4ORMA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm338 (n-[3,5-difluoro-4-(trifluoromethyl)phenyl]-5-methyl-2-(trifluoromethyl)[1,2,4]triazolo[1,5-a]pyrimidin-7-amine)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
375
structure length
375
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Fluorine Modulates Species Selectivity in the Triazolopyrimidine Class of Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 149
structure length 375
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ormA00
3LHUA 4QNWA 4LS2A 1OYAA 1VZWA 1XBVA 3LTSA 3HIJA 4RX0A 2VXNA 3NQGA 2A21A 1OX6A 1UUMA 3ELFA 1DHPA 3NL5A 4M5PA 3WJZA 2XN2A 3G24A 2V0TA 1M5WA 4RKAA 2YR1A 2QR6A 1PVNA 4LWWA 5KZMA 5I3IA 3MYPA 4IMDA 1H60A 1ICPA 4CQAA 2FJKA 3NQEA 1KM1A 4EIVA 5HR7A 2BTMA 3C2RA 5EMUA 8TIMA 1EUNA 1OFRA 5G2HA 3O8AA 1IGSA 2H90A 1YXYA 3UZ5A 4MVAA 4JX4A 3C2EA 4ONVA 2Y61A 4I7VA 2TPSA 4GFSA 3B0PA 4N6EA 2E6FA 1BEUA 2I14A 3W7MA 1W5QA 2ISWA 4R33A 3MMTA 3O05A 1DOSA 1Q3NA 2NWSA 4M7TA 4Z1CA 4NNAA 1IXNA 3B03A 3KX6A 3BW2A 1QCWA 3U2OA 3PAJA 3W7KA 2X30A 5BRBA 1FCBA 3SGUA 1ICQA 3TW6A 2NXIA 2NWRA 1Z48A 5D2TA 4AB4A 4A2SA 3TIMA 4UTJA 2DZXA 3RNDA 1QPQA 4BFAA 2V2CA 2GJNA 1B3OA 4FB7A 1DV7A 4CCEA 1MO0A 1KBIA 4BWLA 2ZA3A 3E96A 3L67A 2ZRXA 2KZHA 1XXXA 4DPPA 3C56A 2CZ5A 2HMCA 5I3JA 4FNSA 1O95A 5K2ZA 4OQVA 5AHIA 5KZDA 1OHLA 4JS3A 1OFEA 2IQTA 1FDJA 2C3ZA 1WV2A 3QYQA 3G1DA 1DQXA 5G1YA 4UR8A 4RK8A 4UMAA 4POCA 4IMGA 2QDHA 3L5LA 2Y7DA 3BO9A 1YPFA 3EWBX 3LXBA 4DF1A 3W1PA 1FDYA 1VLIA 4LUJA 4YL2A 2CLHA 4ALDA 3PG8A 1VCVA 5HINA 1OYBA 4UMCA 4HPJA 3QPYA 1H61A 3S1XA 2WNQA 4JTKA 4RZ6A 1OG0A 1YXDA 3IIOA 3B0UX 3NZ1A 3NQAA 3GDMA 2VKZG 4AF0B 5HR6A 3FYOA 3W6YA 4PL2A 4R34A 2QAPA 3UWYA 3TSDA 5KINA 4OV4A 3P8JA 4LT9A 2Z6IA 5D2VA 1ZNNA 4C1KA 1NSJA 5DELA 3W7GA 3PVFA 2ABAA 4LVFA 2P0OA 2XN1A 1G4PA 2XFWA 1PHWA 1YLVA 4DELA 1HTIA 1OVDA 3S1VA 1WDWA 4HT3A 2W0UA 4EF9A 3TROA 1LDCA 4BWLC 1SO6A 3MHFA 1GYNA 3D0CA 2G97A 3M5XA 1VR6A 4TIMA 4K7YA 3ATZA 3HO8A 4JXCA 3N34A 3A22A 4HIBA 5FF0A 3BG3A 1UB3A 5LNVA 3W7CA 4GXMA 4HHPA 4PCFA 3DENA 1DL3A 4WY0B 2ZFAA 3NL2A 5L6UA 4IWWA 1WBHA 2CLLA 2TRSA 3NEVA 4FX6M 5F1UA 5T26A 5LGZA 5AHMA 4K8HA 1JULA 2QCDA 1DQWA 1R2SA 1SFLA 4QIUA 2G5WA 2PE4A 4OE7A 4N4PA 5DXXA 4WQ6A 1SW3A 2QCDB 2ZBTA 2OX1A 4O4WA 2ALDA 4L4MA 1MEHA 4MYAA 3WJYA 3AJXA 3ANYA 1Q6RA 2EPHA 2PC4A 1QMLA 1GOXA 3NYZA 3OHIA 3RF9A 3DGRA 2P1FA 1M7OA 3M0ZA 1TJPA 2ZA1A 3ZWTA 3L21A 3OVQA 2V9DA 3CIWA 3DFSA 3LCFA 3QW4B 3O6YX 2V2HA 3UXDA 3HG4A 1U5JA 5LNSA 2VFGA 2DU2A 4TMBA 1T0OA 1EIXA 1OFOA 5AHFA 3W87A 3MJYA 5CPMA 4HNNA 4JDYA 3UQNA 1FDZA 3NM3A 1Q6OA 2VFHA 2I1OA 3L5MA 4JDBA 1ME9A 2EF9A 3DI1A 5E1QA 2F84A 2NX1A 1YDNA 3LCHA 3P67A 4UTTA 1R2RA 1LROA 1F6KA 1H7XA 1I8JA 1WBJA 4O1AA 1F2JA 1XCFA 3DH7A 4NVTA 2NUWA 3I7SA 1DJNA 1KM4A 3U6WA 1XDMA 4QJ1A 3HB9A 1ZFJA 1FWSA 3M5ZA 3HG2A 2FPVA 3M5YA 3QMTA 4GUJA 4TR9A 1GTHA 3Q2DA 2ZZ4A 3TX9A 1W3IA 3HPSA 2B7QA 3W7LA 3S9YA 1LYXA 1TV5A 2XN0A 4ORMA 3H53A 1ML1A 3TR2A 3P60A 4A3UA 4CQ9A 3Q37A 2ATMA 2CLEA 2H6RA 4R7JA 5AYZA 3SSJA 4D2JA 5AOUA 3E49A 4MYXA 1UUOA 2C6QA 3TJLA 4O15A 3W7DA 1F73A 1EB3A 3LHVA 1ZENA 1A5CA 3LXCA 1DBTA 5DBTA 5CGQA 2LLEA 3GZ3A 3MI6A 3MP5A 3ABRA 2QCCA 5HWMA 4LV4A 4IXXA 4QISA 4S2BA 3MHGA 1X6UA 3QC3A 2I9EA 1VC4A 1FWRA 2Z0IA 1MEIA 4LC8A 1FBAA 3W7RA 1TMHA 2Y6ZA 3C2OA 4WD0A 3S0CA 4X22A 1JVNA 1OX4B 2Z2UA 4OWGA 3WFAA 4QQ3A 1DORA 2J27A 1K8YA 1SSGA 1FWNA 4UTKA 4IXHA 1ONRA 3W71A 1IXOA 1KM0A 3NQ7A 3TFCA 1IXPA 2TYSA 2C15A 3EWUA 1H7WA 4JTTA 2Q8LA 1PL9A 5KITA 3KHJA 3L9CA 1SFJA 1ZY9A 3PUEA 1E51A 2PURA 3ABQA 1W3NA 3HGRA 3N2MA 5D37A 3MWAA 1TPH1 4DBEA 2VEMA 3I6RA 4IUOA 3LHWA 2TMDA 3G0XA 4BR1A 2VFIA 5BNKA 1A5SA 1W8SA 3BGJA 1LTDA 4NNCA 3PUDA 1H7PA 3C6CA 3HPZA 3W72A 3INPA 4NZFA 3NAVA 2GQ8A 1XBZA 4O1DA 4UCGA 2YFNA 2OT0A 5D30A 3GB6A 3W7EA 3GAKA 5AHNA 5F2IA 4KKXA 4Z0SA 1S5WA 5HJLA 4O53A 2GUUA 4CNNA 3W76A 1L2UA 1T99A 3NGJA 4JN6A 4HSNA 4B5NA 1H1YA 3EWZA 3SZ8A 1L9WA 3QJAA 4WXZA 1D3HA 3QSTA 1GT8A 2HTMA 2YDAA 1HFBA 4N9EA 3L0KA 1OF8A 3W88A 1TPFA 3SJ3A 4XKYB 1KLZA 1PS9A 3ABSA 2PRHA 5D2XA 4UMBA 4LY8A 1GVFA 1R47A 3W1UA 3FEMA 1JCYA 4LC6A 4PH6A 3N9RA 3O15A 1WOBA 1H7RA 1O60A 4Z0JA 4IQLA 4RXGA 3U8GA 1ZAJA 1SO4A 2BWGA 1C29A 5CPOA 1KTCA 3GAYA 1H7OA 3SECA 3L65A 4LVDA 2QUTA 3UWVA 3TXVA 3CWNA 5J5RA 2V81A 5D02A 4CNOA 3P80A 3BLEA 4IPJA 1S3HA 2Y85A 5BOOA 5CZSA 4JICA 1O5XA 2WNZA 1K7EA 3W75A 3PF3A 4N9DA 1JJKA 5F4XA 2QCLA 3JRKA 2J9XA 3LRMA 5TQLA 4MFEA 4Y9AA 3LRLA 1QFEA 5FESA 2GVLA 3QQ0A 2NX9A 3EB2A 2QJIA 3LTYA 3HPXA 5CSRA 1GQNA 3NPWA 4ADUA 1G4SA 1W56A 3TAKA 5AC7A 1LRQA 5LKYA 5CZJA 4ZQCA 1W5MA 4Y96A 5D04C 3UWZA 3DFNA 3EXSA 3DFOA 3L2IA 1A5BA 4MJZA 5C2XA 3AO0A 1VCFA 3NM1A 1SUXA 4JYEA 5CKSA 6ALDA 2RDUA 2YSWA 1GVRA 1TRIA 5AYXA 1NF7A 4N6FA 2Y7EA 4YXGA 3R12A 3L66A 2ZTJA 5AN7A 2Y89A 4WZHA 1WQ5A 5F2LA 2VFEA 1RPXA 2A7NA 2C14A 5CPLA 1I2OA 4E2DA 3LCGA 1JQXA 4O13A 4RXFA 3G1HA 1G4TA 1K03A 3NQ6A 4R53A 3TV8A 3W1XA 3FA5A 2VENA 1YADA 1SR9A 1KM3A 1F5ZA 1VJIA 2QAFA 2AQWA 4KWVA 1AW5A 1TV8A 3FKKA 1TPVA 4CNPA 1JR1A 3NPVA 5D03A 3PBYA 5G2IA 5G5IA 2CFFA 1SQ7A 4MY8A 