4ORMA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm338 (n-[3,5-difluoro-4-(trifluoromethyl)phenyl]-5-methyl-2-(trifluoromethyl)[1,2,4]triazolo[1,5-a]pyrimidin-7-amine)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
375
structure length
375
Chain Sequence
b'YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Plasmodium falciparum
publication title Fluorine Modulates Species Selectivity in the Triazolopyrimidine Class of Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors.
pubmed doi rcsb
total genus 149
structure length 375
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ormA00
1T0OA 2QCLA 2QAPA 3QZEA 5I3JA 5AB3A 3EKLA 4LRSA 3C56A 2GPTA 4IPIA 3JS3A 1GJPA 3C6CA 3WFAA 1EX5A 3A5VA 4IJBA 1FDZA 1T96A 4R33A 4TR9A 2YW3A 3H55A 1JQXA 5HWMA 3AJXA 2F84A 3G1YA 1B4EA 4WZHA 2FQIA 4HNUA 4WOZA 1H63A 2V0TA 2Z6JA 2QCGA 1AW5A 1DORA 4O17A 1RV8A 5G1TA 1W8SA 3S8HA 4OGZA 5C2XA 2RFGA 4FEZA 1XKYA 3HG5A 1SZFA 1MXSA 2DZSA 1Q6LA 1TPUA 4NXSA 3FJLA 3LTSA 1EA0A 1LTDA 2V2CA 3S1VA 1NVMA 1LYXA 3W1QA 4TX9A 3TSDA 2O7SA 2DZXA 5U4NA 1IXOA 3LI1A 2ZRVA 3QPZA 4K36A 3EX1A 2C15A 3BO9A 3IGXA 4TMCA 3QMSA 1YDNA 2DJXA 4EVZA 2YPIA 2X1SA 1K7EA 4JGDA 5EY5A 1F7BA 3G0XA 3T44A 2Q8ZA 4HNNA 5GVJA 1XFBA 1S5TA 5KSWA 1QFEA 1FWWA 1DV7A 3PWAA 3W1MA 4QNWA 2J9XA 1GT8A 4N4PA 1TTPA 3RU6A 4JYDA 3UWWA 4RZ6A 5D03A 4RXFA 1EWDA 5KZEA 5F4SA 3S9YA 2R14A 2NXGA 3QPYA 3UPWA 3W7HA 3M0ZA 3P60A 3TXZA 2GJLA 3TW6A 1QPRA 1ZAIA 2C16A 4MIMA 2ZA1A 1GVSA 3EX6A 3NL6A 4MKNA 1SZEA 3GXNA 3T78A 2QR6A 1VJIA 4ZVJA 2V5BA 1SSDA 1FDYA 4XQ6A 1HTIA 4FNSA 3BVJA 4UFJA 3W1AA 2V2HA 3FOKA 2W0UA 4R34A 4JX4A 4FX7A 1W5OA 4NNBA 1PHWA 1ZFJA 4JN6A 5CKSA 2RH9A 3UZJA 3UQNA 1WDWA 3DBPA 2BX7A 1FDJA 4O28A 2ZRWA 4ORIA 4IPJA 3I7QA 4PTNA 1G4SA 4YLWA 3E12A 2WSYA 5CSSA 4B5NA 3UWVA 4UTLA 2E68A 5HR7A 1OFEA 3FYOA 3M5VA 3NAVA 4HHPA 2Y61A 1KM4A 1DKWA 3N9SA 4FHAA 4N02A 3WK1A 4FO4A 4RZ4A 1DL3A 3O15A 3E9AA 5T26A 2ATSA 1OFDA 3OHIA 3QC3A 3IIZA 3U6WA 4J9JA 3TJLA 3LHYA 3M43A 8TIMA 3G24A 1K7XA 3JR2A 4XUGA 3TCEA 2E6AA 3O8AA 1XBVA 2RDUA 3OA3A 1SO4A 4FNPA 3NQAA 2Y70A 4ZQNA 5BNKA 1AG1O 4UFHA 4JYEA 5DBTA 1U5JA 2ISWA 1BTMA 1QPQA 3L67A 1ME8A 1YYAA 3M6YA 3DXIA 3SR7A 1Z44A 1PCWA 3MI3A 4A21A 2QF7A 4MUZA 5HJLA 4HIBA 4UMCA 3QMTA 2Q8LA 4OWGA 2KZHA 3W7GA 1KTBA 2CWNA 1SW7A 4UTMA 5U7SA 3NPWA 2Q3OA 1M7OA 1SSGA 3CWOX 3L5LA 1R30A 2C6QA 4ZQOA 1ZNNA 1W54A 2YCEA 1DJQA 2ZZ2A 5DXYA 1F05A 3MP3A 3N73A 1NSJA 4P2VA 4MY9A 3F4WA 3TDFA 5DY2A 3S1WA 1ADOA 2Y63A 2DZTA 4CCCA 3CU2A 4HNVA 5LSMA 4GJ1A 1A5SA 1RZMA 1J5TA 5C5YA 3MBDA 4MYXA 2HSAA 3L0NA 2YZRA 4UTIA 3LOTA 3WK3A 1LRNA 1KTCA 1EIXA 3DFOA 1TIMA 4PH6A 3E96A 1GVQA 4YWIA 3B06A 2ZZ3A 2CLKA 1B3OA 4EOUA 4GC4A 1OK4A 1RQEA 2TRSA 5KMYA 5ABTA 1Q3NA 1WBJA 3ATYA 3UNDA 1O5XA 5D2TA 3CB8A 3BLIA 2QJIA 1YDVA 3WK0A 3INPA 2ALDA 2HMCA 4WXZA 1QWGA 1FX6A 2WQPA 1GVRA 3KVJA 4Y96A 1LROA 1M5WA 1XDLA 1Q6RA 4JTJA 3I7SA 4R7JA 3NL2A 1Z42A 2J9ZA 3N3MA 4UUIA 1PHQA 1TPFA 2GVLA 3C52A 3KVMA 4FX6M 3FEMA 1QMLA 3NQVA 1JCNA 3FS2A 4YCPA 1XM3A 2ABAA 1LLWA 2I9EA 2YSWA 1H5YA 1WX0A 3PUOA 2YGYA 1EP3A 5K4ZA 3HGSA 1C8VA 4N9CA 2A0NA 3M47A 3H53A 3R89A 4TMBA 1VS1A 4I9AA 2H8ZA 3IIPA 4NNCA 3NZRA 1K03A 3W7CA 3GZ3A 5BW6A 3QH2A 3DI0A 1KFLA 3TQKA 5DXXA 3KVKA 2G97A 3UD6A 5AC6A 2D73A 1NF0A 1OHLA 4UTKA 1YTDA 4O50A 1QO2A 1L6SA 2X16A 1KBJA 3IRDA 3STFA 1A5CA 3O16A 5BMXA 1AW1A 3LLDA 2QDHA 1JRBA 4ICNA 5I3IA 2BLEA 4OHQA 2PC4A 1ME9A 3WJZA 3OG3A 1WV2A 2FTPA 1W56A 2AAMA 2E1DA 3P80A 2VKZG 4IWWA 3LX9A 1MEWA 3PF3A 2NV2A 4GFSA 4QNEA 2QDGA 5CPMA 3L21A 2QCDA 2PRLA 3DHFA 2VFEA 3QEZA 3MP5A 