4ORGB

Crystal structure of human fab cap256-vrc26.04, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
211
structure length
208
Chain Sequence
b'VLTQPPSVSAAPGQKVTISCSGSSSNIGNNFVSWYQQRPGTAPSLLIYETNKRPSGIPDRFSGSKSATSATLAITGLQTGDEADYYCATWLTSARVFGTGTKVIVSGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP256-VRC26.04 light chain
molecule tags Immune system
source organism Homo sapiens
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
total genus 35
structure length 208
sequence length 211
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2014-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4orgB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4orgB01
1QFPA 3WIFA 3WNPA 1F3JA 2ZSVA 3KPRB 2R8SH 3BHBB 2A6IB 2H32A 3K3QA 1A14L 3K4ZA 1ZANL 5I17B 1HZHL 1UVQB 3DYOA 4DUVA 4HCRA 5ICYB 1RD6A 2PETA 1Z6JT 4LHQB 2C1PA 1D5XB 4ODBD 2CJUH 1ZA6A 2VLLB 3CLEH 3IJYB 3T3PF 3LEVL 4LEOA 2H9GB 2WNGA 1FGNL 2HJLA 5E8EA 4OM0H 2DICA 4LCCA 2VQ1A 4R4FH 5A1AA 2BSRA 4Y5VB 4NHUA 3DETD 3LN4B 4NNYB 1HSBA 1ONQA 5FF6A 3D69A 2I26N 2IPUK 2NY4B 4I1NB 1KTKE 1JN6A 4X99A 4YDKH 1PLGL 2EDQA 4HS8L 4EI5C 4JPKH 3MLZH 5IIEA 5FUOL 2NY0D 5DD0L 1G84A 4HF5L 2P48B 1YPZA 3P9MA 4P23D 1MRFL 5F9OL 1H3VA 3NCYP 4OZFA 3OJVC 4JVUA 5ADOH 1ZHNA 2YA0A 4XPTH 2YS4A 3AY4A 4Y19E 5M7QA 1OWWA 4N0CD 2RFXA 4CUCA 1H15B 1TTFA 3GSQA 3MGAA 1ZSDA 2HLFC 4XPFH 1XFPA 3C5SB 4LCUA 1YQ2A 5GZOD 2NXZB 3UEZA 2B1HL 5DC4B 3QP3A 2EC8A 1LP9B 3RVTD 3EHBD 3QDGD 4PV8B 4MJ4A 1A4JB 3M1BA 5EZIL 1EHAA 3U0TB 2AXJA 2OI9B 4KK8C 4OCLC 5IMMA 1IZKA 5BRZA 3VRLE 2FBOJ 2XWBA 2QSCL 5B39B 2VLKA 1LILA 2W9EH 3N1MC 1VACA 5AG9A 3MRQA 4QGTA 2YD5A 4M7JH 1BM3H 4J4PC 5ICZB 2I5YL 1QRNB 3NPZB 4F8QA 2O93L 3TESA 4M5YH 4POUB 1C08A 4LCWD 3QIUB 1WFTA 4HKJB 4DVBA 3V52L 2A73B 3HZVA 3QUKB 3C2AH 3KXFD 1D5BA 3KHQA 5HDOA 2DB8A 3CVHH 3UYRH 3L5WB 4GAGH 1S7RA 2YUZA 4PJEF 5FV2A 5CJXC 3QG6A 2IANA 2FEEI 5C0IA 3RX8A 4U1NA 4PJEB 5A2JH 3PWPA 1MOEA 3UBXB 4OLVL 4TTDC 4LU5L 1NCBL 3B9VA 3NIGF 3ESVF 1N8ZA 3EO9H 3QEUA 4JPVH 4Y89A 2BRRH 5E6IC 1DJSA 1HINL 4NKIH 1RMFL 5GS2H 3N1QC 3QDHA 1MRDL 3SDXE 2C3GA 4AT6A 3VCLB 1KIQB 3B2UD 1OM3L 4ODTL 1UCBH 1GXEA 2VLRD 5D9SB 1MAMH 4EDWH 1OARL 2FIKA 4R9HA 3IDUA 1FG9C 1JPTL 1HN1A 1T2QH 4PJGE 2PR4H 2WINA 3BP7A 4R0LB 3SDDA 4TSAH 4WV1C 1FNSH 1S7VA 1FYTE 1GC1C 5JIHA 3D39A 4R90H 4X6DF 4YGAB 1JNLL 3I2CH 3KS0H 3O3DA 1R5WB 4K71B 4ZUWA 3ULVF 3TVMA 3EUUA 1JUFA 3PJSA 3BMWA 1M05A 2B2XH 1A7RL 1RZKH 3CVIL 4KI5C 1FN4B 5EU4B 3VFOB 1HQ4A 5HBBA 3CVHL 3DUUA 4ONHB 4XCFL 3UYRL 5AWNH 5F89B 4ZOEA 2F58L 3AM8C 2Z35B 1T7XA 1XGYL 1RUKH 1WZKA 4YX2H 4DVRH 5C1MB 1NCWH 1OQOA 1Y6NR 3U9UB 4H88L 4Z5RB 4I3SL 3MPCA 3RVVC 1SEBB 4MWFA 5IW6A 1FC2D 2W0FA 5C0JA 1CL7L 4MNGB 2ZG3A 3MUGA 4WIQA 3MRHA 2DQEL 1V7MH 3BSZL 2Q8BL 4KVNL 5F3BB 3V5DA 3QHZH 5HHNA 4FMKA 4PJCA 5FKPA 2ICWJ 3B43A 4MAYC 4PJHA 4NFCA 2X4PB 4P59L 4AH2A 2CLVA 2YK1H 3C5ZB 4AIOA 1BGXH 1QPPA 3FAXA 5F6HI 2Y7QB 3ZE1E 1JZ7A 3L5JA 3RAJH 4XP5H 3U0PB 3SJVD 3QUXA 3BH8A 4QHUB 2EDFA 3G08B 4HBCH 1WSST 2OR8A 1FAIL 1EO8L 4RA3A 3C60A 4E42A 5I1AA 4PRPB 4WTZG 3OKKA 4GW4A 5EOCL 3HNVL 3DXAE 1RQ5A 4PUBH 5DXWA 4HWZA 4OLZL 4JN1L 5DRNB 3JV6A 3C08H 4ODXB 5ESAA 1AGCA 2F53B 3MV9E 4WW1A 1Q38A 1NLDH 1XGTB 5GSRB 4IRZL 2OTWA 4FQCL 2UUDK 1BD2E 1SY6A 1U8OA 5HI3C 1IAMA 1PKQE 2DWDB 4X98B 2B5IC 4HG4J 5L8LB 2I25N 2XZCH 3EJZD 1HYSC 4F57L 3GRWH 4R4BA 5IB1B 4WEMB 3Q1SL 5D71H 3AUVA 3QEQD 3NA9L 4HUVA 1C16B 4ELMA 5EIQA 3BN9D 1CFTA 3GZKA 1T22A 1WQVT 1H5BA 5FB8B 5FKAA 5K9QI 3C8DA 5KS9E 4KJQC 2IGFL 2PYFA 4XPFL 1ED3B 1CBVH 5EU3B 2EE9A 5HHXH 4TVPD 3WJJA 2Z8RA 1QSEA 5D2NE 2BVOB 1VFBB 5E8DL 2ZJSL 5DWUL 1KSRA 5DJ6B 4UDTB 5DRZA 3FHAA 3CX5J 3NFPA 2VZOA 3CFDA 3QDJB 1Q9KA 1Z5LA 4HSQA 3MRNA 4ONFH 3V4PH 3V95A 2R23B 3MOBH 1KPRB 3MUY1 4YFLF 4BK4A 4NN6B 2ITCB 3WDHA 4OCMC 3SDXA 3FN0L 1PSKH 2QBWA 5IMOA 1MPAH 3FQRB 3VD3A 4FQXD 5DDHB 3LB6C 1MJJA 3OL2A 5CSZB 5JPNB 5GS1B 3CD4A 4V1DA 4MDIA 5JQ6H 4XZUA 4X4MA 3NFSH 3S8WA 4BFGA 4JQXC 4JPWL 4GMTL 4IIQA 1EMTL 1W72A 2XKUA 4TUOA 2DJUA 2MTPA 3DUSA 4XX1G 3SO5A 5I2IB 5TE7H 1MI5D 5BXFB 2Z92B 3TNNB 1BVLB 1HH6A 1KIPA 1CD8A 2XRAL 3QIUC 4XMPH 2VAAB 5D93C 4R97B 4IHOA 1G1YA 5C0FA 4ERSH 3I9GL 4OCWH 2LE9A 3K2MC 5LCVL 3QRFM 3OJDA 4UIKH 4F58H 1FGVH 1V3JA 4M1GL 5TGBB 1YEKL 3RVWD 2DJSA 4S11A 4FXKB 3ZKXC 4EXPX 1ODAA 4LFHG 4YDJA 1ERNA 2C7UA 5ESVB 4M6OH 3V6BR 4C57C 5J9PA 4KRNA 5A16B 5KS9B 3HN3A 4XXCC 4RIRA 4FQCH 5I71C 3SGEI 3ULUF 1U91A 3MLYH 3DMMC 3G6JF 3KJ6H 2ZCKH 2D9CA 3VXSA 2AXFA 3MNZA 1EBAA 1UWXK 2AEWA 3LPFA 1NFIA 3M07A 4OZIE 4NBZB 2R2BA 5GRVL 1UADC 1E4XI 1NBVH 5D7IB 3RWFA 1UXSB 3NABL 2WZPD 4NFDA 1N59B 4P2QE 3UTZA 4JJ5A 3RWJA 1A3QA 2EYRA 5F3HA 3WS3B 1D5IH 5GXBB 5HPOA 1J1OH 3T08A 4GO6B 1G7QB 3SGKA 4AENB 3O41A 3BEWA 4I8DA 3H9SB 1MQKH 1QLRB 2EDYA 1UEYA 1A5FL 2X1OA 1IKNC 2V5MA 3OXRB 2I07B 4G6AD 4KPHL 4Y2DA 1CF8H 3TIEA 3ARVA 3OZ9H 1WZ1L 3U1SH 1HZHH 1MFNA 4JKKA 2EEAA 2FZ3A 3E3QE 3ZMRA 3PF2A 5T5FL 3VFGH 3CXHK 1M7DA 4OCSL 1JI1A 3GJFA 4JY6A 1YC8A 4Q0XH 1IAKA 2QSQA 4KQ4L 4X4XB 1HOCB 3FQWA 4JN2B 2AJVL 3CFCL 3WO3B 1QLFA 1MCHA 4HS3A 2DTMH 4I4WB 2YD4A 4QGYA 3MLUH 