4ORMA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm338 (n-[3,5-difluoro-4-(trifluoromethyl)phenyl]-5-methyl-2-(trifluoromethyl)[1,2,4]triazolo[1,5-a]pyrimidin-7-amine)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
375
structure length
375
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fluorine Modulates Species Selectivity in the Triazolopyrimidine Class of Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors.
pubmed doi rcsb
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
source organism Plasmodium falciparum
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 149
structure length 375
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ormA00
1FWTA 1VCVA 1SO5A 1HG3A 1Y0EA 2A85A 3FKRA 3UQNA 3OEXA 1G4PA 1IGSA 5HNRA 5K4XA 3DU0A 1HFBA 5AHEA 4IMEA 1M7OA 2B4GA 3LB0A 4NXKA 1FY6A 1VLIA 2FPTA 4WOZA 2G96A 1G7VA 4O13A 2CZDA 3M0ZA 4NU7A 4FIQA 1W3TA 5AYYA 2KZHA 1A5SA 4RKAA 1QPOA 3CQ0A 3NZRA 4XKYB 4A2RA 5LGZA 3O05A 1TTIA 4UR8A 4UMBA 4TX9A 3W1PA 4RCXA 4R33A 3TQ0A 1LLWA 3JS3A 1WDWA 4PC8A 4JY9A 4O57A 4AMAA 4DBDA 3C2EA 4UTTA 1ZAIA 2A7PA 3BARA 4U4MA 1LBMA 1YTDA 3SY5A 2C19A 3THQA 3OVPA 2PRMA 4AAJA 4N02A 1SU5A 4AVFA 5G2WA 1FBAA 4CQ8A 1KM6A 1NSJA 1W5PA 2CLOA 1KFEA 1X1OA 5FF3A 2CZEA 4LVFA 5G4WA 4H6KA 3FLUA 1H61A 2DZXA 2HMCA 3ATYA 3W07A 3PB2A 3LOTA 4Z0SA 4DEFA 1TPDA 2NWRA 2TSYA 3QSRA 3QMRA 1OFPA 4K6AA 4Q32A 3TW6A 1KM0A 1TJRA 3GX9A 4GC4A 1VS1A 2JGQA 3DBPA 3MJYA 1A5CA 1GVSA 1TJPA 4MLRA 1U5JA 3SZ8A 2H8XA 3LBMA 4ZQPA 4ADUA 1JRBA 1F6PA 4IJBA 3F4NA 2TRSA 4BFAA 3PBUA 4MIMA 4YXGA 3EX1A 2QR6A 5CZJA 3LHZA 3MO7A 2J27A 1JJKA 1SSDA 1VH7A 2QF7A 4O28A 3HBLA 5C55A 4EOUA 3EX4A 3SFKA 3EWUA 1ICQA 1WOAA 2DZWA 3CWOX 3EKZA 1H7NA 3O15A 1GVFA 1KLZA 4X2RA 3MHUA 4PH6A 1KFKA 1FWRA 5G2IA 2ZA2A 5DY3A 2R91A 2ISVA 1MSSA 5F1VA 1DVJA 1VQTA 1Z44A 3UWUA 4FIRA 4QM1A 2AAMA 5A5WA 1PV8A 2ABAA 2QJHA 2CLEA 3SGUA 2ZTKA 3M41A 1KV5A 4UMCA 4RR4A 3N19B 4CNPA 2H90A 1SPQA 2WV8A 3NM3A 1LBFA 3NQEA 3F03K 4LUJA 5HUPA 4Y90A 3STEA 5DXXA 2FJKA 1RVGA 1TTQA 3L0GA 1AG1O 4JTJA 1PL9A 1LROA 2DZVA 1TQXA 5U4NA 2YDAA 3FA5A 2TMDA 3HG2A 1FDYA 1K02A 4IPIA 1ALDA 1PCKA 1W5MA 3PBWA 5CZTA 1BEUA 1TSIA 1NF0A 3U8GA 4B5NA 3C52A 5D09A 1OG0A 1QMLA 5DBUA 3B03A 2X1RA 3MMTA 3P60A 1SZNA 1THFD 1XDMA 5TIMA 1KBIA 1R2TA 5AHIA 2B7QA 3W7RA 1RR2A 4IMFA 4TMCA 1VCGA 3RMJA 3UZ5A 1ZAHA 3GDLA 2BTMA 4HSOA 3W74A 3C2RA 4UTWA 1OFQA 3W87A 3H54A 2H6RA 3W7OA 4O19A 3IIVA 5K4ZA 3G1YA 3STFA 2ZZ4A 3M5VA 4O18A 3FEMA 1ICPA 3W75A 5D38A 4CCDA 3THAA 2E5BA 3HJZA 1QNVA 2WKJA 5D2YA 3LRMA 2YSWA 1GT8A 3LHTA 3VI2A 2ZZ3A 1UUOA 2ZBTA 3HGJA 3N34A 2E68A 1X1ZA 1UJPA 3OIXA 5F4WA 1R2RA 4NQ1A 3YPIA 5K3VA 1SSGA 1UCWA 4LNYA 5F2IA 2FQIA 4O1AA 2CZ5A 3E0IA 3LLDA 2IQTA 1WV2A 3IRDA 4A22A 3RNDA 3GIYA 4R53A 1PCWA 5J5RA 1TYGA 3IIPA 5CZ0A 1JUEA 1XCFA 2YZRA 3LV5A 3R5EA 4X3ZA 3W1RA 3QQ0A 5D2XA 2VFIA 4KWVA 2QUTA 4JXCA 4HPJA 3QPYA 4JTLA 4JIPA 3P5YA 1ZY9A 2Q8LA 5C54A 1AK5A 3INPA 4UTTC 1DHPA 4EWND 4JGDA 5HR6A 2AGKA 4N9BA 3GVGA 4JX5A 3A21A 4GBUA 3W1LA 1ZJIA 3VKJA 2NXGA 3G0XA 4OE7A 3L5LA 2OMAA 4M6PA 2Z1BA 3KHJA 3M44A 4UNKA 5D2WA 1GZGA 1YLVA 1QDSA 2NXHA 4JTIA 4E0CA 3WK3A 3CC1A 3IGSA 3P7YA 1FDZA 4WY0B 2QCEA 4GE8A 1GVQA 3TMLA 1JCXA 3MI6A 3I7QA 4ZQRA 3W7MA 2DZSA 2C16A 1G7UA 1TPUA 3NNTA 4O14A 3H53A 1DQWA 3I68A 1QPNA 1H1YA 3PVFA 3PC0A 1VHNA 3LRKA 3NOEA 3FOKA 2NUYA 3L5MA 3HPZA 4E38A 1TPFA 5FEPA 2FIQA 4BI5A 4UTHA 5BMWA 3VCRA 1Q6RA 5FESA 3A5VA 4NJGA 1I2PA 1P1XA 1MO0A 2CFFA 4N4QA 2CLFA 1KM5A 4CNNA 2W0UA 5IM51 4BR1A 4CLMA 4NXSA 3BLFA 1QOQA 1FCQA 2VFDA 3B4UA 3IVSA 1R47A 3LCWA 1ML1A 1GVOA 4I7UA 2OZ0A 3TJXA 3L5AA 5AC7A 4WY0F 1TPB1 3W7QA 2GQAA 1CI1A 3QPZA 1DORA 3UXDA 3BW4A 4ZVJA 3EB2A 3UD6A 4IXXA 2A6NA 3TR2A 1QPQA 4QAIA 2H3DA 1TPVA 1M6JA 3CIWA 4Y6GA 5DLCA 2FPYA 5KITA 5BNKA 2VFFA 4MFDA 2E6AA 3O06A 3W1UA 3PWAA 5EKYA 1GWJA 4RXGA 1TRIA 3NVTA 4P2VA 1H50A 1O95A 2VEKA 2DJXA 2V5BA 1C29A 4BF9A 5LNUA 2VENA 3EWWA 3LI0A 3DKJA 3W2LA 4A3UA 4DO6A 2A7RA 4JN6A 1ONRA 1GEQA 3SR7A 1AMKA 1H63A 3EWYA 4XBSA 2C13A 1TQJA 3G18A 4AEOA 3T78A 5FEZA 3E96A 4CQAA 4NZFA 3W1AA 2C6QA 2J6XA 3A24A 3LHVA 3DFQA 1FXQA 5HR7A 1YXYA 3MBFA 3CT7A 2I1OA 4QJ1A 1K3UA 2A21A 2ZZ7A 1Q6OA 4HN4A 4OV9A 1H7XA 3GK0A 3TKFA 5L6UA 5G4EA 1SO3A 4UTWC 1W37A 4MPQA 4PA8A 1SR9A 2J9XA 4JDYA 2VFHA 3A9IA 4JYFA 4Z08A 3NQDA 1LOSA 3WJXA 1LTDA 1G6CA 4GUJA 3GDTA 5AHFA 1F73A 4N9DA 4WJEA 1LYXA 3WK0A 3WJYA 2ZDRA 1OFBA 3ZWTA 1VLWA 2V82A 3LXCA 2RH9A 5LKYA 3PUDA 4ZMGA 1I45A 1TV8A 1TIMA 4NNAA 4UXDA 4LVAA 3G1SA 2GJLA 4DO4A 1TPWA 3KRSA 4H3DA 1SFLA 1QO2A 1XL9A 3O16A 3NR0A 1JCLA 2ZZ2A 3P67A 2E5CA 1I2OA 1KA9F 3W7IA 2X2GA 3HGRA 4LVDA 4OU1A 2RKXA 3TH6A 3W3OA 4DPPA 2I14A 4NUWA 4JIQA 3PB0A 3IIXA 3KFTA 4IQLA 2RDTA 1FUYA 3GNNA 3L67A 4XTIA 3NEVA 1W5NA 2F7FA 1WA3A 4RZ5A 3MHFA 4PL1A 5AHMA 4OGZA 3BVJA 3SI9A 1CX9A 3E9AA 4M6VA 4UTIA 1XUZA 5I3GA 3C6CA 3G3DA 3S5YA 3NQ8A 4UFLA 4MY8A 4FX8A 1H7OA 2ZRXA 4M7TA 1TCDA 3QYQA 1KM4A 1JULA 2Y63A 2VEIA 4GXMA 2D73A 1ME9A 4Y9AA 1JCJA 1V7YA 3L68A 2PCQA 4LRTA 1IF2A 3OVQA 5HWNA 5HWMA 3I7SA 4E2BA 1GG0A 4FB7A 2CLLA 4IWWA 1OF6A 4UIOA 4MUZA 1D3GA 1H5YA 