3N14A 1FUYA 4KFNA 4NJJA 3P74A 4JY9A 5GVJA 4RR4A 3QF0A 3TK7A 3M44A 2DJXA 1KFCA 5HULA 3KVJA 3SI9A 1R2TA 4O12A 1O5KA 1LOLA 3BPWA 2Y62A 3F4NA 3IVSA 3STGA 5AC6A 4WY0F 5A5WA 1SPQA 2Y7FA 3B4UA 2GVJA 5C54A 3LHYA 1WOAA 3CT7A 3QMSA 4FXSA 3QW3A 5HQEA 5D32A 2ATSA 3RK8A 1VS1A 3BLFA 4ZQNA 1TQJA 3PWAA 5D2YA 1F76A 4JTEA 1L6SA 1D9EA 3FFSA 3KAOA 3HGSA 3O6CA 2Y63A 3W1RA 3R5EA 3TQKA 1SO3A 3WJXA 4UTLA 4CCDA 3W7IA 3MI2A 3S5NA 1OFDA 5DXYA 3TU9A 3M1ZA 3OIXA 3BG9A 1HO1A 1EWDA 2WSRA 3UWQA 4H3DA 1HO4A 1LZOA 5FF2A 4JYFA 4UIOA 3CLMA 3F03K 4UFMA 2WQPA 4GC4A 5AYYA 4AAJA 1BKSA 1V5XA 5CSSA 3F1QA 4DXVA 2FPYA 5KTLA 3TKFA 1FXQA 3IIXA 4EWND 4BI6A 3A21A 3TMLA 3N2XA 1PV8A 3MHUA 3W74A 3MUXA 5C6MA 4RLIA 4NJIA 3UZJA 2NUXA 3A5VA 1Z42A 2C18A 1VLWA 1G7VA 3PBUA 1TPB1 3VFLA 3NVTA 4XQ6A 1XBYA 4UTWC 3TH6A 2FIQA 1ZCOA 5AFDA 2A6NA 2JKAA 3G0UA 3MI3A 4UFJA 1GVOA 1RR2A 5FF7A 1MZHA 3CTLA 5FF3A 3MP3A 4N9BA 5FF4A 1FCUA 4N02A 1K02A 3GXNA 3WK0A 1OF6A 1W1ZA 5K9XA 3TFXA 2FPTA 3C3NA 1ALDA 2B7OA 1T8XA 4ML9A 4OV9A 1JRCA 1ZAIA 1SZEA 3IGXA 4UTHA 3DKLA 1TREA 2E6AA 3GDLA 3PC0A 4K37A 5I3FA 2E5CA 3EKLA 4YMZA 2A2IA 4O52A 2RKXA 5BMWA 1AG1O 2OMAA 1BTMA 1FX6A 2UV8G 1AL8A 2VEPA 4OGZA 5LZLA 1W5OA 5FEWA 1WYIA 1SZFA 4Z1AA 3PSWA 2C1HA 4NX0A 1X1OA 4LRTA 1KTNA 3G3DA 3SFKA 4H4IA 3HG3A 4JX6A 3GIYA 4PTNA 2ZQ0A 3HG5A 1FXPA 1GTEA 5AHLA 1I2QA 3EX6A 3SW6A 2QUUA 4M7SA 1R30A 1IF2A 3PSVA 5HUOA 3NA8A 1OK6A 1JCNA 4GUGA 4NQ1A 1M6JA 1P0NA 1LOQA 3PUOA 2H3BA 3W1AA 2RHGA 2JK2A 1P1XA 3NQ2A 4WUIA 2H3DA 2WSYA 3W3OA 5ABTA 4WOZA 1QWGA 3GNDA 3FYPA 4O17A 4PEKA 1PHQA 4DF0A 4WJEA 2VEKA 4LV9A 4LS0A 4NXKA 4S2CA 3DBPA 4BI5A 3N9SA 2DZVA 4DO4A 3SIZA 4RZ4A 1ZALA 4MLRA 2Q3OA 4KWWA 2OT1A 1JCJA 4M6VA 1U83A 3GLCA 5G4WA 3USBA 4IX0A 5HWJA 3M9YA 4HSOA 2J88A 1LBLA 4FIQA 1LRTA 2FTPA 3NL3A 3LV6A 1CW2A 3W7QA 2BXVA 3PB0A 3IVUA 4O50A 5LGXA 4JIPA 3NZRA 1GVQA 3PY2A 1TQXA 3TSMA 3S6DA 4N9CA 4OHQA 4GRSA 4MY9A 5AHEA 4PL1A 1MEWA 3IV3A 4U4MA 5EY5A 2QCHA 2E6DA 2FDSA 4QM1A 4HN4A 4PODA 3DZ1A 3N19B 4TX9A 3GXPA 3DI0A 3TC6A 2CLKA 2QCFA 4RJEA 1N55A 1WXJA 1C9DA 5HNRA 1BWLA 4JTGA 4Y8FA 2CZEA 4ZQRA 4LUIA 1K7XA 3LGEA 4CCCA 5AC8A 4EF8A 2YW3A 4MZYA 3CU2A 1JCMP 3UWUA 4FNQA 5H91A 4DO6A 1ICSA 3W1QA 4ZVJA 1EEPA 2Q8ZA 2NXGA 3GXTA 3GDRA 3LHTA 3EXTA 3SR7A 2NV1A 1SO5A 2YZRA 3DAQA 3T44A 4Q33A 1TTQA 4AEOA 3LXAA 2WV8A 1YDVA 3K30A 2CU0A 3KVKA 3P5ZA 2C16A 2H8ZA 3LERA 4O8RA 5F1VA 3P82A 3S1UA 1Q45A 5DCDA 4TMCA 2YYTA 1X1ZA 3NNTA 3W1NA 1OX5A 3UY7A 3E12A 3GNNA 1JUBA 4M6QA 3S5ZA 1AW2A 5D05A 3CWOX 3TE9A 1KM2A 3NPUA 2X1RA 2Q3RA 5U7SA 2FFCA 1ZAHA 1Q6LA 2ZZ2A 2QCNA 3DFPA 3QRHA 3BW4A 4O14A 3C2FA 4IMEA 1NEYA 2WPBA 1WA3A 1KTBA 4Y90A 1F7BA 5BW6A 1KFLA 4MFDA 3C61A 3W86A 3I7RA 2FQIA 1AMKA 3RLUA 1F74A 1GWJA 3PR2A 3TCEA 4LVBA 4FXRA 3W7OA 5G2WA 3P84A 1UCWA 1F05A 4CLMA 1NVMA 1WX0A 1JRBA 3FJ6A 3B0VC 3LCLA 4ADTA 4HNVA 2VFDA 4O18A 1VCGA 3NQCA 1NFBA 4JYDA 3BGGA 4TO8A 2AGKA 3IEBA 1P4CA 2A6LA 5LNUA 4UTIA 1XC4A 1EP1A 2R91A 3W7HA 3HMJG 1YDOA 1EWEA 1B57A 1THFD 1LM1A 2RFGA 3C2VA 3QQ1A 3STEA 5BMXA 4FNTA 1KV8A 5HMSA 4ZQPA 5KZEA 1LCOA 3W1MA 1XKYA 2CLIA 2NZLA 1FWTA 2ZRZA 1Z44A 2X2GA 5G4EA 3W2JA 3W2UA 3NDOA 1H1ZA 3QH2A 2QJGA 1A53A 5DLCA 1J2WA 1FCQA 3NR0A 4CQ8A 1PCWA 1QOPA 3G8RA 4K7VA 1UBSA 1VYSX 4N2YA 5FI8A 4OBTA 4UNKA 2CLOA 4LRSA 3PBVA 4X9SA 1TYGA 1W54A 1KFBA 2H8XA 1VYPX 4M19A 3S5YA 3P7YA 4JEQA 1LBFA 1GPWA 3EWXA 3KOFA 1J5TA 5LNRA 1G4EA 2YGYA 1TRDA 1SW7A 1QPOA 3PBWA 3GR7A 2GOUA 3HBLA 4KFPA 5H2ZA 2NV2A 4LW7A 1L6WA 3VE7A 2PRMA 3A9IA 4XBSA 4NXSA 1EX5A 3N3MA 3L5AA 3TA6A 2R8WA 3CM4A 1W3TA 6TIMA 3F4WA 3BVJA 4UFLA 3HF3A 5F4SA 1JQVA 1HUVA 3DKJA 4JTUA 3GX9A 3QMRA 3TQ0A 3W1LA 2BZNA 2Y88A 2E77A 2JBMA 1IXQA 4GBUA 1W0MA 3EX1A 3EX2A 4K36A 3TAOA 4BF9A 3A23A 1HL2A 1SW0A 4RV8A 4AHQA 2Y7GA 3HOJA 3M7WA 3T55A 3H54A 5K4XA 2NX3A 4IJBA 1B4EA 2E68A 5E93A 1QOQA 1EP3A 2ZA2A 3IIPA 3S1WA 2P10A 3TNOA 5IBXC 4OT7A 5K3VA 4O19A 1YTEA 2FB2A 5FEPA 1J4EA 3HQ1A 3QSRA 2X1TA 4ORIA 4X2RA 2ISSA 2V82A 5E0KA 3VI2A 2QUVA 7TIMA 1FQ0A 4FNRA 1XFBA 2PCQA 2GQAA 3LOTA 4J9JA 4DF2A 1H5YA 4GWEA 4LU0A 5K7JA 5HUPA 1ZJIA 3R89A 3LCIA 4A29A 1XBXA 4WX2A 3O63A 1SSDA 4FO4A 5CG7A 3NQVA 1GJPA 1GVSA 3UWWA 1YPIA 2QDGA 2V5LA 1GG1A 4M6PA 1KM6A 1ZHAA 3E02A 3M47A 3GDTA 1YTKA 5K9CA 3W22A 3HGJA 1LRNA 4HKPA 4UFKA 3OBKA 2WSQA 2EHHA 2BLEA 4ZMGA 4U28A 4GUIA 5K9DA 4BK9A 3V75A 1EP2A 1TJRA 1D3GA 4JD4A 2ZYFA 4O57A 3W2NA 1OK4A 1GEQA 3W1TA 4DQWA 1BWKA 1LBMA 4WXYA 4YCOA 1W5NA 5TIMA 3LLDA 4JNMA 3MBFA 3G18A 5AB3A 2DP3A 2W6RA 2TSYA 2A5HA 1AL7A 3CEUA 3GVGA 4TU1A 3WJSA 3W84A 4XZ9A 3B04A 1KFEA 3UPWA 3IIVA 2V30A 3W7JA 4FEZA 2JKEA 5D38A 3QPZA 3JS3A 2WOQA 3O07A 3NL6A 1G67A 3LHZA 1K3UA 1XUZA 4ZQMA 1XM3A 4ZZ9A 4P2VA 4PC8A 1X8FA 1XL9A 1OYCA 5CZTA 2D73A 3EEGA 1Q6QA 3IIZA 3UPBA 4UTWA 1K8ZA 1NAL1 4FX7A 4UC5A 5K4ZA 3LI1A 2NLIA 2YYUA 3EXRA 2V2DA 1M7PA 3A24A 3BV4A 3RLVA 3KRUA 4FF7A 3ZS4A 3OVPA 4O1BA 2OZ0A 2QKFA 3NG3A 4JTLA 2HS8A 3YPIA 1W5PA 3TMQA 1TO3A 1KBJA 4DO5A 3DU0A 1B4KA 4JGDA 3IVTA 2VFFA 3DFQA 3LX9A 5FEZA 3M16A 1P0KA 1LLWA 1H62A 1YXCA 4JIQA 4Q4KA 1SZNA 2CZFA 4LVAA 5MHBA 4QSHA 4E0CA 3W07A 1EA0A 3R2GA 3SGZA 