3O3BB 2N1KA 3GBNH 3LEYH 3FO2A 2APVA 2A9NH 2CLRA 2VABA 1XCTA 1K5NA 3U7YL 1J0YA 3HZYB 1Z9OA 1WK0A 3ARDC 3FHQA 1TCRB 3QEQB 1PG7W 1KLFA 3F58H 4NSKB 3GIVA 4P3DA 3MRMB 2DI8A 5DA4A 4KDTC 1OWRM 3ET9F 1JZ6A 3PXJA 2YC1B 1VADA 1Q9LB 1BAFH 4XX1E 1UM5H 4A2MA 1KEGL 2APBA 3LEYL 1BD2D 3MV9B 2VO5A 4LLVB 1EFQA 2IBZY 1I1AA 2ICWA 5GRJH 2QLVB 5DJAB 1BBJA 4XPBL 3DBXB 5E1HB 4JFEA 2DIAA 5INDA 3SKJH 2BSED 3LEXA 2LAGB 4ZTOH 2APWA 5FGCE 4F57H 1C7TA 1AGEA 1ZLUH 3RVVD 5F1IB 1XIWA 5E00A 5DEGB 2WIIB 3X12A 3HI5H 3LKSA 2NX5B 1G0DA 2VAJA 1DVFD 5HGBA 2KBGA 1JHTA 1FFQA 4U0QB 1T0PB 5KSAB 3LN9A 2VOTA 1A6AB 3MLVL 4KGJA 3T77B 2VRAA 2OYPA 1YEDA 1MREH 4TQEL 1NGXA 2DQFB 1BZ7A 3D5OF 3OBAA 5T1KB 5DMGC 4I0PC 4JZJC 4QF1B 1RFDL 1S7QB 2ESVE 3ARED 5ERWB 5CEYB 3UBXI 2ATPB 4N1EA 3SDAD 4QEGA 1BGXL 4HW6A 4DKFL 3FO9B 3U46B 4R7DB 4HAFA 1N6QL 3FONA 3MLZL 3S6CA 1IGYA 1WIUA 4U49A 4LOUD 5DHYB 4R3SB 3BUYA 4P99A 3T2PA 4M43L 2GTZA 4JPIA 4GRLA 2WUBH 3MCKA 3TPKA 5ISZB 3VW3H 4L4VA 1EJOL 4GG8A 2DTSA 4O9HH 1B0GB 1NBYB 4PJGF 3Q48A 1PW3A 4KAQL 4MXQC 3MMEB 5DUPH 4GG6A 1BZ9B 3NIDF 2BERA 1F6FB 3HE6C 1CFSA 4ZNEA 4Y4FA 3NAAH 4HC1A 1U8HB 1E28A 3LS5H 4WWKD 2G9HB 5JHLL 3OR7B 1T04B 2Q6WB 3SBWC 1A7NL 2NR6C 3V2AR 2R1XA 5A2FA 4W70A 5FUOH 1NCDH 1JTPA 5D6DA 3IDNA 3IJHB 3IDJB 3P0VH 4KXZH 1FORH 2KQMA 4ZTPH 5C7XH 4J4PD 3B9KA 2QHRH 3QIWC 2Z31D 1F3DJ 3VWKB 3AGVA 3SDCB 4BKLB 5SWZD 3H8NA 4QRPA 3KYOB 5HVWA 1YJDH 5CJOH 4PJGA 4HUWA 4OF8A 4PG9A 1J1PL 3HC0B 1TTGA 3OGCA 4P2QB 5HYSB 5I66B 4W4OC 2ZPKH 1EEZB 1UXWA 3FO0H 2G5BA 3FB7B 1HHJB 3S36X 4LSTL 4AM0A 1AIFA 4JG1H 5GJTL 4ODUB 1NC2D 4XP9L 3HUJA 3N50A 4OLXH 3P77A 2QJDA 3O11A 1X5ZA 4J1UB 4XCYA 5JXAL 1PD6A 2ZOKA 4OJFL 4MAUL 3X3GL 1S9XB 4M48L 4A6YB 4HQQL 5DYOA 3SCMA 5BZDA 4P23C 4EUPA 4QWWD 5INCA 5C0ND 1CGUA 5FM5O 1AQDB 1ACYH 1MCFA 3ULVD 3B2VH 3ULUL 5L7XL 5BO1H 1BQHB 5IEHB 1WF5A 5IGXL 5LKNA 3QI9B 2NZIA 5T1DH 2X4SB 3KPSB 5GGUA 4GLRI 1IC1A 4ZG1A 1DLHA 1WV7T 2FO4B 3RRQA 1NH6A 4XTRD 3AVEA 4TYUA 2VLKE 3QQ9C 2MKLC 3V4VH 3D0LA 4JFZH 1KLUA 1A6UH 1T7ZA 3C8HA 3VRJA 1H3XA 4YO0B 4Z18A 4PUBL 4RMWA 5I1LB 3IB4A 4X5WA 1J8HD 3TO4A 4NO2B 4F7CB 2FJHA 5SX4H 2FJGA 2OK0L 4NNXA 4Y1AE 3T0ED 1JFQH 1LO4H 1NMAH 3MRBB 4JO3L 2WLYA 2R4RH 5E5UB 1S5HA 3WUZA 4KROC 3RBGA 5IFAH 1S9VA 1CD1B 4CW1A 2XI9A 2DQGH 2V7HB 3VWJB 5T1LD 1DQJB 2HRPH 4FN0A 3VRIB 3QIWA 5I8KL 3P0YL 4QCIA 3GBLA 4NWUL 2NY6C 2AJ3A 2EXYC 2DQIH 3MRCB 2UWEA 1KJ2A 3BH9B 2P7TB 4TPRL 5DSCA 2FR4A 4L3EE 5D7JB 5JHDE 1TVBB 1JMZA 2X89A 1FYHB 3QDMD 5ITBH 4FG6C 4NPYA 1SQ2N 3G6AB 4XNQB 1NFKA 1HDMA 1IM9B 4L4TD 5DJZB 4DKFH 4OLZH 5BOPA 1BBDL 4JFFE 1YEIL 3KG5A 2BC4B 4YAQB 1FFNB 2Q7YB 5L2JA 4L5FL 5I1JH 5K9QG 4MNHA 1XH3B 4P4KC 5KG9A 1FIEA 1MRCL 3ARBA 1U92A 5I0DA 4BUHA 1HQRA 3FFCD 1U93A 1IKFL 5F7DA 3DURA 3MJ8B 5IM7A 4HIIA 4ZFOL 3RNQA 4KKNA 1FL5A 1MCBA 4Z7WE 4ZODA 2Q8BH 4PJXA 5M94B 4DFIA 2IQAB 4PJ5B 4RGNE 5D72L 3S4SA 3GMNB 4JGUA 3B2VL 5E08H 1CXKA 4DK3A 4DZBB 4WFGE 2OP4L 2Z31A 1CQYA 1A7QH 3DTXA 1KJVB 5DJXA 4ELME 2H9GA 5TQ2L 3SKNB 1SHMA 3EYOA 1FGNH 4APQA 1Q9WA 3TIDA 5KAQG 4X0KB 4HIXL 4DK6A 1C08B 4X6CE 2VQ1B 3SDAA 3L3HB 1C7SA 3B8YA 2Z8SA 3KPLB 3FQXB 5K9KB 3UO1L 1CICC 1T4KA 1WICA 2VLRB 3DMMB 3U2SA 2JLLA 5LXGL 1D5BB 1MCIA 1EZVX 4HWUA 4KHTH 5BVPL 2MHAB 4U3CA 3WFHA 5KANI 4JB9L 4YBHA 3T4AA 5DD1L 3MV7E 3BKCL 3MBXL 3WN5C 4L1DA 2IANB 1WGOA 4S1QH 2XPGA 1DVFA 1LP9E 4WTZA 4NRZA 4PY8I 3KYKH 2ADGA 1NMBL 1KTDB 4ODSH 2IBBA 4NQXB 1H15A 3D25B 1YYLH 2RB8A 2RGSA 4NRYB 4GRWE 5FCUL 4G5ZL 4PLKC 1C12A 2BVQB 1QFWI 1YN6A 1JI2A 2G2RB 3EYQD 2FEDD 3KYNB 5CZXC 3H2WA 1WZ1H 3F7VA 1NDGB 1BD2A 3R1GL 2HYMA 3GKWH 4YK4C 2QQNH 4PRNA 4OZIA 3IVKA 1NGYA 5ICZA 3VFPB 4JFHE 3C6LB 1IAIH 1WBXB 5ENWB 1M05B 1CXHA 3QWOA 3QULB 1CDHA 1FN4A 1ND0B 4RFNC 1CGWA 3VXTA 4FTVA 4DCQB 4WFHD 4ZNEE 4HGWA 1BQLH 3IFNL 1R5IA 2MJWA 4D0DA 1P4IH 3ILPB 1FDLH 2DQDH 4PJEA 3HMXA 1Z0MA 4GW5B 1U58A 2X44D 3EDKA 4BM7A 5ESQA 2IH1B 1MY5A 2UZIL 1VDGA 2R69L 5DC9B 2VDNL 4AL8H 5CZKA 5L88L 3VFSA 4N1CA 3PV6B 5JXED 4Z7QE 3M8OH 2X4PA 2NY4D 2BHUA 3MJ7A 5EU6A 3DSFL 3O8XA 2J5LB 1TTUA 2YZ1A 5HPMA 5KSVB 3U0PA 1YMMB 5D1XD 5D2NA 3S34H 4C56B 4YDVB 3LN5B 4P5TD 1GVIA 4EEEA 3RJQB 1OP3K 1OTSD 3OKEB 3WIIL 1GIGH 2DKSA 3JWOH 4OFIA 3QDGA 1T03H 1JIBA 3L3GB 5DQJA 2BSTB 1S7TA 4HS8H 1F90L 1XGRA 3MUZ1 1YYLL 2V9TA 1GJIA 3SKOA 1ZEAH 3SE8H 1OAQH 4WW2F 1JPSH 3TZVB 2B4CH 5BS0B 5F7FA 2OJEA 4R4BB 2I9TA 2BSSA 3OHXB 4MAUH 3X3GH 4NNPH 4OM1L 1F11A 4FQHB 3FOMA 4XAKD 2HFGL 5FKAB 1QBBA 1FL6B 2OBGA 4U1SA 5MEOB 2AJYH 5DWUH 5LXGH 1Q8MA 2EH8H 4AIZB 4DTGL 4MLSA 1CF8L 4QOKE 2C4XA 3MA7B 1HXYB 3OAZK 3MLPA 3TCLA 3QIBA 4L8DA 4UTBH 3OKDB 3BGFC 3QEHB 5H37G 2V2WB 2XZAH 5DJ6A 2IALB 3RWDB 4PP2A 4GLRH 1ZS8A 4R96A 3UBXG 1KPRA 3O81A 3IXTB 3ZDZF 3GSWB 5D72H 2IJ0C 2HJKB 3HR6A 1RULH 2NLJB 4QHUA 5L6YH 3T3MF 5C0BE 5HI4D 1LNUB 4QHLB 2JELL 4RBPH 3VGAB 3QHFH 4BQBA 4FABL 1U41A 4BSJA 2GSIA 3QG7L 4YH6A 3K2UL 2CGRL 4YGVA 5CSZA 1I1FA 1LK3L 5D2NC 1IKFH 4S1SL 1QD0A 4PRDB 5EC1A 3VDCA 5LVEA 2GJJA 3WLBB 1BFVL 3WNKA 5F88B 1YEEL 3VI3F 2OTWB 3CU1A 1ZOXA 2DYPA 1E4KA 3A6CL 2CSPA 3WSQH 4I48A 2C4FT 2PYEA 4I77L 1JZ3A 1FQ9C 1MREL 5CWSB 1HHKA 3CSBA 