3S0CA 1TO3A 1OK6A 2RHGA 3IVTA 2O7QA 2A7NA 3S6DA 1RZMA 1H60A 5H91A 4MYXA 5KZMA 4MJMA 3T40A 1W1ZA 4OQVA 3TX9A 3BLIA 4KFPA 3LCHA 3GAYA 2QCCA 1TTPA 3EWZA 3OG3A 3MP5A 2X1SA 3TSBA 4JTGA 4O4WA 2V8ZA 1LORA 1E51A 1LDCA 1EA0A 3SJ3A 3QC3A 1KFJA 3CEUA 3Q2DA 4GRSA 1OX5A 5U7SA 3W7GA 4A21A 3PM6A 2WSRA 2OT1A 4MKNA 5FEWA 1NFBA 4JD4A 4AWUA 3BG3A 5KINA 3DH7A 3M5YA 5FF4A 1QR7A 1O5KA 1SW3A 2QAFA 2WQPA 2XN1A 1KTCA 2CZFA 2EHHA 1YDOA 1BKSA 4U28A 3EEGA 1VC4A 4S2CA 3R2GA 5HUOA 4GWEA 1GVRA 4DF2A 1TTJA 4NX5A 4I9AA 2QCDA 5DBTA 4HNVA 1UBSA 1WX0A 3NQ2A 3M47A 2QCLA 4MJZA 5D30A 3O8AA 3MP4A 2YW4A 4HNNA 4UC5A 3S9YA 2YXGA 4FNTA 2H3BA 4UMAA 2FLIA 4EF9A 4BI7A 3M1ZA 3G8RA 3AO0A 2Y7EA 4UTKA 4DF1A 1XBXA 4TU1A 2J9YA 3STGA 3W1MA 5AOUA 4N2YA 5DELA 3UY7A 4WUIA 1EP1A 1Z48A 1EEPA 2ZRZA 5KZEA 3P5ZA 1JUKA 2A1YA 2G95A 2NLIA 2FB3A 2O7SA 3CTLA 3SECA 4O1BA 5E1QA 5EBUA 4TO8A 3P81A 4IX2A 1B4EA 4IMCA 1I8JA 3NA8A 3LCGA 3KVLA 4OWGA 3DGRA 3HG3A 3NQAA 3NPVA 4EF8A 5MHBA 2GQ8A 3W6YA 3UNDA 2Y6ZA 4UFIA 5L9FA 3M7WA 1HTIA 1Z41A 3ZS4A 1DBTA 3TNOA 2PC4A 3PSWA 2E1DA 2GVJA 1XBVA 4N9CA 5K9XA 1TMHA 4LTSA 1W5OA 4WY0A 4KFOA 3HPSA 3DAQA 3OHIA 5HJLA 3TCEA 1FWWA 4JTSA 4AB4A 3B04A 3PUOA 1OHLA 4N6FA 2Y7DA 5D03A 2CLKA 1YDNA 5T26A 1KBJA 1IXQA 3P84A 4XBKA 3NQFA 2QDGA 3DFSA 1OABA 1Z42A 4MVAA 3U6WA 1QPRA 4IMGA 5CPNA 4K7YA 4FX7A 2A6LA 2Q3OA 1IXPA 2X1UA 3UWWA 1R30A 2DU2A 1QWGA 4WXZA 1B57A 1W56A 2OCZA 4XWUA 1IXNA 2W79A 7TIMA 3WK1A 4YMZA 2OT0A 5G1YA 2LLEA 1HUVA 1SQ7A 3I6RA 3PS7A 1FX6A 2GVGA 3TROA 3FKKA 3UWYA 5C6MA 4IUOA 1FWNA 1K8YA 2A2IA 3O6YX 4X22A 2VXNA 5I3HA 2YFNA 1F05A 2CWNA 4N9EA 2VEPA 5EPDA 4LU0A 1TV7A 1OJXA 1AW5A 4MZ8A 3CWNA 1PVNA 3TFXA 2VFEA 1R46A 1YTKA 2JBMA 1G67A 3HF3A 3W2UA 1X7FA 1KFCA 1F5ZA 1F2JA 2YR1A 1VZWA 3KXQA 3HB9A 3DI1A 2BX7A 3LX9A 3LI1A 3W2JA 1Q45A 3LTPA 3LCIA 3L0KA 1MXSA 4O52A 3GB6A 3DENA 3PG9A 1FCUA 2QCDB 3FS2A 3L21A 3T55A 3EWXA 2E6YA 2ISSA 3FJLA 1K7FA 3CU2A 3OA3A 3A23A 3LGEA 5KTLA 3DFTA 1C9DA 4HHPA 2C0AA 2V2HA 3W83A 3G1DA 3M6YA 2PE4A 4UFKA 3LXAA 2WJZA 1QOPA 3KAOA 4LV9A 4FNRA 3VNDA 3NZ1A 4DELA 3DFNA 4YLWA 5CGQA 3PR2A 1OYBA 4YCPA 3FYPA 3G22A 2ATMA 4JEQA 3TQVA 3MI3A 2ZCGA 3ZFHA 3UWQA 5G2HA 3G24A 5FF2A 2QCHA 3N14A 2QUUA 3TAOA 4ADTA 2QCNA 2B0MA 2Y7FA 3W1QA 1R2SA 3QQ1A 1BWLA 3PBVA 2Z0IA 3UPWA 3IGXA 1OFRA 4GFSA 1XXXA 2A4AA 4NNCA 2HS6A 1FCBA 1LLZA 5BMXA 2Y61A 3C2FA 4NVTA 2Z6JA 5LNSA 4JX4A 3GDRA 5AHLA 3BPWA 3DHDA 1J2WA 4ADSA 1XDLA 2DZPA 3W1XA 4FNQA 5K9DA 2B7NA 3ELFA 1RQBA 2ZA1A 5CG7A 4NNBA 2TPSA 4JS3A 1A53A 3V1PA 2QAPA 1P0NA 4DO5A 3GLCA 2JGYA 1QCWA 3W76A 4O10A 2YYTA 4LY8A 3F4WA 4UR7A 3W7NA 1NEYA 6ALDA 1OFAA 1KTBA 1KM2A 1XKYA 2JKAA 4WOQA 1WBHA 1LRTA 1FDJA 3W7DA 3DFPA 4WD0A 3PULA 3W1TA 3W88A 1VR6A 3TE9A 4K36A 5CPMA 3USBA 1LP6A 3MBDA 4JTUA 3NO5A 4UUIA 2HSAA 3L9CA 3G1AA 3MHGA 3UWVA 1IXOA 3N73A 2GPTA 3G1XA 3PSVA 3TUUA 2A5HA 4S1FA 3H55A 4FO4A 2ZTJA 4K39A 4JX6A 4A2SA 1O5XA 3NL5A 4GUFA 3JRKA 1P5BA 2JKEA 3S5NA 1NVMA 3LCFA 3TMQA 4UTJA 3TC6A 1Q6LA 2NX1A 5C2XA 1ME8A 4PEKA 1LRQA 4YL2A 2Y88A 3HGSA 4FXSA 1RPXA 3P74A 2R8WA 3HIJA 1A5BA 3S5OA 3TIMA 2HS8A 3C4UA 3C2VA 3NPUA 5AYXA 3GXNA 3RLVA 4MLJA 4NJKA 5IBXC 3S42A 1VYPX 2EKCA 1OK4A 4WXYA 1N7KA 4K8HA 4O1CA 4O0ZA 2V81A 2YGYA 2EGZA 1JCYA 4CCEA 4O4VA 5HWJA 1B4KA 1QFEA 3N2MA 3R89A 5K2ZA 3LERA 2OX1A 2VOMA 3G1VA 3LTYA 3P82A 2TYSA 3WK2A 5F4XA 1QO5A 2RDWA 1WBJA 4RZ6A 1KV8A 4PODA 3LLFA 5CZSA 4UTUA 3A22A 3LCXA 3O6DA 4TMBA 5I3IA 2BWGA 3O6CA 1C8VA 3QSTA 5LNVA 4Z0JA 2C14A 1ZNNA 4TR9A 2XN2A 2P1FA 1L2UA 1H7WA 2NX9A 3W71A 4G1KA 1T99A 3NQ6A 4JNMA 1YDVA 1GG1A 2FDSA 5FF0A 3V75A 2GUUA 3NGJA 4UCGA 2V2DA 3WJWA 4BWLA 1OF8A 5GVJA 1K7EA 3W86A 3NQGA 5K7JA 3NQVA 5F1UA 1WXJA 1Q3NA 4NJHA 5TBOA 1DJQA 2EF9A 4POCA 3UWZA 1ZALA 2WO5A 1G69A 3MW7A 2UV8G 3ZWSA 1K8ZA 5AC8A 2BXVA 4RK8A 1KLYA 2QEZA 3BO9A 3TK7A 3W9ZA 3N9RA 2ZRVA 1N8FA 4Z1BA 3QW4B 2NX3A 1S5VA 4Y8FA 1W8SA 3SIZA 1QAPA 2JK2A 4LVBA 3TA6A 1OX4A 3T7VA 2EPHA 4JDBA 2DP3A 3GDKA 4IX0A 4YWIA 2BSLA 1X8FA 3U2OA 1JCMP 4M19A 2Q8ZA 4MFEA 1JR1A 4C1LA 5HULA 4BK9A 3R12A 4K38A 3I65A 3GZ3A 5HQEA 1KFBA 4O11A 2Z6IA 5CPLA 1L6YA 3UZJA 4CCCA 3PUEA 4QNEA 2G5WA 1EX5A 3W73A 1K03A 1F74A 3R13A 1EWEA 2XFWA 3QJAA 4KWWA 3PY2A 4JICA 1UB3A 3OVRA 3B0VC 1P4CA 1ZENA 2BLEA 4JYEA 3NDOA 3B8DA 1XFBA 4WZHA 4ZQCA 2ISWA 1EUAA 2ZZ5A 2NXIA 3A5FA 3LV6A 1YXCA 3W23A 2RFGA 1AL7A 2VEMA 4QIUA 4C1KA 1RQEA 3VFLA 5C5YA 1TV5A 3HG5A 2NWSA 4FF7A 1XBYA 4Z1DA 3LHWA 4AF0A 1W0MA 1S5WA 3KVMA 5FEXA 1KFLA 2QCMA 3G0SA 4P61A 1JUBA 3KOFA 4XQ6A 3KX6A 4UFHA 3NQMA 3MWAA 1OFDA 4E2DA 3M16A 3Q37A 2FB2A 4JTTA 1GYNA 3QFEA 5A8GA 3WFAA 5I3JA 1VYSX 2P10A 3QW3A 5AC6A 5E93A 4O16A 1FXPA 4OV4A 3W72A 2YYUA 3HG4A 1VPXA 3UXAA 1ADOA 1W3IA 2QJGA 2J9ZA 2EAWA 3DXIA 2C1HA 4NJIA 3MUXA 1DOSA 4LS2A 4M5PA 4AWTA 2WPBA 1WAUA 3B0PA 3O1NA 4IGHA 5EL1A 2QJIA 2F84A 4LVGA 1JRCA 3VE9A 2CW6A 4K7VA 2ATSA 3ANYA 5AB3A 4LS1A 1FWSA 1K8XA 1MEHA 2CLIA 5D2TA 1YPFA 1GOXA 1GQNA 1B3OA 3HGOA 3GNDA 2X16A 5SWUA 4KFNA 3IGUA 3G0UA 4BI6A 5F2MA 2GQ9A 1OFEA 3W2KA 2Y7GA 4LW7A 2E5DA 3BG5A 1EP3A 1VGAA 4O53A 1MEIA 3GR7A 3BG9A 4ALDA 4L4LA 1PIIA 3QM3A 1SW0A 5CPOA 4O17A 2C18A 1MEWA 2J24A 2QCGA 