4E2BA 5KSWA 3P81A 3P62A 1Y0EA 2DZTA 2VC6A 1V7YA 1JUKA 1O94A 4UNLA 3JR2A 3M43A 5DBUA 4DPQA 3S5OA 4O16A 1W37A 2RDTA 1CI1A 4ZL1A 3WK3A 3OVRA 3NOEA 3CQ0A 3MP4A 3HJZA 4GNJA 4JTHA 2Z6JA 3EX3A 3KVMA 2DZWA 4JTSA 3R8RA 3MO7A 2GJLA 2CW6A 3ATYA 1I2RA 2DJLA 3B05A 4Z1DA 1JUEA 3W2MA 4FHAA 4FNUA 1GYLA 1W31A 1RQBA 4FNPA 4MKNA 4N4QA 5CZ0A 3TC7A 4AWUA 2CLMA 1I4NA 3I68A 1OFAA 3CIXA 1VPXA 4QNEA 1TPEA 2G96A 4AVFA 2PRLA 4MZ8A 3G1SA 1PIIA 4O0KA 3SY5A 3O06A 4AF0A 3FLUA 4Z1BA 3KRZA 3UY8A 5F4WA 3W70A 2X16A 1YTDA 3TQVA 3LCXA 3FS2A 3WK2A 1VH7A 5EPDA 4A2RA 3I7QA 3KRSA 1VHCA 5U4NA 1VGAA 3G22A 3LDVA 3G8EA 3OEXA 4YWIA 5D09A 3LRKA 2A7RA 3T7VA 1QPNA 3VNDA 3BW3A 4ICNA 4JY8A 5D2WA 4H6KA 3LV5A 3E0IA 2W79A 4MZ1A 1LP6A 1ME8A 3N73A 3G1VA 3C8FA 1H51A 1VRDA 2CLFA 2G95A 3CPRA 4MY1A 5EL1A 1XDLA 2E5DA 5EA9A 5IM51 2A7PA 4WY0A 3BK0A 1ME7A 4IPIA 2EKCA 2QCMA 3DHDA 1PE1A 1NF0A 4JX5A 1H63A 3B06A 3CB8A 3G1AA 3L0GA 4NJKA 1TPUA 2ZZ5A 4K8EA 3W7PA 1OFQA 2J9ZA 1HG3A 3UXAA 4DEFA 4XBKA 3T4CA 2VELA 1GZGA 2QCEA 3OG3A 1KV5A 3BG5A 2JGYA 1TPC1 3W73A 1TIMA 4W9TA 3W9ZA 5I3KA 2Y70A 5CPNA 3W7NA 4GJ1A 3QZEA 3ZWSA 1KW1A 2ZTKA 1QDSA 1X7FA 2B4GA 4HPXA 3VE9A 5F2GA 4A21A 1C8VA 3GDKA 4EOUA 4OU1A 2QJHA 1XUUA 5KMYA 1FWWA 3S8HA 2FB3A 4HNUA 3IGUA 3C4UA 3L68A 4JTJA 1KLYA 3W83A 3FOKA 3O6DA 5C55A 1CX9A 4LTSA 5DN1A 4K39A 4A22A 2RH9A 1N7KA 4ADSA 4O1CA 4MLJA 1L6YA 4JTFA 4WOQA 4UTMA 2ZZ3A 1JCLA 1OJXA 2ZZ7A 1YYAA 2O7SA 3STFA 3QEZA 1VQTA 4UFIA 4AWTA 1IIGA 3E9AA 4O10A 2YW4A 2QEZA 3RFAA 1I45A 4GUFA 5DCEA 3GYEA 4LOCA 1EPXA 4FIRA 3MYOA 2J9YA 4UR7A 2E5BA 3P5YA 4IMCA 3M41A 3TDFA 1SU5A 3FKRA 2V8ZA 3NQ8A 3DXIA 3PG9A 2QF7A 4GE8A 1RD5A 3Q58A 4LNYA 3LI0A 4GUHA 2ZRVA 5LSMA 3UNDA 2ZZ6A 1FY6A 5EYWA 1T96A 4P61A 1A5AA 1G6CA 2FLIA 2GQ9A 2OJPA 2VEIA 2R14A 4UFHA 3LTPA 4XUGA 2WNNA 3L0NA 4XTDA 3QM3A 3G3MA 3BARA 3LLFA 2DZUA 3ZR4A 3DHFA 3G1YA 2E6YA 4NX5A 1Z41A 5L9FA 1S5TA 3M6YA 2DZSA 2VOMA 4Q32A 3WK1A 2J24A 3CEPA 1KFKA 5EBUA 1RQEA 3W2LA 3W2KA 3C0JA 1AK5A 2A85A 2DZPA 4AMAA 1R46A 4UUIA 3WJWA 1K8XA 3IRDA 4DBDA 2BX7A 1B9BA 4O54A 2Z1BA 3PULA 1RV8A 4FX8A 1TV7A 1DJQA 1TPWA 2ISVA 4MUZA 4K38A 3GR8A 1FCVA 4PFMA 3IGSA 2V5BA 4IX2A 4QAIA 4I9AA 1F6PA 1OABA 3PS7A 2ZRUA 3EKZA 2WKJA 4XWUA 1AW1A 4UTUA 3C52A 1VHNA 1I2NA 3VCRA 1TTJA 5A8GA 3TUUA 3R13A 2A0NA 2C13A 3KFTA 2YX0A 1OX4A 4IGHA 3LBMA 4UTTC 2BSLA 3NPXA 4LS1A 3THAA 3G0SA 3LB0A 4QITA 1TSIA 1TCDA 2ZRYA 4HNTA 3UD6A 1TPDA 1UJPA 3M5VA 3V1PA 2CWNA 5C5YA 1VYRA 2EAWA 3BLIA 2RDWA 2GVGA 2C19A 4NUWA 4RZ5A 5IBXA 2A1YA 2WO5A 3NQFA 3NQMA 4NJHA 3ABOA 2OCZA 1O4UA 4MPQA 3STCA 4IOTA 5F2MA 3EX4A 3NO5A 2ZZ1A 2WJZA 1QAPA 3T40A 2B7PA 4JTIA 2B7NA 1G7UA 3G1FA 4AXKA 5LHFA 3B8DA 2J6XA 2ABBA 4LVGA 1S5VA 2R94A 4MOZA 3NQDA 3Q94A 4MIMA 3RMJA 5SWUA 1RZMA 3A5FA 5J5DA 5FEXA 4NJGA 1H50A 4AWSA 3I65A 1EUAA 1IIHA 4O0ZA 1K7FA 4KFOA 1XI3A 1QPRA 3LM7A 1GG0A 1KM5A 5HWNA 1LORA 3PB2A 2NUYA 4UXDA 2ZRWA 3W23A 1RVGA 1UASA 2EGZA 4AH7A 4G1KA 1LOSA 4XKYA 3DFTA 3THQA 3TW7A 2X1UA 2GPTA 4PA8A 1RQHA 4EVZA 1N8FA 1P5BA 1OFPA 3UYCA 2YCEA 5I3GA 2E09A 4I7UA 5EKYA 1ADOA 3P8IA 4ZQOA 3LBCA 2B0MA 3CC1A 4AHOA 1KA9F 4YCPA 1DKWA 3S42A 3O16A 1MXSA 1MSSA 3CHVA 3MW7A 1WAUA 1QNVA 3VKJA 4NT0A 4XTIA 4I7WA 3GKAA 3W85A 1I2PA 3QFEA 2AAMA 4O28A 1H7NA 4BI7A 2O7QA 2JKPA 1QR7A 3FJLA 2DORA 2ZCGA 4S1FA 1A50A 3OA3A 2ZDRA 2HSAA 2A4AA 2CZDA 4Y6GA 4E38A 3EWWA 4IMFA 3TSBA 1QO2A 1SZGA 4NU7A 5DY2A 1KFJA 5I3HA 4RCXA 2HS6A 4YLWA 3ZFHA 5LHEA 3GKFA 5TBOA 3KXQA 4NNBA 3FIGA 3G1XA 3PM6A 4AHPA 4L4LA 4C1LA 2E1DA 2C0AA 2YPIA 3KVLA 3HGOA 3NXFA 3TXZA 2YFOA 4K6AA 1LLZA 1QO5A 4MJMA 3LCWA 5G1TA 1TTIA 2YXGA 4O4VA 4JR5A 1DVJA 2X1SA 4NZJA 1TB3A 1TTPA 3T78A 4Z08A 3RU6A 1PCKA 2JGQA 1G69A 3TJXA 2QCGA 3H55A 1JCXA 5DY3A 3MBDA 5LNWA 1OFBA 4O11A 3O1NA 2F7FA 3GK0A 4X3ZA 5DCBA 5D33A 3P61A 3EWYA 2NXHA
chains in the Genus database with same CATH superfamily
1EHNA 1RLCL 1I60A 3LHUA 1RP8A 1VZWA 4GO9A 3SM0A 3NQGA 2A21A 4L4PA 1DHPA 3UG4A 4YTSA 2XN2A 3G24A 2V0TA 3WUFA 2YR1A 2F6KA 1PO9A 2HDJA 4KBXA 1IEVA 1QI3A 2V67A 1J18A 3FDGA 1K4GA 3AIUA 3R4IA 5A8MA 4EIVA 1GQLA 5HR7A 2BTMA 4H7ZA 1EUNA 3ZJ8A 1UP3A 5CC7A 2XZ7A 2WHJA 4OUEA 4MVAA 1F3WA 3FXGA 3B0PA 1EF3A 1UD6A 2E6FA 5A8QA 3W7MA 1HN1A 2P3ZA 5A6SA 3AHYA 4AIOA 1X8CA 3OVGA 3GHSA 1LWIA 1TELA 2ZC1A 2ZXQA 1QNRA 3W7KA 3PAJA 3P3BA 3AU6A 1WDRA 4FOJA 4GYFA 2Z1WA 5D2TA 2DZXA 2DVUA 2Q02A 2V2CA 3A3XA 4MUPA 1O68A 4ZO7A 1B3OA 1MRQA 1DV7A 1KBIA 1RJPA 2ZRXA 1PIGA 1XXXA 1GEHA 4QE4A 2HMCA 1VFHA 1CLKA 3QV9A 1EX1A 4BHYA 2ZVRA 4DUVA 4N7QA 4GZJA 3T0AA 3H8AA 1FDJA 2WZIA 4IMAA 1KKOA 1RH9A 2P0IA 3TLQA 4IF2A 1W3LA 3L5LA 2Y7DA 3FY1A 1UHVA 3VOIA 3RAOA 5GNXA 4YL2A 3LY0A 3PG8A 4PMXA 3ZOAA 1D7FA 1QATA 4HPJA 3QPYA 4JNZA 1G0CA 3GS6A 4YTRA 2C1GA 4NAEA 3NZ1A 1E4NA 3JU2A 3RX4A 4HYVA 3UWYA 4AVOA 2V69A 4OV4A 2Z6IA 5D2VA 1KWKA 1VFMA 3HM7A 4C1KA 4CU8A 4H9VA 4NAEB 4HPNA 5DELA 2P0OA 2XN1A 1PHWA 1YLVA 4CN1A 2VGIA 1BAGA 1MVYA 3WH7A 1IGWA 4PZVA 3M5XA 4K7YA 3ATZA 3N34A 1M3UA 4MM1A 1GOIA 4U3CA 4QXIA 1UB3A 3DENA 4ICMA 3PANA 1O6IA 4BS0A 5EU9A 3NL2A 4YN5A 5L6UA 3GHTA 1AD4A 4K8HA 1D2KA 4JQ1A 1QI4A 5EGRA 5T9BG 2G5WA 1NOFA 