1XR9A 1T1ZA 4P46B 1LHZA 4MXQD 3IDYC 1OSPH 4ELMB 1I7RB 3P0GB 4D9RD 3FB6B 1QFHA 1PZ5A 4XPHL 2YMXL 5GQBA 3WYRA 5ALCL 4QNPF 3JVGC 4WEBH 1CN4A 1UJ3B 5TDPB 2NCMA 5ANMB 3WD5H 5GGRB 2VYRE 4AG4H 4MD4B 5MENB 4JFYA 1PQZB 1RIUL 2BXYA 4YR6A 4LRIA 2Y4SA 1YMHA 4L4VD 1U6AH 3CFEB 1R3LB 2P1YA 3MLSH 3DXAD 3VWJD 4PRBB 3L7FB 4G8GE 1G9MH 5HHPB 3FO1A 1NC4A 3QIBC 1SM3H 1LQSR 4WNQA 2M26A 1NAMA 3EOAA 3RTQD 3C09C 5FA4A 1RUAL 1MLBB 1P9MA 3HG1A 4K94C 3D87B 3BD4A 1LDSA 3HNTL 4Y19B 1DUYA 4PY7A 3LRHA 5TF1L 4WV1A 1T21A 5GS1A 3UROR 2XWTA 1ZGLA 5DRWB 1PX4A 5IBUB 4AENA 2R4SL 4DAGH 1KPUA 2APTA 2EXWD 5CINL 3UO1H 2WUCL 3D3VA 1U95B 3OWEA 5DK0A 2W9DL 2VXSL 2ZWLT 2C4FU 3OX8B 5SV3A 2AJVH 1IJ9A 4MAYB 3S98A 4FQIL 2I60L 4YHPA 4HX1A 1NUNB 4PJDF 4Z7QF 1D3CA 3BPLC 4LCYA 5FO8B 1QRND 2FGZA 4JHBA 5H94B 3OSKA 2NY1D 3OJDB 3P4NB 1JWUA 1NC2B 5B3NA 4NQCE 5IB2A 3HAEB 1QLFB 2PO6D 2VZ1A 3PWJB 3OZ9L 1I8MB 5IQ9B 2IWGA 2ITDB 5D7JD 4BA8A 1X9QA 1M1SA 1NCBH 3SE4C 4MJ2A 1JTOA 1K5NB 3PNWB 2A6KB 2CKBL 2ZPKL 4IRJC 4OIIH 4HCRH 3VXSB 2AXFB 1M6OA 2JCCB 4AEHH 5MENE 3SKMB 4NUGH 3B3IA 3O4LE 4HWEH 2NR6D 4YDIH 5CD5C 3BD3A 3A6CH 4M4RA 4UAOB 1JTTA 2GSGB 4JHAH 1X44A 3MRKB 4H5SA 1A7BA 3KVQA 1JE6A 4X7SL 1A1OA 3E2HB 4K2UH 1PEWA 3F12B 1KIUA 5HDBE 1NL0H 4OAWA 5I17A 3WS3A 1E4WL 3KYAA 1MVFA 4ESKA 4ONOA 4QHMA 5FYKD 4U1JA 4FQXC 1M71A 1YMME 2VLLA 5E4IA 4CMHB 4IEFB 5D5ME 4YDKL 3OXRA 2EDJA 4M1DL 4ZAKB 1XR8A 3V79C 1W0VB 2E7BA 4Q2ZB 4NIKB 5EO9B 3ARGC 1RURL 3LS4L 1UWGH 1J11A 3VFVA 3VDAA 1QRKA 4OZ4A 3L3IB 1NCWL 1QSFE 3JTSB 1GGCH 4OJFH 5C86A 4S2SA 4RZCA 3BQUD 4G8GA 1P6FA 1XGPA 4TNVK 2EYTB 3EO1A 3AAZA 4HS3B 3ES6A 4OQ1A 4JZNB 2LTQB 3CDCA 1KFAL 4PV9A 5AAMA 1DDHB 4HJ0C 2QQQA 2AABH 4YQXL 3QR2A 3ZSSA 3ARRA 5DQ9B 3MLTB 2O61A 3VG9C 1T7YA 5D1ZA 2RFXB 1VENA 4E0RB 1HYSD 5J6GB 4X4YA 2J6EL 3CCHB 3TFKC 3ARUA 5HDBF 1JYNA 5SWZB 2IF7A 1OAKH 4NM8L 4HGMA 3WFEH 1XGUA 4HXAH 4KU1A 3MRIB 4WRLA 1EO5A 2P5WE 1I3RA 3UPAA 3VH8A 2D0HA 5GRUH 2H32B 3I02A 5F8QC 5A43C 1UCBL 1F90H 2A2QT 3H0TA 3C8KA 4M4PA 1S78D 4WI5A 3D3VD 3QUZB 4GRWH 3IT8D 4MNQB 1UEMA 3CK0L 4MQXC 2I24N 1NBYA 2BY2A 4XNUH 4NKMB 1RIVH 3KS0J 2Q87A 4YXLL 4PGCA 4O02L 1C5CL 1K85A 5IKCB 1AGBB 3ZHKA 2FWOA 4LQ1A 4PJ9D 4QOKA 3PWVB 4HS6A 4OTXL 4LSUL 4S1DD 1OAXH 1A47A 5F9WC 2DM3A 2XOTA 1EJOH 5GS0C 2R0ZH 7FABH 4XMKL 3WXWL 3PHSA 2UZYB 1XF2B 2VE6B 4J2XA 1BZ7B 5J3HC 3TNMA 1T1WB 3MZTA 3WLWC 2CUHA 5C08E 4TUJB 1PKQB 4QRPB 4HLZG 3MUHL 1NKOA 2BNQE 1BM3L 3IFNH 3NGBB 5JLZB 4YDLB 1FZJA 1GZQA 4PRPE 4H1LA 1R3HA 1IZJA 3NN8B 4KQ3H 4LASH 5FAAA 3FO9A 1TZIA 3GSQB 3CFJA 1K3ZA 4KY1L 2YD2A 3PP4L 4XVUC 5IB3A 2VDRH 4LSRL 4O2EA 5KVMC 1LP9A 1TQBC 1XF4A 5T1KD 5KN5A 1NCCH 2J5LC 1L0QA 5ISZA 5ADPL 2OTUB 3VW3L 25C8L 4L4VB 4DQOH 5DYOB 2ILLA 3RKDD 4H26A 1FSKC 3WIFB 2D2OA 4J6RH 1FG2B 3BPCB 3RIAK 4J3XA 2DRUA 2EE6A 4NP4L 3QXVA 2NX5D 2BDNL 2WP3T 4R2GD 2DLEA 3R8QA 3EJZC 3QB7C 4M6NL 4XP4H 4ODHH 1T0NB 5BQ7A 3KDMA 1UVQA 1WISA 3H9SD 1DLHB 1T04A 4KRPD 3WS6C 5ICYA 1HQ4B 4Y2DC 1TZGH 4HKJA 3JV4A 3LY6A 25C8H 2V9QA 1LEGB 5CP3H 3K0WA 1U8KA 3MX0A 3GSXB 4LVHC 3E6HA 4R97C 3D48R 3L5IA 1OOAA 1LP9F 2XTLA 4M3KB 2JJSA 2EZ0C 4E41E 2FJGB 2X1QA 5TE4L 5HHOB 3BPOC 4NWTL 1I9EA 4HUUB 1XCQA 4Q6YA 4NHUB 1QEWA 4P4RB 4PB9H 4XXDB 5JNYA 1KEGH 4S1QL 4LLMA 3IFPB 3MRHB 4JO1L 5AZ2H 4R26L 3DO3A 3IXAB 3KR3H 4V1DD 1TZGL 5JMOC 5HI5D 2V9RA 3MV01 4HUWB 2D03H 3G5YA 1P7QD 1WCBA 5FKPB 5SX4I 1U8MB 3INUL 3MUJA 4S1DC 1AKJB 4MD5B 2C26A 4AT6B 3D18B 3N85H 5F9DC 3U7WL 4ZO9A 5J6HB 4LNRA 4JDTH 4R6UA 1FIGL 1TVBA 1JPGB 1KCRH 4P9HL 3QPXH 3KPMB 1OGAB 4XMKH 1C5BH 1H0DA 5DGQA 4RGOH 2WINB 1QFWM 1PY4A 2GUOA 4HQQH 4CVZA 2ADIA 3RZCC 3O3DB 1A6TA 3K81A 1FIGH 1SEQH 3AU1B 3NPSC 5INCB 2W65B 2ICWI 3PDDA 3KWWB 3MR9A 3EAKA 4G7YH 2X1PA 5JIPA 4ZUUA 5BRZB 3JXAA 4WHTA 1QFUH 5F7YC 3F58L 2FO4A 1OP3H 1A0QL 5CD3B 2EECA 4QXUL 1G9NL 3U4BL 4FP8L 2AJUL 4NRXA 4O51B 3P40A 2ARJA 4TVPH 2E7MA 2HMIC 3SGJA 2X4UA 3HC4H 4GRMA 4MA1C 3RNQB 4Y5XB 4U6VH 3QO1A 1MLCB 4JGMA 5EFIB 5CHNB 2PYFB 2EEDA 2E6JA 2BFVH 2C3WA 5EU3A 4PS4H 4QRTB 5CMAA 3S4SB 3BT2L 2L7JA 1IE5A 1V7NH 4PRIE 3QDJD 4CGTA 1KCRL 2IMNA 1T3FB 4XBEH 5B4MC 1A64A 3VXMA 3EBAA 3L5XL 3MV8A 3V5KA 1FJ1B 1KB5H 4UT9L 2V17L 2W9EL 1Z5LB 2P7TA 4GUPA 4JO2L 3HE6B 1ETZA 3ULUD 5E2UH 4KK6C 4GW1A 4WWID 3GBML 4XWOC 2D4FA 3HG1D 4CJ0A 3DX9A 1QYGH 2J12B 5IBTL 1F4YL 3RTQA 4A2LA 2FX9H 3WHXB 3VXQA 5A2KH 4M6ML 1WTGT 3L6FB 1NEZB 4MA3B 4OLWH 4PLJD 3BP6B 2EYSA 3GSNA 3HRZB 4M7LL 1B4RA 1MCDA 1AP2A 1EUTA 4PJXF 1MJUL 1DANT 1KT2B 1RY7B 3ZKSD 1K6QH 2HKFH 4IIQB 3D25A 3QO0B 1W72B 4LLAA 1MCEA 4TUOB 4DGIL 4OF6A 4FXLA 2YPKA 4UB0L 3ZYZA 1BVLA 2ZKHH 5GIRA 5HYJD 2Z31C 3HUJF 2P42B 3LIZL 2ICEA 1U3HA 1RPQA 3LKPA 1FL5B 2XIDA 5ETUB 1ZVSB 5I8CB 3GB7A 3DUUB 1EA9C 5E6YA 1OCWL 2JJUA 4Y2DD 4R2GB 2YD9A 4L9LA 4MCZA 1RZKC 4DZBA 1UZ8B 5DO2D 3TYFB 4YDJB 3QZWA 2C7UB 5ESVA 5IFAL 4WJ5B 2VC2H 1UGNA 5ENWA 4XP9H 5E9DD 4X0KA 3ULVH 2ZJSH 5ADOL 2XQBH 3ORJA 4CVWA 3O2DL 1J9CT 2WBJD 1CGYA 1T4KB 3QA3A 5HHNB 1JV5B 1T5WA 2ITCA 1BMGA 2FLBT 3KPQA 5DFTA 2Y23A 3QFJD 4PREA 3IDYB 5EU7C 4KGLA 3SHSA 3NA4A 3BE1L 2KL6A 3RU8H 3IS0X 2DBLL 2F5BL 3Q3GB 3TT1H 4BSVA 5DDHA 4APQD 