3L2IA 1OX6A 3C0JA 3EXRA 3MYPA 4PTNA 3W7CA 3M5ZA 5DXYA 2ZRUA 4GUGA 3L0NA 1TB3A 1K7XA 1W5QA 1EB3A 2VELA 4O12A 1V5XA 4HNTA 1GTEA 1F76A 1SZGA 1H7RA 2B7PA 5FI8A 4H4IA 4O1DA 2X30A 5D02A 1CW2A 3LHUA 4NZJA 1OX4B 4UFMA 3ABOA 4JTEA 1EPXA 5FF7A 4Z1CA 3W70A 3W2MA 1JVNA 3S1WA 2P0OA 4BWLC 3RLUA 2WSYA 3W7HA 5LHFA 1NF7A 5AN7A 1VYRA 4ML9A 3BW2A 1LCOA 4J9JA 1GPWA 4PCFA 3CEPA 3HQ1A 1TRDA 2QUVA 3NL3A 4DBEA 1DJNA 2YFOA 4UFJA 4FHAA 4QISA 3HMJG 1TPH1 3Q94A 3NAVA 4I7WA 3BGJA 1SO4A 5LNRA 3P8IA 3NQ7A 1AW2A 2ZRWA 4RXFA 5DN1A 4D2JA 3GYEA 4R34A 2DORA 3ATZA 3P80A 3ABQA 1DKWA 3IEBA 1F7BA 1NAL1 2JKPA 5BRBA 4NX0A 4ZQMA 5IBXA 3G8EA 3TV8A 5AHNA 3IV3A 4DPQA 4N6EA 3EXSA 2OJPA 1S5TA 3E02A 5BW6A 2WNNA 3BGGA 1VHCA 3P8JA 1EUNA 1AL8A 4AF0B 2V5LA 5HMSA 5F4SA 3TDFA 4Y96A 4XTDA 1EP2A 2CLHA 1DV7A 1L6SA 1ZCOA 1TPC1 4OT7A 4QITA 3TQKA 2B7OA 2DZUA 2XN0A 3N9SA 5F2LA 3N2XA 3W7JA 3BK0A 4EVZA 4MZ1A 5EYWA 3E49A 3QF0A 2H8ZA 3B0UX 3G3MA 4FNSA 3G1FA 5CSRA 4ZQNA 5DCEA 8TIMA 4AWSA 3L66A 1H1ZA 1PHWA 2E77A 2GJNA 1KTNA 1SFJA 1N55A 4MOZA 3D0CA 5HINA 3M9YA 4CNOA 3S1UA 3B06A 3IIOA 2Z2UA 1VJIA 1IIGA 5KSWA 3I7RA 3EX6A 3DFOA 5TQLA 3ABRA 2YW3A 3GKAA 4TIMA 1LZOA 4NT0A 1O60A 2A0NA 1H51A 4RZ4A 3RU6A 2G97A 3AJXA 2GOUA 2J88A 3NPWA 3M5XA 2NUWA 3F1QA 3EWBX 4ORIA 1W3NA 1ZFJA 4GUIA 3TSDA 4JTHA 3R8RA 2FTPA 3C3NA 3P61A 3DZ1A 1P0KA 3SW6A 5DY2A 3FYOA 5D37A 4WX2A 3GR8A 3W1NA 1GJPA 3NQCA 4S2BA 4ZL1A 5LHEA 3PF3A 4MYAA 4O8RA 3GDMA 2Y89A 1KM3A 4L4MA 1G4EA 1ME7A 3ABSA 3W7EA 5D2VA 5I3KA 1OFOA 3LTSA 4Q4KA 1JQVA 5D33A 3HPXA 4RLIA 3ZR4A 3C2OA 4LV4A 4AHQA 4HT3A 3K30A 4UTLA 2NV1A 4LC6A 1H62A 5G1TA 4QSHA 3S1VA 1I4NA 1SZFA 1LOQA 2CLMA 3C8FA 1A5AA 3KVJA 4OBTA 3M43A 4HKPA 3TU9A 3NYZA 2QDHA 1S3HA 2V2CA 2WOQA 1UUMA 1YYAA 3NPXA 3FJ6A 4JYDA 3GXPA 1I2RA 4AHOA 1VCFA 1RD5A 1VRDA 4LS0A 3FIGA 4IXHA 3CB8A 5H2ZA 2WSQA 3CLMA 4K37A 3KVKA 1FQ0A 1XI3A 3W85A 4FNPA 3S8HA 2CU0A 3W2NA 4O54A 5EMUA 5F2GA 5D04C 3QEZA 4EIVA 2ZRYA 4KKXA 1I2QA 4M7SA 3SGZA 2Q3RA 1SO6A 2ZFAA 4X9SA 2HTMA 1B9BA 3JR2A 3L65A 4FX6M 1MZHA 2AQWA 2VC6A 5D32A 3DHFA 1YPIA 2E09A 5DCDA 4FNUA 1XUUA 1WQ5A 1KM1A 1J4EA 4MZYA 1I2NA 3S5ZA 2V9DA 2V0TA 3GKFA 1XC4A 4OHQA 1EWDA 4LT9A 1PS9A 4AH7A 1OYCA 3LM7A 2C3ZA 1OVDA 5CKSA 3LDVA 2YCEA 4A29A 3DKLA 3N3MA 3W84A 1HO1A 3TC7A 3TW7A 3NL6A 3BV4A 1DQXA 5LGXA 4YCOA 2QKFA 1WOBA 2E6DA 1T8XA 3TSMA 4HPXA 3RK8A 4HSNA 2ZZ1A 2E6FA 4QNWA 1LM1A 3BW3A 6TIMA 1T0OA 3STCA 3TXZA 1RV8A 1D3HA 4DF0A 1HO4A 2DJLA 1A50A 3LCLA 5D05A 4ONVA 4DQWA 1XM3A 2VFGA 2QCFA 1O94A 4LRSA 2DZTA 3UPBA 3NG3A 3CM4A 1FCVA 3KRUA 5E0KA 1ICSA 2PRHA 4LWWA 4W9TA 3WJSA 3TXVA 4IPJA 3BLEA 3C56A 4R7JA 3LRLA 4QQ3A 1XBZA 3O07A 4LOCA 3O63A 4ZQOA 1GYLA 2X1TA 4DXVA 4CQ9A 3MYOA 3Q58A 2ABBA 3EX2A 4RJEA 3W7LA 4PL2A 1UASA 4ZZ9A 2Y70A 3OBKA 3CPRA 3MI2A 3PAJA 4IOTA 4XKYA 4UTMA 1M5WA 2RDUA 1YTEA 1PHQA 3QRHA 1L6WA 5I3FA 5LNWA 4RV8A 2FPVA 3KRZA 1LRNA 3RF9A 3TAKA 1DL3A 3WJZA 3LXBA 4AHPA 3NL2A 3G1HA 1PE1A 1U83A 3T4CA 4JTKA 5K9CA 5CSSA 5EY5A 4MY1A 1JCNA 3NM1A 5BOOA 4FXRA 1D9EA 4GUHA 1L9WA 4I7VA 3IVUA 4ICNA 4N4PA 3UY8A 3W7KA 3EXTA 3B05A 5DCBA 5J5DA 4ORMA 2Y85A 1YXDA 3C61A 1RQHA 5LZLA 3IIZA 3TJLA 4RX0A 4JR5A 1SW7A 1ZHAA 3GXTA 5AYZA 2WNZA 3CIXA 2BZNA 1F6KA 1T96A 1G4TA 2YPIA 2V30A 4XUGA 1AW1A 1TREA 4GJ1A 3EX3A 1H7PA 4O0KA 2YX0A 2ZQ0A 4JY8A 3GAKA 5KMYA 1GTHA 3P62A 1ZAJA 2Y62A 2R14A 1SUXA 1LOLA 1W54A 2FFCA 3HO8A 4NJJA 1J5TA 3RFAA 5EA9A 2VKZG 3EKLA 1Q6QA 5G5IA 2C15A 3MP3A 4PFMA 2I9EA 4M6QA 3S1XA 1KW1A 4O50A 4MY9A 3CHVA 3W22A 1LBLA 1G4SA 2GVLA 4K8EA 5KZDA 2ZA3A 2PRLA 4XZ9A 1WYIA 4LUIA 4O15A 3LHYA 3VE7A 1OYAA 4Z1AA 4LC8A 4HNUA 1M7PA 1HL2A 1O4UA 2NV2A 1YADA 2WNQA 4GNJA 2R94A 4JTFA 3W7PA 2ALDA 2ZZ6A 3SSJA 4WQ6A 3DI0A 3T44A 3NXFA 1EIXA 2PURA 1SZEA 2NUXA 2ZYFA 5LSMA 5AFDA 3QMSA 3UYCA 4UNLA 3FFSA 1IIHA 3LBCA 4Q33A 3QMTA 2NZLA 2W6RA 1W31A 4AXKA 3PBYA 3E12A 1X6UA 4HIBA 3QZEA 4FEZA 3PG8A 1JQXA 1BWKA 3QH2A 3HOJA 4IMDA 1TPEA 3TFCA 5ABTA 1BTMA
chains in the Genus database with same CATH superfamily
1FWTA 1EF2A 1SO5A 5CC7A 1K6WA 4B5TA 3DU0A 1HFBA 3WSUA 3LG3A 2VMFA 1M7OA 4S3GA 4C65A 1XLCA 1VLIA 2FPTA 4FIQA 5AYYA 1A3HA 5ENLA 1EFZA 1A5SA 1TR1A 4HMEA 3ABZA 4AY7A 1DWIM 4C1NB 4XKYB 5GNXA 3VD9A 3O05A 4UR8A 4TTGA 4KGLA 3AMCA 4XVDA 4PC8A 4D8AA 4DBDA 1ZAIA 1V3JA 4HN8A 1S5NA 2C19A 1ZBVA 1H5VA 1V0NA 2VDIA 3DHPA 1S2UA 1FHVA 2CZEA 4AIEA 4H6KA 1AA1B 2DZXA 3AZTA 3TN5A 4BF7A 2HMCA 2PTXA 3W07A 3DG6A 3MMDA 1B1YA 1BPLB 3QSRA 4JKLA 1JAEA 1IEQA 2PB1A 2AAAA 2JGQA 5BZAA 1DJWA 2WJEA 4AISA 1TVNA 4B2DD 5FAGA 2POTA 1GORA 3A64A 4MIMA 1TWZA 1W2PA 1Q7ZA 4GIEA 1E72M 1UIOA 1JJKA 2JE8A 1SSDA 5FJPA 1WZAA 5C55A 3EWUA 3EKZA 1H7NA 4JTAA 1CLVA 3ZZ1A 4ACYA 1KFKA 4AW7A 2GGGA 2PD5A 5T9CE 4KEMA 2ISVA 1MSSA 1WUEA 1OEPA 4KT2A 1VPQA 2A3EA 3DESA 3SGUA 2ZTKA 3M41A 4F40A 1LBFA 1KNWA 3M7SA 3NGFA 4ATLA 2WLYA 1AG1O 1VBUA 1LROA 1PB0A 3QGAC 2DZVA 3EBVA 1TQXA 5U4NA 3TNBA 3FA5A 1EXBA 4IPIA 3PBWA 1BLIA 3C52A 3N6HA 3GH4A 1LLOA 4L9YA 5DBUA 4HP5A 1EBGA 4EPDC 1SR0A 4M82A 3AS1A 1ENUA 4B4FA 3W7RA 1RR2A 4C6NA 2G8ZA 2BOGX 4LUTA 4TMCA 2D2JA 3GDLA 3W74A 4CD4A 4UTWA 1N2VA 1JD7A 5K4ZA 4F0RA 4PSRA 1QUMA 3M5VA 4O18A 