5CJMA 3WQ6A 4WQ6A 3TR9A 4REQB 2OQHA 3L4VA 3CMFA 2A3CA 2Z29A 2DSKA 3ANYA 3VCCA 1Q6RA 2EPHA 3UJEA 3KL0A 2I5IA 2YB4A 5TAOA 2Z4GA 3CJPA 3PZUA 3L21A 4KPLA 2V9DA 3MSRA 5GNYA 3DFSA 3QW4B 2C91A 1A5OC 3O6YX 1Q6EA 1Q7QA 1BXNA 3HG4A 3VINA 2J62A 4S3BA 4BA0A 2A3EA 2DU2A 1EIXA 4MNJA 3VKAA 1FDZA 1JZ8A 3ANVA 3NM3A 2VFHA 1TWZA 1JDEA 2EF9A 2VURA 4WEVX 1XW8A 1GOKA 2NX1A 3P67A 4UTTA 1R2RA 1LROA 2J7BA 1I8JA 5H8MA 1J8VA 4UCFA 1XCFA 4NVTA 3I7SA 4I6KA 1DJNA 1M01A 2J13A 1E9YB 3QPEA 1SJDA 4HVXA 4GZIA 3CH0A 3KBNA 2DQWA 4E3VA 1E9ZB 4TR9A 4W8AA 2WJFA 3LA4A 1TR1A 1V0NA 5A6AA 1V93A 5DT7A 1U5VA 3DYOA 2DSZA 3SRKA 9XIAA 4A3UA 1HIZA 2ATMA 2H6RA 3AHTA 3GHRA 4R7JA 1J0HA 5AYZA 3SSJA 2V63A 1OZMA 1QW7A 2G3IA 3W7DA 3WNKA 4K1GA 3GU2A 4C6DA 5TF0A 3LS9A 1GVEA 4DNMA 3MZNA 4FP1A 1QU4A 3K1DA 3RX2A 3GZ3A 3N4EA 3L4ZA 3LSCA 4GACA 1JPIA 4JFVA 3ABRA 3L4UA 3I3BA 4IXXA 3MHGA 4UWMA 3QC3A 3T07A 4I90A 4D9PA 5A2BA 1RK6A 1VC4A 3H22A 2Z0IA 1MEIA 4LC8A 1R38A 2UZ9A 4KCTA 3S0CA 1XSJA 1OX4B 2Z2UA 3AS1A 5HJYA 2VQTA 1SR0A 1RAKA 1GVYA 1ONRA 2C7FA 3PBGA 4GI4A 1H7WA 4TV6A 1MDLA 3EKGA 5I07A 4I9JA 3E2QA 3PBMA 4E6MA 1XYCA 1OWQA 3K4AA 1WUFA 2I9UA 4QEHA 1DXFA 4DBEA 4HNOA 4D8AA 4XO7A 1BHGA 2TMDA 3H2NA 3AMGA 4C7FA 4NL1A 1TVPA 1MNZA 3WMLA 3INPA 1EO5A 2FVKA 3GB6A 3WD1A 3ZMRA 1HJSA 4MB5A 1UZDA 4M1BA 5HJLA 2OKTA 4GX9A 3AXIA 3W76A 3A4JA 3EA2A 2NVDA 3TJ4A 3EWZA 3QJAA 1PWLA 1D3HA 1KB3A 1GONA 5EMJA 1HFBA 3L0KA 3PTDA 4DBUA 3OBAA 1TPFA 1XCWA 3ABSA 2PRHA 1I1WA 4LY8A 1JGIA 2CHOA 1JCYA 4PH6A 3N9RA 1O60A 3U8GA 2EJAA 1VIZA 4Q8QA 1C29A 4ZSUA 5JQ9A 2ZICA 4IZGA 1H7OA 3SECA 3RR4A 4HZMA 1VIWA 3SCNA 5A6BD 4CNOA 3VD5A 1E5JA 4IPJA 1XIHA 4AD3A 4J3ZA 1XWYA 3GG0A 1YHTA 2QVNA 1K7EA 4Q8TA 1JJKA 2QCLA 3ONCA 1X98A 2PLJA 3QQ0A 1N8IA 4P8VA 3TC3A 3EB2A 2QJIA 1CWYA 3NPWA 2XU2A 4ADUA 3OGSA 1W56A 5AC7A 2X8RA 5CZJA 2WMKA 4G56A 5CAKA 4RNHA 3EXSA 3DFOA 3L2IA 4MJZA 1WNOA 1SUXA 3GXDA 1FA2A 1POKA 2CCRA 4IL0A 1XPYA 1NF7A 4N6FA 5LIKX 3L66A 1C8XA 2Y89A 1UWUA 3UPMA 1WQ5A 1UBPC 2W91A 3OQEA 4EXBA 2OFJA 1RPXA 1ZBKA 3G77A 4GVIA 1JQXA 3CV1A 1JF6A 3O7UA 4RXFA 4HYWA 3G1HA 3FAWA 2OYMA 4ZE5A 1DWGM 4R53A 3TV8A 1A80A 1CXEA 3FA5A 4DVOA 3AHXA 2AQWA 2QYGA 3QOMA 1TPVA 3KS5A 4CNPA 3EOLA 1AH4A 4I5UA 5G5IA 4V1YA 3RO6A 3N14A 5CSYA 2X42A 4RR4A 1KFCA 3BAIA 1BG9A 3V5FA 3WF1A 3STGA 5A5WA 1SPQA 5C9XA 1QUMA 5E9AA 4L6HA 3BCDA 2BVTA 1M65A 5D32A 1KD0A 3WLNA 3BLFA 1K77A 1TQJA 3WMCA 3PWAA 4Q4OA 5D2YA 3LLXA 3B9DA 1L6SA 2F6UA 4LAMA 2Y8KA 4Y9PA 3LQGA 1Q65A 3SGGA 3R5EA 3AMLA 1G5AA 1SO3A 2F6XA 4W7UA 1WUEA 3TU9A 3L2LA 4WR3A 1HO4A 3B8UA 1XD1A 4K1WA 3MTWA 3BDKA 4K2SA 1YBQB 4DXKA 1POJA 2WQPA 3B8IA 3VAVA 2YCLA 2DIEA 4AAJA 4PMQA 1V5XA 4G7EB 3F1QA 4DXVA 1E1CA 1A0EA 3CUFA 3WQGA 3EOSA 4BI6A 3A21A 4GX8A 3OZMA 2I56A 2YCLB 3TMLA 1JDFA 5C6MA 1TV3A 3MUXA 4RLIA 1Y5WA 1EDTA 1E6SM 4DLFA 1W1IE 3PBUA 1IZCA 4XIMA 3NVTA 3AIRA 2Z2BA 3S46A 3TH6A 1S2CA 3R11A 3OLIA 2CLPA 4PB5A 2JKAA 3TTSA 1GVOA 1RR2A 3KDOA 1QTWA 2QT3A 5FF3A 1QK2A 4JAWA 2REQA 4F0KA 4HCDA 2VD8A 4OKDA 3GXNA 2BY0A 3WK0A 4OJYA 1IR2A 1OCBA 2B7OA 2R1MA 4ML9A 1JI1A 2WSPA 4XAPA 3NDYA 2REQB 1DJIA 3NSXA 4NKCA 4ECLA 2OLHA 2RKXA 5BRPA 3VIFA 1AG1O 3H4XA 3WDQA 3PZ9A 4ZGYA 2PP3A 3URAA 1AL8A 2VEPA 4IPPA 3QGVA 5FEWA 4MWAD 3WEZA 1ZBVA 4Z1AA 2J7DA 2VJXA 2I16A 2XIQA 4E2OA 3ZSSA 2ZQ0A 3HG5A 3IUIA 3AC0A 5AHLA 7TAAA 3EX6A 2YBVA 2FYMA 3WH9A 3VO0A 4GLEA 4RL3A 3OGRA 2PDMA 5HUOA 2BFGA 3WDPP 1M6JA 2AOSA 3PUOA 5DRIA 5BXTA 1P1XA 4QEEA 3NQ2A 2WSYA 3KWSA 3APTA 3W3OA 3BOXA 5ABTA 1AZ2A 6ENLA 4O17A 4LV9A 1W1PA 4LS0A 4NXKA 3W38A 3OLGA 4MLRA 4GISA 3PJTA 1OGSA 4KWWA 3NYDA 2OT1A 1U83A 2XH7A 3KOYA 4LAKA 3CZJA 3RLGA 4HHHA 4IX0A 5HWJA 2J88A 1KGWA 4AIBA 5C9WA 3LV6A 3MCOA 2BXVA 3BV7A 1GW9A 4LJ3A 1GQIA 4O50A 3KL5A 1ISYA 2YLLA 4JIPA 1GVQA 4NYYA 3SCUA 3PY2A 4JQ2A 4GQRA 1MFUA 3S6DA 3S9ZA 4N9CA 4OHQA 4GRSA 3H7UA 3R1ZA 5AHEA 4U4MA 5EY5A 2DT1A 3C0QA 1BRLB 1PZ1A 4ATWA 2YA0A 3GXPA 4GK8A 4RJEA 1WKEA 1N55A 1WXJA 1E1FA 1C9DA 1PPIA 1BWLA 3DCPA 4KWUA 4ZQRA 2PZ0A 3LGEA 1XLLA 4UZSA 1JCMP 1HJWA 4UQBA 2AKMA 4FNQA 2YXXA 2HE5A 3D46A 4ZVJA 1EEPA 3WQFA 2Q8ZA 3A6OA 1TUFA 1BKHA 3GDRA 3LHTA 4GGBA 3BSGA 2X7VA 6XIMA 1QNPA 5F1VA 2YYTA 1AQMA 3UY7A 1DTUA 1J6OA 1MQRA 1JUBA 4M6QA 5D05A 4L5ZA 3DFHA 3DFPA 2J7FA 3TCSA 4H04A 4TTUA 3TZFA 4GO8A 1HQTA 1F7BA 4MHBA 1GUVA 1YX1A 3W86A 4DBSA 4DWSC 4OBRA 3PJWA 2IKHA 1B3YA 3P84A 1UCWA 2VOTA 1V8EA 3L12A 4HNVA 1PKYA 4O18A 2R82A 1NFBA 3V5OA 1X38A 4JYDA 2PBGA 3IEBA 2DUAA 3M0MA 1EP1A 3CYJA 3K4DA 3UG5A 1JAKA 4GC3A 3HMJG 3NSMA 1EWEA 1LM1A 3STEA 4DZ5A 5I7GA 1K9TA 5JBEA 4QR6A 3VUSA 3W1MA 2NZLA 1FWTA 3C8NA 3A4WA 2PDKA 3C3UA 3T09A 3ZR6A 5ABGA 4MB3A 1H1ZA 4US5D 5CEWA 5CZKA 3LGGA 3T05A 1HZYA 1QOPA 3G8RA 2CKRA 2GDVA 4JIIX 4UNKA 1JAEA 2XWEA 1QK0A 1VYPX 3P7YA 3CO8A 1GPWA 1BF2A 4QHRA 1G4EA 5H2ZA 5E6ZA 3DC0A 5HMEA 1IWBA 1UP2A 5CJ5A 2WMJA 3A9IA 3UNTA 2PSNA 1GHRA 4XBSA 4IFOA 4Y8EA 4YPJA 1B2YA 4BF7A 3H26A 4TTGA 5F4SA 3TYDA 4KRTA 1P7TA 1I9CB 4JTUA 2PF0A 3GX9A 1EYEA 1XSIA 3MS8A 2GFTA 4KT2A 1U30A 4S3FA 2AQVA 2BZNA 2E77A 1ECEA 2JBMA 1IXQA 4GBUA 1W0MA 3KDNA 4DM1A 3WD0A 4LCRA 4F0SA 3TAOA 3WLIA 2E7FA 