2ZG2A 4R8WL 5IGXH 5DLML 4LSPH 2Y7QA 2MKWA 4KUCF 2FLRT 2X4RA 2RCSL 2WQRA 1QKZH 2F58H 4L4TE 2DI9A 1VFOA 2YN5A 4NUGL 4WW2B 1AR1C 4NDMA 2YOCA 4P2OB 4IRSA 3IDIB 2FJFA 2J1KA 2I07A 3A67L 4NC1C 4ZXBB 4OZHE 3L1OL 4CMHC 3MCG1 3BFOA 5J3HD 4PRIA 2NY7L 5CEXB 2KUTA 4ODXA 1GGBL 2R0LL 1UKQA 3DXAB 2VAAA 1RZ7H 3GMRA 3JUZA 2ZUWA 5GSRA 4OZFG 2EDTA 3MLUL 1U8OB 3AS2A 3GMQB 1ZT7A 2GTWA 4N0FA 2ARWA 2DWDA 4X98A 3M17A 4ZXBC 4I9WD 1P2CA 4EQ2A 3GO1H 4KRMB 1KB5A 5F6IB 4MVBC 5GRZA 5KSBF 5F1OB 5E2VH 4U0RB 4ZFFA 1BFOB 3LH2H 3MRDA 1JRHL 4G43B 3W11D 1GCFA 2P8PB 4OI7A 1C1EL 1GZPB 1N3NB 5K9OB 3MNZB 5FM8A 3AC0A 4C59B 1VADB 4HFUL 1UXSA 4M6AA 4P5TA 3CZFB 4MX7B 3UTZB 3IDXL 3QIWD 1XZ0B 2YZ8A 4BYHA 5DUML 4Y5YB 4AIZA 3BDBA 4LSSH 5DFVD 3UAJD 1IAIL 3SDXB 3KJ4B 3ARYA 5KW9L 2BCKA 3HPLA 3FN3A 4GRWF 1U8QB 4LEXL 5IUSA 4XVSL 2WIIA 4L4TB 1QFWL 5EU6B 3MCLH 1TNNA 1UYWH 1ZS8B 1EK3A 4XZUB 3O45A 1NUGA 4UNTA 2HH0H 3BQUC 1FC1A 4M7ZC 4YC2C 4YHYB 4WI2A 5D2NB 1P53A 2DLIA 5DJYB 5EDXA 3LN5A 5E7FA 1T2JA 5DEFB 1DBAL 2PTTB 4WDIB 1CICB 2C1OA 1I3VA 4I18B 4DQOL 2GSIB 3UJIH 3AXLA 4JCLA 4N5UA 1RHHB 3H7LA 4PRDA 2L0DA 2VABB 2KQNA 3WMSA 1I9RH 3HS0A 3WDIA 4KMTH 4FQQA 4LLWB 4P46C 2HWZL 3HC4L 3G04A 4S10A 1V3MA 3FAWA 3T0EB 1S9KC 2ADFL 2P8MA 4U6YA 4XBGB 5C2BH 3EO9L 4P3DB 3TZVA 4JFHD 4GS7C 4J3OC 5I75B 5JZ7D 4NJ9L 4QRRD 5KSBA 5CUSL 3O3UN 3NFSL 5HHQB 5EBMB 8FABB 4Y4KD 5DMGD 4Q9QH 4PTTB 4GAFB 4C58B 5CEZE 4KTEH 2QKIA 4Z6AT 3QFDB 4HXBH 2Y06L 2R2BB 3CU7A 1G9ML 3SKJL 4P0DA 1P7KA 2RR3A 5IB4A 2P5EB 4MJ5A 1DVFC 3RA7L 3FT4B 1F02I 5EG6C 5I1HH 3AMLA 5E9DB 3X12B 4OCYH 5D1XB 2VZ3A 3VD9A 3VH8G 2RQ8A 2QR0A 2UYLA 4O2CB 5F1NB 5F97E 3HA0A 3R06B 2Q6WA 5BV7H 5HGBB 5IFHL 1FBIL 5MHSD 3MYJA 2DWEA 3O3AB 3FO1B 3QXWA 3BIAX 2NLJA 3I6KA 3OPZL 3S34L 3CK0H 1N0XL 1P7QB 4C55A 3T77A 3FO0L 3KPRD 4NNPL 4OM1H 5EBLB 4M3JA 5CGYD 3BQUA 4G8GD 4MXWL 1IGIL 4UINH 1YNLL 1MNUL 2CIKA 4MHHG 2WV3A 1MIMH 3O4LA 4P9MH 3L95B 5CEYA 2BOBA 2XN9D 2F8OA 3O4OB 4Y8DC 3MA9L 4G9FE 3EDEA 3GMOB 2GHWB 1E27B 1ZLVH 2FL5A 2GI7A 4M5YL 4RRPA 2DBLH 5ACMA 3EJYC 3FONB 4Z7WF 3FO2B 3OTTA 5GISH 5HHME 2CLRB 3SN6N 5MI0C 4JFPA 4P5KA 3O0RH 4HX1B 1S7UB 3O4OC 2DMBA 3ARFD 2YD3A 5TPWL 1ZLSH 3TA3A 4JPIB 4YDLC 3NOIA 2IPKB 3GHBH 3P4NA 4NO0B 5E4EC 2YC1A 3WIHA 3GNMH 1IC5H 2XXCB 3RDTD 1EO8H 4EUPB 2FEDC 5MENA 1F3JB 1NLBH 4YR6B 5D7LD 3TBVA 4LPTA 3RUGB 2A6IA 4O9HL 1ZLVK 5CILH 5GRYA 1T7WA 3QI9A 4YUEH 1KJMB 2V2XB 5B8CC 1M6OB 2JCCA 4UZGA 3FOLB 1RZFH 1YUHA 1KLUB 4WNQB 1NAMB 1SJEB 4HEME 1ZAGA 4RAHA 2AGJL 3BSZH 3VXNB 4JHWL 5EU5B 2VXTL 5DR5L 3IDNB 3IDJA 3VD7A 2E27L 5FCSH 5CIPA 1J5OH 3O6FC 3DUHA 3V4UL 3MRBA 3VXSE 1U9KA 4J12A 4M62L 5B8CB 5LJYH 2JELH 4BKLA 2A1WL 3O6KL 2JK5B 3V0WL 3ULUH 5HSFA 3PE9A 4ODWA 4A6YH 4P2QA 3RI5K 1XR8B 3HMXL 1R5VA 3P30H 3DMMD 3H9ZA 1S7QA 2J4WH 4H1LG 4OBSA 1AD9B 2I27N 3VFTB 1N5YL 4BH7A 3PHOB 1N0XH 1WIOA 5D5MB 1MCRA 5HYFA 3PQYE 4U1MA 3EYFB 4NKQB 5IB5A 1JNHB 4LP5A 1WTLA 5I1IL 4K7PH 5KJRH 4MSWA 1IGYB 3DVIA 5C0AD 3OKMA 1N5YH 1N4XH 3U30B 2PR4L 4PJ5D 1DDHA 4PV8A 4LRNL 2ZUQC 1J12A 5EZOH 4RMSA 1DL7H 4ZO7A 3KJ4C 1ZWIB 4RGOL 1F5WA 4ODSL 5D1ZB 1KJ2H 2FGWL 4QRSA 1VACB 4JDTL 4OFYD 4OCNC 1U93B 1KN4L 3SCMD 1FVDB 4D9LH 1KGCD 4NZUL 4FQ2H 5F7DB 2H26A 4PJ9A 1IBGH 3B6SB 1J0KA 4NN7C 3BKJL 4AMKH 1WEJH 1DBKH 1P4IL 3WO4B 2AABL 3F12A 3TJHD 1G7HA 3QIUA 1FV1B 1AGFA 2O5ZH 2J88L 3L7EB 4LSQL 4DGYL 5I1CL 4HIEB 1TLKA 1FBIH 3ZO0A 2V7HA 5AYQA 3ZE2E 2YN3A 5GHWL 3MFFB 4Z77B 3G5VA 2YBRB 3VRIA 1YZZA 4YUEL 1AGBA 1GGTA 3B9KB 2H2SD 4LARL 1NFDB 4ZAKA 3WE6A 4EXKA 3IDMB 1W0VA 1YECL 3VWKA 1KJ2B 3UJIL 2AERT 4NC1E 4RAUA 1IFHL 4YHIB 4HUXB 2YK1L 3DMMA 3GI8H 4PG9B 4V2BA 1I1RA 5FYJU 4XNQA 5HHVH 1P5UA 3X13B 2AEQH 5DF0A 1JGDB 3MBEB 4KJQD 4XNXH 5MP6H 3ES6B 1RVFH 4BK5A 3O0RL 1WITA 2QQLL 4DGIH 1WWBX 3ARGD 3JVGA 1A02N 1K6QL 1TDQA 1M7IB 3EDFA 1HEZB 1N7ML 4OUUB 4R26H 5T3ZE 3O11B 4J1UA 1KPVB 2ZOKB 2P49B 5DQ9A 2HRPL 3BZ4B 4I3SH 4HJGB 1LEIB 3SGKC 4NZJA 2BVEA 1U92B 3WSQL 5FK9B 1LDPL 5KVFL 1VSCA 4QHNB 4OD1H 3U9PL 3THMH 1A7PL 1KOAA 2XN9B 2VH5H 4OFYA 2IQ9L 1AE6H 4YHMH 3RHWF 5CFHA 4PRPD 4RSVA 4DGVH 3VDBA 3LHPL 4JFDB 2B2XL 2W1NA 4NQTA 3RZCD 1NAMH 3KPSA 1BECA 1KULA 3VXPB 2ESVB 1DN0A 3CDGA 4JFXB 5HHMD 4PJ5A 3QHFL 4U33A 2PW2A 4XVTH 5TDOA 1QBML 4B41A 4GSDH 3RDTA 1IEBA 1YQVH 4BZ2H 4CN1A 4PRNB 1I8KA 4KZDH 3DTXB 1B90A 1NGYB 2AV7A 3KAAA 3BAEL 4HPYL 1AFVH 4KHXL 4NNXB 2F54A 4CNIA 4LVHB 4FQPA 1MCWW 4LEXH 2J8HA 5FCUH 2R39A 2FWOB 1NCAL 2B7DT 3E6FA 3CSYB 4QY8B 3KPLA 3ARQA 4EN3D 2QADC 4DUXA 1G6RA 1W8NA 4AYFA 4FTVB 5TE6H 4DCQA 1T0MB 2XRAH 4FQJH 3QUZD 1L6XA 1B6DA 3DSNA 4HPOL 3F6LA 3P73B 4UIMB 2IADA 4XVJH 4YIQA 2GKIA 2AEIT 1LE5A 3RVTC 3PL6A 4JRXA 3TNMB 5HGAB 3SDCD 4XXDA 1QSED 1UA6L 3VXOA 4LLMB 1H3WM 4PJ7E 2XPGB 4UBDC 3W0WD 4ZO8A 3S88L 4NPYB 1HDMB 1HNFA 3F7RA 3JTTB 3AS1A 1I1AC 4HPOH 4H1LB 4ZPTB 3TCXA 3VGHA 5I1AB 1WCBB 5DA0B 3EYUL 4N0CC 4WHDA 4LHUG 2EXWC 2BY3A 1DQDH 3WL9A 4OZGF 4JCMA 4L8SC 5IG7A 1T2QL 2A1WH 3BZDA 1YN6B 5EZOL 1XIWC 1Q9OA 4JFEE 2H1PL 4MJIE 4WW2C 2NY0C 4MNHB 3SDYL 3RKDC 5I8EB 2X9YA 4MA8L 3OKYA 1A2YA 3CLFH 4Y2OA 1QZ1A 1NDGA 3S7GA 4G8FB 1DSFH 4YWGL 1DQQB 2WMPA 4JM2F 3VFPA 