3TUUA 3R8RA 1V7YA 1S5WA 5K7JA 3DKLA 3NOEA 3NEVA 4S2BA 4GUJA 1H1YA 4BI6A 2JKEA 4HN4A 1CW2A 1YDOA 3NO5A 5D05A 3SSJA 5G2HA 1TV8A 3KHJA 3MJYA 1H61A 3QYQA 5DBUA 3M5YA 4Z0SA 4AWUA 3Q37A 3MYPA 5LKYA 3LHVA 3BARA 3G3DA 4BI7A 2R8WA 5J5RA 1FCBA 4MJZA 3SECA 1GYLA 3HGJA 4KWWA 2C0AA 4QITA 4E2BA 1XXXA 3LV5A 1KM6A 1HO1A 2V9DA 4UFIA 3S6DA 3TC6A 2YR1A 3IIOA 4IMEA 1Q6OA 1GZGA 4DO4A 1FUYA 1R46A 3G1VA 5F4WA 2F7FA 3C8FA 1BEUA 1TPC1 5BRBA 3S0CA 3WJXA 1LM1A 4O0KA 1KFEA 4UFLA 5AYZA 1B9BA 2CLMA 3W75A 1TPDA 1L2UA 5F2LA 2V5LA 4IMCA 4IQLA 4BK9A 3GKAA 4FB7A 4NX5A 1KBIA 2JKAA 2QUVA 1WA3A 2XN2A 4NU7A 2QJHA 1ICQA 2XN0A 4OT7A 1JUEA 3TQ0A 1Q45A 2PRMA 4QSHA 3W7PA 2CZ5A 3WK2A 4LV4A 1XDMA 3WJYA 2ZBTA 1TPWA 2TSYA 2GVGA 3FA5A 3HPXA 1TJRA 4OE7A 3O07A 3FKKA 2ZDRA 3OIXA 4M7SA 1EP1A 1GPWA 4OBTA 1IGSA 1TTIA 2WV8A 2YXGA 4I7UA 1ZAJA 1ICSA 4AXKA 3LB0A 4NX0A 1IIGA 4AEOA 3TV8A 4PC8A 1TREA 3IVTA 3LHWA 3P8JA 4RCXA 5HMSA 1G7UA 2XN1A 5AC7A 1FWSA 1QOQA 3UWYA 4DF0A 5C55A 1JQVA 3P61A 3RLVA 1WBHA 5BMWA 1H1ZA 4EWND 4UTWC 2PCQA 1JVNA 3K30A 4X9SA 1H7NA 4NJIA 1F74A 4IXHA 4OQVA 1EP2A 1UB3A 1VHCA 3PULA 1KFJA 1VRDA 1WXJA 2NXHA 2QCNA 4LVGA 3QW3A 4XBKA 2ZRYA 4N9EA 3C0JA 5DCBA 1MEIA 5G4EA 5K9CA 3PC0A 4IX2A 5AHLA 1VPXA 3W7DA 3OVRA 4KFPA 3A24A 3MWAA 2Z1BA 1QDSA 4ADTA 4UTWA 5D2YA 4LS2A 3MMTA 3TAKA 3C2OA 3FIGA 5K2ZA 4JS3A 3QJAA 3UWUA 4O54A 3TA6A 2R91A 2X1RA 1F73A 2Y7FA 2J27A 4Y6GA 2E5BA 2I14A 3I68A 1VZWA 5LNVA 4OU1A 5DLCA 1JULA 4UC5A 4O8RA 4DO6A 4FNQA 4JTKA 4RXGA 5LNWA 1WOBA 2Y88A 1PV8A 2E6YA 3P62A 5G2IA 3W6YA 4NUWA 4JY8A 1THFD 2Y7EA 5HUOA 5E93A 4LRTA 4QJ1A 5G5IA 1HUVA 1UASA 4FXSA 5SWUA 2DU2A 2E09A 2E77A 3N2XA 1OFOA 5F4XA 3SIZA 4MZ1A 2WNQA 4WUIA 4R53A 5FF7A 5I3HA 1IXNA 1VH7A 5D30A 2ZFAA 3GX9A 1JJKA 5KZMA 1CX9A 4Y9AA 1W37A 4PODA 3W7RA 4CQ8A 1TPB1 3S5OA 1LZOA 3CPRA 3N9RA 1LBLA 5LNUA 4ADUA 1OYCA 2GJNA 4Z08A 5CGQA 2QJGA 1FY6A 4O1CA 2VEKA 3L66A 1JR1A 5AYXA 1L6WA 4FF7A 4DPQA 4M6VA 5HQEA 2C19A 4UTHA 2DZVA 3M41A 5D33A 4NQ1A 3TIMA 4RKAA 4GUFA 2V82A 3PBWA 1P0KA 4GRSA 4JEQA 4MZ8A 1OFBA 4FIRA 4PFMA 3A23A 3RFAA 3QW4B 2GUUA 1LDCA 4GUHA 4AHPA 4YXGA 4H4IA 3STEA 4M6QA 3DFPA 5D04C 2PURA 4MFDA 3F03K 4O11A 2YDAA 3EWYA 3UXAA 5KITA 3NL3A 1R2TA 1KFKA 3S42A 1FCQA 2ZA3A 1QPNA 2WNNA 3IGSA 4K38A 3GAKA 1BWKA 1TV5A 3IIVA 1W3IA 3CIWA 2NLIA 4K39A 3B03A 3GR8A 4Q4KA 2ZZ1A 3DH7A 3SGUA 2LLEA 4MPQA 1TPEA 2CLLA 1SQ7A 3IGUA 4HPXA 1TB3A 4TIMA 3EXSA 1N8FA 2YYUA 4LUIA 4EF9A 4BFAA 1IF2A 4HSOA 2FPTA 1SO6A 2C3ZA 1X8FA 4JDYA 1S5VA 2CLHA 3N2MA 1BWLA 3LCHA 2ZZ6A 1GVFA 3SY5A 3BK0A 3TU9A 5KINA 3NL5A 3GDRA 3LLFA 3NQDA 4ADSA 3B04A 3TC7A 5I3KA 4AF0B 1TJPA 3TFCA 3TW7A 3U8GA 4UNKA 3NYZA 4AH7A 4GXMA 4M5PA 3UZ5A 1JCMP 1B57A 1S3HA 1N7KA 3NQCA 1XBZA 2J6XA 3LHTA 1LRTA 2ISVA 1VCFA 1HFBA 4RV8A 2NX1A 3PAJA 3W84A 2J24A 4RLIA 1O94A 1W5MA 5HUPA 3ZR4A 3I6RA 2BXVA 4GWEA 2ZTJA 3TR2A 1TSIA 1ML1A 4XWUA 2AQWA 4MJMA 1WAUA 5AHEA 4XTIA 1LBMA 1KFBA 3KOFA 3TSBA 1O95A 1TRIA 3W7OA 1QR7A 1J4EA 4DBEA 3QMRA 1PL9A 2Y6ZA 4UMBA 2V8ZA 2WJZA 3LCXA 4Y8FA 3GLCA 3TNOA 2J9YA 1F6KA 1QAPA 1OFPA 4MFEA 4S1FA 4PL1A 4N4QA 1ZAHA 1MZHA 5D2XA 2ZRUA 4E2DA 2GQ8A 2Z6IA 3QQ1A 4Y90A 4MY8A 1I2NA 2C13A 4UMAA 4BWLA 1U83A 3QRHA 4POCA 4JTSA 1F2JA 4UNLA 2Y7GA 1PVNA 1KFCA 3TKFA 2QCMA 4A3UA 5CZSA 1H51A 3ZFHA 2A85A 3QF0A 3OBKA 5DCEA 1G6CA 2I1OA 3LRLA 4QIUA 3P5YA 1TQXA 1H7PA 2ZRZA 3THQA 2E5DA 3R5EA 3YPIA 2B7QA 2DZUA 3OVQA 4DXVA 2IQTA 1D3HA 1GEQA 3OVPA 1AK5A 1FCUA 3OEXA 3VE7A 5HNRA 4WX2A 2TPSA 4AHQA 3M44A 3GVGA 3EX2A 1YPIA 5CZTA 1YXYA 1KLZA 2CLIA 3PBUA 5I3GA 4XBSA 2QUTA 3CT7A 1M6JA 4LUJA 3MHFA 4CQAA 3MI2A 4UFKA 