3FEMA 3W75A 4CCDA 5D38A 1VFUA 1OCQA 1QNPA 2REQB 1QNVA 3WLQA 2GGEA 1MMFA 3JVAA 4Z2GA 1E4LA 3LHTA 1QI4A 2ZZ3A 3TJIA 1W32A 1HF6A 1XIFA 5A8NA 3N34A 5F4WA 4JHZA 1NWRA 1DJXA 3GVVA 3CMJA 2OVLA 3ME3A 3WN6A 1FWJC 2OQHA 3AJ7A 1NOFA 4TOQA 1TYGA 2GJRA 1MUWA 1XCFA 2ZUWA 2YZRA 3SCSA 3R5EA 2GK1B 4X3ZA 3QQ0A 5D2XA 1KCXA 2VFIA 3T0DA 3PHAA 1OCNA 4JTLA 2WAGA 2Q8LA 5C54A 2Z1WA 3VGHA 4Q7IA 3EOLA 1XLLA 4N9BA 4W8AA 3UG4A 4ZBCA 1E3ZA 1EIBA 3QLDA 2EXOA 4OE7A 3ARTA 1B9ZA 3B3DA 1W9DM 1QDSA 3T8QA 3WK3A 4PUDA 4KQNA 3IK2A 1FWFC 3KBMA 2QCEA 1JZ3A 1GVQA 3MI6A 4PZVA 2DZSA 2X0SA 1IEVA 2OFJA 1TPUA 4O14A 3H53A 1DQWA 3I68A 2BY2A 5EMMA 4AZBA 2DY3A 3LRKA 2ICSA 2GUBA 4ZTYA 3OIHA 3A4WA 1Y7VA 3S5SA 3WYZA 2VOTA 4BI5A 5FESA 4ML4A 1IT0A 2CFFA 4ERIA 1UMYA 4U10A 3KTCA 2PTDA 3IPWA 2IMRA 3MVIA 3IUHA 5HBFA 1KCLA 1LQAA 2BXYA 3IVSA 1ML1A 4R5EA 4QDMA 2WVTA 1TPB1 3BW4A 3TYDA 4D6CA 2HROA 1M6JA 4Y6GA 2H9AB 4GI9A 2VFFA 3HQNA 2E6AA 3ITOA 1GWJA 2WC4A 2YCLA 4G8TA 4KERA 4I9JA 5A2BA 4WDUA 2V5BA 5LNUA 3EWWA 3R0UA 1LQ2A 3LI0A 3DKJA 4RDVA 5A6KA 5I03A 3FVMA 2J62A 3EWYA 2C13A 4NG3A 3L7RA 3W0KA 3E96A 3LHVA 3EWDA 2J6VA 4JQ4A 2QF8A 5HR7A 3MBFA 1XLHA 3ITGA 2PLJA 4J3TA 2GQ3A 1H7XA 3THCA 4ZCWA 3TKFA 4W88A 3LY0A 3UG8A 3QTGA 3IAQA 1R38A 4IFKA 4MB4A 3GDTA 3BAIA 1F73A 4AQLA 3WK0A 3ZJ7A 3ZWTA 1XC6A 1Q2RA 1G0CA 4LVAA 4GFIA 4AD2A 2WQDA 4PE8A 2OR2A 1TVLA 2XIQA 3KCOA 3NZPA 1XL9A 2OEKA 1JCLA 2ZZ2A 3KOYA 1T5AA 4DNMA 4AIBA 3W7IA 2RKXA 1P1MA 5EFDA 4NI8A 3GQYA 5I5RA 1WDQA 3IIXA 1CENA 3CQKA 4AD4A 3L67A 4Q8WA 4XTIA 4YVXA 1GK8A 5MKGB 1H49A 1EH9A 2O4MA 4M6VA 3GC2A 4PMQA 2I7GA 1RJRA 4DZAA 1TWSA 4AWEA 3CAQA 3G3DA 3VKCA 3ZOAA 4UFLA 5CGTA 4HZMA 3GC4A 4IIDA 4LAKA 1KC7A 4LALA 7A3HA 1KM4A 2JFEX 2QDDA 2D73A 1HJVA 4XD3A 4LYRA 3GZAA 3VINA 3GVWA 4QS5A 1GCYA 4B91A 7ODCA 3VX0A 5HWMA 2XM1A 4FB7A 5JH1A 2OB3A 1E1CB 3RCNA 1D3GA 2CEQA 3MZ2A 4XAFA 4TV5A 2PDGA 4S3DA 1XLBA 1T6MA 3IVTA 2O7QA 3R11A 4PCTA 4UCFA 1H60A 4MJMA 3C8NA 5CGMA 4C5ZA 3GIPA 1B3XA 3TX9A 3KL3A 1UR8A 3GAYA 4PMNA 2QCCA 2F6KA 2W62A 2OG9A 4OBRA 3MP5A 4FXFA 3TSBA 5M3WA 1UKQA 1QI2A 1LORA 1POJA 1O5QA 3QC3A 2PDHA 3AXKA 1T7LA 1ZCCA 2OELA 3BC9A 2WSRA 1GOKA 5XINA 3M5YA 3UF9A 1SW3A 2QAFA 2WQPA 1XHGA 1XIHA 1I0DA 1FFQA 3WD2A 2EHHA 3VOHA 2VEGA 3EEGA 3L4XA 3ZJ6A 1TTJA 4I9AA 3B8VA 4DAIA 3NQ2A 4HA0A 5D30A 4HNNA 3WQ8A 1B2YA 2F38A 4H83A 2BXZA 2D2OA 4RL3A 2FLIA 4EF9A 5EB8A 2HXTA 1OIMA 3AO0A 4AEFA 1DWFM 1XBXA 3VCCA 4TU1A 3F2CA 3VOGA 5AOUA 4LBRA 3UY7A 1A3XA 4KWUA 2GGHA 1S2VA 5C9ZA 3CHDA 2A1YA 2NLIA 2PC8A 3F7JA 3SECA 3LN3A 4EXAA 1AQMA 3NA8A 3KVLA 3HG3A 3R8HA 5FSDC 3WNPA 3POHA 2Z1XA 4GC3A 1RHCA 3NPVA 2B31A 1W1B1 3MDWA 4DZ5A 3DOPA 1XW8A 1SMDA 4UFIA 5L9FA 3U57A 1Z41A 3L4WA 3TNOA 1GQKA 2BGNE 3AUOA 2PC4A 4TX8A 5H1WA 4PUEA 4S3AA 4KRZA 2GVJA 4N9CA 4DWSD 1OT1A 1VKFA 4WY0A 4KFOA 5HJLA 2PDMA 3U4AA 3A3WA 2AGTA 5A6TC 2Y7DA 3W81A 5D03A 5ABEA 2CLKA 2DSKA 5T26A 1FWAC 5JH2A 1IXQA 3L2LA 3GXIA 4KWSA 4XBKA 2CCRA 4I6VA 2ZC8A 1EYEA 3KRBA 2PWVA 4J40A 1IXPA 4AEEA 1Z32X 2WXDM 1B57A 2W79A 2QJNA 5LIWX 3ANUA 2OT0A 2PDYA 5G1YA 4F0LA 1JZ8A 3MKCA 1BXNA 1EDGA 1UD2A 1FH8A 3PS7A 1V6UA 2GVGA 2Z7GA 3SUUA 3BLKA 3SQSA 2VQUA 4WKAA 3BOXA 4EAMA 4PN2A 4HJWA 1F05A 3RJXA 5LYRA 2VEPA 5EPDA 2IQ0A 1OJXA 2GJPA 3CWNA 3UVIA 3WEZA 3TFXA 2VFEA 2XH7A 1QWKA 4JQAA 4EACA 1R46A 1YTKA 4QJ5B 2E7FA 1JZ2A 1OWQA 3CQHA 3A47A 1X7FA 2J7BA 5EMJA 3KCJA 1IWBA 5I79A 3HB9A 3PN8A 2J7EA 3DI1A 5HDRA 2BX7A 3LX9A 2Q6ZA 3T81A 5BCAA 1KBBA 4FP1A 1Q45A 1I6NA 1XYZA 1I0BA 3LCIA 3WF1A 1MXSA 1W9BM 3PZTA 4O52A 2Z2BA 2OOFA 3EWXA 3DYPA 3WBYA 2W3ZA 3OA3A 1EGMA 4H2CA 5KTLA 1C9DA 1HP4A 3G1DA 2WJZA 4MWAD 5AKQA 4LV9A 5REQA 4G7EB 3FA3A 4LPCA 2JF6A 4DELA 1KGWA 3PR2A 5I3DA 2ATMA 5ABGA 1NQ6A 4JIHA 3TQVA 2ZCGA 4L6OA 3ZFHA 2YCJA 3N14A 4ADTA 2QCNA 1CLKA 1UH3A 4MHBA 3CH9A 3AWNA 2P76A 4C90A 4GFSA 4NNCA 2HS6A 2OZTA 1LLZA 4AG0A 1WKDA 2A3LA 2XJ7A 5LNSA 1CZ1A 3VGGA 4JX4A 3FN9A 1CBGA 2VX7A 3OBEA 1OC7A 3SCTA 1XDLA 4INFA 1RBOB 2B7NA 4E4FA 2ZA1A 4HA4A 3IJDA 1P0NA 3ZT5A 4DO5A 1VFSA 2EG7A 3UZWA 1YBQB 2YYTA 4HQVA 5FIPA 3W7NA 4D6GA 6ALDA 3AYSA 1OFAA 1KTBA 2Z1VA 1KM2A 2E8YA 2Z2AA 3VPLA 1XSKA 4GY1A 4D71A 3W7DA 2X1IA 3TYEA 1V6TA 3M46A 3F2DA 4UUIA 1US2A 2HSAA 4GVIA 4ECLA 1IXOA 1EJTC 3N73A 3WFLA 2WC3A 1HJQA 1XRVA 3CK5A 5BXRA 3CGTA 3VA8A 1RVKA 3OZPA 2ZTJA 1E9LA 3RLGA 3D3AA 4K39A 2V3EA 4HJFA 4GUFA 1P5BA 2O9RA 1YKWA 2PGFA 3SN1A 3ARXA 1EX1A 3EOEA 2NX1A 1KRAC 4F79A 4HGXA 4PEKA 3OW1A 5CSYA 3LPOA 1ZL1A 2ZVRA 5E70A 5I07A 1A5BA 3C4UA 3C2VA 5A6LA 2YL6A 1RA5A 4LAOA 3AIBA 4MLJA 1VYPX 2OU4A 1DXFA 1OK4A 1VPYA 5DT7A 4Q6JA 2V81A 4WEVX 2Y1HA 2YGYA 5DMNA 1JCYA 3LBOA 3FSUA 1V02A 3RPMA 3RG6A 4XISA 4R9OA 4LBSA 2VOMA 3G1VA 4L9XA 3S1GA 4F2UA 4I5RA 4PODA 3O6DA 3LNMA 2ISFA 3O6CA 2EG8A 3WKZA 3T4WA 1ZNNA 4TR9A 3G2GA 3UXKA 1S2TA 4GVGA 1CLXA 3EGJA 3AXMA 4NRRA 3VVGA 5I2UA 4FZIA 3G1RA 1X97A 3V75A 1R86A 1XYAA 1BRLA 2YIHA 4UCGA 6XIMA 1AD1A 3WQ4A 2PGEA 1XLAA 5F1UA 3R1ZA 2RAGA 1Q3NA 4NJHA 4NZCA 2OZ8A 3GS6A 7REQA 1DJQA 2EF9A 2QMJA 1F3XA 1ZALA 3D3FA 4IP4A 5AC8A 5CBBA 4GKTA 2VO5A 2QEZA 3BO9A 1EC8A 3BCJA 1N8FA 3QW4B 3BH4A 5GJMA 2PAJA 3PJWA 3SIZA 5ABFB 1H2JA 1XRSA 