1U2CA 3MV7D 1CFTB 1AJ7H 1L4IA 3T65A 4FQJL 5FB8A 3R0NA 4UOW0 1IEHA 1U0QA 3DSFH 1J1PH 2YRLA 1OTTD 4OGXH 3RDTC 2IMMA 3QRGL 3M8OL 5ACZB 2R56H 1NGZB 5C6TH 2BNQD 2NZ9C 5I1JL 2P24B 5HYQA 4DJMA 3GUTB 2DIBA 4UDTA 4APQB 5CJ8A 2WWMC 1CTNA 2LQRA 3TT1L 2NXYD 2XACC 4GOSA 4HFWA 3LVEA 2V5YA 2RIKA 1FNLA 2DQDL 3AREB 1ZVHA 1QSZA 4MGXA 1UKTA 2WBJB 4B0MM 5GGVY 4L8CA 4XXCA 4ZOBA 2FIRT 5FYKH 2RBLA 4QLRA 5HHVL 3VFSB 5D7JC 2V2WA 3ROOB 3ABZA 5J8OA 1OHQA 3D85A 1A9BB 4R96B 1U2HA 3GSRA 3HE6A 5GSVB 4RAVA 3MRGB 4CVUA 4TSCL 5C8JB 4KTDL 1XMWA 3GSWA 4L3AA 5C3LD 4LFHD 4LDEB 3REWA 3EO0B 2DI7A 4FQ1L 4TOYL 2VDRL 3DUSB 3OKEA 5HGHB 4X8JA 5F21B 3QDGB 3TYGH 3TNNA 3HB3C 4G42B 4GRWB 2DM2A 1KF9B 4IOFD 1CFBA 4PR5B 1GC1H 2OJZL 5CSGA 1JF6A 5I9QC 3QQ3B 4I13B 5FUCE 3TFKD 4ZTOL 3BEVB 3ZHLA 2FATH 5FYLH 5LWYL 1FHGA 5HVFB 1FVCB 3N9GL 2CMRL 2GW5A 5CD3A 5ACLA 4PRHB 1QHOA 4OZIB 2PYEB 3ZDYF 4BZYA 4QTIH 5GS3A 1I7ZA 3QAZB 3C6LA 3ALPA 4AEFA 5GHWH 4CDHA 4I3RL 4DOHB 3QWOB 1PZ5B 4LBEB 1BAFL 3FQTB 3TPUB 1AY1H 2ZNWA 3JSSA 2YEZA 1MJ7L 1UZ6E 5FA3A 4XTRC 1IGCL 4HGWB 3FCTB 2CR6A 5ANMA 1MHHA 4E41D 5C09B 4WJ5A 1YMHB 5IFHH 2DQCL 3LQAH 1FP5A 5AUMB 3OKOA 2PW1A 1QBLH 4GBXA 2X4TB 4G6AC 3RWGA 5ESQB 5EOTA 3UJJL 1NC4B 3RIFK 3WKMH 3TN0D 3KPQB 2VIRB 4PREB 4Y2DB 3Q6FA 3WFEL 4QHLA 4K8RH 2B1AH 1R3KB 3BUTA 5FA4B 3GRWL 4HPYH 4J3WA 5BW7C 1NEZA 4ZD3H 1DUYB 1KG0B 3RGVA 1I1FB 3VXRE 1D5MB 3RL2A 4CN6A 5AG8A 5AAWA 2YD8A 5TFSL 1A9EA 4JGJA 5D7IE 3WHE1 4PBWD 3VGFA 4XVSH 4X7CC 4GJTB 2AGJH 3BJLA 3O2WH 1V3LA 5C2BL 2E9JA 2DDQL 3V5HB 1VERA 2A9NL 3O8XD 3BKYL 2NNAA 1T1ZB 4C4KT 1G0YR 1UZ6F 3HZYA 1INEL 4ZNCD 2VISB 2Z9TA 4N0RA 3TBTA 3G5XB 3SKOB 1XGQA 4JQIL 4CN4A 4F15C 1H3PL 4U1GB 3F7QA 5FO8A 2JJVA 1KGCE 2FX9L 2GTWB 4N0FB 5FYLE 4KKCD 3GIVB 3M17B 4NBYB 1BJ1J 5E8PA 5I6XC 3GKWL 3HAEA 3LMJL 1G7LA 3ZYOA 2D31A 4LPUA 4OI9A 4XP4L 3HE6D 1BX2B 1I9IH 5HHMB 2A6KA 1RV6X 1RZFL 3ZLQC 1I1AB 3O3EA 5DJAA 2P8PA 1BBJB 4UUJA 3DGCR 5K93A 4J8RB 3U4EA 4N8VA 3QA3B 4LDLB 4XPBH 2FHFA 5C70A 2F8VA 3P9LA 4ORGA 4K3DH 2D7PA 4NC0B 1BOYA 3RWDA 4GRLC 4HIJB 3S37L 3LB6D 4JKLA 4WV1B 1IILE 2BZDA 1TZHA 1T66D 2X10A 4KROB 4TRPL 4ZFZA 2ZUVA 1IGCH 1U95A 1BZQK 2BXZA 4HJJL 3A67H 1DANU 5H2BB 4ZXBA 4BJLA 4JANB 4Z7WA 4YGVB 4M6OL 3SY0A 3EOBB 3OF6D 5EC1B 4APQC 4L4VE 3BP4B 4H20L 5FGCB 2DKMA 1D6EB 4QRUA 3KLSA 1CS6A 1CICA 1OAXL 2PUQT 4F2MB 2EO1A 2CMRH 4ENED 2P45B 5CWSA 3RVXD 3V4PL 1SBSH 3CIQA 2JTDA 2ITDA 5JXEC 4MQTB 3H9HB 3HB3D 1RZIB 1ORQA 3QCUL 1F4XH 4ETYA 3IAPA 4XP1H 1ORSA 4HIHA 2ICES 4RNRA 1F97A 43C9A 4NUJA 4LSDA 2NY7H 5DO2C 1N3NA 5K9OA 4Z7NE 5F6IC 2KZ1B 1MQKL 4K8RC 5J6GA 4X4YB 3MNWB 5DEZA 2IGFH 3TJHC 1CGVA 1F00I 2HT2D 2GIYA 2AV1B 3LV3A 3V6OE 4RMVA 3MRKA 3D6GA 1E28B 2CUIA 3STZB 2XZQL 1QRNE 4EBQL 4XGZA 2NTSP 3W11C 3K8KA 3KPTA 2QKIB 4MNQA 1EXUB 2BNQA 4EUPG 2CXGA 3GSVB 4F3FA 3V0AC 4OZGE 4KRPB 4I9WE 4YQXH 1OVZA 4P4KD 3T09A 1X5LA 2F9BT 3O6ML 4PY7B 4K23L 2YSSA 5B39G 5MEPA 1G7IA 2EC9U 3HLAB 3JV0A 4OKDA 5IVZA 4Q2ZA 3LKRB 2XNAB 1NCTA 1OLZA 3R06A 2DQUH 4F7TA 2YPLE 2DQIL 2HT2C 3O3AA 1TJIL 1FVEB 2EDHA 5HYSA 5I66A 5DK0B 3WO4C 1UWGL 5IW3A 4OFKA 1MHCB 3X14B 1UACH 2E6QA 4UDUB 5T1LB 2OMNA 1U3HC 1K2DB 3L3DB 4OSUL 5LBSH 2C3VA 1NFDE 2CIKB 4OQTL 4PJ8C 1BF2A 2ENSA 1AR1D 2OLDA 5ID0B 4EI6B 4JZOB 3MLTA 1E27A 4A6YA 3OKLA 4NHCH 4EQ3A 3PWJA 4GXVH 3CFJB 4KI5D 2ZUXA 4PJFB 4OQTA 5FO9B 1C1EH 2QQKH 5SWSD 5HYSG 1FFPA 4LHJB 3PNWA 4KUZL 5D96C 3I85A 4ISVB 4ZUTB 1G1CA 5FHAL 2HMID 8FABA 2VWEE 1MPAL 3NZ8A 5L7XH 1GGCL 2XQYG 3UTSD 5D2LE 1GSMA 1NGQL 4JO4H 3QXUA 1UT9A 4UMGA 4MD0B 5T3ZH 5EIIB 3GM8A 1TPXB 4HC1H 4X5WB 3FT3A 4DKEL 4YEFA 1T89A 3FT4A 4P4KA 4OLXL 4XNMA 5FYJL 1DLFH 3TWCH 3ARWA 1E0OB 1YEJL 2X4OB 3QUZC 5GJTH 2GK2A 1P69B 2E7HA 4FFWC 1C5CH 4WHCA 5D5MF 4IRSC 4QOKB 2HLAB 1CD1A 1OPGL 4XI5C 1P1ZA 1ZA3B 4ZD3L 1ZANH 1ZGLP 3MYJB 5E56A 1M71B 5DMKB 5JOPD 5HHXL 5F9AC 1FPTL 3VFUB 1ZK9A 5E24E 1H8OA 1P7QA 1LO2L 1NANI 1L9NA 3NCFB 1TETL 4NJAH 2R1WB 5C2UB 1T1WA 3W0WB 3O4LB 3NFNB 4P9HH 3T1WA 4HXBL 4TUJA 5F72S 3L95A 1OF2B 1U8NA 1V05A 5I30H 1RMFH 5DRXB 4RDQF 4YK4B 2JK5A 1Q0YH 1HILB 3F7PC 1F45A 5LWYH 2E9IA 4LLUB 4JKMA 3DIFA 4H0GA 3VXRA 3AAZB 4MD5A 4UNVA 4W81A 1DUZA 1JWMB 1GOGA 5L2JB 4WI4A 1EFXB 3HNVH 5FUCC 4WWKB 3KPMA 1F4XL 4FG6D 3TA3B 1FNEB 3BP5A 4I3RH 4XT1C 2A83A 5I73C 1N5AB 2Q7NA 3PV7A 3WFDH 4U1IA 3I6LD 4DEPC 3BZEA 4LVEA 3FRPA 3CCHA 3HAEG 4L8SB 4GQ9L 4S0TD 3EYQC 3C9NB 4D8PB 1FG2A 3BPCA 4CRPA 1RURH 4NO3A 1FZKB 5C08D 4ELMF 4F7PA 3OJMB 3ARXA 2HTLC 4ENEC 3VH8B 3EW3B 3KWWA 3KPOB 2UUDH 3H0TB 3U4AA 4YPGB 5K33A 4KTYA 2WUCH 3OAYH 5BQ7B 5IFJB 3BZFB 5C0AE 4ONGH 5AD0A 1U8IA 4JFFB 1TJHH 4PJ5E 3T0DA 2QSCH 2AKRB 4G9FD 2QTEA 1CLZH 4NKMA 1A4KA 3O9WB 3SE3A 3E6HB 5F7HA 1EHLH 4WO4C 1JGUH 1CL7H 2BOCA 2N7AA 2D7MA 4JDVB 2I9LA 4HUUA 3ZDYE 2YHGA 4P4RA 1D9KD 5CHNA 3TBYA 1WJ3A 1JPFB 2J2ZA 3JWDH 3GMLA 2R4RL 3NABH 1H3TA 1WT5C 3U82B 3QT2A 3G5VB 2DDQH 3ZE0E 3BPOB 2FBJH 3CFBA 5GZND 4M03A 1CFVL 1AKJA 1G7MA 4XC1H 3VXRD 1HKLL 2WQ8A 3P4MA 1U3HD 3L3OA 5DZOA 1UB6A 1ZE3C 2IANE 4Q9RH 5EZLA 5HDQL 3QG7H 4LNRB 3WD5L 1E4XL 2B39A 5GJSH 5C08B 3S96A 1PLGH 3GK8H 3TZVC 2HTKD 4UV7L 1BFSA 2GJZB 4F7EA 