1B3XA 1W9PA 5A6TC 4AHQA 1Y8BA 4HZ8A 3H54A 4IJBA 2OSXA 1V51A 5JU6A 3N6QA 5IDIA 3TNOA 1IE7C 5K3VA 3L4TA 3THDA 1YTEA 1JZ5A 4V27A 3QR1A 1CLXA 3D6NA 2V82A 2QUVA 4LH8A 1QRQA 2AKZA 2GQAA 4XAYA 3FN9A 4GWEA 4Z2LA 1UOZA 3ARXA 4AC1X 4GG9A 4YVXA 1K4HA 3AQUA 3UWWA 1PKNA 3GWQA 3LBOA 3N1AA 1PKMA 3VX1A 2PDLA 2QDGA 1RUSA 1ZHAA 2BNJA 1WXZA 3GDTA 2ZX5A 2RGLA 3W22A 4BKNA 1PYFA 1JG9A 2IUZA 1TV2A 2GDQA 4UB9A 1NU5A 3AJ7A 4ZO8A 2HISA 4AY8A 2IKIA 1Q8AA 5C7HA 1NM9A 4KEUA 1OINA 1S39A 1VPQA 1TJRA 2ZYFA 4U3AA 3L4XA 4HMEA 1BWKA 1CLVA 5IHSA 4PUJA 3EGJA 1XYAA 2VUYA 3G18A 3WYZA 4DZHA 2VWTA 1BGAA 4FA3A 3KEHA 3WJSA 1O7AA 1C7SA 4ACYA 2DQXA 4XZ9A 3EPOA 3IIVA 2V30A 4AD2A 3LEPA 3JS3A 3BGAA 2WOQA 4W5UA 3O07A 3MKKA 1T8QA 4QJ5B 5BOFA 1XUZA 4ZQMA 4AZBA 4KW2A 4P2VA 1WDDA 4C7DA 2D73A 3EEGA 3DG3A 1K8ZA 4NZ3A 5DO8A 6A3HA 3SRHA 3LI1A 3VTRA 2NLIA 1PTGA 3DGBA 1DJGA 1ZBWA 1PZ3A 1DPMA 1WKDA 2FVLA 1M7PA 3N3TA 4QTGA 3A24A 3AMDA 3RLVA 1V4YA 4P7NA 1A5LC 3OVPA 2OZ0A 4WF7A 3N2CA 3UU0A 2A3HA 3BSMA 4F9JA 1KBJA 4DO5A 1B4KA 2QZRA 4JIRA 1XIFA 2VFFA 3GVRA 4WJXA 4BF5A 2DW7A 4M80A 1KXTA 5E9XA 2CZFA 5MHBA 4QSHA 4AZIA 4E2BA 1E6RA 2CBUA 3P62A 1Y0EA 2F38A 3RM4A 3H4GA 2XJ7A 4IIHA 1W37A 3GY1A 3U7VA 3T0BA 1ZTVA 2YBUA 1UJQA 2FDMA 3KVMA 4JTSA 2CERA 2GJLA 4GH1A 1V3LA 3NJ3A 2CW6A 2DJLA 2QQ6A 3B05A 1XG3A 4FHAA 1W31A 1RQBA 4AWUA 2CLMA 3I68A 4Z2HA 1KRMA 4AVFA 2XSBA 4MZ8A 1E72M 4DY1A 1PIIA 3WF4A 1P0EA 3H21A 3CHDA 3UY8A 2QGHA 1VH7A 5EPDA 3MC5A 1CZ1A 3SUVA 3LDVA 4HOZA 4AYSA 2W9MA 5MF5A 1DJWA 1TKKA 2DH3A 1UR1A 3OZOA 4ICNA 4H6KA 4F48A 4FLRA 4M8UA 4PTDA 2EPKX 1HL8A 1E15A 1LP6A 1J93A 3N73A 4V2XA 2O4QA 3C8FA 3CB3A 1CDGA 3AISA 5EA9A 2X2YA 1BPLB 3IJQA 2A7PA 3OW1A 1P6BA 2D2OA 3MV01 3DC8A 1RCQA 3DHDA 2HK0A 5CLTA 3URNA 1VBHA 3QTPA 4HU0A 2FZNA 1XYBA 3G1AA 3T6CA 3L0GA 4K8EA 2UY4A 3UXAA 1DTNA 3WH6A 2VELA 2GJRA 1FKXA 3GU1A 1KV5A 3BG5A 3GW0A 1TIWA 1E6QM 3C2YA 4W9TA 4L9YA 4QROA 4PULA 1SJAA 3W7NA 3CT2A 4GJ1A 1KW1A 3G1RA 3VE9A 4HPXA 3WDIA 1HF6A 4ZFMA 1JIBA 5F2GA 3B3DA 5CGMA 4FR6A 3SURA 3ME3A 4OU1A 2E8ZA 5KMYA 1FWWA 3S8HA 1U22A 3IGUA 2DZAA 1WB0A 2C79A 3FOKA 3O6DA 4PMRA 1CX9A 1NDVA 4K39A 1BTCA 2OTDA 4M51A 4UTMA 2ZZ3A 1JCLA 3NTYA 3KW3A 3M64A 1YYAA 3TZNA 1J01A 3QEZA 3LPGA 1VQTA 4M0XA 3ZO9A 1MQPA 1IIGA 4DWSB 1EPXA 4FIRA 4HOXA 1B5TA 2X41A 3MYOA 2VZVA 4F0MA 3M41A 1SU5A 1GPFA 3GG1A 4RW3A 3QZ6A 3PG9A 2QF7A 4GE8A 1RD5A 3UJSA 3VIHA 3BANA 5HATA 3UNDA 1CBGA 2EPLX 1E9IA 1E6NA 2FLIA 2GQ9A 2VEIA 3B9NA 1LWJA 4XUGA 1FOBA 2WNNA 3P93A 3G3MA 1RY0A 1Z41A 3AYSA 1ESWA 1AJ2A 3LG3A 3IARA 1E3ZA 2XFYA 3HTWA 3WK1A 3WY1A 2OELA 5EBUA 1E0XA 3W2LA 5I24A 3P2VA 4G5DA 2A85A 2DZPA 3S2LA 4PTMA 4YHGA 4DJEC 1KC7A 2QXWA 1K8XA 1RBAA 2PDCA 3R8GA 4XSLA 4MG4A 2Z1BA 1TV7A 4LEQA 1FCVA 4QAIA 3T9PA 2DIKA 2VGBA 2NV9A 1RBLA 4PE8A 4JHZA 4FAMA 4UTUA 1I2NA 3SUUA 2C13A 2INFA 1C8QA 3NPXA 1A5NC 1NY1A 3THAA 3B8WA 1VEMA 2WMGA 4HJWA 2P3EA 1A49A 4IGNA 3LK6A 1UJPA 3M5VA 3ITTA 1CGTA 2EAWA 3BLIA 1AFSA 2C19A 3CUZA 4NI3A 3KM8A 2A1YA 2WO5A 3M0KA 5HANA 4EKJA 1VEOA 2RDXA 5FAGA 5MKGA 5IDZA 4MPQA 4HA0A 4IOTA 3HQNA 4HQVA 4LBRA 1OCQA 4JTIA 4OOUA 4AXKA 1G7UA 4K3ZA 5LHFA 2VQUA 3WH5A 3MUIA 2ABBA 1S5VA 4A8RA 2HNEA 3NQDA 4MOZA 1WP6A 3H7VA 2CETA 2FKPA 4KCUA 3TYZA 1SYTA 5FEXA 2R1LA 5IOBA 2J7GA 4AWSA 3VM5A 2FH6A 3FW6A 3UR7A 4XO6A 3UA4A 1XI3A 1QPRA 1ZJAA 1R3SA 3AS0A 2UBPC 4BCEA 3WKZA 5HWNA 3AWOA 2NUYA 4DB7A 1M9HA 3BAKA 3CL7A 1QPKA 1NDYA 2EGZA 1E73M 2WANA 1LL4A 1LOSA 1S2TA 3DFTA 4QAWA 3TW7A 3FDKA 4S23A 1RQHA 4WVXA 1VBJA 3E38A 1OFPA 3UEQA 3E5PA 1IEWA 2YCEA 1MQQA 5I3GA 2E09A 4ZB5A 2VX7A 3P8IA 3LBCA 3WEMA 4O1EA 1MWOA 1QHOA 3SADA 1MSSA 3MW7A 3HU7A 5CBIA 1YDYA 4F8XA 4XTIA 2IPJA 3CWHA 3PUGA 3OOQA 4BI7A 4HK7A 4QS6A 1I75A 3AOFA 4HMDA 3QOKA 1OG6A 2FTYA 3OA3A 2ZDRA 3UG3A 3PNUA 2HSAA 9CGTA 3BURA 4Y6GA 2ACQA 4E38A 1IT8A 4IMFA 3P0XA 4XIAA 3RIKA 4PUDA 1KFJA 4LX4A 1WAWA 2GSEA 3GNOA 4IJRA 4P7RA 5LHEA 3KXQA 5FIPA 3FYYA 4NNBA 4JN7A 5HQLA 5KEZA 2A79A 2XPKA 4L4LA 2P50A 3NXFA 3TXZA 2YFOA 3VABA 3D47A 1QO5A 4X0VA 2OOFA 4AZ6A 1Q4NX 3CQIA 1DVJA 2WVSA 7A3HA 1K9DA 4NZCA 4D72A 3LENA 4IIDA 1G69A 2OZ3A 2QCGA 3H55A 2OB3A 3KTCA 3CYVA 4GNKB 4O11A 2IPGA 2VCCA 2F7FA 3GK0A 1GKPA 3EWYA 4IFKB 2VDGA 1UD4A 2VVSA 1ZSXA 1AVAA 1XBVA 3HIJA 3FVDA 2VXNA 3DHUA 1UUMA 4GZEA 3WJZA 4TVDA 1SGJA 3REQA 2VEFA 1VJZA 1FHVA 2QR6A 2BVDA 1PVNA 3S9IA 4LWWA 4MB4A 5KZMA 5I3IA 3FK4A 3MYPA 3QFWA 4IMDA 1H60A 2WNWA 4J7RA 2FJKA 1XSKA 3NQEA 1KM1A 1E40A 3EZ4A 4YHEA 3REQB 5FJTA 4DBWA 2J8TA 3U3HA 1OGGA 4AD0A 5G2HA 3VDHA 3RX3A 4JX4A 4ONVA 2TPSA 3SO7A 1ONEA 1H5VA 4R33A 1Q3NA 3OQ8A 4Z1CA 3KX6A 5HNUA 1FCBA 1ICQA 2V5DA 2BXYA 2NWRA 3RGTA 3AALA 4MWAE 3UGVA 4AB4A 2NQHA 5FJPA 2GJNA 3IWPA 4KEZA 3CQJA 4J2MA 4CCEA 2OEKA 1MO0A 3OGVA 2IPWA 4DPPA 4PTVA 4AYGA 4GCXA 3DYMA 4OQVA 5AHIA 1FTXA 5KZDA 1A0CA 4Y2WA 3G1DA 3W00A 4KRZA 1H0IA 1IWPA 2QMKA 5FACA 5G1YA 4UR8A 1AJ0A 1XH1A 2QDHA 3CAVA 4WK9A 3LXBA 3EWBX 4DF1A 4JFWA 3W1PA 1XH0A 1VLIA 4LUJA 4NYUA 5HINA 4ZSTA 4RDWA 1PSCA 1XLDA 4FI4A 4RZ6A 4JQ4A 4B5XA 3CUHA 3NQAA 4AF0B 4PL2A 2WB5A 1PBGA 2PU0A 5ABHA 3TSDA 3DECA 5KINA 1A5KC 2HBXA 1M7JA 3VFCA 1OM0A 4LVFA 