1OX4A 4Q4SA 4C6EA 2CBVA 4DJEA 1VBJA 2J78A 3GDKA 4H9VA 4DZHA 4IJCA 3QKEA 4GIAA 1N8WA 4HB7A 1JCMP 4M19A 4DVOA 2PDQA 5HULA 4BK9A 5I00A 2DT2A 3R12A 3L4YA 2XIIA 1KFBA 5CC3A 3DUGA 1ZB5A 2Z6IA 5FJJA 5CPLA 5JBEA 1Q2SA 3UCDA 3VILA 3EOOA 3KEHA 1PPIA 1EYWA 3PUEA 2G5WA 3W73A 1N8IA 1F74A 3CMFA 3M07A 1WP6A 3CPUA 3UESA 3VUSA 1UB3A 3PZQA 4TVUA 1P4CA 2XSBA 1BAGA 3W24A 4WZHA 3IS4A 2ZZ5A 3WIJA 4O1FA 2ZWZA 2OSWA 3ARYA 3W23A 1F8IA 3S47A 2WMIB 3ZO9A 1TVPA 4I8YA 5C5YA 1TV5A 4PBFA 4EK7A 5C2GA 4AF0A 4XKMA 2O9PA 4U31A 3MA8A 2IKGA 3KVMA 1KFLA 1P43A 1JUBA 3H21A 3NQMA 1CXEA 4W8BA 5KZ6A 1US3A 1GYNA 3QFEA 5A8GA 1AMYA 2KAUC 2XYLA 3B9OA 3WZ0E 4B5WA 4XBJA 1IR2A 5AC6A 1P7TA 1PBGA 1JG9A 1FXPA 3A4JA 4OV4A 4A3HA 1ADOA 3IANA 3R79A 2EAWA 3UU0A 5JIPA 4Y9NA 4QHRA 1QBBA 4DUOA 4M5PA 3GFXA 1WAUA 4GXPA 2QJIA 2F84A 3CQIA 1GNXA 3EMCA 1M03A 2ATSA 1EJRC 1VIWA 1JPDX 4Y2WA 4CNTA 1K8XA 3VIJA 4B9ZA 1RK5A 4NYYA 1GQNA 4OTKA 4QE1A 2ZX6A 1B3OA 3HGOA 3AYRA 2X16A 4GI8A 5SWUA 2QVNA 4BI6A 1OFEA 4XO7A 1UC5A 4LW7A 3UP8A 1VGAA 1PUDA 3H7UA 1MEIA 1VBRA 2GGIA 3BG9A 3W28A 1EQCA 4L4LA 1PIIA 1V03A 1SW0A 4IP7A 5CPOA 4O17A 2O0TA 2EPOA 2QCGA 4UR9A 3L2IA 3EXRA 4DJFD 3VCNA 2GDQA 1CB2A 3W7CA 3L0NA 3OP2A 1EB3A 1VBHA 4H6QA 4KPLA 1RCQA 4J1OA 3PJTA 1KRBC 3QYSA 2CZVA 4O1DA 5D02A 4UFMA 4H7VA 5FF7A 4R3UA 4MAZA 3W2MA 1VEOA 1JVNA 2R1NA 2P0OA 1J6OA 2JALA 2YCKX 4C6KA 4W93A 5LHFA 1DXIA 3CT2A 2BS9A 4QX4A 4ML9A 5JMUA 3BW2A 4J9JA 3AS0A 1FKWA 1QK2A 3HQ1A 1TRDA 3WH7A 3WUGA 4O8AA 3WG6A 4QISA 1TPH1 3Q94A 3IUIA 2YA2A 1SO4A 5LNRA 1GQLA 2YA0A 2ZRWA 5DN1A 3GYEA 3GM8A 4GCAA 3OLDA 3P80A 4HBKA 3VMOA 3ONBA 1DKWA 1F7BA 5LXXA 1R8LA 4F4RA 5IBXA 1MW1A 1P0DA 1JI2A 1V4YA 2OWCA 5JUVA 3WELA 3UR8A 3E02A 4TTUA 5BW6A 2V3DA 3QLLA 3WL1A 3P8JA 4K1WA 4NAFA 5F4SA 1DV7A 1L6SA 1TPC1 2QV5A 3KBSA 4QITA 2EPKX 2DZUA 2XN0A 3LZ3A 1ZJHA 3U2ZA 3N2XA 3WDQA 3VMPA 1GKQA 3GWQA 3SUVA 1ZTVA 4KIRA 5HOSA 3AIEA 4FNSA 1MDRA 4WDTA 4LGXA 3M0VA 4IQEA 5CSRA 1K77A 8TIMA 1H1ZA 2Z29A 1X98A 3FAXA 1KTNA 1SFJA 1UR0A 2GZXA 5A2AA 4A8NA 4C6IA 2R1KA 5IFTA 4CNOA 2PUZA 1HW6A 3IIOA 1XFCA 4GY0A 1OD0A 4E8DA 3EX6A 4OFCA 1JGIA 3ABRA 2YW3A 3GKAA 4TIMA 1LZOA 2ZUUA 3BCDA 3SCPA 1O60A 2VX4A 3DGBA 2A0NA 4RZ4A 4R7WA 3GXDA 2G97A 3MCNA 3NPWA 2X09A 3BAXA 3WQ6A 3EWBX 1ZFJA 2QQ6A 4GUIA 1V8EA 4IISA 3ARVA 3EDJA 3TSDA 1XG3A 3C3NA 4B90A 3LK6A 3W38A 2GJXB 4WX2A 3GR8A 2FJUB 3W1NA 3NQCA 2ANUA 1Q63A 3PF3A 2HK1A 1VJZA 4MYAA 4L4MA 4QROA 3FAWA 1WZLA 1REQA 1GPFA 1JQVA 4NP7A 4XO6A 1HXJA 5FJRA 3VUPA 3SADA 5E0FA 3ZR4A 1MQPA 3SY8A 1KGXA 4LV4A 3N04A 3K30A 4GKLA 4UTLA 1H62A 5G1TA 4L61A 3CL6A 3TYZA 1UA7A 2CLMA 1A5AA 1TJ2A 4UQCA 3TU9A 3NYZA 3OGRA 4ZOCA 1X96A 5ECVA 1XIMA 1JF5A 1JEZA 1MUMA 2IW0A 2QIWA 2IKJA 1I2RA 1VCFA 2V6AA 3ITYA 1HJSA 3NWRA 3HURA 4IXHA 5H2ZA 2WVSA 1X1NA 3M0KA 3WF2A 3BLOA 3W85A 2WHLA 5EMUA 3AUJA 1TKKA 2HISA 1EZ2A 3VNKA 2WZMA 4P7OA 2FZBA 1EHNA 3SGZA 2Q3RA 4CNUA 2R82A 4X9SA 3PTKA 3QBUA 2FGLA 4MKVA 2HV5A 2TAAA 3DHFA 5JXQA 4CCZA 1H3GA 3W27A 4XAPA 1NWSA 3GKFA 4OHQA 3H4WA 1EWDA 4LT9A 2R1PA 2CITA 2C3ZA 1OVDA 2BVWA 1EQPA 3BJSA 4A29A 4AD5A 5EBAA 3NL6A 1ISWA 4NAEB 3GNXA 3GW3A 3DC8A 2QKFA 1WOBA 2V5KA 3TSMA 4D9PA 4QBXA 3OTRA 1MNZA 1PX3A 4YHEA 4HYWA 1H4PA 1YW1A 3STCA 3TXZA 4UOZA 1RV8A 1D3HA 4ACZA 4DF0A 1HO4A 2DJLA 3E5BA 5D05A 4ONVA 1XM3A 3GTHA 1O94A 4WSJA 2HRWA 3NG3A 3CM4A 1FCVA 1TZ9A 2CBIA 2PRHA 3CWHA 1TX0A 3PPGA 3BLEA 4R7JA 3TN4A 4CVWA 4AU0A 3MS8A 4QQ3A 4QCEA 3ZR5A 4IIHA 4B3ZA 1QXLA 3Q58A 2ABBA 3W7LA 4PL2A 4IIEA 5FOOA 4LSBA 3OBKA 3CPRA 3ITTA 1ZSXA 4C1NA 4XKYA 1ZLPA 2RDUA 3QRHA 3IJIA 3M0YA 3KRZA 4D6IA 1E5JA 3HFTA 2NVDA 3T0BA 2DT3A 5H6HA 2BVTA 3E0FA 1B0IA 4DJDD 1GHSA 1TWIA 1JDEA 3HA1A 4DY1A 4EPEC 4JTKA 5K9CA 2EPLX 5CSSA 4A6GA 1ESWA 3GG0A 2ZVIA 1D9EA 1XR2A 1A0CA 6TAAA 3IVUA 1MQRA 2WVVB 1MRAA 3W7KA 3B05A 5AVHA 1CXLA 4J3XA 5DCBA 3TTEA 4J27A 1E6QM 4U33A 1YXDA 4LANA 1JDFA 3UGRA 3IIZA 3PZOA 4JR5A 1SW7A 4L4PA 5AYZA 1BYBA 4HMCA 2FH6A 1T96A 1G4TA 4WVXA 2C0HA 3EX3A 5T9BG 3KW3A 3GU9A 5BWAA 2Y62A 2R14A 1LOLA 1J5TA 5GPRA 3QGKC 1EL3A 2FHCA 4GXWA 3T2OA 1Q6QA 5G5IA 4KEUA 4PFMA 4BJHA 4O50A 4WHBA 3CHVA 1LBLA 2NV9A 4WF7A 5F7UA 2J8TA 2PRLA 1GZJA 4GX9A 2BP1A 1MXGA 2CXEA 4O15A 5E9XA 3BOFA 4Z1AA 4HNUA 1M7PA 5E6YA 1MQQA 4HNOA 4HOXA 1PEZA 3IRSA 2ALDA 2DT1A 2ZZ6A 3DI0A 3NXFA 4IHCA 1CNVA 4PB5A 1LWJA 4NSBA 5AFDA 3QMSA 4UNLA 1XIBA 1ODUA 3QMTA 1AVAA 2NVCA 2QGHA 2W6RA 4KW2A 3UFYA 4P7LA 3V4BA 1TCMA 2PDXA 3PBYA 4J4KA 1X6UA 2PPGA 1E6PA 1KKOA 3QZEA 4I6KA 2GDUA 1BWKA 1V77A 3BSMA 4FF5A 1TPEA 3TFCA 5J8LA 1VCVA 3VOFA 1HG3A 1Y0EA 3FKRA 2XIJA 5A1AA 5K4XA 5AHEA 4Y7EA 4MDPA 1P48A 3UJ2A 1U2YA 2G96A 1G7VA 4O13A 4NU7A 1R7OA 1W3TA 2PDIA 2KZHA 1E0TA 1RXOB 2QPUA 3WX7A 2DZAA 1QPOA 3CQ0A 3DEQA 4A2RA 4H8NA 1TTIA 1UP2A 1V6WA 2OLHA 3W1PA 4RCXA 2XZ7A 4R33A 1LLWA 1PZ2A 3JS3A 3GUGA 4MAVA 4AMAA 4OZOA 2IQDA 3IK4A 1Q5MA 1GGOA 3CQJA 2UBPC 3JZEA 4CD8A 4CU6A 4C6JA 3R43A 1XGZA 4L6HA 4LAUA 2PRMA 5GJNA 3SCVA 4N02A 4AVFA 4D6EA 4CQ8A 4W8LA 2QPSA 1L6FA 1KFEA 3FA4A 2YZ5A 1UR1A 1Z6KA 3UJFA 3CUJA 3FLUA 4L9ZA 2GK1A 4Z0SA 4DEFA 4DO7A 3URAA 2NWRA 3BMVA 2TSYA 1A49A 3AS2A 4Q32A 1KM0A 3MB9A 3GX9A 3SUWA 2E3ZA 