1DQLL 2LU3A 3C5ZD 4UQ2B 3CLFL 4U1HA 2GUOB 1CFNA 1C12B 4P57A 4NJAL 3BW9B 3MR9B 5FYLD 2EDWA 3GSNB 4LARH 1G0XA 3FTGB 5D8JL 3W9EB 1LK2A 2E7LA 3MROB 2NY1C 5DMIL 4QRSB 3MJ9H 5FGRA 1F4WH 5D1QB 2YPKB 3IVKB 4X6EA 5CIPH 3PABA 1PY9A 4MA8H 4RMTA 4FZ8L 1KBGH 4UV4H 3RBSA 2XA3A 3LKPB 3UTSA 3VG0L 2W0KA 4KZEL 5T3XE 3MGTB 4RWHA 3GB7B 5GRUL 3GJFK 2LU4A 3L7EA 1LEGA 3PGDB 3DGGB 3ZDZE 3CXDL 2HT4D 3LKOB 4WO4A 1WWCA 3MNVB 4NGHL 2XY2A 4P2CG 3O6KH 2P46B 3QJFB 2HVKA 3O6FD 4Z77A 3BRFA 5JIKA 4NYLB 3H9YA 2OP4H 1IGFH 2Y5EA 4HLZH 1S8DB 2CUMA 4NQUA 5KSAC 4J3UA 4EI5B 2WWMD 3ECBB 5ITFB 5IHZA 4RAUB 1JGLL 2YKLL 1QQDB 1VFMA 4PBVC 4JRXE 4WUUE 3ZTNL 4HMCA 2JB5L 2A0LD 4MXVE 1RJLB 3MJ9A 5C0CA 5JW4N 4JHZA 2HAZA 4OLVH 1I7TA 1MJ7H 4Y4KA 4KAQH 3HE7B 4MA3A 4WGVB 4HWBL 2AK4E 3ZE0F 1YJDL 5CJOL 4BSWB 1CDBA 2B4CL 3GI9L 2K1MA 4YFDB 5EN2B 4D0CB 4C54A 4I0CC 5TE4H 4HJGA 1LEIA 3CUPB 3DVGB 4IRSB 2AAVA 4TSBH 4WU7B 4CVZB 3ZE1F 2FH6A 5FGBA 3AU1A 5IG7B 2ZG1A 2F54D 2PXYC 3V4UH 1JYVA 5GIRB 3SDDC 3CGTA 5C0NC 3EJYD 2JJWA 4RGNB 1I3UA 4HUMB 1NAML 4NO5A 3ARZA 2IH3B 4AEEA 3SGEH 3BO8A 1P2CB 2HKHH 3TYGL 4NRXB 5FYJE 3ZE2F 2CDGB 1ZVYA 2PXYB 1UZ8A 3TYFA 1IT9L 4HWEL 1SVZA 5T1MB 2D7QA 4O2FA 2VN4A 4DW2H 4ZFFB 3RQ3A 4M9OA 4X80L 5MEOA 5EO0B 3BYYA 1KN2H 3BPNB 3FB8A 4KDWA 1Q0XH 4QY8A 1SBBA 3OV6A 4M5ZL 4ODHL 4GXUM 2YA2A 4KY1H 4G7VL 2P24A 5HYQB 5D1ZC 5HYJB 5EIVA 4L8DB 4EIGB 5EPMA 3MV8B 3GSUB 3U0WH 1YPZF 2DIJA 3CZFA 4OKVB 4HFWB 3RUGE 4JRXB 1Y6MR 1F8TL 4FQLH 5I6XB 5D7KE 2X9XA 1DEDA 3UTPD 1S7SB 4HKXA 4EN3A 4P23B 4L8CB 3TZVD 5MERA 2BX5A 3H42L 4ZPTA 4JM2D 2XZQH 1OT1A 1U8QA 4ZPVA 4HD9A 2HRLA 5CINH 1NC4D 3LKNB 3NCCB 3BOVA 3BMVA 3HRZA 5LG1A 4P2RD 5BV7C 2PXYD 1Q9OB 3NTCL 5KAQF 5C8JA 4HH9A 3IRZA 1LWRA 4X6DB 1I8IB 3QIBD 4G8FA 3QCUH 3QNZA 2UY7A 1WUNT 3MACH 1W0WA 5EBWB 4MMXC 2HWZH 4NQCD 2WWKT 4H8WH 3RFZC 3QXDA 4NN5C 1AQKL 4WI7A 1CCZA 1GOFA 3RHWK 5C0RH 1BFOA 3V7AE 2B0SH 3ZL4L 4BELD 2JJTC 4MJIA 2X42A 4XCNB 1X5FA 1Z9MA 3RWEB 2F5AH 3VE0B 2P8MB 4U6YB 4XBGA 4WTWA 3TGXA 3G5ZA 2PYED 1OTUC 1FORL 1PQZA 1D9KB 4GG6F 1LD9B 4LLQB 4O02H 4Z78B 1ITCA 1S9WA 2VLJB 4POZD 5DQDL 4XNUL 5EBMA 1OAZL 2SEBB 4NC2B 4XRCB 4QYOB 5ID1A 2BVPA 4PJHE 1TVDA 3CDFA 4DGVL 3TBSA 3ARPA 2OR9L 1MRCH 4U3HA 2A6JA 5JW5B 2LTQC 1A3RH 1HHHA 1P7KB 3E0GA 3SOBH 5IB4B 3Q3GA 2P5EA 4BSVB 4QTIL 2ED8A 4MJ6A 5E9DA 1YNKL 1NSNL 3B5HA 4Q0XL 1NANH 3QISA 5TQ0L 1VFUA 2ZUUA 2LABA 3KYMA 2WUBL 3BWUC 1QUNA 3B9AA 3D3VB 1RIUH 2W9LA 4NN7B 5MP6L 2FJFB 3DWTA 4KWUA 1Y0LB 5J1AA 3S97C 1RSFA 1AKJD 4PRIB 4KPHH 1NGPH 3AXLB 2VXUH 1T83A 5SV4A 2JJSC 5I74B 1OAUL 4PGJA 3FFDA 4IIQC 4LCYB 3UJTH 1RUML 5MI0B 4FQQB 5TH2A 3G04B 3UJJH 1H3PH 2JCCE 4HH8A 1INEH 5KVFH 3MRRB 1FYTB 3GNML 5E8EB 2BY0A 4I2XE 3V5HA 2DM4A 1VGKA 1ACZA 5DS8B 1I7ZB 3KNBA 4ZFOB 1I1YB 4LCIH 2VL5B 1BVKA 3PWPE 5FF6B 4ELKA 2P5WD 3K4DA 3X11A 5DZLA 1SY6L 1EGJL 1UG9A 5JORA 3LZFL 5J89A 4WFGD 3RUGA 1WAAA 3DROB 3EYSH 3MA9H 2NW3B 5D1XA 1DL7L 2QR0B 2UYLB 4Y5YA 5IJKA 5F7WC 3ILQD 4LRNH 1ZSDB 3O6FB 4YNYA 3OG6B 4WCYH 2HJFB 5EWIL 4YBQD 1CT8A 3ZDXE 2J8OA 5D70L 3V6ZB 3HPLB 4PJHF 1BP3B 4ZSOA 3CX5K 1CWVA 4WFFE 4XB8A 4OGAC 2D4DA 1A6ZB 4L29A 3U0TA 5IMMB 5EO9A 1FO0A 3O2DA 1KG0A 1I3GL 1NMCC 3RGVB 1PG7H 1WEJL 3IJSA 1J1XH 4O58L 1BQSA 4DKEH 4OF0A 1RZJC 1L6ZA 3MRQB 4L3EB 3ZSTA 5JHDB 4WCYL 1IGFL 3JTSA 1FSKB 2J4WL 1YDPA 2EIZA 4S2SB 5DD3L 4PJFE 2NMSA 4G8GB 1SYSB 1NDMA 2QV2A 4UT6L 1QRNA 1AXTH 5I16A 3SJVE 1IGJA 2X05A 4DN4L 5L9DL 4FTVD 4PV9B 1IAOA 2QADB 3HS0B 3DX7B 4FHBD 3MLSL 3G5XA 2O61B 3UMTA 4PJDB 4FZ8H 4UV4L 5ANME 2F53E 5JW4Q 5IB5B 1BWWA 15C8H 5IT2H 4WHYG 1DEEB 3E1F1 4CDGC 5EOCH 1F42A 2C3HA 4G9DB 3G9AB 1YEJH 1S5IH 4KVCH 4GKSB 4OQTH 1A5FH 4XPHH 4ZMAT 2FYYA 3C8KB 4HIHB 4OLWL 5J12C 3ROLB 4MQXD 4NCDA 1JF5A 3DARA 5D6CA 5F7NC 1QVOB 4J8RA 3UDWA 1EEYB 3VCLA 1K4CA 5DK2A 1YUHB 4XHQA 4ORGB 5CZXD 3LD8B 3RUGF 4YXHH 3S35X 3UTTD 1LO4L 1YEEH 5DD5H 3N06B 4Y5YC 5GGQL 5IJKC 4QT5B 3NH7L 4U6TA 4DKAA 2H2PC 4UT9H 4TTGA 3PWVA 4HS6B 3O6MH 1YY9C 1N26A 3DRTA 2H8PB 3L5XH 1JJUA 2ZCKL 3BESR 5D7IF 3LMJH 4HIEA 3I75B 1HKLH 1R5WA 2BNQB 3IGAA 5GS2D 3P11H 3GSVA 4WO4D 1E6JH 4MA7L 5EBLA 2BHYA 4OB5H 3NVQA 5IVXF 1KXVC 5MEPB 5E5MB 4U05A 5IVZB 3OB0H 4M6MH 3S3PA 4YHIA 3H3PL 1FZJB 1GZQB 2DLHA 4ERSL 1FVEA 1OW0A 1CU4L 4M00A 2G60L 4JR9L 4Z8FL 3B9EA 4KVCL 1A1MA 1K2DA 5FUZH 2VITA 4GKOA 3MBEC 4PJFF 2IPTL 3H9HA 5J1TC 4HHAB 1NAKL 2CR3A 5ID0A 5IMLB 1SEQL 5DHVB 4K2UL 1TCMA 4K55A 4IMKA 4NO0A 5HD8D 1YECH 2CLVB 3T0AA 3D2UA 1R3JA 2XZAL 5C0DB 2H26B 4DN4H 4QRPE 4GQPH 3DRQB 3BH8B 5FDYA 2R0KL 4TNVF 1K8DB 2CLZB 1G9NH 4OZHA 4X9GA 1C5DB 5I1KL 4LU5H 3ZT7A 1TIUA 4PRPA 2PW2B 1OAYH 4GW4B 5EU7E 4QNPE 5DFVC 1FNFA 2PO6B 4N8CL 5D7SH 4X6BA 1LEKA 4QOKD 3JV6B 4MB4A 4PRID 5DMIH 4P4KB 1I9JL 3IDMA 1EIBA 3PIQA 5JW3L 4C4KO 1MCLA 1IM3B 3LKRA 1KJ2L 2FGWH 4X7FC 4DOHE 5H8DA 3UC0H 5DLMH 1CDYA 3V6FA 1QP1A 5ICXA 5DMKA 3G5YB 3VI3E 4ODTH 5JIIA 4PRAA 5C07A 4U6HA 5EO1A 3EDDA 1KELH 4K3JH 2B20A 1YC7A 3KLDA 4MYWB 4UOJA 1FNHA 3WN5A 5J6HA 2KZWA 2C3VB 4BH7B 1J18A 3VXOB 3HRPA 1P4BH 1B0WA 1KCSH 2NY6D 3K8MA 4NBXB 4OUUA 3OG4B 1DLFL 3TWCL 2MCPL 3HC3L 5TF0A 4CAGA 3GRWA 2GCYA 5I73B 3IFOB 