3DFSA 3B4UA 3LERA 4JX6A 3ELFA 2Y85A 5CZJA 3VFLA 1KM2A 4NVTA 3ABRA 2VEPA 3LCIA 4XKYA 4FXRA 3TMLA 3G1SA 5F2GA 1V5XA 1GG1A 4NXKA 4XKYB 2A2IA 3HO8A 1O4UA 5EA9A 5FI8A 3ZS4A 5FF3A 2H8XA 3JRKA 2ZZ4A 4JIPA 4DEFA 5G1YA 1OK6A 2H6RA 2PE4A 4JTIA 4M6PA 2R94A 3DKJA 3W87A 3LGEA 2JKPA 4EIVA 3GNDA 4UTTC 3CEUA 1EWEA 4O52A 3TJXA 1A5AA 4CCDA 4Z1AA 2DZPA 3PR2A 3W3OA 1TRDA 3FJ6A 2FDSA 5CSRA 5F1UA 2VOMA 5EBUA 2QUUA 2VFIA 4JTFA 2JK2A 5D2VA 2DJLA 4Z1BA 3G8EA 1XBXA 3A9IA 3IVSA 4JIQA 4M7TA 3W2UA 3W73A 2YFOA 3LV6A 3EB2A 1W5PA 3GXTA 4DO5A 2A7PA 2B7PA 4ML9A 3NM3A 5HWNA 3LDVA 4WOQA 2NWSA 1P0NA 2EF9A 1SZNA 1SR9A 3HG3A 4U28A 3SI9A 1KW1A 4DELA 3L65A 3NGJA 3PG9A 4CQ9A 4DQWA 1SU5A 4LU0A 3EX3A 4IXXA 4FX8A 2W6RA 1TYGA 3M7WA 3W1NA 2WKJA 1AMKA 3M16A 4ZMGA 3FYPA 2G95A 3TFXA 2WO5A 3B0UX 1YLVA 4UXDA 4LNYA 3G0UA 3NQEA 2ZZ7A 5KZDA 2ZCGA 2NX3A 3LHZA 3TMQA 3HF3A 3LTPA 1SUXA 4FNUA 2VFGA 2GQAA 1OX5A 5LGXA 3EKZA 4ZQMA 3SJ3A 1KM3A 4LVBA 3RF9A 3DFTA 3N19B 3VI2A 1H50A 2H3BA 3LRKA 4PL2A 4O1DA 1UCWA 5LHEA 2E6FA 4U4MA 1YXDA 1RD5A 5G4WA 4JICA 3G1AA 3GIYA 2V30A 2QCEA 1SW0A 3TSMA 1YPFA 3BG5A 5CG7A 3P7YA 3W71A 4KWVA 3O05A 3NQGA 3VKJA 2JGQA 3F1QA 1XI3A 1I2QA 3P67A 3G1HA 4YCOA 3FKRA 1CI1A 3M5XA 6TIMA 5FEXA 1J2WA 1GOXA 3BW2A 2VC6A 1W31A 3ZWSA 3UXDA 1K8ZA 3AO0A 4X2RA 5AYYA 1EEPA 3M1ZA 4HT3A 3L0KA 1FXPA 1OG0A 5BOOA 3LCLA 5K3VA 1RR2A 1EUAA 1YTKA 5DCDA 1ME7A 3S1XA 5A8GA 1W3TA 4O18A 1G4EA 4WJEA 2NUWA 4NJGA 3ABOA 3KXQA 3HMJG 2B4GA 4K37A 1VYPX 1DQXA 2C14A 3LHUA 4FNTA 5AHMA 3NPVA 1NF7A 2QEZA 3SGZA 2BTMA 5DN1A 2G5WA 1Y0EA 2A7NA 5F2IA 1DOSA 3L9CA 2ZTKA 4O0ZA 4JTHA 5F1VA 3GR7A 3PB2A 2O7QA 2P1FA 1DJNA 4JTUA 2RDWA 4OV4A 3STGA 3W7IA 1SZGA 3HGRA 3BGGA 3M5ZA 1X7FA 1I2PA 3HIJA 1GVOA 1SW3A 1IIHA 4RK8A 4K7YA 3GB6A 1G67A 3FFSA 1LBFA 1JCLA 5IM51 1XUZA 4LVFA 3MYOA 1LOQA 3ABSA 1W1ZA 3L5AA 3MHGA 1H7XA 2OJPA 3PUDA 1R2RA 1UUOA 3QQ0A 4RJEA 1QO5A 1LORA 2H90A 3QSTA 5AOUA 2NZLA 4UTTA 4O14A 2VENA 3EWWA 4YMZA 5F2MA 3L68A 3Q94A 1ALDA 2WPBA 2NUXA 2ABBA 3DI1A 3M9YA 3BW3A 1TV7A 2B7OA 2ZRXA 3PSVA 2WSRA 1H62A 3W7EA 3W86A 4AVFA 3LCWA 4CNPA 4L4LA 4GUIA 3S5NA 1K8XA 3GKFA 4AHOA 2Q3RA 3ANYA 1OFAA 2PRHA 3CTLA 3P8IA 3R13A 4JTEA 3W7KA 2J88A 4HPJA 2VFDA 2CZFA 4HSNA 4LS0A 4H6KA 1PCKA 2NX9A 3NVTA 5D32A 3A22A 2HTMA 2NWRA 4DF2A 3GDLA 2GOUA 3DAQA 3DENA 4G1KA 2TYSA 1XCFA 4GUGA 3G18A 4LY8A 2VFFA 3PVFA 2NV1A 1MEHA 1M7PA 2RKXA 3W1RA 1AL8A 3PBYA 3T40A 5L6UA 5LNSA 3EX4A 3LI0A 1OFRA 3BG3A 3NM1A 4IGHA 1TPVA 4QISA 1TPH1 3W2NA 3S5YA 1C9DA 1K02A 4IMFA 3HPZA 3RNDA 1I8JA 4LC8A 2BZNA 4O15A 1VLWA 4E38A 2X30A 1NFBA 3W70A 3GXPA 2Y7DA 1K7FA 1DQWA 5K9XA 5TBOA 4C1LA 3USBA 4N9DA 4Q32A 5HWJA 2ZQ0A 1GWJA 2AGKA 3S1UA 1JUBA 1W5NA 1HG3A 5FF4A 1A50A 2YW4A 3MW7A 4O13A 3IV3A 4ALDA 3S5ZA 3BPWA 1E51A 3W1PA 5E1QA 1KV8A 4WY0A 3P81A 4A2RA 3N34A 1R2SA 3HG2A 3DHDA 3TK7A 3UY8A 1L6YA 5G2WA 4O4VA 1PIIA 3BLFA 3CM4A 2QKFA 1B4KA 3CLMA 4CCEA 1I4NA 1I2RA 4QQ3A 2EPHA 5TIMA 4N2YA 1JUKA 2BSLA 3I65A 4JY9A 3NR0A 4PCFA 4AWTA 3G3MA 4GBUA 5E0KA 4IOTA 4JTLA 1UBSA 2Y62A 3TH6A 1F76A 1X1ZA 5H91A 1JCYA 2QCDB 2HS8A 4KFOA 4N6EA 1W3NA 5K4XA 4NZFA 3EXTA 1F5ZA 3SZ8A 1OJXA 2A4AA 4LV9A 1FCVA 3SW6A 4TU1A 5AFDA 4M19A 3O63A 3GDKA 3NQ7A 1P5BA 6ALDA 3NDOA 3NQ6A 2FPYA 5CZ0A 3HBLA 3A21A 4FIQA 2ZYFA 4K8HA 3GK0A 5CPLA 3P74A 2P10A 5D02A 3NPXA 2DORA 3GDMA 1JCXA 1O5KA 3HB9A 3HPSA 1QOPA 3HQ1A 4X3ZA 3I7RA 1QNVA 4PEKA 1Z41A 3BLEA 4CNNA 1GTEA 2TMDA 4LOCA 3R2GA 4O12A 1KV5A 4HNTA 3QM3A 2X1TA 4NJJA 4NZJA 1ICPA 1XUUA 2ATMA 2YYTA 4BWLC 1KA9F 3PSWA 3P82A 4A22A 4RR4A 3R12A 2OMAA 3KX6A 3LXCA 2WNZA 3KVLA 1RQBA 5LNRA 3CC1A 4MLRA 2A1YA 