1VS1A 3GHUA 4X60A 3B8WA 1A5CA 1GVSA 1NDVA 1TJPA 1U5JA 4ZQPA 2PZ0A 3F4NA 2EJ1A 2TRSA 3A6OA 3VYLA 3AHXA 2FDMA 4YXGA 3EX1A 1J0ZA 3RO8A 1GW1A 2DVUA 3MO7A 2J27A 5HXMA 1BSLA 1DJYA 1UIPA 4XV0A 2Z24A 4LCSA 4O28A 3HBLA 3EX4A 1QNOA 2OQYA 3MHUA 4PH6A 1FWRA 5G2IA 2PD9A 1PYFA 2R91A 2IPGA 1Z44A 4PMRA 4UTFA 4HNLA 5IFPA 2XU2A 2DEPA 4FIRA 2VR5A 5A5WA 2QJHA 1W3KA 3APYA 1KV5A 3WNMA 4FOKA 2R9RA 4MWAE 1O12A 5HUPA 1DJHA 3RUBL 3STEA 4OJYA 1ITXA 1DP0A 3CUXA 4JTJA 3PPFA 1XLMA 2IPWA 1X7IA 1KWGA 1A5MC 1W5MA 4ZEPA 5CZTA 1BEUA 1TSIA 4EKJA 3OYZA 4C7DA 4DWDA 1UYQA 4WRHA 3P60A 1SZNA 2H9AA 1XDMA 2D3LA 3CXOA 4FLRA 1KBIA 2I5IA 4IZGA 4IMFA 4HNCA 4X0VA 1VCGA 1ZAHA 3PJUA 4YVVA 4HSOA 1TV4A 3H54A 1CDGA 4O19A 1YMYA 4HTYA 1J2BA 3I4KA 4S3CA 5KETA 1ICPA 1EPVA 3QXBA 3HJZA 1U22A 1V0MA 4DLMA 2WKJA 3AIWA 1XISA 1XPYA 2YSWA 1GT8A 3WLPA 3WNLA 3VI2A 2XFRA 1UUOA 3QFWA 1D7KA 1UR9A 3EYPA 1OADA 3YPIA 4PULA 4QQUA 3RM8A 5C7VA 4O1AA 2JIEA 2YOCA 3H12A 4G5DA 5BRPA 1PTGA 3LLDA 3V5OA 1WV2A 3V1HA 2OTDA 3IRDA 4R53A 4CNSA 5LIXX 3QHNA 2CXGA 1PCWA 1BWVA 4OUEA 3IIPA 5CZ0A 4KWVA 2FZ9A 4HPNA 2WVUA 3QPYA 4F2BA 3P5YA 4KBXA 3LEPA 5CCZA 1AK5A 3HJEA 4UTTC 4JNZA 4RDYA 3IJ6A 3FVDA 1CEOA 3OA5A 3A21A 4GBUA 3VKJA 2NXGA 1KR0A 2Z1KA 2OMAA 2QNEA 3BSHA 1O1HA 4NKCA 4M6PA 2Z1BA 1MW2A 1GZGA 2V38A 4U2ZA 1ZRQA 1OT2A 1JAKA 3CC1A 3IGSA 3EDFA 2X7WA 4WY0B 2VHLA 1WAWA 5MKGA 1JCXA 3W82A 3GTXA 5C7HA 1C7SA 3S6TA 4A8RA 3W7MA 4C7GA 1G7UA 3NNTA 1J0KA 1QPNA 1H1YA 3PVFA 3BZJA 3PC0A 2BVYA 3NOEA 2Y0FA 2C71A 4NILA 1NDYA 3L5MA 3HPZA 1CXKA 5FEPA 3UZXA 1HGWA 5BMWA 4CD7A 3VCRA 4CQCA 1I2PA 1P1XA 1MO0A 4AUBA 2CLFA 4JN7A 1JXJA 4D72A 4WJXA 1K4GA 3QR3A 4NXSA 1Y5VA 1E1CA 1QOQA 2HWGA 1XGDA 2VFDA 2ZUMA 2FVLA 1R47A 3LCWA 4IPLA 4I7UA 4G2DA 2V5JA 3FY1A 4RE3A 3UPMA 2XPKA 1T40A 3UXDA 5A6BD 3EB2A 3AS3A 3F2BA 1QPKA 3V16A 4QDWA 3O06A 3PWAA 1TRIA 3NVTA 1O95A 2DJXA 4Q8TA 3T08A 4FA3A 2VWSA 3GO2A 3W2LA 4JN6A 1D8WA 1K9EA 1AMKA 4IQDA 3VK5A 4P8WA 3OBAA 4M0XA 2ZX7A 3FV9A 4AEOA 1J8VA 5FEZA 1UR3M 3QC0A 1QTWA 1Q6GA 1E0VA 2I1OA 4XD4A 5LA2A 2A21A 2DVXA 2ZZ7A 2PEVA 1Z8AA 4HN4A 2PFHA 3GK0A 1LUCB 2INFA 5G4EA 1H09A 4PA8A 1SR9A 5CBJA 2UY2A 2VFHA 3A9IA 3VZXA 1TWWA 3NQDA 3UXIA 4ZE4A 3CV1A 4V15A 4DUVA 5EU9A 2Z7KA 4N9DA 5AC5A 1GOIA 1DHKA 2ZDRA 3CZGA 1OFBA 4AY8A 2J8GA 1VLWA 4GVFA 2RH9A 3K8KA 1TIMA 4NNAA 1SM9A 5CEWA 3OHMB 3EDDA 4P7NA 1SJCA 4H3DA 1SFLA 1QO2A 1WB0A 3CS2A 2OSXA 1DE6A 3UCQA 5AVNA 1I2OA 1R6WA 4GI6A 1RPKA 3STPA 3VDBA 3WNNA 1XYBA 2I14A 3F5KA 1NOWA 3PB0A 1FWCC 4JIQA 3KFTA 2RDTA 4CEUC 4QGCA 5DX7A 2P8CA 3MSRA 1FUYA 3GNNA 1W8GA 3NEVA 2F7FA 3MHFA 4GLEA 3RAOA 2ZE3A 4CD6A 5E9AA 3GU2A 2X41A 3SI9A 1CX9A 2CWXA 4UTIA 1XUZA 1UOKA 3KBJA 3KTXA 4IFOA 5I3GA 1JNEA 3NQ8A 3BSGA 4QS6A 1W1IE 4FX8A 1H7OA 1W2VA 4H00A 1PIGA 1RH9A 3T0TA 3WQEA 3CBWA 2HE5A 4Y9AA 1DPMA 4PTXA 3RX2A 1JCJA 1V7YA 1GKPA 1J93A 2PCQA 3MANA 2V68A 1IF2A 4B9YA 3CHCA 3I7SA 4E2BA 3UVAA 1OC6A 4ZO6A 1OF6A 2O92A 1PWMA 3VDAA 1LT7A 3FDGA 3N2BA 4IPPA 1HJWA 1UR4A 3T0AA 1DIKA 4HZ7A 3PANA 1W1ZA 4W89A 4OQVA 3BLIA 2VZVA 4BS0A 4KFPA 1CWYA 5A6JA 3K4AA 1TTPA 1Z9AA 2X1SA 1GUVA 3FJ4A 5HMEA 3KE0A 1E51A 1LDCA 2VX5A 3SJ3A 3CEUA 4GRSA 1OX5A 2BY1A 3PM6A 3D46A 3F4CA 2DH3A 4PR4A 5KINA 1P6BA 1QR7A 1O5KA 2XN1A 1UWUA 1B30A 2CZFA 3R25A 1BKSA 3V0UA 3U5YA 5DBTA 4HNVA 1UBSA 1DE5A 1WX0A 2GWNA 3NOYA 5IRPA 3NVDA 1XCXA 3O8AA 4IICA 1L2QA 4PRTA 4UMAA 1RLCL 3ES7A 4AC1X 1ISVA 4YYFA 3I6TA 2QYGA 1QJWA 4G7EA 3EPOA 4XG1A 2Y7EA 4UTKA 3VNZA 2W4XA 5FJOA 4DX3A 3STGA 1BRLB 5DELA 4L65A 1EP1A 3SQLA 1DIEA 5KZEA 3P5ZA 5CJNA 1JUKA 2W61A 1W9VA 2J7DA 5BRQA 5E1QA 4TXEA 3BICA 1BHGA 1I8JA 3ITLA 1K4HA 4OWGA 3DGRA 2V5DA 4GJIA 4IM4A 2FZMA 3CYJA 1RD6A 3NQAA 1PKYA 1XD1A 3W6YA 4M1RA 3ARRA 3E2QA 3L23A 1I1XA 3Q67A 1M9HA 1HTIA 3QHOA 3HU7A 1DBTA 1K1DA 6ENLA 4YN5A 4FLOA 2R6OA 1E6XM 2G50A 1WE5A 1XBVA 3G5EA 2PWHA 2O9OA 1W5OA 2YBUA 3HPSA 1AJ0A 4I5XA 4JTSA 4AB4A 1MW0A 4MB5A 1YBQA 5G1MA 4QG6A 2DV0A 2FYMA 1ZS2A 1YDNA 3FGCA 3VOJA 8RUCA 3S2MA 3GTFA 1LWHA 3U6WA 4IMGA 5CPNA 4K7YA 4ERAA 4FX7A 4KRUA 4CU8A 5FACA 3T05A 1R30A 4YVPA 2DU2A 5BWFA 1JPIA 1QWGA 4WXZA 4DJEC 2QMKA 1IXNA 3WK1A 1KXQA 1X39A 4YMZA 4DIAA 4FSAA 2HXUA 1SQ7A 1GJUA 3TROA 2DSZA 3UWYA 5C6MA 1JI1A 1JNDA 4ZA0A 2VXNA 2WMKA 4R27A 3U48A 3R7MA 3S3GA 4NZ5A 1XIEA 4N9EA 4MZ8A 4WGXA 4U3AA 2V67A 3C5QA 4PSPA 1RALA 2JBMA 1G67A 1MI3A 3HF3A 1VFLA 4Y9MA 4G56A 1UD8A 2D23A 1P7TB 2YR1A 3KXQA 1T8QA 3CL7A 3MCOA 3LI1A 2ADAA 3JU2A 1EC9A 2J77A 1EKOA 4Y8EA 4Q8UA 4H1ZA 1HKMA 4OBSA 1HKIA 3CASA 3GB6A 3LM3A 2DFAA 1FCUA 3L21A 3E6EA 4CN4A 3A9BA 3FEQA 2HZGA 1K7FA 1XWYA 3CU2A 1KFWA 5I7GA 2F6UA 1A5KC 3DFTA 3KS5A 3M6YA 3PAOA 3WMBA 3TCSA 3LXAA 4DWSB 4NRSA 3KAOA 3ID7A 2PS2A 4FNRA 3VNDA 1IQ8A 1YRRA 3AMLA 4JOMA 3LPFA 3SM0A 1UWRA 2HVMA 4YCPA 2QUNA 3G22A 2NSXA 1U1JA 5M2FX 4AMCA 5G2HA 3G24A 5FF2A 1P0BA 2YKKA 3TAOA 1F3TA 5ABHA 1BWLA 3UPWA 4GX8A 1OFRA 4K68A 2ONEA 4D8LA 1S5MA 4OIFA 5CPSA 2O9TA 2Y61A 3C2FA 3P3BA 4NVTA 5FKYA 3LPPA 3DHDA 1C90A 1J2WA 2XFFA 5K9DA 3G6LA 1A53A 4CN1A 2QAPA 4S3JA 2DQXA 2JGYA 1QCWA 4O10A 1ZJBA 4UR7A 4HU3A 1FDJA 4KF1A 5IDIA 4WD0A 3FSTA 3WBEA 1EA9C 4A8IA 2DGAA 2EO7A 4JTUA 