1G4PA 2XFWA 3KUMA 1ODZA 4DELA 1SFSA 1EJUC 4C6EA 4DUXA 3TROA 4BWLC 1SO6A 4NI8A 4OFCA 4H2HA 2GQ3A 3D0CA 2G97A 3MDUA 6REQA 1VR6A 4TIMA 5I03A 4TVCA 4JXCA 1LQAA 1V6TA 3SCVA 3ICJA 2WW5A 4XZLX 5IHRA 5LNVA 3CAWA 2VD9A 4PCFA 2BB0A 1KFWA 1XDJA 2DY3A 2TRSA 4FX6M 3G6LA 5T26A 5LGZA 2PGFA 5AHMA 5AC4A 3S1GA 3AUJA 3GFYA 1R2SA 1D8WA 4QIUA 2E40A 3RMEA 1SW3A 2XGBA 5JH2A 2BHZA 4O4WA 4L4MA 2BODX 1MEHA 2VYOA 5C9ZA 3PZOA 2HVMA 4KEVA 3T08A 1UR3M 4PEEA 1XIMA 3WUGA 4GIEA 4EX4A 2E3ZA 3R0KA 5HK4A 2O92A 2DT3A 2ZA1A 1BLIA 3UR2A 4D1JA 1SMAA 1WZKA 4ZTXA 1LF1A 1ZB5A 2J8GA 4XB3A 4PMYA 1VFFA 1TZZA 4B90A 2BGQA 4EPBC 1XP3A 5I2UA 1T0OA 1OFOA 2OG9A 3MJYA 1XYMA 2XFFA 5HDRA 1HJVA 3UQNA 4S3KA 1Q6OA 2I1OA 3SEPA 3DI1A 5E1QA 2G37A 3VPLA 1YDNA 1F6KA 1F2JA 8XIAA 2NUWA 3KP1A 3E2VA 3DEQA 1XDMA 4ZENA 1ZFJA 1BG4A 2DPEA 2HXUA 3M5ZA 3HG2A 3FHAA 3QMTA 4GUJA 1ZGDA 4AZ5A 4QG6A 1IEQA 4B3LA 3CV6A 3Q2DA 3P0WA 2ZZ4A 3QGAC 5RUBA 3HPSA 2B7QA 2Z1SA 5I78A 5BROA 3W7LA 3S9YA 1LYXA 1TV5A 4ZA0A 4ORMA 2QDEA 1ML1A 3XIMA 3V0UA 3OTRA 5LIWX 1X97A 3GFZA 5AOUA 2BOFX 1ADSA 2C6QA 3U9IA 1F73A 2ZX8A 2AGTA 1ZENA 3OLDA 5CC5A 1DBTA 2PU1A 5J04A 1TJ0A 5CGQA 4HA3A 2LLEA 1CGUA 4PYSA 4Q7NA 2FMOA 3WMSA 5EB8A 5HWMA 4TXEA 1DXEA 2IXVA 5C71A 5E70A 4WGXA 4F9DA 3WZ0E 3USZA 3DOPA 3PAOA 1E4LA 1FBAA 2Z28A 4G9PA 2MANA 2BY2A 3W7RA 4L1WA 1I0BA 4OWGA 3VZXA 1SSGA 1FWNA 2D2JA 4OUIA 1XINA 4C6FA 1EQCA 4YWSA 3W71A 1KM0A 4Z1YA 3KHJA 1SFJA 3WL0A 3T2QA 2UY3A 1XX1A 3GFXA 3LMYA 1XCXA 2CBJA 3ABQA 4D6CA 3N2MA 4Z2JA 2UWFA 2PI6A 3MWAA 4INFA 1TPH1 3I6RA 1WXYA 3AZTA 4HZ6A 3G0XA 3M6DA 1JYNA 2VFIA 4Q4RA 3DG6A 1W8SA 4MJ2A 2VC7A 2JFEX 3PHAA 1LTDA 4PCNA 1H7PA 3C6CA 2AL2A 3HPZA 3W72A 4E8DA 4AD1A 1XBZA 4HOWA 1UD2A 1RPKA 4GI8A 4UCGA 2OT0A 5D30A 4S3AA 4NAFB 4PGLA 3XISA 5LA1A 4A8LA 3F5LA 4DRSA 3Q4DA 2CXGA 2JIEA 1PZ2A 3HA1A 4CNNA 4YJ5A 1T99A 4HPHA 4HSNA 1H1YA 1HT6A 1L9WA 4QDWA 2JF6A 4WXZA 2Z7KA 3K5XA 3SY8A 4FLOA 2YDAA 3W88A 3URBA 3SJ3A 4XKYB 1KLZA 4LB3A 2QGYA 4JTAA 1R7OA 4J1OA 3LGDA 1YEYA 1GVFA 1R47A 2EQDA 2PODA 3FEMA 3EA3A 4YVVA 3O15A 1WOBA 2P5NA 4X2PA 2PAJA 1PWMA 2ZXDA 2MUCA 4KF1A 1SO4A 3LD5A 5CPOA 4KGLA 3GAYA 1NWRA 3L2MA 1UP0A 2WK2A 1MXDA 3TXVA 3WELA 5A6KA 3BLEA 4HNLA 5BOOA 5CZSA 4JICA 3VOJA 1IEXA 3MCNA 1O5XA 2ZXAA 3W75A 2Y24A 5CBJA 4XD5A 4LF2A 3N15A 1JGMA 2FFIA 3M0HA 6XIAA 5FESA 2W61A 1W17A 4WDUA 4ZBCA 1G4SA 2F2KA 2CYGA 4Q8WA 4ROQA 5LKYA 4ZQCA 3DFNA 5D9MA 3PJXA 1FFQA 4JTCA 3NM1A 3KTSA 5CKSA 1UD3A 2RDUA 3MB9A 1CB2A 1GOQA 4Y9MA 2Y7EA 3R12A 5AN7A 2QULA 2WQDA 5F2LA 4Z17A 2J7EA 4E2DA 4DAIA 1K03A 3NQ6A 4TV5A 1TV4A 5DX7A 1KM3A 4KWVA 1AW5A 1TV8A 3ZLHA 5AECA 3FKKA 3K2GA 2GZXA 2PWUA 5G2IA 1BVWA 1SQ7A 2CFFA 4NJJA 2PWGA 3QF0A 3TK7A 3M44A 3KVJA 8RUCA 3SI9A 1R2TA 2VC9A 4O12A 1LOLA 5E5CA 5A6JA 3BPWA 2Y62A 3F4NA 3IVSA 3SCPA 3B4UA 1YE6A 1JZ6A 1RLDA 3UXIA 2WC7A 4ZO9A 4JKMA 5HQEA 3IPWA 1UD8A 1JEZA 3SFWA 3GXFA 2WVVB 4HB7A 1W9UA 2DV0A 4CU7A 3AXXA 1XS2A 4H7VA 4LUYA 3O6CA 1SJCA 3E2RA 4PTWA 3WJXA 4B15A 4DI9A 2PDWA 2HJPA 2Q6ZA 2W4XA 3S5NA 1ZPTA 1WDSA 3THCA 4A3YA 7ENLA 4ACZB 3BG9A 3PFMA 1HO1A 4C6BA 3VMNA 4HSHA 4QGCA 1LZOA 2PLCA 5FF2A 4UIOA 3F03K 3F4DA 1HKVA 1XLMA 4D6DA 3ZVHA 1VB9A 4GC4A 1J10A 5E6YA 3VDAA 2FHBA 1E5NA 1CNVA 3UZXA 1XGEA 3N2XA 3W74A 1QNSA 1VKFA 4NJIA 3PFRA 2NUXA 1VLWA 1UWAA 2FIQA 1ZCOA 2NVAA 4RE2A 3BCFA 3T8QA 3RPDA 2WHMA 4YYFA 3G0UA 4UFJA 3SCTA 2XVNA 4IT1A 1MZHA 3CTLA 5LXXA 3SCQA 4N9BA 5FF4A 1FCUA 3CZKA 3UW6A 1K02A 3TFXA 2E9BA 2ZUUA 1TZ9A 2FZBA 1E0TA 2PDJA 1CXFA 1FHDA 1F4AA 1SZEA 3IGXA 1OBAA 3DKLA 1TREA 3GDLA 3PC0A 1OY0A 4LUTA 3IGHX 1DYSA 1BTMA 2DUZA 1FX6A 3V35A 3GZAA 1MW2A 5KZ6A 1MW3A 2WWCA 4LUTB 2IKJA 2VCAA 4B5TA 4U33A 4ZEPA 3PTMA 4JX6A 4CD7A 2Z00A 1FXPA 5ECUA 4D8ZA 2G3FA 5C9RA 1ISXA 3VGEA 2H9AA 1Z9AA 1CXIA 1JCNA 1OK6A 4NQ1A 3NO1A 4XD4A 2L5HA 5FJIA 1LQ0A 4CU6A 3UCDA 2JK2A 4PRWA 4QLLA 4WLCA 7XIMA 3GNDA 3FYPA 2WCAA 1PX8A 2C8NA 2PTXA 4S2CA 4CNTA 4E4PA 3N9SA 4DO4A 4RZ4A 5D4YA 1TG7A 4JFSA 2PP0A 1KXHA 2X0HA 3IS4A 5M2FX 4FLQA 1Q6DA 3CASA 4RNFA 4HSOA 1LBLA 3AXKA 4HGXA 2G3MA 2ONEA 1CECA 1CW2A 4S3DA 3K4WA 3OP2A 3RU8X 2GK1B 4AMCA 1EH9A 3UJFA 4LBUA 4F79A 1ITCA 3WL1A 4QM1A 4KWSA 3DZ1A 3P14A 3ENLA 2WAGA 2QCFA 2XG9A 4H8UA 2NQ5A 1JL8A 1FWGC 2D69A 4Y8FA 2CZEA 4LUIA 1J0KA 1GQKA 5AC8A 3OJGA 3TTOA 2ZWYA 3UWUA 3QVQA 1EJTC 5H91A 1ICSA 3W1QA 2PC8A 4LEFA 2ZE0A 3M0VA 2ANUA 4IP5A 3EXTA 3SR7A 4RUBA 1HL9A 1TA3A 2WHKA 3DAQA 2E9LA 3BC9A 2E0PA 1YDVA 4AG0A 3K30A 2GUYA 2J78A 4O8RA 3P82A 1Q45A 5DCDA 4ZB0A 2VO5A 1J0IA 3NNTA 1OX5A 3E12A 1AODA 5REQA 9XIMA 3POCA 3CUGA 2ZX9A 3C0LA 3ITVA 1KM2A 3NPUA 1GORA 1PKLA 3LNMA 1Q6LA 5CGTA 4E4FA 2QCNA 1N2VA 1XLHA 2OODA 3ABXA 3BW4A 4HMNA 2GL5A 2WC3A 4IMEA 4PUEA 2GWNA 5REQB 5AY7A 1WA3A 5BW6A 4MFDA 3U2CA 2VRQA 4PN2A 3CS2A 3KL3A 1GWJA 4LVBA 3W7OA 4JN8A 1ISZA 2PUZA 1E1EA 1GCYA 3FJ6A 2IW0A 4LAOA 2BHUA 4LGXA 3DHPA 1ZL1A 1XISA 2OSWA 4XUYA 1VFTA 3BGGA 2A6LA 4R27A 3KLKA 1FWBC 1YDOA 3ITYA 3J7HA 3C2VA 5BMXA 2YZ5A 3BAJA 2YA2A 5HMSA 4ZQPA 5KZEA 2CLIA 4JCLA 2ZRZA 4WSKA 1DXIA 2X2GA 5G4EA 3W2JA 3NDOA 3I3EA 2QJGA 1OD0A 3KBMA 3HZ3A 1IHIA 1J2WA 1FCQA 3GO2A 5LYRA 2ALRA 1SJBA 