3EEGA 2GQ9A 3RK8A 1YADA 1WQ5A 3IVUA 4LWWA 5D2WA 1JCJA 1AW2A 4PA8A 3B0PA 3EWUA 3GNNA 3MP4A 5LZLA 4H3DA 3PS7A 3NQMA 1OF6A 4IX0A 3B05A 3LBMA 1LLZA 4LTSA 4UIOA 3W1LA 3PB0A 2A7RA 4IMDA 2V2DA 2P0OA 3O6YX 3LRMA 1TCDA 1ZENA 4LT9A 4UCGA 3DZ1A 3MBFA 3NA8A 4KFNA 1OF8A 4HKPA 2GVJA 4K8EA 3NG3A 3NPUA 4P61A 5K9DA 2QCFA 1ZCOA 5J5DA 2UV8G 2XFWA 4YL2A 1PS9A 1O60A 2Y89A 3W74A 2RDTA 5HULA 4JR5A 3LCFA 3FLUA 2CLFA 3MI6A 1QCWA 3TQVA 4LVAA 4UFMA 1JRCA 3TXVA 1VHNA 2OX1A 1P4CA 5DY3A 2OCZA 3GYEA 3UPBA 3W7LA 2EAWA 2VFHA 3W1TA 1RVGA 3QFEA 4ZL1A 4K7VA 3G1XA 4UTJA 4W9TA 4L4MA 3T4CA 1G69A 1TO3A 3TX9A 2G96A 1VGAA 4Q33A 4JD4A 1GTHA 4ZZ9A 1D9EA 3THAA 5L9FA 3LXBA 3NXFA 4KKXA 1GYNA 1OYBA 2X2GA 1W0MA 3C2RA 3V75A 1KM5A 3DGRA 3W83A 5HR6A 4O1BA 4LW7A 1LCOA 1N55A 1KM0A 4UR8A 4LC6A 1R47A 4QAIA 3W9ZA 3ABQA 1X1OA 3MUXA 1K8YA 4MY1A 4ZQCA 4WXYA 1IXPA 1H7WA 5LGZA 5TQLA 4OV9A 1EUNA 3KRUA 2HS6A 3Q58A 4O10A 3UY7A 1XC4A 3T55A 3CWNA 4D2JA 2C18A 4Z1CA 3GDTA 2X1UA 1W5QA 4N9BA 2WSQA 3RLUA 1F6PA 5CPNA 4UTUA 1SO3A 3G1DA 2A6NA 1TQJA 1VC4A 3LCGA 4WQ6A 3A5FA 2CZEA 4BR1A 2FIQA 1OABA 2ZZ5A 3MHUA 5DELA 4O53A 3B8DA 3GAYA 1Z48A 3IEBA 1UJPA 4CLMA 2VEMA 2ZA2A 1OX4B 1H7OA 1XBYA 2VELA 2CLEA 3H54A 3PBVA 2EKCA 4WY0F 3W2MA 3LM7A 1QPOA 3STCA 4O19A 4E0CA 1EB3A 2ISSA 1GQNA 1EPXA 4A2SA 4FNRA 1HO4A 1VR6A 4O4WA 4GE8A 4ONVA 2E6DA 4DF1A 4AB4A 1DVJA 4BF9A 1WYIA 3G8RA 3W2KA 1D3GA 1FWNA 4RX0A 3EWBX 1VLIA 1L9WA 3T7VA 1SPQA 4LS1A 4Z1DA 4MVAA 2DP3A 4DBDA 3KRZA 5EYWA 1VYSX 3DFQA 3EWZA 3KAOA 2QCCA 4MOZA 3P5ZA 4O57A 3BGJA 2FPVA 2FB3A 1C29A 2FLIA 3W2JA 5AN7A 2VXNA 1FWRA 3C3NA 1TTQA 3L5MA 3TE9A 3IIXA 3TAOA 1GG0A 1SO5A 3EXRA 1A53A 5FESA 1I45A 2B0MA 3O6DA 5CPOA 1ZJIA 2Z0IA 5HINA 1PE1A 3W2LA 1G4PA 2A5HA 4O1AA 1H7RA 1IXQA 3BG9A 3UYCA 3N14A 1AL7A 3G1FA 4EF8A 3NQ2A 5D09A 1T8XA 3F4NA 4ZQPA 3W7MA 4NJKA 1OYAA 2QAFA 3NZ1A 4AAJA 2E5CA 1HL2A 3W7NA 1OFQA 1UUMA 3BW4A 4TO8A 4RZ5A 1FBAA 1VYRA 3LTYA 2EGZA 5D37A 2YFNA 2A6LA 3BV4A 5KTLA 4AMAA 3E0IA 4X22A 1KM1A 1ZHAA 1FQ0A 4XTDA 3PM6A 5I3FA 3L2IA 2FJKA 2VEIA 1G4TA 2WOQA 3D0CA 1K3UA 5C54A 3WJWA 3G0SA 3E49A 4CNOA 3LXAA 5EMUA 1LP6A 4JTGA 1I2OA 4JTTA 2EHHA 2NUYA 5FF0A 1RPXA 3DU0A 3B0VC 2V81A 1DHPA 4DPPA 3P84A 3E02A 3W85A 3PG8A 1VQTA 1OX4A 3W23A 3W1UA 3PY2A 2JBMA 1XL9A 3SFKA 3V1PA 4BI5A 3NNTA 5FEPA 5FEWA 1BKSA 4AF0A 2CZDA 1ONRA 1T99A 2A21A 1KLYA 3ZWTA 4JNMA 2OZ0A 5LHFA 5AHFA 4ZQRA 5EPDA 2C1HA 4GNJA 4NJHA 1Q6QA 3TROA 3G22A 2FFCA 2OT1A 4I7WA 1NEYA 3UWQA 1TMHA 2OT0A 4I7VA 2CU0A 5IBXC 3HGOA 1P1XA 3W1XA 1ZALA 2DZWA 2CFFA 1G7VA 4MYAA 5AHIA 5MHBA 3NQ8A 4N6FA 3PUEA 3C2EA 4QM1A 3W7JA 5FEZA 4C1KA 3O1NA 4NNAA 1H60A 1LRQA 5AC8A 2YX0A 4S2CA 3LBCA 1X6UA 3NQFA 4LVDA 4AWSA 2B7NA 4O16A 5IBXA 3W76A 3MO7A 5D38A 3HJZA 2BWGA 5AHNA 4JX5A 1WOAA 3WJSA 1FXQA 5EL1A 5A5WA 3CHVA 2QCHA 5C6MA 1RQHA 1YXCA 3QSRA 1ZY9A 3U2OA 1DBTA 5EKYA 3C4UA 3CIXA 3W07A 1VCVA 1SFJA 1FWTA 3C2VA 3VCRA 3O06A 4IMGA 4XZ9A 3CEPA 4IUOA 1NAL1 2Z2UA 3VE9A 1OX6A 3KRSA 2RHGA 3HOJA 3UWZA 2JGYA 3CQ0A 1LOLA 4K6AA 4JXCA 4Z0JA 3ATZA 3W72A 4JYFA 3W88A 5H2ZA 1A5BA 7TIMA 3EWXA 1OVDA 2NXIA 3W7QA 2CW6A 4WY0B 3RMJA 3DFNA 3Q2DA 1MSSA 1TTJA 2FB2A 5FF2A 4NT0A 4ORMA 3C2FA 2H3DA 1SFLA 3VNDA 1MO0A 2W79A 4JDBA 1YTEA 3KFTA 4MZYA 1VCGA 1KTNA 3O6CA 4UR7A 4MLJA 4WD0A 3W22A 3C61A 4A29A 1LOSA 2CLOA 3HG4A 3L0GA
chains in the Genus database with same CATH superfamily