1VIZA 1B3YA 3G1AA 2J74A 1V3KA 3MHGA 3V0SA 1LG2A 4S1FA 3GBEA 4JX6A 4A2SA 1GQJA 1E43A 4J7RA 4EP8C 5C71A 4GK8A 1OB0A 2P3ZA 2WMIA 3JRKA 3WLLA 4ES4A 2Y24A 3VKDA 3TYBA 3TMQA 4AIOA 2VTFA 1QNRA 1Q6LA 3UZYA 1UBPC 1XLEA 1ME8A 2WHKA 1O68A 1LRQA 3VD7A 4X2PA 1EJVC 4HMNA 1ADSA 3ZIZA 3NSXA 3HIJA 2HS8A 1VFMA 3VC5A 1V02E 1RBAA 1CGXA 5D8WA 3S4TA 5IBXC 1Z69A 3S42A 4UQ9A 4F9DA 1P6WA 1N7KA 3N2CA 4ZSTA 4M56A 4M8UA 3ZT6A 3WH9A 1QFEA 3N2MA 4XD6A 4AX7A 5K2ZA 2GSHA 4HU8A 4Q8PA 1WBJA 1KV8A 3AXXA 3LLFA 3WLRA 4XZIA 2DUZA 3OZOA 1Y5WA 4Z0JA 2Y8UA 3EB3A 4B5UA 1EF3A 4EANA 4RNHA 2CC0A 4XUYA 4Q7NA 3FX4A 4CGTA 3VAVA 1ONXA 4G1KA 3NQ6A 1XIJA 3TZFA 1JYXA 1YDYA 3QV8A 3DG3A 1WXJA 5JIWA 3LMZA 1G69A 2MUCA 1QATA 1BGAA 3WNOA 1Q65A 1NWUA 2WPGA 2XGZA 4RK8A 1KLYA 3BDKA 3TK7A 2X40A 3S2NA 4Y8FA 1HL9A 1QAPA 2NQ9A 1E1EA 3T7VA 5ECUA 2EPHA 3LYEA 4JDBA 1A4MA 1WZKA 3N13A 4IX0A 4HYRA 3AYTA 3T0CA 4GIRA 3IJ8A 4PUMA 1AODA 4F0MA 1QU4A 3U2OA 2F2KA 2NQLA 3T2QA 3KL5A 2V3GA 2J66A 3H7VA 5HQEA 4O11A 2XHYA 4R7OA 6CGTA 4JFVA 2D22A 1TMQA 4D1JA 3DDMA 3UZJA 4IP5A 3EMQA 4CCCA 3SRDA 5DO8A 1EX5A 1HKWA 1NH6A 1HJXA 4QXIA 1PWLA 4B15A 4PRWA 1E4MM 4KWWA 3PY2A 3OVRA 3IJQA 3GYCA 3NDOA 5DANA 2ZUSA 2NQ5A 1D3CA 2VVNA 4AYGA 1EJ7L 3LV6A 1YXCA 1JZ6A 2BDQA 5CJ5A 1CB7B 4QIUA 4C1KA 1RQEA 3RCYA 1PKLA 4PMXA 2O4QA 3HG5A 2NWSA 3MUZ1 3K4DA 3OVGA 1RJPA 2C91A 1FHDA 3LHWA 1W0MA 2O55A 4P61A 1PZ0A 3EWCA 4UFHA 4WGHA 1OFDA 3Q37A 4HHLA 1R3WA 1YNPA 4HHMA 5FCZA 1TIWA 2XTKA 3AOFA 4JHMA 3HG4A 2YDRA 2YCIX 1BYCA 2QJGA 2J9ZA 1N82A 2DH2A 3TTYA 7ENLA 2C1HA 1IZKA 2AOSA 1DOSA 3MUXA 3E0WA 1YE6A 2WPBA 1RCOB 3E2VA 5LIUX 2RGLA 4LY4A 4IGHA 5EL1A 1JRCA 2CW6A 4K7VA 2XVGA 5AB3A 3L2MA 4FS9A 4LS1A 3OODA 4Q8NA 5D2TA 1UKTA 4IH3A 1MYRA 4N7QA 4JL1A 5F2MA 9XIMA 2WWDA 2GQ9A 4W7VA 3IARA 1WDPA 2GJXA 1DWAM 1KD0A 2Y7GA 3NDZA 1ISZA 1EP3A 3GR7A 1UP3A 2JQXA 4P7QA 4JFSA 3QM3A 3V7PA 2DUAA 1F3EA 4GHRA 3ENLA 1ZU8A 5I77A 4WR3A 2J24A 1OX6A 3MYPA 4DXXA 4L64A 4PTNA 1UR2A 2XH2A 2IKHA 4GUGA 3WLNA 2P3EA 3M0HA 4M1BA 1TB3A 3I3DA 4W4QA 3ITXA 3AHTA 4AZIA 1V5XA 4HNTA 1F76A 4XZWA 2B7PA 2ZXDA 3UA3A 1M04A 1M7JA 2X30A 3AICA 3SFWA 3LHUA 2I57A 4AXNA 4RV3A 1IHIA 3NIYA 3W29A 4BWLC 1E6ZA 3RLUA 2W92A 2G37A 4US5D 1Q66A 4FLQA 1AFSA 2BOEX 5AN7A 2QVHA 4S3BA 1LCOA 1JYVA 3CEPA 3NL3A 1XPGA 4DBEA 1DJNA 2VC5A 1J79A 3HV9A 4UFJA 3DHUA 3NCOA 3O0KA 5C9XA 4Z17A 3VNMA 4PUJA 3P8IA 3H2MA 1AW2A 5AZ0A 4H2HA 4RXFA 4R34A 3ABQA 3GHSA 3N4EA 2QJMA 3H2EA 3IEBA 2OYLA 3SO7A 3CZJA 1V6XA 2JKPA 4NX0A 3G8EA 3TV8A 2ZIDA 5RUBA 3BOLA 2HNHA 3EXSA 1GOOA 3DG7A 2GVEA 3XIMA 5T91A 4OKDA 3P0XA 1NFGA 1AQ0A 1VHCA 2VQTA 1IV8A 1AL8A 4QLJA 3SCOA 5HMSA 3VZZA 4UQEA 1ZCOA 4NAEA 3N11A 2B7OA 3N29A 4I9MA 3W7JA 2AMGA 4IG2B 4LQ1A 2YA1A 4MZ1A 3GNPA 3GG7A 3OJGA 2H8ZA 4FR1A 3B0UX 4P5UA 3VDCA 3CUIA 3WCZA 1CCWB 4KCWA 5DCEA 4AWSA 1PHWA 3BAJA 2E77A 4Q8VA 1N55A 3A4AA 4QRNA 4JIIX 5HINA 3M9YA 3W02A 2OOGA 1KGUA 2WSPA 2Z2UA 2YLAA 1VJIA 1IIGA 3WQOA 5A8MA 5TQLA 3ERPA 4NT0A 2XH4A 4GYKA 5EMKA 4W85A 1H51A 1R9ZA 3B9AA 3RU6A 1O7AA 2J88A 2OWXA 2C1IA 4FI4A 5CZKA 4RW5A 3B9EA 1FP9A 3R8RA 2FTPA 1P0KA 2X05A 3AFBA 3SW6A 2HCVA 1U5HA 4S2BA 1A4LA 3K8LA 2RGMA 5LHEA 4EXBA 2OGJA 1KM3A 2Y89A 1G4EA 1GJWA 4BKNA 5D2VA 3M0LA 1P6CA 1E0WA 1IYXA 5HATA 4ZTXA 5D33A 3HPXA 4RLIA 1Y65A 2NV1A 2WVVA 4QSHA 3S1VA 3EZ4A 2YLLA 1SZFA 4V1YA 3HPFA 1LOQA 3UERA 1ELSA 3UW6A 1Q13A 4KESA 3BLLA 3M43A 4H9UA 4HKPA 2V2CA 3AU6A 1TR9A 3SRKA 3NPXA 3SBFA 4WCJA 3K2GA 1QI5A 5C0QA 4GQGA 2TODA 3V18A 4IGMA 3NSMA 4K37A 5CC5A 3KVKA 1FQ0A 1XI3A 3E0VA 2HBVA 5DEZA 4HZ8A 3S8HA 3URBA 1G5AA 3WEMA 2HBXA 1IR1A 4J28A 3KZPA 4M7SA 1UW9A 3APGA 1ZUAX 4M80A 2XVLA 3JR2A 2Z00A 4FX6M 1QW9A 1MZHA 1YPIA 2PDCA 3VKBA 4LJ3A 1XUUA 3JUGA 3RR4A 2V0TA 1UUQA 1XC4A 1VRXA 3WQFA 2W5FA 3R6IA 2ZUTA 5CKSA 3LDVA 1WNOA 3TC7A 3QY6A 1UD3A 5LGXA 1PKMA 4YCOA 3MUAA 4QCFA 2E6DA 4G7FA 2EG6A 1BF2A 1XH2A 2E6FA 1LM1A 3BW3A 2Y5SA 3SRFA 6TIMA 2HPIA 3W37A 3VIFA 4ATDA 3VABA 4LB4A 3D5HA 2QCFA 1YQ2A 3BAYA 4D6FA 2DZTA 3RILA 3T42A 1ICSA 5IOBA 4W9TA 4GGHA 3GW0A 3K8MA 1XYCA 3WDRA 3CV7A 1E9ZB 3H8AA 1E4NA 1XBZA 3TLQA 3UA4A 4QR6A 1XRFA 2E67A 1T41A 4DXVA 4CQ9A 3MYOA 3MSDA 1J10A 1KQYA 1TZZA 2PDNA 1UASA 4D6DA 3F5LA 3VM7A 4AZCB 3VNLA 4UTMA 3I6EA 1M5WA 2VJXA 5LNWA 4I9TA 1U1HA 3RF9A 3WJZA 3LMYA 3WLOA 3RRAA 1PX4A 2WZIA 1U83A 3T4CA 1XCWA 3KUMA 3EPMA 4HK7A 1JCNA 3NM1A 3B8IA 2D24A 5FSEC 4GUHA 4I7VA 4ICNA 4N4PA 1JYWA 1EOKA 3EXTA 2OEMA 1R0MA 4DBUA 3WLKX 2G3NA 4ORMA 1TA3B 3K13A 2Y85A 2IPFA 4UQDA 3VNJA 3AYVA 1RQHA 4Z2HA 2G3FA 3TJLA 4RX0A 3LA4A 3HQOA 2J7HA 2C8NA 4HA1A 1EHAA 2V30A 1E6SM 4XUGA 4GJ1A 3KOZA 2AL2B 5FJUA 1JFXA 3GAKA 5KMYA 1GTHA 1QHPA 1ZAJA 4TV6A 4PMUA 1SUXA 2FFCA 3HO8A 2ZXQA 3A4XA 3EKLA 3MP3A 3H26A 3GG8A 4UWMA 3S1XA 3MKVA 2CNCA 3GIQA 3W22A 2GVLA 1G4SA 3MMWA 4K8EA 3REQB 3U9IA 2ZA3A 2PDFA 3GVRA 3MV11 4P8XA 4YWSA 4BQ4A 2G0WA 4LF1A 2CBJA 1HL2A 1CECA 3WMSA 2WJDA 1O4UA 2J13A 1OIFA 3OZMA 2OO6A 4C6PA 3V36A 3SSJA 3FDKA 4A3QA 1UH2A 3N9KA 1EIXA 1BYAA 1S1PA 2INZA 4FOUA 4Q6XA 3WQDA 1SZEA 4ROQA 2AQOA 2NUXA 5CJMA 5XIMA 2ZYFA 3ZVIA 4YJ5A 3KDNA 3UYCA 3B40A 4Q33A 5DF0A 3TWAA 1W31A 4AXKA 4OOZA 3GBDA 4GCXA 3PZMA 