5T91A 1UBSA 1VYSX 1IV8A 3BTNA 4X9SA 1BSIA 1TYGA 3VM7A 4M19A 5BU6A 4GKTA 2Y5EA 3PZTA 4BEUA 3EWXA 2EJ1A 1J5TA 2YGYA 3KOWA 1TRDA 4CQDA 3UESA 3RHGA 1JNDA 4E4UA 3DDMA 3HBLA 4KFPA 2NV2A 1L6WA 1M53A 2PRMA 1I0DA 4NXSA 2Z1XA 4LALA 1JPDX 3TA6A 2J79A 4PMVA 2WPGA 1L6FA 3Q65A 3EA1A 3I4EA 1Y65A 1BF6A 4CN4A 4C6CA 1A0DA 3GHUA 4WKAA 3EX1A 4BF9A 1SW0A 4RV8A 2Y7GA 3HOJA 5K4XA 2VCBA 2PA6A 3DFYA 3DBNA 4HU3A 1Z8AA 5CBBA 3H70A 1QOQA 4WKHA 3S1WA 2P10A 5IBXC 5B7ZA 4ERGA 4O19A 1R9ZA 3CMJA 5C8BB 2FB2A 3B0YA 3BMWA 3UZWA 4DJFA 3QSRA 4Y9NA 2X1TA 1PTAA 3A4AA 4B16A 4DI8A 3TNBA 5D9NA 4E8GA 5E0KA 1HP4A 3VI2A 1WKYA 3W29A 4FNRA 1XFBA 1CIUA 4LYQA 3VDGA 4J9JA 4ILSA 3W01A 4DF2A 3ARSA 1F3EA 1XC6A 3VOFA 1ZJIA 3K13A 3LCIA 4MMWA 3O63A 2D22A 1SSDA 3NFUA 3NQVA 3SQLA 2F8QA 2Y8VA 4M6PA 7REQB 1KR1A 3HV8A 1YTKA 2QPUA 1MUMA 1XICA 1KR0A 1LRNA 3HGJA 4HKPA 4NRRA 1S1PA 3I3DA 1J0JA 3MUY1 2ZUMA 1EO7A 4E3TA 2DSWA 2BLEA 1QOXA 1EJ7L 4LYKA 2EO7A 4GUIA 1EP2A 3N17A 4GGHA 3R94A 4PUWA 3MKVA 4MDOA 1D3GA 1ZS2A 1UZHA 4GYPC 4O57A 1GEQA 1W9VA 5G4HC 3W1TA 3MANA 1LBMA 3LLDA 3MBFA 3CGTA 4V15A 4UNIA 5AB3A 1FWDC 1WO2A 1VENA 5HPCA 1AL7A 3CEUA 3GVGA 1UR2A 1HVQA 3MMUA 2OXNA 4PBFA 3TTQA 3N4FA 3W84A 3WFLA 5KETA 4L80A 5D38A 3WCZA 4KS0A 1K3UA 1QHZA 3L23A 2VM8A 4AZCB 1OYCA 1NWUA 1IYXA 1U1HA 3Q45A 4BQ5A 1J6PA 1UH2A 3T4WA 5BYWA 3MMWA 4UC5A 2GDUA 3B9AA 1Z69A 1T7LA 1XIDA 4HK5A 2V2DA 3OHMB 1XIIA 1TCMA 3BV4A 4C60A 4FF7A 4LXFA 3ZS4A 4O1BA 2QKFA 3SQSA 2WZTA 3NG3A 4JTLA 4MF4A 1EOMA 5BCAA 1W5PA 1AUSL 1TO3A 2G4FA 1GK8A 1VPYA 2PEVA 2XZ9A 5FEZA 3ZJKA 1GW1A 1EC9A 3R2GA 4KMQA 5EMLA 3P81A 1EGVA 3AMCA 1RD6A 3RLHA 3ARQA 5ECVA 2P53A 3SRDA 3BZJA 3HURA 1EJVC 1V77A 4HNCA 3F7JA 2CBIA 1CI1A 3WK3A 3NOEA 3WLLA 3CQ0A 3MP4A 3F2DA 4JTHA 4Q3MA 2Z6JA 4NHVA 3NURA 5A2CA 4XVEA 2C1IA 1JZ4A 4J3XA 2PDQA 3WENA 2A3LA 1BGGA 4Z1DA 3ZYZA 3W2MA 4FNUA 4JL2A 3LPFA 2A3BA 5A95A 4Q8NA 3U5UA 4C5ZA 3SY5A 3FLUA 4Z1BA 3GD6A 3TONA 1A4LA 3M0LA 2X16A 1YTDA 4ZFCA 1XJBA 3B8VA 4QP0A 4A2RA 3I7QA 4LFYA 3KRSA 3MA8A 1X6LA 1VGAA 1TX2A 1EGZA 5H6HA 1UC5A 1O5QA 3ARYA 3G8EA 1M41A 3WQVA 3LRKA 3PK7A 2A7RA 3T7VA 1E4IA 1XLFA 4JY8A 2RAGA 4ERIA 1UH3A 3LV5A 3E0IA 3E74A 2DVTA 2PGWA 2W79A 2Z24A 2XISA 3KHDA 4Q8VA 3G1VA 2CLFA 5BXPA 5ABFB 5EL1A 3LQLA 5CLWA 5IM51 3KOXA 4IPIA 3V0SA 2QCMA 2RJHA 1YNQA 4Q4MA 1NF0A 4JX5A 1BD0A 3B06A 1V3KA 3T81A 4H2CA 3AMKA 3WNMA 3WFZA 1REQB 2ZX6A 1IT7A 4NJKA 2ICSA 4NILA 4XBKA 3T4CA 3ORWA 2VR4A 3NEHA 3MPGA 4REQA 1TPC1 5I3KA 2Y70A 5CPNA 3AAMA 4AD4A 2QUMA 3CUXA 4YTUA 5HA7A 4QFUA 5DANA 4E8CA 4EOUA 4L9XA 2QJHA 3GTFA 1XUUA 4C6NA 2XM1A 4C5YA 1SMDA 3C4UA 1US2A 5CJNA 1V0KA 4KRUA 5C55A 4OVXA 1DWJM 4A22A 1N7KA 4JTFA 4ZODA 2HWGA 1OJXA 5AVNA 2ZZ7A 4AWTA 3IK4A 4X60A 4R7WA 2QS8A 4ZR8A 1UH4A 3SDOA 1XGZA 1GQJA 5DCEA 3GYEA 4LOCA 2HZGA 1JFHA 1DEDA 1LUCB 3W53A 3Q67A 4UR7A 4CCZA 2YLAA 4TVUA 3FKRA 3GRIA 2V8ZA 2PDGA 3L4WA 3PTQA 1S3TC 1NDZA 5LSMA 1LWHA 4N42A 1T5AA 3UYIA 2ZZ6A 1FY6A 1T96A 4B9YA 3FA3A 1G6CA 4IP7A 1DIKA 4IIFA 2Y5SA 3LLFA 2DZUA 3ZR4A 2NVCA 5L9FA 3KCJA 1S5TA 3M6YA 2RUSA 4HCLA 4ZB2A 4QE1A 1YQ2A 3CEPA 3W24A 1RQEA 1UMYA 3C0JA 1AK5A 3LUTA 3OO2A 1R46A 3WJWA 4YTQA 4DUOA 2ODOA 2VMFA 4DJDC 1PYMA 3WF3A 2ISVA 4K38A 4PFMA 3BCJA 1E3XA 4I9AA 1H41A 3UBPC 1F6PA 1UYQA 2INZA 4PRTA 5CG0A 1TE6A 2ZRUA 4XWUA 4E2VA 1TTJA 1AJZA 3TUUA 3E0WA 2I7GA 2YX0A 1OX4A 4P7LA 2PWFA 1FWIC 3N11A 3KZSA 4JKLA 3G0SA 2ZRYA 4HCHA 3UWEA 4HNTA 5JVLA 1TPDA 3S3GA 3V1PA 4IL2A 4ZXLA 3WBYA 3W81A 1UKPA 1GOWA 2VTFA 3GXMA 2VGGA 5IBXA 4QCEA 1O4UA 3DERA 2XH2A 1UIOA 2PF8A 1TMQA 1QAPA 3R25A 2B7PA 2NT0A 3GNPA 2F61A 3QQWA 2VWSA 2B7NA 3G1FA 3B8DA 4LVGA 4MIMA 1YNPA 4D6GA 1UG6A 2XGIA 5XIMA 1ITXA 3A5FA 4Q4PA 1NP0A 4MNMA 3QY7A 3I65A 4LCSA 1IIHA 4PRRA 3WH8A 1K7FA 4M3PA 5I0DA 1GG0A 2R1KA 4HHMA 2YL9A 2ZRWA 2E25A 3W23A 1RVGA 5C2CA 1N82A 3UETA 4UTFA 2DT2A 3VXGA 3THQA 3MWCA 5EMKA 3AHVA 3VNLA 4PA8A 2X40A 4JL1A 4EVZA 3VIKA 1TVLA 1JZ7A 1P5BA 4FLSA 3UYCA 4I7UA 1ADOA 1WDPA 4JEJA 4ZQOA 3CC1A 5I3DA 2V3DA 4YCPA 1DKWA 3S42A 3WLPA 4ROPA 1FFRA 4AQLA 4ZCWA 2IMRA 1QNVA 3NVDA 3H2CA 4NT0A 4I7WA 3GKAA 1TWSA 1UZ1A 3EB3A 4QBXA 3W85A 2QIIA 3O2LA 3VVGA 2AAMA 2V68A 1H7NA 4O28A 3OZPA 2JKPA 3FJLA 4DO7A 5A6LA 4S1FA 2A4AA 2CZDA 4EACA 2XIJA 3AU2A 3EWWA 1V6WA 1SZGA 4UQCA 1M68A 4C6KA 5I3HA 2HS6A 3S2NA 4HPGA 3ZFHA 3WDJA 2WC4A 4QG8A 3A47A 5D9OA 5TBOA 4RE4A 4EPDC 4L9ZA 3FIGA 4B5SA 4RV3A 2VRJA 1XIBA 3D3AA 2PD9A 3EWCA 3WD4A 4WHBA 1W91A 1EF2A 2QUNA 4MJMA 3LCWA 5CCZA 3QXBA 4O4VA 4Q8UA 3UCQA 2WCGA 2W67A 2X1SA 4WDWA 3A3HA 5EMYA 3E5BA 3O9NA 2HE8A 3BLPX 3PWGA 5I77A 4UBPC 1O5RA 3G6MA 3AIVA 4ERAA 5DY3A 4J2PA 3IJLA 1A3WA 1OFBA 1WZMA 1I6NA 5DCBA 3MSYA 1IR1A 1F8MA 1UR0A 3IRSA 5HOSA 1XYZA 4QNWA 4LS2A 2OGJA 3ARWA 1DWFM 3LTSA 4BQ3A 4XZHA 4EANA 2ZWZA 1OX6A 3ELFA 1DE5A 1VFUA 3ERPA 4RKAA 1C9WA 1TR9A 4L6OA 4S38A 1XLKA 2HBVA 2WBGA 1ICPA 2PWHA 3TYAA 4CQAA 1XF0A 5B7YA 1U1UA 4R5EA 3KWXA 1IZKA 5EMUA 4FPSA 8TIMA 3WLSA 1GKRA 1P6WA 3IACA 1IGSA 3UZ5A 2Y61A 4I7VA 4GFSA 4N6EA 1BEUA 2I14A 3T42A 2ZUNA 1R3VA 4MDPA 4DWDA 2EPMX 3MMTA 4CVWA 1E71M 4LPCA 2NW0A 4F0RA 1YBQA 4M7TA 1IXNA 5BWFA 2X30A 4MKVA 