3D3AA 4HPNA 4F0KA 3TYAA 4HD5A 4DJED 2W3ZA 3PHAA 2INFA 1DJIA 3WNNA 4Q4OA 3PAOA 1EO7A 3H55A 1RLCL 1SJDA 2F84A 4AZ7A 3G1YA 3PBGA 4HNUA 2VDGA 2VYOA 4U31A 2V0TA 4MF4A 2EG8A 2QF8A 3TTSA 1RA5A 4O17A 2RFGA 4FEZA 3RU8X 3WLRA 3S3GA 1SZFA 2WBKA 1GVYA 3EB4A 4S3DA 5JBFA 1Q6LA 2RGLA 1EA0A 2NV9A 1LTDA 1UKQA 4PYSA 4XZNX 3S1VA 1NVMA 3BAIA 3ZJKA 3IANA 3SIMA 3WF0A 5RUBA 1GZJA 2D24A 4ZB5A 1RY8A 1UH2A 3BO9A 3IGXA 2DUZA 4L9XA 2V5CA 1YDNA 2DJXA 3FGCA 2HCVA 2YPIA 1EDGA 1K7EA 5EY5A 2ADAA 4HNNA 3QY8A 3PPHA 1DV7A 3PWAA 3W82A 4QNWA 2J9XA 4N4PA 2DFAA 4RZ6A 2D22A 1GOQA 4RXFA 4Y9MA 5BWAA 5KZEA 2R9RA 3B97A 4NIRA 3KWXA 3UZXA 4YJ5A 1M7XA 2ZA1A 1X1NA 3EX6A 4MKNA 3MCNA 4HCLA 5A95A 1IQ8A 5KETA 3R1ZA 3T78A 2QR6A 3APTA 4D1JA 1KC7A 1GYMA 4YVVA 5ECUA 3ARSA 3BVJA 3QZ6A 5KZ6A 3EDKA 1ZFJA 1O5RA 2RH9A 3UZJA 4U33A 2XFYA 1B90A 3QHMA 1FDJA 5B7YA 2VI0A 3JUGA 2DSVA 2OWWA 4XX6A 1XRVA 2WMIA 5GNXA 4UTLA 1UA7A 3AMDA 4HHLA 1FHVA 1EHNA 2OFJA 3N9SA 4QDPA 3QC3A 3QN3A 1JIBA 3FK4A 3QGVA 1HJWA 3G24A 4FS9A 1XBVA 1PWLA 1SO4A 4FNPA 1ZBKA 3GVVA 2Y70A 4U10A 3RN6A 2FFIA 1U5JA 3FJ4A 1OSEA 1QPQA 2JALA 3A6OA 4AZCA 3SCWA 4QBXA 4R9OA 4L6OA 4W7WA 1Q6DA 5CLTA 3MI3A 3Q45A 3SCVA 2FVMA 2VDHA 3POHA 1XG4A 4K68A 4HU0A 3UZWA 2YL9A 4RE3A 2KZHA 3W7GA 5EMKA 1F61A 2CWNA 2Y8UA 3NPWA 3QHOA 1SSGA 3CWOX 8RUCA 4B2DD 3WD2A 3L5LA 2C6QA 3GFYA 3CUXA 4RZBA 4FOJA 3T0AA 3N73A 5DY2A 1HKJA 1XLKA 4HNVA 5LSMA 1ITCA 1A5SA 3BCJA 2BASA 2WB5A 1YIXA 3D46A 4MYXA 3L0NA 4JTAA 4PRTA 2YZRA 4YWSA 3WK3A 1LRNA 4Q4MA 1JPKA 1Z32X 3OLGA 3CV2A 4PH6A 4YWIA 4IFOA 4WJ8A 1FH7A 3M7SA 1B3OA 2ZVRA 1OK4A 2I9UA 5KMYA 2BOGX 3CB8A 1YDVA 2PU1A 3AAMA 3INPA 1EF3A 1FX6A 1OC7A 3KVJA 1KO0A 1XDLA 4JTJA 1UQZA 4FI4A 3NZQA 2HK0A 1TWIA 3VOHA 1QMLA 1JCNA 1QASA 1XM3A 1MQPA 3GNRA 1PTAA 2ABAA 1WUEA 2I9EA 2YSWA 1JCTA 1WX0A 9RUBA 1K70A 4C6PA 4WGHA 2A0NA 5I09A 3ALGA 1CXKA 2CETA 3H53A 2DIJA 1U1HA 4TMBA 1FFRA 1BFNA 4I9AA 3BE7A 4NNCA 2NVCA 4RNFA 2YDQA 3KOZA 3ENLA 2BGQA 1M1BA 2RUSA 1GQJA 3KM8A 1LT8A 3KWSA 1EJTC 2E8YA 5I77A 1QHPA 4NHVA 5D9MA 1QO2A 3O16A 4PUWA 5BMXA 2BLEA 5A94A 4LJ3A 2PC4A 2QGYA 1S5NA 3L23A 1PSCA 4NYUA 5CZKA 1DJWA 2QPXA 3C0LA 2XYLA 4OIFA 2WZMA 2QDGA 3L21A 2PRLA 1JFHA 2VEGA 4XVDA 1V7YA 4JL1A 2A3BA 3PTKA 1PB0A 5K7JA 5HDRA 1E70M 4CEXC 1A47A 2CZVA 2E9LA 2JKEA 1CW2A 1YDOA 2YDRA 1NDVA 1S2AA 1RVKA 5D05A 3SSJA 3HM7A 3KHJA 3WUEA 1Q6EA 4URIA 4Z2KA 3MYPA 3MMWA 3KE0A 4BI7A 1W9BM 3JVAA 4IIEA 2AAAA 3HGJA 4D6JA 2NSOA 4E2BA 2XGBA 3ARXA 3PJUA 3C2YA 3I3BA 1PX3A 1IGWA 4IMEA 3VGHA 3EPMA 1GQKA 5ABEA 1TPC1 3WQFA 3L2MA 2F9RA 3S0CA 2DSUA 4FLOA 2CEQA 4UFLA 3SEPA 2JFEX 1TPDA 1J6PA 3SN1A 1L2UA 1LT7A 3I10A 4IQLA 3VX0A 3BLKA 3UJRA 3VMNA 3GC5A 2QUVA 1VD6A 2OZ8A 3WQOA 2DDXA 2XWEA 2BMBA 3KL3A 4GFIA 3UNTA 3MCMA 5DFAA 2XWDA 1TX0A 3W7PA 2CZ5A 3L7RA 4C6IA 1DWGM 3FA5A 3A3WA 4TTGA 1TJRA 1QBBA 2ZDRA 2VCCA 3OIXA 1GPWA 1UKOA 4OBTA 3MV01 2PTWA 1AJ0A 4I7UA 2Y4SA 4NX0A 3Q65A 1BF6A 1NWRA 1IIGA 1EJUC 4RCXA 4I9JA 1CGUA 1G7UA 2XN1A 3FA3A 4BQ3A 1JQVA 3RLVA 2HV5A 4LNCA 2POTA 4J3SA 4UTWC 1MUCA 3ZR5A 5I2UA 6XIAA 2PDGA 4DZIA 5FL1A 1UB3A 3PULA 4QFUA 5MF5A 1WXJA 2NXHA 3APGA 1PZ3A 4XBKA 2GYIA 2DT3A 1MEIA 3CASA 1KB3A 3EEZA 4GQQA 4F2BA 4ADTA 5A8OA 3MKCA 4HK7A 3FIGA 4JS3A 1GOKA 1Y65A 2PDLA 3QJAA 4ZO8A 4O54A 3TA6A 2R91A 1F73A 1I1XA 4C6JA 3S46A 1XIFA 4JEJA 5LNVA 1GOIA 1J96A 1JULA 4O8RA 2Y88A 2FZNA 3AXKA 5G2IA 3W6YA 3LMYA 4PUDA 1YBQB 3AQUA 4ICMA 4QJ1A 1GJUA 1JDAA 1F8IA 4WUIA 3BLPX 4TVDA 4PBFA 3LQGA 5D30A 1BQGA 2P3EA 3NEHA 1QBAA 3PP7A 2W66A 4M81A 1XDJA 4GO9A 1CX9A 4Y9AA 4D6FA 3BSMA 5CBIA 1K6AA 4CU6A 3S5OA 3ARUA 2XINA 3MDWA 5H8UA 1MRAA 4IUGA 2HXTA 2OQYA 3RR4A 5I79A 4ZA0A 2FJUB 1XR2A 1BLIA 4C6BA 4EPEC 3ZQ9A 1CDGA 2CBVA 2VQUA 2GJNA 4AEEA 2V67A 1PIFA 4KESA 5CGQA 4J2PA 5XIMA 3TTEA 3ANVA 1BPLB 4G7EB 1NWTA 5AYXA 1L6WA 4H9YA 4DPQA 4M6VA 1PXGA 1KKRA 