1V0KA 2CHOA 4YTQA 4UQBA 3QH2A 4WK9A 1BTMA 4MDOA 4W5UA 3W01A 4MPKA 1W1YA 3MKKA 2Z4GA 2WW5A 3UQNA 3OEXA 1VEPA 4J3SA 4BF5A 4HHHA 1HNYA 1I60A 1J6PA 1E56A 1J11A 5I06A 3MUIA 4HVXA 2R1MA 2CZDA 5HMDA 5J04A 4DJDC 1L6GA 4S3EA 1QI3A 4XZMX 2I56A 5E6ZA 2OX4A 4UMBA 4B2DA 4ZOBA 4TX9A 3TQ0A 4OECA 2Q8XA 1WDWA 4JY9A 4O57A 4UTTA 4AX6A 1QOXA 4ZGYA 3BARA 1LBMA 3EOUA 3QVQA 3FNDA 2YB4A 3URNA 4AAJA 5G2WA 1KM6A 1NSJA 1W5PA 1XYFA 2CLOA 2D2HA 2PLCA 4LVFA 4DM2A 5HNUA 1C8XA 1H61A 4XAGA 2RJHA 1UPMB 2NQZA 1JF6A 1JDCA 5HAOA 5IHRA 4LBUA 1K9FA 4V1XA 1OFPA 1KQZA 1TJRA 1BSIA 4PEEA 4MLRA 3WLMA 3MV01 4GYFA 2H8XA 1FHUA 3MZNA 3QOMA 2CHNA 4L1GA 1KWKA 1JRBA 1F6PA 3TTSA 1QW8A 1K6AA 3CO4A 2OQLA 2CERA 2Y8KA 1DYSA 2PGRA 3OGSA 1B3WA 4XZHA 1XG4A 4AZGA 5C9WA 1J9YA 3WLHA 4ZODA 3XISA 1AJZA 3CWOX 2OPJA 6REQB 4LEQA 4QJ3B 4S39A 1KLZA 1E6RA 5AC4A 3H2FA 2XVNA 1LL4A 3F5JA 1UKSA 2ZA2A 3TOYA 4K2SA 5TAOA 5F1VA 1DVJA 4PUWA 1UROA 1RP8A 2BHYA 4QM1A 3K1DA 1PV8A 2G3JA 2ABAA 1VFTA 2X0YA 4UMCA 4C6BA 1S1RA 3LUTA 3F03K 4Y90A 1WKFA 4LUSB 1TTQA 3AZSA 2WKGA 3L0GA 1PL9A 2VR4A 3BMWA 4BY3A 3HG2A 1AH0A 1FDYA 1K02A 1ALDA 1PCKA 1C3FA 1OY0A 3B9DA 2VC9A 1QMLA 3FXGA 3B03A 2OSYA 5HNNA 3S9IA 3ZR6A 1R2TA 1V3IA 2BGSA 1K9TA 3EAUA 3UZ5A 4MF4A 4JPGA 3NZGA 4JNYA 4C6CA 3CMGA 3W6LA 1U33A 3UETA 4UB9A 1OFQA 3W87A 1WDDA 2H6RA 2V5CA 3IIVA 4PMOA 4W7UA 1XS2A 4TVCA 1KBLA 3THAA 3ONCA 3BXWA 3LRMA 2VWTA 3OYXA 4X9YA 3VIGA 3NEHA 3P14A 2WBKA 2ZBTA 5FJIA 3HGJA 2E68A 1X1ZA 3OIXA 4PGLA 1R2RA 5K3VA 1SSGA 1UCWA 4LNYA 5F2IA 2FQIA 1R5YA 2XFYA 4L80A 2IQTA 4K1GA 1LUCA 2F8QA 4A22A 3PUGA 5LIKX 1CXHA 3VNIA 5J5RA 4NL1A 4GQQA 1GHRA 3QTPA 1JUEA 1GKRA 3LV5A 2IXUA 4NI3A 2BHUA 2Q71A 4JXCA 4HPJA 4E3TA 3POCA 4HD5A 3VZYA 5EMLA 5HR6A 1V0LA 1VD6A 4JX5A 1TUFA 3W1LA 1ZJIA 3R4IA 1MUCA 5GNYA 3MJMA 3L5LA 3KHJA 3M44A 4UNKA 2JIWA 4O0QA 4E0CA 4MADA 2Z28A 3EKGA 4F48A 1IWAA 3KWXA 4GE8A 3SUSA 2J4GA 3PZGA 4L5ZA 4ZQRA 3FGCB 3J7HA 4OOUA 3C86A 2R1LA 1VHNA 1R87A 4X63A 3M4HA 1PXGA 1R3SA 4PMDA 2DZBA 4E38A 2X2YA 3RGTA 1TUXA 9CGTA 4CNNA 3PJXA 5IM51 4BR1A 1Q7QA 1UQYA 3UR5A 5CC6A 4CLMA 2VCBA 3C0QA 3BLFA 3SIMA 1FCQA 3B4UA 1EC7A 1GVOA 2GOKA 3WQ5A 2OZ0A 3TJXA 1W1TA 3AC0A 3R0DA 4WY0F 3W7QA 2GQAA 5CG0A 1EXPA 3WF0A 4GOAA 1CI1A 1H1NA 4ZB5A 3N2OA 4ZVJA 3ZJ8A 3UD6A 4R85A 4QAIA 4GY7A 2WKLA 3VIPA 2FPYA 4Q7BA 1IEXA 1BD0A 1U1UA 3OLEA 3RM9A 2Y2WA 4PUKA 5EKYA 5KEZA 1RY0A 1US0A 4P2VA 1H50A 1H0GA 2ACQA 2Z25A 2VENA 5A8PA 4CQDA 4UNIA 4A3UA 2A7RA 2ZKMX 2KX9A 4REQB 3IV8A 4XBSA 1HKVA 4XSMA 4H6RA 1TQJA 3G18A 1MNSA 3CO8A 3T78A 3OU8A 4CQAA 4NZFA 3W1AA 1AH4A 2C6QA 3A24A 1QNSA 1FXQA 4EE9A 1YXYA 3CT7A 1ONEA 1WKEA 2JEPA 3ALFA 1K3UA 3GR4A 1E5NA 1Q6FA 4ZXLA 3F4DA 4OV9A 4E4PA 5BOFA 3AXHA 1BFNA 1W37A 3MQTA 4MPQA 4JDYA 4JYFA 4QG9A 2QDEA 4Z08A 4UOJA 3GY1A 1G6CA 1V7AA 4EX4A 4GUJA 5AHFA 4WJEA 3WJYA 1RA0A 3KOWA 5BXSA 1AQHA 3PUDA 2WK2A 3RJYA 1I45A 4GMEA 1F61A 1RJQA 2GJLA 2FTWA 4EXQA 1HVXA 5I24A 2XG9A 1TPWA 1MFUA 3KRSA 4H7CA 3AIQA 1RAKA 2J8FA 3CIVA 4MNLA 3NDYA 1CGUA 4QSFA 3NR0A 3O16A 3P67A 2E5CA 3XINA 5HQLA 1KA9F 2X2GA 3TH6A 3W3OA 4NUWA 2OKTA 1DJGA 1TV3A 3ZLFA 2P88A 4IQLA 1F6YA 3C0LA 4LNCA 4Z1YA 4DB7A 2VR2A 4YYCA 1WA3A 2FMOA 3GSMA 2ZX5A 4RZ5A 4Z2IA 4HYVA 3UJRA 4BQ3A 4PL1A 5AHMA 4L6DA 3QZAA 3E9AA 3HQPA 1MFVA 1NJJA 4LCRA 4A05A 1W6TA 2OODA 1YHTA 4N0RA 3UT0A 1TMLA 1R3RA 3KCLA 4M7TA 1TCDA 1JULA 2Y63A 2VEIA 2Z26A 5AY7A 1ME9A 3UJEA 5H8UA 3L68A 4LRTA 5JQ9A 3RIKA 1GEHA 1EDTA 3G6MA 2CLLA 1LQ0A 3UGVA 4UIOA 4MUZA 3S9ZA 2D0HA 1TO3A 1OK6A 4R88A 1DWGM 2RHGA 3SDOA 4DRSA 1RZMA 3KOXA 5H91A 1UQZA 2WB5A 4ICCX 1Z3NA 4MYXA 1QHZA 1A0EA 3AHVA 3LLXA 2DVTA 3OG3A 3CLWA 1TFVA 6A3HA 1SGJA 5DT5A 1KFJA 3Q2DA 3Q4DA 5U7SA 4A21A 3W7GA 2VGGA 4C7FA 6PTDA 2OT1A 5FEWA 4JD4A 1HJUA 2BHZA 3CAVA 3CV2A 3DH7A 5FF4A 3RPTA 3UBPC 2XWEA 1GZ1A 2FZ8A 3GNRA 2ZADA 4QEEA 1KTCA 3PFRA 2VCAA 5A6SA 1YDOA 2PDUA 4U28A 3WQPA 1BVNP 4S2CA 1OZMA 3R2GA 4DF2A 4NX5A 3I10A 2PODA 3M47A 2QCLA 4MJZA 4ZENA 3VMNA 2YXGA 4IF2A 1Y8BA 2H3BA 4DWSA 2W91A 5B80A 2IUZA 3ISIX 3JZUA 4BI7A 3G8RA 4ZO7A 1DTNA 3B4YA 5IDZA 4DF1A 2C7FA 1EBHA 1TWDA 4W86A 2J9YA 4L4OA 4E3VA 3W1MA 4N2YA 5CAKA 1Z48A 1IEIA 2ZRZA 3WUBA 4IUGA 2G95A 3PBMA 4DLFA 2O7SA 4J2PA 4J5NA 2VI0A 3T8LA 4JCLA 5EBUA 4Q8QA 3P81A 3U0HA 4IX2A 1C92A 3FYYA 4H7ZA 1S39A 5AECA 2VD9A 3SEPA 4J2MA 4ENLA 3W6MA 3BANA 3UNDA 1PJ9A 2J7GA 3M7WA 2G4FA 4M81A 4DBWA 4LYPA 1IGWA 3H7RA 3ZS4A 1ZBKA 3WH6A 1TE1A 1XIIA 1RSCA 1TMHA 3N1AA 5K9XA 4LTSA 3AI0A 3TCEA 3OHIA 1FWWA 2AL1A 2EQDA 4LX4A 4UQAA 3B04A 2ZICA 5BROA 3EOSA 1ZPTA 3BQ6A 4N6FA 4ZE5A 4GISA 1EJXC 4AD3A 3NFUA 1DIOA 1S3TC 2VEFA 3P84A 3WFZA 2AMXA 5A8OA 3OGVA 3DFSA 1OABA 2HEJA 3K46A 4MVAA 1OZQA 3RRXA 4GO9A 2A6LA 2Q3OA 1B31A 4FPSA 3UWWA 2FVMA 5A8QA 4TQTA 1IZCA 3WL0A 1EGZA 1W56A 3P6LA 1XP3A 3T6CA 4XWUA 7TIMA 4RPPA 1CPUA 4E8CA 3VNYA 3GTIA 1HUVA 3CNYA 1XLKA 1FX6A 1YEYA 1JZ4A 3NYDA 3FKKA 4E6MA 3H4GA 3WMCA 1K8YA 2E40A 3BE7A 3DIPA 2QJJA 1VJSA 2A79A 4X22A 2WMFA 1S46A 4MWAA 1KBKA 1AW5A 1PVNA 3M0MA 1PSCA 3FCPA 2YXOA 3VOCA 4G9PA 3R8GA 1F2JA 2PDWA 4FR6A 2HNEA 1BTCA 5DRIA 3MWCA 4HU4A 5A3HA 2OO0A 1I1WA 1CIUA 2BASA 1HL8A 3DENA 3PG9A 2GYIA 4E5TA