAA 1F6LL 5DHXB 1PG7W 4TSBL 4Y5VA 4E41D 1YUHB 4TUKH 1K5NB 4PV9B 3SQOL 4NN5B 1MCLA 5EDXA 4PRPA 3BVNB 3STBA 2VAAA 3V0WL 3ILQC 2Q86A 4KK9C 1N4XL 2BNUA 1QQDA 1UH2A 4X4MA 3RNQA 4JR9H 4YR6B 1BREA 1TQBB 2XN9B 5ABDE 2HFTA 3KPQB 2IANA 1I7UA 3BVNA 3EOAA 4JKPH 5BOPA 2FJFA 3VW3H 2AJUL 4FMFA 4J4PC 4MWFB 3U7YL 1DQDL 5C7XL 4NKDB 3RA7L 4ZAKC 4JFED 1IM3B 3CFKB 4LLDB 1Q9LA 1BBJA 1KFAH 5J11C 3G6DH 2ESVB 4Z0BH 5JHLH 3HZYB 2XZAL 4OSUH 5BZDB 2R2HB 5ICXB 2WBJB 4NOBA 4R26H 3A6OA 3HMXL 2H32H 3AY4C 4RA0C 4K3HA 3ZDZE 4CAGA 4ONFH 4KPHL 1AI1H 4ZFOL 3VDAA 3ULUL 4JPIA 1WC7B 3BQUD 3O6FA 1GHFH 2DBJA 3VCLA 1BD2A 3P2TA 2HTLC 3AM8A 4QRPB 3ZL4L 3TVMA 1CT8A 1MFEL 2EH7L 3V4UH 4JFHD 1A0QL 3VFSA 3SCMD 1UM6L 4GH7B 4PJAB 1CLZL 2CRMA 4EI6B 2DQGH 2QSTA 2YPLD 2L7JA 3UTSE 4XP1H 3L3GB 3MREB 3QHFL 5IBUB 9CGTA 1YEEH 2VL4A 3FAXA 4LMQI 1NFDE 2OCFD 1KB9J 2FNBA 1BBDL 5DVLA 2CQVA 4HWEH 4WEBH 2WMPA 3FT2B 3QCVH 3I02A 4U1MA 4KGLA 4CNIA 1RFDL 4HGWB 5FV1L 4QXUH 2AP2A 1YQVL 4WHDA 1D9KB 3OGCB 4ODWB 1NMBL 5F7EH 1NGXB 1UWXH 3CJJA 2E27L 1H9VA 5GGTL 2HVKA 2PETA 3BI9X 1M1SA 2PUQT 1E4KA 3QNYA 1FC2D 3WIHL 2ITCA 3WFCH 5J56B 4L4VB 1TVHA 1LDSA 4R26L 5IK3A 2OBGA 4Z7VB 5D1ZC 4GMSH 4DFIA 1C12B 2X41A 4JDTL 1Q9OB 3I9GH 1F4YL 1J0HA 1NCCL 4LQFH 2VN4A 3MRDA 4UQ3A 3IU3A 1LK2A 5T5NG 3RY6A 3V52H 3A67L 1ZWIB 3I3BA 2P8MB 3BN9D 3S37L 3IU4L 4HCRH 1BJ1H 1A1MB 2PYEB 2DJUA 3MLUL 2B0SL 1I1AA 3QIUC 1SBSH 3LKQB 1TJGH 1Q0XL 1FZMA 3L3GA 1OAQL 2XTJC 4JVPA 4PJXA 5CGYD 5HGHA 2AJVL 2XN9D 1OAXH 5HTSA 1E6OH 4D0CB 2NY3B 3MGOA 3QUYC 4DKFL 1CFTB 3GSVB 4R90L 2VSCA 3WHE0 4NGHH 3BJ91 1QEWA 4EXKA 1YY9D 3H3KA 2A77L 3L7FA 1KEML 1YEDB 1TFHA 3H9HB 1AGFA 5E00B 1K4DA 5EUOF 1AO7D 1MFDH 1KCVL 5GRJL 3WIIH 1DE4B 3U82B 4PGCA 1GGUA 2P47B 5C09D 4I0PA 2XWTA 2PTUA 1G0YR 3OX8A 3VXME 2QR0A 3ZTNH 1KXVC 4L5FL 5T3XL 4JVWA 1JPFA 2NY6B 4WW1B 5AD0A 4FFYH 3VXQA 4C55A 3TNMA 1D5BA 4M61B 2DIBA 3LN5B 1R5VA 3FONB 1EXUA 3O9WA 2XN9E 3PDOB 5CGMA 4XC1L 3WSQL 1UWGH 4HKJB 1EV2E 4OLUL 5FM4A 3SDXA 3HC4L 3DMMD 3HE6A 1QR1A 2KBGA 2HP4A 5BV7B 4NCC2 1MJ8L 5T1LA 3MGTB 3NFNB 3QXUA 4KV5F 4OF0A 2NNAB 1BVZA 2F8VA 2OMNA 2GJ6D 3FOMB 5J11B 2GSIB 2DF3A 4X6DA 5C07B 3LKNB 1F4XH 4UU9B 3S5LA 1IGYB 1INEH 1PEZA 1VB9A 1N0LA 3QJHB 4KHTL 1T04B 5D96B 1M7IA 1E6OL 1OGAE 5E6IB 5HY9A 1JPGA 2MKWA 3TBWB 1FDLL 3BP5A 3DSNA 4N9GA 5HHOB 1TCMA 5DFVC 5GGVH 2I5YH 1S7SA 5CJXC 2HMID 3MLTB 5DRZB 5GS3A 1XEDA 1YPZB 2J3SA 4D3CL 3RGVA 4IRJB 3NFSL 3RIAK 2EZ0C 3R0NA 4JZOA 1T4KA 3EGSB 1GGIH 5JUEL 1MEXH 1GZPB 5DURD 4X5XB 2HT2D 4PJGE 5I1HL 2WBJD 5BO1L 1KPRA 4LCWB 3W2DL 4W4OC 5DUML 5FKAB 1MRCL 2CKNA 4G6KH 4KTEH 4LDLB 4G7VL 5B38G 4ERSL 1KEGL 5LCVH 5TH2A 3EOBA 3PHOA 5CSGA 4BFIA 4BUHA 4EVNA 3MXVL 1WCBA 3DARA 3QYCA 4Y16C 4XNXH 3EYVA 4FQPA 3G6JF 4PB0H 4FNLL 3O4LE 1YEGL 4UINH 4TPRL 2K1MA 2W07A 4NT6B 5DI8A 3SKJL 3TNNA 4J12A 4JFYA 1KXQE 3C08L 5HVHB 4KZEL 2H26B 1KCSL 3GIZL 3ZT7A 3QIWD 4PJCB 4MVBC 5GRVL 1MCSA 3ZHLA 3QUXC 3V5DA 2QADC 3VW3L 4P46C 4JRXD 3MXWL 2ICWJ 5INDA 1FORL 2F9BT 4LCIL 4NQCD 2F5AH 1YEHL 5DRZA 3QHZL 3EYFA 4WFFD 5EU5B 5F97E 4UTAH 4FQIH 5D8JL 1SMOA 3DVFA 1CICB 3QDGA 3O45B 5KVDH 1ND0A 1QHOA 5E5MA 1AHWC