3B9AA 1R5YA 5D33A 2OELA 3UW6A 1UUQA 5FJRA 1KXQA 3VABA 3AWNA 1P0KA 1VFLA 1CENA 4PFMA 3A23A 3N6JA 3DYOA 3QW4B 1W1PA 1LDCA 4GUHA 4B5VA 3AZTA 2F6UA 1K9EA 2PAJA 1W6TA 3EWYA 3UXAA 1MW2A 1FCQA 4EXBA 1QI0A 2VRJA 2E0PA 1J01A 1TV5A 1W3IA 3AICA 2IKJA 3WIJA 4GZIA 2HNEA 3SGUA 3V5FA 2TODA 4HPXA 3IGUA 2YB1A 2YYUA 2BS9A 3GW3A 1B1YA 1KXHA 1S2TA 1E5NA 2DSWA 2H9AA 4B5WA 1BWLA 2XIOA 4AEFA 4HHMA 1UOZA 4XV0A 1EIBA 1JZ3A 1BXNA 3TU9A 3GDRA 1T41A 3PZNA 5C2GA 1U5VA 5XIAA 4RNHA 2OO6A 3ARTA 5LXEA 3A4XA 4UNKA 2V3GA 4M5PA 3CO8A 1S3HA 3UYIA 3NQCA 2J6XA 2VD8A 4I9TA 3LHTA 4JKMA 4NY2A 1CXLA 1M9HA 3W84A 3ZR4A 1UPPA 1ISXA 1S1RA 3VC5A 2ZTJA 2QUNA 3EOEA 3TN5A 3EOSA 1EGMA 5A2CA 4KWSA 2ZWYA 1DIDA 2AQWA 3PTDA 1QR7A 4M1BA 3IJ9A 4DBEA 3QMRA 2Y6ZA 4UMBA 2V8ZA 4Y8FA 3TNOA 2J9YA 2Y5EA 1GHRA 1QAPA 4E8CA 4S1FA 2W67A 1XGDA 4MY8A 4GNKB 4POCA 3KCJA 5I00A 5I0DA 4IHCA 2VOTA 1N8IA 1PVNA 4JQ4A 5CZSA 4S3EA 3A4JA 5DCEA 2HBVA 4AX6A 4LF2A 4I3GA 1FWBC 3KP0A 1H7PA 2ZRZA 4DZAA 2E5DA 3R5EA 4DXVA 3K8KA 4Q8TA 1AK5A 2TPSA 2XVKA 4LUYA 2J47A 3M44A 4V2XA 4U5IA 3UWEA 4KBXA 5C2CA 2WW5A 3AALA 3FSUA 1RXOB 3MI2A 3W6LA 1JDDA 3LERA 1WDQA 3AFBA 4JX6A 4V28A 1I1WA 3ELFA 2Y85A 1ISZA 3K5XA 1KM2A 3LZ5A 2XH4A 3RAOA 4KMQA 3QGKC 4XKYA 3HFTA 4L7ZA 2HK1A 3G1SA 4HVXA 1GG1A 4Q8UA 1RBOB 4M1RA 3ZS4A 5FF3A 3JRKA 3SDOA 4JIPA 2UY2A 2OLSA 3DKJA 3W87A 2ACRA 2Z24A 4H7CA 1P7TA 1HGYA 3PWGA 1NOWA 1EWEA 1NTHA 1J0IA 1O6IA 2WPGA 1MNSA 1TRDA 2FDSA 3VDGA 1TVNA 4WDUA 1WUFA 1G94A 4JTFA 2YCLA 4XIAA 4B5UA 2A3EA 4GJJA 2XDFA 3SO7A 3TJIA 2WCGA 3N25A 5FKYA 1W5PA 1C91A 3GXTA 3ZYZA 2QXWA 3NM3A 1P0NA 3VDBA 3AXXA 3HG3A 3SI9A 3ZJ8A 5GPRA 1T6MA 1EDTA 1EXBA 4Q8VA 3O7UA 5CPTA 4ZMGA 5PTDA 1S5MA 3TFXA 2WO5A 3GG0A 4UXDA 2HQAA 3NQEA 3WLJA 2ZCGA 3LHZA 4GHRA 3TYZA 1JYVA 1A5UA 4Y9NA 2VFGA 2GQAA 3ZOAA 1OX5A 3ARQA 3QV8A 4ZQMA 3VMPA 4HBKA 4LVBA 4YTQA 1C8XA 4DIAA 4B2DA 4C6LA 3PFRA 5LHEA 2FTYA 4DB7A 5G4WA 3GIYA 5BRQA 1YPFA 5CG7A 3WSUA 5HQMA 3O05A 1U2YA 1ZU8A 2NQ5A 1I2QA 1MQRA 3G1HA 6TIMA 4I90A 3WF1A 2XFRA 4NZ3A 2X0YA 1BKHA 1FVPA 3GVRA 3VD7A 4QSFA 1TJ1A 3WN6A 5BOOA 3LCLA 5K3VA 3S1XA 3EPNA 1TWDA 2BGNE 2NUWA 4ZENA 3ABOA 3SGGA 3HMJG 3WH5A 4IFRA 1EGVA 4ES4A 3DGBA 2B4GA 1GCYA 2DSZA 1DQXA 4OJYA 5A6MA 2HISA 2VHLA 3NPVA 2BNJA 4BEUA 1LL6A 3KRBA 5DN1A 1DWIM 4HA3A 3RGTA 2BGSA 2XIJA 2HVNA 1PDZA 1DOSA 4O0ZA 5F1VA 3D47A 1Q8JA 3AU6A 1DJNA 4JTUA 6A3HA 1SZGA 5E6YA 5DMNA 1OG6A 1CGVA 3HIJA 4DUOA 4GIYA 3WG6A 1GZ1A 1JYXA 4HA0A 2J7CA 3QV9A 3WMLA 3GTFA 1MW1A 4X0VA 3MY9A 4HP5A 1W1ZA 3AS2A 3OBEA 1H7XA 3PUDA 1VRXA 4MUPA 2OSWA 3LM3A 3LLXA 4UTTA 3BJFA 1TA3A 5IDIA 2DW7A 3EWWA 1UWSA 1VBRA 5BOEA 3GD6A 3Q94A 4HTBA 2ABBA 3M9YA 3ZLHA 2B7OA 2WSRA 4J1OA 1H62A 3B9OA 3LCWA 4L4LA 4GUIA 2GK1A 1K8XA 1BQCA 4H83A 3ANYA 3R7MA 1OFAA 3CTLA 3V0UA 3S2JA 3SM0A 4HPJA 4HSNA 4LS0A 3NVTA 5E70A 5FA5A 2NWRA 4DF2A 3GDLA 2QJMA 4Z2JA 3DHUA 1AMYA 3E0VA 3ICJA 5XINA 2WM0A 1Q6CA 3T81A 1V7AA 1TVPA 3MVIA 4IGHA 3ZVHA 2OLAA 1L8NA 1PJ9A 2BY2A 3CZEA 3QKZA 4B16A 4UOJA 4W8LA 1VLWA 2WVVB 3GXPA 4S39A 4PB3A 2UY5A 4BZYA 2PGWA 1GWJA 2ASHA 2YW4A 2ZE3A 2WC4A 1F6YA 4O13A 5CSUA 3BAKA 1E51A 3SUVA 5TNVA 3W1PA 5E1QA 1CZ1A 4WY0A 3CZJA 2WZTA 4LAUA 2GDQA 4KEMA 4EPKA 2NVAA 2P0IA 3TR9A 1PIIA 3BLFA 5E5CA 2DGAA 3AS1A 3CLMA 1XYLA 4CCEA 1MVYA 2EPHA 4M29A 2QIWA 4N2YA 2CYGA 2E8ZA 4JY9A 3BTNA 3AMKA 4AWTA 1V77A 3CTTA 3WNLA 4IOTA 1ESWA 3CBWA 1QU4A 2HS8A 3UG8A 4OUEA 3R8GA 4UQEA 1LG1A 5HOSA 4BKNA 2QIIA 3VCNA 1VBUA 3VIPA 1XYBA 3GDKA 3NQ7A 4AQLA 3GDBA 3VNKA 2Z00A 3NQ6A 4GI9A 5CEWA 4K8HA 3GK0A 3VIHA 3TZFA 4QJ5B 2P10A 5D02A 3NPXA 1JCXA 2PP0A 3HB9A 3HPSA 2OTDA 