2ADIB 4PGBB 3BXNA 1A6TB 3MLXL 1EAPA 1EAJA 4PB9L 2ENYA 4LOUC 4ZOAA 4OLEA 1LDPH 1RAMA 2ADJB 5E6IB 4WWKA 4Y4HD 2HKHL 3RTQC 5FHAH 3FRUB 3W39A 4JRYB 2ESVA 4Y7MA 4PJ8D 2PYEE 3DETC 1IAII 2X4QA 5ECJE 3RX7A 3TN0B 3IDGB 3RDTB 4O51A 1IEBB 5AYUL 4D8PA 3BRGC 1KCUH 1ZHLB 1IQDB 1TJHL 5LGKA 1A6VH 1J10A 3KPOA 1AI1H 2EDXA 4PJDE 1AH1A 4KVNH 5DD5L 4PPTA 4WEBL 5EFIA 1FV1A 2YA1A 3OR6B 3IU3A 2ATKA 5DTFA 2JKXA 2R0WH 4X8XA 1A8JH 1TQCB 2IFFH 2DQJL 5ACZA 5I2IA 1D5XA 1P4LA 4RCAA 5GGVH 1X6LA 5C0GB 1T3FA 4G6MH 5KW9H 2VDPH 1J05B 1NCNA 1NFDA 3WE6B 3RPIB 1MVUB 3RIFF 3QPQC 5C0FB 3P73A 4PJBF 4UIMA 4LCCB 1ZXQA 3OKNB 2IBGA 2D3VA 5E2WH 4JDVA 4OF7A 2Q86B 2CDFA 2CDEA 4PJBB 2YD7A 4JQVC 1NBVL 4FRWA 2HN7A 3LQZB 3MRFA 2QSTA 4G6FB 2V17H 2Q3ZA 2WBJA 1EMTH 4G80A 3O6LL 1KCVH 4M02A 3U83A 4G6FD 4Z7OF 1IC7L 3QCVH 1YEGH 4HAGA 1OGTA 3X13A 1OAYL 4P9HC 4KK5D 5JXEA 4HKBA 2VLME 5F96L 2OL3B 3MODH 5CGYC 3VXMD 2VXVH 1YPZB 3P9MB 3C2SA 2AK1H 2BFVL 3U36B 3D85B 1HEZA 1A9BA 3TO2B 1AO7B 3H7BB 1X7QA 1KT2A 4Z95H 4RFEA 3V8CA 3EO0A 3MZGB 3LRGA 4U1IB 4KQ4H 3ARDD 1CFNB 1LO2H 4KK8D 3BI9X 4OCSH 5F96H 4X6CA 4RX4D 1N4XL 3HMWL 1X4YA 5C07E 1QSEE 4JDZB 2E27H 5H35B 3C60D 1U3HB 1G9NC 3Q6GH 3QQ3A 3M1BB 1ZGLM 3I6GA 1DN0B 3CDGB 2BJML 3BEVA 4ZUSA 2VZUA 4OFVA 5IFJA 2A77H 3MROA 5TDOB 1HWHB 1T1YA 3HMWH 1AC0A 3QZWB 2ZCHL 4H0HB 4L8BB 2R2HB 2F54B 2Y25A 4CNIB 5HYIA 3DPBA 5DJ0A 2O26U 1N64H 3WFBL 2DQTL 4IOSD 3T1FB 3BWAA 4M8QA 2AJSH 4JN2A 3U7WH 2DOCA 3UYPA 1BJ1H 1MCQA 3RWCB 3MODL 1U8PB 3UX9B 4XNZC 3VMNA 4YFEA 3RZWA 4PJCE 4LAJH 3KJ6L 2IADB 4JN1H 2AXGA 1D7FA 1NL0L 3ARDB 3AROA 1GIGL 2VLRE 2GEEA 4JKPH 4X7SH 1OL0A 2EIEA 4NSKA 1LO3L 3CC5B 2WK2A 3GSNH 3PWNB 4PJ7B 3WFCL 4XNZB 2UV3A 4F37F 2VIRA 3T4YA 2VDQL 1CE1L 4X7TA 3Q6FB 5B38A 3EIFA 3KPRA 1QSFD 3MLVH 1KIQA 2KDGA 3KPPA 1IQWL 5D71L 1IC4L 3TEUA 5T33L 1KYOJ 4PJIE 2WP3O 1S5IL 1CD0A 4JFEB 5INDB 4D3CH 4PFEA 1A2YB 1A9EB 2JIXA 4OLUH 3RVWC 5ALBH 2WSKA 3H3KA 3I84A 1LK2B 3PQYA 4WU7A 5CZVH 5HDQH 5AYUH 4PBXA 4PRHA 1KB5B 4ZUWB 3VFNB 1WFUA 5GGSA 1IRAY 1XT5A 5T5NF 1IEAB 4Y5VA 3VGEA 4FFVC 5B3JF 4P3CH 3QFJE 1JHTB 2OMBA 4BQCA 5IF0B 1H8SA 1GAFL 3RNKB 1MWAH 2EC9T 3I50L 1NGZA 3MJGX 4EJ1C 5JW3H 1N6VA 5F89A 3K8LA 4YEEA 1MNUH 5T1KA 3VFRB 4QRRA 5A40E 3MOAH 6FABL 2R15A 3QJFA 1MELA 4QRQB 1SEBA 4MWFB 1RUQH 4H8WC 2HVJA 1IAIM 3ZKND 5FYJD 3OKOB 2PCPA 1I7UA 5J11B 5DMYA 1KIRA 5C09D 3KPNA 2DQHL 4OZGB 5SWQB 4N90D 4J3VA 3IFLL 4RMUA 4XI5D 5J0BA 4Q9CA 3QYCA 4HIXH 4XWGH 1RJLA 1YNTA 5K59E 2ESVD 3S36H 2FX7H 1JPTH 4PD4J 4L4TA 2ARJQ 4G6JL 4UAOC 4RQQB 2ORBH 4UTAL 3NPSB 1RZJH 5CKGA 5HVHB 1N2RA 4GG8B 2HFEA 1TZHB 1V5JA 3QUXB 4WEUD 3ELAT 1SJXA 3G08A 1PZUB 1NAKH 1I9JH 1J8KA 2XN9E 3CUPA 3DVGA 4OLYL 4X6FB 4GFTB 4FOMA 3T2QA 1CFSB 4AQ1B 4RGMB 5FYJH 3QDME 1EDQA 1QA9A 4WFED 3Q5OA 1Q1JL 4RMRA 2R0KH 4JFOA 4JEGB 3T0EA 3WXVL 2H2PD 1D6EA 4QRUB 1CLOL 3IJHA 4RGMC 5DURD 5DHVH 4MNQE 2Q20A 3VU2A 4EOWL 3U7AA 4U1NB 1ADQA 3QBTB 5IV2A 1MFAH 2DAVA 5F7EL 4PTTA 3K7UA 2P5WB 3F7YA 3HI1B 2QQLH 2KH2B 5DVOA 2DQHH 1CLZL 2YEZB 1X5YA 3D9AL 3OGCB 2EDLA 4XVTL 1FE8H 1UXWB 1U8LB 3INUH 4EN3C 5C09A 4BZ1L 2FIKB 3VGAC 3TA3C 4GKNB 4GBXD 1Q9KB 2IQ9H 1YY8A 4GQ9H 4GBXB 3THML 1NGQH 4JO4L 1RFDH 3VGDA 2DWEB 3SCMB 2K7PA 1S7SA 4HKXB 4EN3B 4LP4A 3PP3H 1L7TH 4FFZH 4M1DH 4E41A 4FQXA 3L3KA 2B5IB 5FYKL 3MLRL 4GMSH 1DN2A 2F19L 1BQHA 3QI9C 1IARB 1WVZA 4JANA 4Z7UF 4Z7WB 4JPWH 2CO7B 5GZNC 1A7OH 1D5MA 3CPLB 5EU4A 5JA9A 4NZTH 3VFOA 5TFSH 4CJ1A 2YR3A 3LCYA 3FT2A 4NP4H 5GGQH 1T20A 2FL5B 1WIPA 5T1DL 4X6DA 5DURB 3KLAA 5I1LA 1MWAA 5BXFA 3QXAA 2FJHB 2VDLL 5I9QB 4G6KH 1EJ6A 4PD4K 1F3DH 2NNAB 4FFYH 4OGYL 2VISA 1RZIA 3QNXB 1KNOB 2XWJA 5E94A 1KCKA 4RNRB 3V5DB 4WY7L 4JO3H 5FM5M 5E70A 4NN6C 5DVLA 3S4SG 4Q9BA 4PJHB 1BOGB 2VLJD 2ED9A 4KROD 1BIIA 1J8HE 2EDEA 3BGMB 1FYTA 4EUPH 2WBKA 1T6WA 3G5ZB 3SGDI 3ARGB 1MRFH 2FR4B 1B3JA 4NKOA 4Q6IA 5A16A 1S9WB 5EUOF 5FGSA 5CGTA 1BVKB 2BRQA 3STZA 2Z4QB 3T3ME 3UTTA 1AY1L 3O3EB 3FMGH 5DGRA 5I19H 5DJCA 4JM4H 5LAXB 3K46A 3U4EB 1CLYH 3FOLA 4QXGH 3VA2C 4HK0A 2VDNH 4X9HA 4AL8L 5L88H 1EPFA 5F9JB 1AR2A 5IR1B 5DJ2A 3P9LB 3LQAC 4F9PA 1I8LC 1HWGB 3D0VB 5HYEA 1N59A 5CIPB 4UQ3A 3FMGL 4JJ5B 3ULVC 1ADQH 2ZKHL 4OUOA 2LV4A 1RIHH 1J5OL 1UA6H 2WM0A 3O41B 4F7TB 1B9ZA 4ZFZB 3WIIH 4JG1L 4PJ9C 2LAAA 5E8DH 4RFNB 4ZSOB 1HK6A 5H2BA 1BQUA 2FHCA 12E8H 4BQ9A 4TVPE 5GS1C 3X14A 4QKXB 4UDUA 1MUJB 4D2NA 3B83A 5C09E 5HJ3B 4X80H 5BJTB 1CK0H 1JWSB 1QG3A 1D5IL 4G6ML 4UI2A 4N68A 3H6JA 4JY6B 3EYFA 1KC5H 5TH2B 4G3YL 2VUYA 1AFVL 3R0MA 4F2MA 1HILA 5DJXB 3NCEB 5EOQH 1LO3H 3SGDH 1UM4H 3MRRA 2FX8L 4KDTA 3NFPB 3U1SL 1DUZB 3L3HA 5F9OH 5KS9F 3KNBB 4Q9RL 3FJTA 3HI6L 1HHGA 3DX7A 1K8IB 2HKFL 1KCVL 2NY0B 5FIEA 1V7NL 2FX8H 4O4YH 3WJLC 3DX6B 4HJ0D 3SE4A 1IGML 2VN7A 4IS6B 4KV5F 4Q6IC 1MJJB 5EIIA 2VDKH 5D96B 5LBSL 3DI2B 3QCTH 1TJGH 4R4NC 4IRJA 3VD5A 3LSOB 4NRZB 5DHXB 3SDDD 4XGZB 4YPGA 2QQNL 3T2NH 4MXVF 4Z7VF 5KBNC 4NQDE 3LDBC 4P48A 1FLRL 1TPXC 5AD0B 4MS8C 4NRYA 1RVFL 4X7EC 4U1LA 3TBWA 4LF3A 1HH6B 1HCFX 3V6ZA 2J8UE 4GMTH 1KCUL 5DEGA 1G7IB 3HLAA 2XNAA 1FO0B 1IFHH 1CDIA 2H8PA 5SWSE 3TBYB 2XTJB 4LIQH 5GRJL 3WKML 3PWPD 4BQ8A 2W60A 2G5RA 