1R9YA 2YL8A 3GC4A 3SGUA 4G7EA 3TW6A 1Z48A 3AYRA 3ARUA 2F9RA 3EAUA 3CMGA 4A2SA 3GC2A 1TWDA 3APYA 4MAVA 5A2AA 1HW6A 4U31A 3WQWA 2JEPA 2VZUA 3E96A 3IJIA 2KZHA 4L7ZA 3C56A 1UR4A 1DP0A 3CHEA 4JFUA 5I3JA 1XRTA 4CD6A 4I9MA 3GBDA 2GGIA 1OFEA 4XV0A 2ISDA 2C3ZA 1WV2A 3QYQA 1PTDA 4S3CA 1TWIA 1E43A 1UUQA 4J3SA 1RK5A 1R6WA 2BG5A 2CHRA 4POCA 4IMGA 4WCJA 1YPFA 4KH2A 4XISA 2EG7A 1EJWC 1C93A 1RP9A 2OPJA 1HJQA 4ATDA 1ENUA 3CPUA 4JHOA 3KBSA 1OADA 1OG0A 3QHOA 1YXDA 3B0UX 4US6A 3GDMA 5HR6A 2F2HA 4R34A 3E6EA 4UZUA 1W9BM 5DF0A 2FTWA 3P8JA 3M07A 4B2DA 1ZNNA 1NSJA 4NRSA 4Q6XA 4Q8MA 3RM8A 1ZUAX 3OPSA 5DMMA 1HTIA 1OVDA 4H9MA 3S1VA 5AZ0A 1WDWA 1FWHC 1IT0A 4HT3A 2GYIA 2W0UA 4GYKA 3MHFA 1GYNA 1L6GA 3VIMA 1XYFA 1Y5VA 3HO8A 3WLMA 1B3ZA 5FF0A 1MRAA 4Q4SA 3BG3A 3GH4A 5DFAA 3VGHA 4Z2GA 2HPMA 4GXMA 1IZJA 5XIAA 4WIWA 4WY0B 3AZSA 2ZFAA 4PB4A 4R3UA 4B91A 3V16A 2BOEX 4F3HA 1WBHA 2CLLA 4C91A 2EXOA 3V18A 3BLDA 5F1UA 4CUCA 1OQFA 2IQDA 1ITQA 3WDHA 1PIFA 5CPSA 3LU2A 1JXKA 1RJRA 3JUGA 3MKCA 1W2VA 2ZBTA 4YTTA 1NARA 2KX9A 2ALDA 2OZTA 3WLJA 1UKQA 3AJXA 1US0A 4CVUA 3SJNA 1MUWA 1ECQA 3DN5A 3HPAA 1QMLA 1GOXA 2YOCA 4ASTA 1W32A 3NYZA 3OHIA 3DGRA 2ZVIA 1F07A 3WQPA 1TJPA 1BRLA 4IPNB 3OVQA 2O9RA 4DJDA 4L64A 2V2HA 4IQJA 1U5JA 3VNZA 3W82A 3PP7A 4QCFA 5AHFA 5CPMA 1ZCCA 1JDDA 3NUKA 4LSBA 3W26A 4JDBA 4GI6A 3S83A 2V3EA 5M3WA 2QV5A 3LCHA 4DM2A 5CPTA 2PPGA 4J3WA 1WBJA 4O1AA 2XFRA 3COTA 3DH7A 1KM4A 3TYCA 2PTYA 3U6WA 4AXNA 4QJ1A 1PXGA 2FPVA 4H83A 4RZBA 4J35A 4AY1A 3H2AA 3OZYA 2BDQA 3TX9A 4RPPA 1XLEA 4OIFA 1BYCA 2YDSA 2WBKA 3VIIA 1Z32X 2PWDA 1YE4A 2G0WA 2XN0A 3S6OA 3VU2A 3TR2A 3PPFA 3Q37A 5DMLA 4KGJA 3E49A 3RG6A 4IIGA 1UUOA 1XLAA 4MYXA 3TJLA 2YCKX 1EB3A 4KESA 3LXCA 2WCSA 1S2UA 5DBTA 4PCSA 4R7OA 1RJQA 3C5QA 8XIMA 1ZJHA 3MI6A 3NCOA 2QV4A 1BWVA 3SCRA 4S2BA 1X6UA 1ZU8A 1FWRA 2Y6ZA 3C2OA 4WD0A 5I5RA 2HXTA 5BRQA 1DORA 2J27A 5IFTA 4EK7A 2YDRA 2OEJA 3R79A 4IXHA 3V1HA 1IXOA 3APGA 1FP9A 4I3GA 2TYSA 3EWUA 4JTTA 2Q8LA 5HBFA 1PL9A 5KITA 3KBWA 3L9CA 1Z7AA 1ZY9A 4MPKA 3RPTA 4X63A 1E51A 1MYRA 3O0KA 2PURA 5DMNA 3UZYA 4JFTA 2INEA 4C6OA 1BVNP 4HK6A 2BOGX 2VEMA 4IUOA 4JTRA 3LHWA 4GFIA 4BR1A 3GIPA 4W8BA 5FL1A 3E0VA 1A5SA 3BGJA 2DSUA 3S47A 1XPGA 3E1F1 3AXHA 2YA1A 3L4YA 1QT1A 5ENLA 2YFNA 3W7EA 3M0JA 2YBTA 2EEXA 1XFCA 1Q6FA 3GAKA 4PMNA 1ADDA 5AHNA 3BJSA 2GVEA 1MFVA 1S5WA 3WLOA 4O53A 1KQYA 2GUUA 1BVZA 1OT2A 3SBFA 4M82A 1L2UA 3NZGA 3EDEA 3NGJA 4JN6A 4B5NA 4DNHA 3SZ8A 1KBBA 4X61A 4QDPA 3QSTA 3BAYA 1GT8A 1T40A 3WUBA 4GHRA 4IUGA 1GGOA 4AWEA 3UFYA 3UF9A 1R86A 4EXQA 5T9CE 3MMDA 5BXSA 1CENA 3S5SA 1H7RA 4Z0JA 4RXGA 4G8TA 4NG3A 1ZAJA 3KS6A 4FS9A 1US3A 1KTCA 4EPKA 4AZ7A 4W8LA 3L65A 4DZAA 2QVHA 3UWVA 2BBFA 2O9PA 3CWNA 5J5RA 2V81A 4UOQA 3P80A 4RNIA 1Q63A 5C70A 2Y85A 1M7XA 4HA1A 2VRKA 3PF3A 1H3GA 3UR5A 5F4XA 2ON3A 3JRKA 3LRMA 2E4TA 1QJWA 3GDBA 4GKLA 4C6QA 2AMXA 2GVLA 2JQXA 2NX9A 3LTYA 3HPXA 4LNCA 1XIJA 3AYVA 1S2VA 2UY5A 1BYAA 1OGBA 3PZVA 1LRQA 1BQCA 3GE7A 3UWZA 4H9TA 4J3VA 5JBDA 5C2XA 1VCFA 2R1NA 5JBFA 4JYEA 3IJ7A 1V02E 2VVNA 5AYXA 4H8HA 1NH6A 2D20A 2GWGA 4WZHA 2VFEA 4WDTA 5FSEC 2A7NA 4WJ8A 1CXHA 1I2OA 3LCGA 4KERA 2ZOXA 4GD0A 1G4TA 2ZDSA 3I10A 5HPOA 5I06A 3AS3A 2ZE3A 3QV6A 4GOAA 1R87A 1SR9A 3BOLA 5CXPA 1F5ZA 1VJIA 2QAFA 1EQPA 3BWWA 8A3HA 1X39A 1Z3NA 2J74A 3NPVA 5D03A 3PBYA 2CHNA 4XZMX 3H24A 3IUHA 1FUYA 4KFNA 1OC6A 5GVJA 2OLAA 2EKGA 4M24A 1KRBC 1XRVA 3LN3A 1ELSA 4W85A 4J4KA 2YCJA 4WY0F 2Y7FA 4L56A 4XSMA 3OYZA 5C9UA 3LHYA 3ARPA 3QW3A 3LPOA 4I9TA 1VS1A 3WF0A 4LCQA 4TX6A 1F76A 4JTEA 3KAOA 4EAYA 2W5FA 2Y63A 1J0ZA 3QLDA 1RCOB 2ZKMX 2QJMA 3W7IA 1TMLA 5A3HA 3M1ZA 4ICCX 3EEZA 3OIXA 1QI2A 4MAZA 1R3QA 1NFPA 5JIWA 2AQOA 3QKZA 2PDIA 4JYFA 4MADA 3CLMA 3CNYA 4MWAC 5D8WA 5AYYA 1BKSA 2FPYA 4G1NA 4D6EA 1JD7A 1PV8A 1UD5A 2O4MA 2BMBA 3UZJA 5E09A 3A5VA 1G7VA 5A8NA 1QBBA 1TPB1 2Y8UA 4L1XA 3VFLA 4XQ6A 4UTWC 3AIEA 5CQ1A 1TUXA 1A47A 3LZ3A 2A6NA 5FF7A 3RITA 4R85A 4N02A 1X7IA 4A6GA 4QG9A 2JF7A 4LYPA 1OF6A 1W1ZA 3C3NA 1ALDA 3GM8A 4KCVA 1T8XA 1JRCA 3S2CA 4EAMA 4UTHA 2E6AA 4K37A 5I3FA 2E5CA 1FP8A 4YMZA 1EDGA 2A2IA 5FJRA 5BMWA 2OMAA 4F2BA 1T41A 2XH0A 4OGZA 4FF5A 4Z42C 2BXZA 2D3LA 5TNVA 3PSWA 4NX0A 1X1OA 4LRTA 5DMYA 2X0YA 1KTNA 3G3DA 3VNYA 3SFKA 3EMQA 4PTNA 1G94A 1CPUA 2POTA 3B9OA 5DQPA 3SW6A 3RO8A 5GJNA 1AZ1A 4U5KA 2QUUA 4KIEA 4M7SA 3CL6A 3PSVA 3NA8A 1P0NA 1LOQA 3TTEA 5I09A 4GVGA 2JIWA 2H3BA 3W1AA 4AIEA 1J11A 2V5KA 4WOZA 1QWGA 3THUA 1PHQA 4WJEA 1YRRA 2BHYA 4BI5A 3ARTA 2J47A 4M6UA 1KBLA 1JCJA 3SN1A 2EG8A 3WBWA 4CKQA 4RE0A 2WVTA 3GLCA 3E2SA 4KETA 3BLOA 3GG8A 3T8LA 1LRTA 4IGSA 4O0QA 3W7QA 3VOCA 1LT8A 1W2PA 2VX4A 3RXZA 4X0NA 5LGXA 2SFPA 1P48A 2OX4A 4CD4A 2X05A 3TSMA 3BZGA 1PEZA 4IIBA 3VGGA 4MY9A 4QJ4B 4DWSA 4PL1A 1MEWA 1OIFA 3IV3A 2FH8A 2E9MA 2QCHA 3O3RA 2E6DA 3WQCA 3IJ8A 3HPFA 4PODA 3N19B 4TX9A 3TC6A 3GTXA 2CLKA 1FWJC 3K8MA 4YVPA 4H01A 4YU1A 5HNRA 4JTGA 1ZLPA 1P1MA 1VD6A 1K7XA 3H2OA 4EF8A 1E70M 5FJOA 2FZDA 2J4GA 4GPNA 4XK2A 3VIJA 4GI9A 4DO6A 2HK1A 4W5ZA 1FWEC 3R8HA 3RILA 2CWXA 5H8PA 1SO5A 2YZRA 3T44A 4Q33A 2C71A 1TTQA 1XQKA 3RYSA 3LXAA 2CU0A 3P5ZA 2C16A 2H8ZA 3S1U