5MKGB 4PEKA 1DWFM 1DXIA 1OADA 3B4YA 2TMDA 1VKFA 4O12A 4LQ1A 3QM3A 2PTDA 3IJIA 1HJUA 3FGCB 2YYTA 2QGHA 2VZTA 1R3YA 4A22A 1FHLA 3WF4A 5HPOA 4PRRA 4RR4A 2OMAA 3KX6A 1RQBA 2FMOA 5LNRA 4MLRA 3UESA 3RK8A 1QWKA 5D2WA 4HGXA 4JN7A 1YRRA 3B0PA 3CO4A 3EWUA 3GNNA 3MP4A 4Q22A 4AD0A 5LZLA 4H3DA 4NAFA 3B05A 4QG6A 2E25A 1CXFA 3W1LA 2CLPA 2P0OA 3NDYA 1XX1A 4M8UA 3NA8A 2OXNA 1Q65A 4K8EA 9CGTA 1QW7A 1ZCOA 1LUCB 3V0SA 3MS8A 2XFWA 4YL2A 3BGAA 3GWQA 2Y89A 2CXGA 4R88A 2GJRA 5HULA 1IEXA 3TQVA 4H9ZA 3H22A 3TXVA 1VHNA 1M53A 1NY1A 3E5PA 5DY3A 2VFHA 4H00A 3QFEA 3L4YA 4G7EA 2PGEA 3REQB 3FXYA 3T4CA 3MU7A 4J3WA 1SJCA 5LA1A 2XSAA 3THAA 3CUJA 3LXBA 3NXFA 1JZ7A 3WZ0E 1RALA 3VUSA 1SZRA 4QRNA 3DGRA 4M82A 4B5XA 3F5LA 2ZUMA 3WY1A 1LCOA 1RJQA 3R6IA 1G01A 4UR8A 5FIPA 4ZQCA 1AH4A 5AZ1A 1H7WA 2YL6A 1SM9A 4E5TA 1EUNA 1GKQA 3LSBA 2HS6A 4O10A 1XC4A 4IM4A 2X1UA 1W5QA 4N9BA 2WSQA 3HQOA 4UTUA 2P3ZA 4KT2A 1XYZA 5CH9A 2YA2A 3VGDA 2O9RA 1WDRA 1OABA 2WSKA 2XIBA 3GAYA 3RX2A 4Y9PA 2WLZA 4CLMA 1RCQA 2YBVA 2ZA2A 3U7VA 3T08A 3CHDA 1XBYA 2VELA 3VOGA 3H54A 1JDCA 1AA1B 1A0EA 3P6LA 3UA3A 2O55A 1QPOA 4O19A 5J8LA 4E0CA 4REQB 2RDXA 3N18A 1GQNA 3DG7A 4DBWA 3DN5A 1VR6A 4O4WA 4DF1A 4Y8EA 3TYBA 2VCAA 1DVJA 4Q8NA 3W2KA 1EOKA 5FD0A 1FWNA 1ISYA 4GVIA 4DBDA 3KRZA 4H41A 5JH1A 4MOZA 3GFXA 2FPVA 3F7JA 5AN7A 2OWXA 6TAAA 1TTQA 4U2ZA 1RLDA 4C6OA 3AZRA 3EXRA 1A53A 2HE5A 3O6DA 3B9EA 4HU4A 5HBFA 3PN8A 3AYSA 3U9IA 1FWJC 3KS6A 3MUCA 1DTNA 3RRAA 1AJ2A 2WC3A 5A6JA 1WDPA 3KCLA 3NQ2A 1MRQA 3IV8A 3SN4A 1FWHC 2EPKX 4BCEA 4EP8C 3W7MA 2IPGA 3RLHA 3GXDA 3VYLA 4OBRA 3CWHA 1EF2A 3AIUA 1FWAC 5CC5A 3MKVA 3W7NA 4XIMA 3LTYA 3AUOA 3R0DA 1NELA 3ARZA 5D37A 3BV4A 5KTLA 1XG3A 4X22A 4NAFB 3A3XA 5IHRA 2XG9A 2VEIA 3MSYA 4D6CA 1ONWA 3D0CA 1K3UA 2CNCA 3S9IA 3E49A 2CC0A 4GPNA 4RNJA 1DWHM 4LALA 5EMUA 5A8NA 2EHHA 4PMUA 3W25A 3ZIZA 1Q4WA 1QTWA 1ZLPA 1WP6A 4L9ZA 1KNWA 1X97A 1V93A 1BYCA 2WZHA 3P84A 3E02A 4PEEA 4I6VA 3W85A 1VQTA 4DBSA 4V1YA 4S38A 3N04A 3BDKA 5IFTA 3V1PA 3PZQA 2AL2B 5FEPA 5FEWA 4AF0A 1ONRA 2CZDA 2A21A 5CJMA 2YA0A 2OZ0A 4JTQA 2PD5A 2C1HA 4XD3A 2V5KA 4NJHA 3WQ5A 4KIEA 4J3ZA 1P7TB 3R79A 3G22A 2FFCA 4R7OA 2OT1A 4GZ7A 4I7WA 1G1YA 4O1FA 5IBXC 3W1XA 4MYAA 3NQ8A 4L4PA 3PUEA 2PLKA 1XLEA 3XIMA 2W4XA 2ZXAA 5FEZA 2XZ9A 1FOBA 3O1NA 4Q6JA 4B3ZA 2YX0A 3PZGA 4GH3A 3LBCA 2B7NA 4O16A 3T42A 3MO7A 2FYMA 1E6PA 5AHNA 2V69A 1YXCA 1I0BA 3FAXA 1ZY9A 1DBTA 4W7UA 1FWTA 4LEFA 2GLKA 3W01A 1V79A 3O06A 4N42A 1GOWA 4XZ9A 1GKRA 2Z2UA 3VE9A 3OIHA 1OX6A 3P0XA 2JGYA 1WKDA 3W88A 5H2ZA 1E4NA 4B5SA 3EWXA 4H6EA 3W7QA 4F48A 1LQAA 5G1MA 1MSSA 1W2VA 3KOXA 3GSMA 4NG3A 1MQQA 1VFFA 4NAEB 2Q02A 2DT0A 1SFLA 3UERA 3KFTA 2FZ9A 4MZYA 1OM0A 4LB3A 2WCAA 3W22A 1PTDA 3QYSA 2UBPC 1JZ4A 4MG4A 2QCLA 1VBJA 3PPCA 2ACUA 5FJJA 5I3JA 4IQDA 3LGGA 3TEVA 3EKLA 2CKSA 4S23A 3BSGA 5BYWA 3ITYA 3JS3A 3WFAA 4JN8A 4IJBA 4TR9A 3GM8A 3FDKA 4PN2A 4HNCA 1JQXA 5HWMA 1O1ZA 3AJXA 2YA1A 3VOIA 2FQIA 5JH2A 1HL9A 3S2CA 3FX4A 4WOZA 2QCGA 1H49A 2QPSA 1E0VA 1RV8A 3F4VA 5C2XA 5ENLA 5DO8A 4QE4A 4RE2A 3IPWA 3ARYA 1TPUA 1J11A 3H7UA 4NI3A 3FAWA 3WNPA 3TSDA 3QR3A 2HRWA 1O5QA 1UD8A 1FWDC 1GOMA 4K36A 3QMSA 4PBEA 4EVZA 2VJXA 2XGZA 3H4XA 1TG7A 4JGDA 2DUXA 3RXZA 1QFEA 4XAPA 1ZTVA 3EMQA 3W81A 1GT8A 3LD5A 2V38A 3RU6A 1KRAC 4OFCA 4JYDA 2OQHA 1EWDA 4AWEA 4GH1A 5F4SA 3S9YA 2R14A 3V4BA 1I9CB 3K2GA 5CAHA 3QPYA 3P60A 3TW6A 1ZAIA 1UR8A 3O0KA 2C16A 3OB8A 4DJDD 3NL6A 2XH0A 3GXNA 3K1GA 2VUYA 1E55A 2QZRA 4YYCA 1TE1A 3W1AA 4R34A 4JX4A 4FX7A 2PZNA 3LA4A 5CKSA 1F4AA 4KEVA 3AWOA 4PCNA 2J79A 4UQBA 3DBPA 4DI9A 4ORIA 4PTNA 1W2PA 5DX7A 3H23A 2E68A 