5I18H 3UTTE 4YHLL 4RISL 3HE7D 3CH8A 1GPOH 4XMPL 2EH7H 4JFQB 1OAQL 2Z8WC 3MXVH 3RJDA 3L3DA 3L9RA 4TVPL 2K3TA 2OR9H 5DT1L 4DAGL 2AJUH 3CZJA 1WBYB 3A0OA 4Z7VA 4NQCA 1E4JA 5FM4A 1KPVA 1NFIB 4LVOC 3HPJB 2L4OA 5L0QC 5BVJA 4YHNB 2OSLA 3OKLB 4GBXC 3BN3B 4JE4B 2MQCA 4K9EL 5E03A 4QHNA 3SQBA 3PL6C 5CCKH 5FO9A 3TT3H 1YYML 4MHHI 3ISWA 2E8ZA 4KMTL 1O7SA 4P57B 5DHYA 5JO5B 4K8RL 5D1QC 1UC6A 3H42H 1G7QA 1MHPH 1UM6H 1UQSB 3BW9A 3QEGL 1WZMA 4Y4FC 2FCBA 3NZ8B 2B0SL 1R3IH 2VDLH 2OQJB 2IFFL 4MMZC 3PV6A 4MLIA 1MFDH 5DK2B 4NOFA 4TNWF 5D1QD 3HUJE 4OLUL 2VSCA 4Y4FB 4OF3A 3B9KC 1I75A 1XF3A 2N4IA 3E6FB 2R1YB 1DBBH 1Q94B 4OD2B 3JWNC 3W2DH 4BFBD 2EIBA 1QSVA 4X4XA 1P1ZB 3I6LE 2R1XB 1HOCA 3FQWB 4MB3A 1OP5H 5DT1H 1UKSA 1T0MA 3ARSA 4WFFD 2IEPA 3BGAA 3VFUA 4X5LA 3L5WA 3NA9H 2HVKB 4OD1L 1BREA 3U9PH 4JFDE 2UY6A 4W4OA 1GAFH 1G7MB 1IM9D 1QSFA 4PY8J 5C0IB 3LIZH 2GJ6B 1HKFA 2CQVA 1TQBB 2YWZA 5FYLL 1JNNL 3S96B 4B50A 4LGSB 3ETBF 4KUCD 2MCPH 1BQLL 1MY7A 2ZOLB 3EKCA 5C07B 3B2UC 5KANG 3WL9B 4U6HB 4Y5XC 5EO1B 5E4EB 3HR5A 4YZFE 1F11B 3MLRH 1JWMA 4DFHA 2C5DC 3HE7A 5ALCH 3ULVE 5E6ID 5F7EH 2NTFA 3P2TA 1YEKH 4NZRH 1N5AA 3ARFC 3LEXB 3MA7A 5E2TL 5DHVA 1BEYH 1X5GA 2GCYB 3OKDA 3QEHA 2AJZA 1RK1B 4OCRL 3C9NA 4LSRH 5D1QA 3RWHA 1R3JB 3TVMB 2RHEA 3SEPA 2DQCH 1BJMA 3T65B 2Y72A 3ULSA 1EEUA 3IXTA 4X5XA 2DLTA 3BZFA 5FOJA 2O5YL 4LLYB 2DQEH 1B4JL 4U4BA 2JIXD 2YXFA 1S3KL 32C2B 3PGDA 3QJHB 1XF5A 2HFTA 1MQ8A 4YJZL 5EU6D 4TSBL 3UTOA 3BX7C 3TO4B 4EKXA 2AW2A 2YPLB 5ILTH 2FB4H 5BMFH 3MUGB 5JPMA 4G6JH 1S9VB 5F6HJ 3SE9H 2DYPB 4CW1B 5FXCH 5C0RL 3U6RB 5K9JL 3DLQR 2VXQL 2NYYD 5I71B 5HYJA 2VQTA 3CFBB 3QIWB 1XR9B 1EH9A 3RPIA 5GZOC 3ROOA 4JPVL 3O6LH 4AH2B 1I7TB 4OLYH 3NGBC 4Y4KB 4G8EB 5EZLB 2DL9A 5FUZL 3QPQD 1Z9SA 3QSKB 2HN7B 3LQZA 3MRFB 3TVMD 3UPCA 5TDPA 4D0CA 5D7LA 2OTPA 4K94H 4LCWE 4KTDH 1GRWA 1NQBA 5T3ZL 4KK6D 3QUMB 2ZUYA 3S36L 2W91A 4FFWD 2DMCA 2C9AA 3QPXL 2W9DH 4GAJL 4YAQA 3BAEH 2G9HA 3IFLH 3U36A 3MYZA 1AO7A 1YQVL 3E2HC 3K80A 3R8BB 3FTGA 5HHPA 2CKBB 1BJ8A 1EHXA 2M2DA 4JFFD 1XGTA 3N9GH 4JRYA 4KKBC 4AEIH 2AEPH 1OB1B 1L9MA 3VWJC 1K9TA 4UU9A 1ZMYA 4TRPH 1D5ZB 3K1DA 3RGVC 1KB9K 1MJUH 3X17A 4P2YA 3PABB 1JGEA 4IJ3C 5DRWA 3V7MA 1C16A 1OY3B 5JUEL 3FQTA 3TPUA 3MRPB 1FO0H 4K3HA 3V52H 3ZTJH 4PJ8A 4MJIB 5I8KH 1MFEH 3FB8B 3LKQB 3RL1A 5SWSB 2V5RA 5LGHL 3FCTA 1T1YB 4HCRL 3MLXH 1P4LB 2G5BB 2X70A 4Z7OE 5C0GA 2EE3A 2PKDA 5I8OL 1QSEB 2ICCA 3C5JA 1D9KA 1KJVA 1FYTD 2NY4C 1EHLL 3ESUF 4KHXH 2R2HA 4LVNC 3SKNA 4WHYH 4QHKJ 5JUEH 3HZMB 3OKNA 4GS7B 2SEBA 4IDLA 3UAJC 5IBUG 3SDAB 4CMMB 1CQKA 4KMQA 5ID1B 1B2WL 2XV6B 3T1FA 4Z9KB 5EOTB 1A6UL 2VLRA 3U2SB 1E4WH 4LKCA 4I5BA 2FECI 3WFZA 3CVHB 1YN7B 2X89D 1ZKAA 2MHAA 1OGTB 5JMRA 4LHUD 2FBJL 2D7OA 2I60H 2IAMD 4ZS6C 5IEHA 3Q0HA 2R2EB 4E5XA 5JPNA 5GGUB 4MDIB 2P4AB 1DVFB 3TT3L 4OBRA 3SCMC 3N1PC 4LMQE 1URLA 3PWNA 1MIML 1VCAA 1S7WB 4YXKH 4RFEB 4JY5L 4X9IA 1SVCP 3T4YB 1I8IA 1OAUH 3CLEL 4GKZA 3FRPG 1B0RB 3HNTH 4M9PA 1KIPB 1J8HA 2CPCA 3TO4D 4GH7B 2JB5H 5KOMC 3PG2A 5E99L 1VA9A 2G2RA 3UTPE 4I0PB 4JZJB 1XGQB 4NO5B 5IOPB 2EE2A 3I6GB 3VWJA 3G6JE 1DQJA 2R8SL 1BD2B 4XCNA 5TQ0H 4K8RD 2Q76A 1G7LB 2WANA 2AJ3B 1MAJA 1YNKH 1MAML 2AQ1A 1CDUA 1JYXA 4D94A 4S1RH 4UTBL 5J9PB 3V8OA 3FQNB 2VLJA 1YYMH 2XKNB 5AZEL 5FFLA 4KTEL 4ELKB 4KK9D 4W6YB 1A21A 1BPVA 1ND0A 3EOYG 1EV2E 1MCWM 3RVXC 2BVPB 3PGFH 4D0BB 3AY4C 2VR4A 2XT1B 3QDMA 1XGPB 1D9KC 4Y0GA 4JZNA 2BC4A 5BVPH 3TJEH 4QRQA 4HIJA 1IBGL 5FEBA 4MJ6B 2EYRB 5F3HB 5C07D 5CBEB 3HNSH 2PCPB 2Z91A 1U58B 4E0RA 3BEWB 2HJFA 1RZGA 3DURB 3MJ8A 5IM7B 2VXVL 3STBA 2QQKL 2B4CC 3OB8A 2GJ6D 2F74A 5IEKB 1MCJA 3MRIA 1Y0LA 2FATL 4HT1L 2DQJH 2X6MA 5J1AB 1LMKA 1AD0B 3B4NA 4J4PA 4DUWA 5EULV 3SE3C 1NGPL 3EOBA 1A7NH 3ARTA 1QBAA 3WNNA 5HPMB 3VGBA 5KSVA 3FFDB 2H6PB 4F7MA 1N2RB 3NH7H 3IJSB 4J7RA 5GS0D 4XPGH 2Z31B 4U3XA 1YDPB 5GRVK 3IETA 5IKCA 4NWUH 4U2YA 2X41A 4I4WA 4GAGL 3C87A 3QXDB 4MCYB 3IU4L 4ZFGL 2CRYA 3KXFB 1U36A 2VZTA 3PUCA 1EO7A 1ORSB 4JAMA 4LCWB 43CAA 1RUPL 1INDL 3G6DH 4PJIA 3IDXH 5JR1L 3X11B 2CRIA 1OP9A 4PG2A 4M62H 1M7XA 2EH8L 3MNWA 4K23H 4N5EC 5L0QB 1N6QH 2UWEE 3EGSB 1A3LL 1CZ8H 1RIHL 5EUOA 1F58L 1P4BL 3DROA 4NQEE 4Z7UB 4D3CL 3SKUD 2ADGB 4I3GA 1JZ4A 4WI8A 3U30C 3ZT6A 3NN8A 3FQUB 4B53A 1U3YA 3WEXB 3WHE0 4JFDD 3P4OA 2A6JB 1AGDA 4YLQT 1J88A 1K4CB 4IDJL 1CIDA 2EXYD 4UOW1 5IB3B 3O9WC 4F80A 5J57B 3GIZL 1UM6L 2IALA 3PQYD 3BYTA 2YSSB 3KYNA 3WFCH 1JCKA 4PJIF 3DRTB 3RGHA 3JWOL 5TE7L 4MA1B 2EDOA 4XBPB 1PX3A 4LSTH 4YBQC 5L8KB 3ALXA 2GITA 2Y5TA 5BV7L 4FQXB 1XEDA 2UVEA 3W9DB 2X1XR 1SYSA 1WBXA 5K9JH 4FNLH 5DFWH 2NY5L 1T0NA 4XMLH 4YHKL 4PB0L 5I30L 2CK0H 4XCCL 4NN5B 1G7PB 4H20H 4NGHH 3HKFA 4EI5D 3CX2A 4EI6A 5L9DH 4JFOB 1PSKL 4L3CA 2HP4A 1CICD 5CCKL 3D39D 4RISH 2XTJE 4LCCC 4IMLB 5E7BA 1R5IB 4PLNC 1S3KH 1VGKB 4G8IA 1XCQB 4QWWC 4POYA 2VITB 1HHKB 4Z7VE 1QEWB 3BKCH 3MBXH 3RY6A 1FFPB 4P46A 3DYPA 2R9HD 3U0WL 1A7OL 1AO7D 4ZUTA 4P2RB 3PGFL 5IMLA 2IH1A 5F8RC 1OD9A 1HYRC 4Z0BL 4CVXA 3E8UH 1E6OH 4MQ7A 1MFCH 5JORB 1B0GA 5CEZL 4N9GB 2DTML 4RDQG 4KRLB 1AXSB 1HSAA 2NY2D 4YPJA 3PWUA 4PRHD 5TQ2H 4DW2L 2P43B 4LVOB 5CJQL 3CFEA 5FGBC 3UJTL