2CHOA 5HR7A 2QYGA 1OFEA 3M5VA 1DKWA 3OZYA 4N02A 5I7GA 3WK1A 4FO4A 4RZ4A 1LWIA 3O15A 5T26A 3OHIA 5AYBA 1W1TA 4J9JA 5BOFA 3EKGA 1TCMA 4PBGA 3VD3A 4XK2A 2V6AA 3JR2A 4GY1A 2E6AA 3O8AA 3OA3A 4XVEA 2V68A 1QVBA 2G0WA 1AG1O 1MDLA 4JYEA 3SCNA 3VDCA 3M6YA 2PPGA 3WLOA 2WXDM 3VNLA 1KCZA 5AVHA 1XC6A 3DXIA 2OEKA 4WEVX 3W0KA 4I5RA 3SUTA 4A21A 5HJLA 4MUZA 4HIBA 1JF5A 1W1IE 1V6UA 4OWGA 4AVNA 1KTBA 3U2CA 2V3EA 2Q3OA 4FP1A 2A3AA 4QS5A 3QGAC 1UKTA 4LYQA 5HJYA 3GXIA 3MP3A 4XD5A 4CU7A 4MY9A 3F4WA 4QLJA 3S1WA 1ADOA 2Y63A 3KLLA 2C79A 2XISA 2V63A 4NZ5A 1RZMA 1J5TA 1BGAA 2J78A 5C5YA 2HSAA 3O6AA 1EXPA 3LOTA 4UTIA 4ZXLA 3LENA 4ZO7A 4QP0A 3ZVIA 4ZE4A 3N4FA 1UYQA 1JGMA 1DTUA 1F3XA 2NQZA 4PUEA 1NOFA 5ABTA 1EBHA 4P8WA 5CG0A 5D2TA 3BLIA 5C9ZA 1DPMA 2PDYA 1QWGA 2WQPA 1GVRA 4QEEA 1M5WA 1Q6RA 1XLHA 3ZT6A 3N3MA 1R9XA 1NDZA 3KVMA 1WKFA 4FX6M 3FEMA 3SN0A 3WMSA 4DJDC 3DHPA 1WDDA 4HMEA 1LLWA 4PUNA 3PUOA 1C8VA 4N9CA 4EWJA 7REQA 3M47A 2C1GA 3WD0A 3R89A 1VS1A 2H8ZA 4OTKA 3L4ZA 2YZ5A 1B3XA 3GBDA 1A4MA 1K03A 3NZRA 3W7CA 3IAPA 3WH7A 4W85A 3GZ3A 3AOFA 3QH2A 3A3HA 3V7PA 5CXPA 2G97A 3UD6A 1NF0A 1OHLA 3AMGA 2Z2BA 3E2VA 3SUWA 2X16A 1KBJA 1PYMA 3IRDA 3STFA 5A6SA 1AW1A 3LLDA 2QDHA 1JRBA 2QHAA 2Q09A 2G4JA 4J5NA 4ZOEA 1JI2A 2OSYA 1BSIA 3WJZA 3OG3A 4GK8A 2AAMA 3P80A 2DPEA 2ACQA 1MUWA 2QVNA 3PF3A 2GQ3A 2NV2A 3RCMA 4CNUA 3DOPA 5FAJA 3QEZA 1E1FA 3MP5A 3TUUA 1DIEA 3R8RA 4F9JA 1R3QA 3WMBA 4QEHA 4QCEA 4S2BA 2VWTA 5A1AA 1CGTA 4GUJA 4BI6A 4LPCA 1MXGA 3WEOA 1Z69A 5CC7A 1H61A 1RUSA 2VX5A 4AWUA 3Q37A 5LKYA 3LHVA 2IQ0A 4KERA 2QMJA 3SSZA 4MJZA 1Y5VA 1GYLA 1E0WA 1KRCC 4XB3A 5ABHA 3SURA 5B7ZA 3NZGA 1KM6A 1HO1A 2V9DA 3S6DA 4CD6A 3TC6A 4LB4A 2WWCA 2YR1A 3SCSA 2INEA 1JDEA 4MWAC 4DO4A 3GTNA 1R46A 2F7FA 4QG8A 5CGMA 2J7GA 4AD3A 1P48A 4QDWA 4O0KA 1MZRA 2J8GA 2ZDSA 1XLBA 3W75A 1NWUA 3OW1A 4GMEA 2JKAA 2YLAA 1EC9A 2PDWA 2PCEA 2QJHA 5AKQA 2XN0A 4AZHA 4OT7A 3DCPA 3TQ0A 1Q45A 4U3AA 4F66A 4MWAE 3UVAA 1EX1A 3WK2A 1RJPA 1XDMA 2ZBTA 1V6XA 1TPWA 1W9XA 4H9XA 1HJQA 2TSYA 3RRXA 3L4TA 2GVGA 1NFPA 2DIEA 4OE7A 3O07A 3VGFA 4DWDA 3FKKA 3R11A 1EP1A 1XPYA 4H8NA 3MKKA 2WSPA 1S38A 5I6SA 1ICSA 1ADSA 1V3IA 4PMZA 4K1GA 4PMXA 3SJNA 3IVTA 1A80A 3P8JA 3VGGA 5HMSA 1QI5A 3VKDA 2X0SA 1BHGA 3C3UA 4GYJA 2QT3A 4A3HA 3P61A 2VC5A 1H1ZA 4EWND 1UH4A 3CQIA 4X9SA 4K2SA 5JUVA 1F74A 4IXHA 4MNKA 4O0QA 1WXYA 4GA8A 2HNHA 3CMJA 3VIGA 1VRDA 5I78A 3QW3A 2PZ0A 3KBWA 4ERIA 5G4EA 4IX2A 1L8PA 4F0RA 3OVRA 4KFPA 4XAGA 3VNJA 4S3BA 4LS2A 3TAKA 3C86A 4HQVA 3UVIA 2FH6A 5E0CA 4C5ZA 2EPOA 1D2KA 2GJXA 3IUDA 4LAKA 4Y6GA 3VOJA 4C91A 1QNQA 2E5BA 1DP0A 3MQTA 3ORWA 1VZWA 2PEVA 4R5EA 5DLCA 3PNZA 4OOZA 1WOBA 2E6YA 1F8MA 4NUWA 3WBYA 1WCGA 3ERPA 4JY8A 5HUOA 1X39A 1GQIA 3URBA 3ZSSA 4DX3A 1WZLA 3HN3A 4FXSA 2DU2A 3N2XA 4RNIA 4WR3A 4AMCA 4L5ZA 1M01A 3O2LA 5D9NA 1RK5A 5I3HA 1OQFA 2ZFAA 3N15A 4HZ6A 4XBJA 3WQPA 3BSHA 4GXPA 3U2ZA 4AFYA 4PODA 3W7RA 4IZGA 4CQ8A 4DAIA 4YHGA 5M17A 1UD5A 1XLIA 3CZLA 1E56A 3VPLA 2J7DA 4IG2A 2PA6A 4XAFA 3N9RA 4YTRA 1OT1A 2YLLA 3AYTA 1XLLA 3HJEA 4FOKA 1IEIA 4W4QA 3PZ9A 2BFGA 4Q4RA 1OYCA 4TX6A 4PB5A 2R6OA 2QJGA 4O1CA 2J4GA 2D2OA 1OCQA 2Z2AA 5HQEA 2C19A 3SUUA 3MO4A 3M41A 1DJYA 1DJHA 1KCLA 1AZ2A 3OTRA 5KEZA 3ZVHB 3VKCA 3SADA 1LWHA 4AHPA 3PZTA 3TW9A 1EJ7L 4IFKB 2FZ8A 4NRSA 2V3DA 2PURA 4DI8A 4EXQA 3F03K 4IL0A 4O11A 4W84A 3S42A 2ZA3A 4DY1A 3VM5A 4K38A 3GAKA 4DVOA 3KLKA 2NLIA 5EGRA 3F5JA 4GD0A 4WGXA 4DM2A 2ZZ1A 4XO6A 2D69A 1R8LA 2WLYA 2BV9A 4MWAD 4TIMA 1EPVA 4ML4A 2PF0A 3EXSA 4ZE5A 8XIAA 1N8FA 4QE5A 3QLDA 3RX3A 2O9TA 2MUCA 1IF2A 4HSOA 1SO6A 1D8WA 1S5VA 2NVDA 1WKEA 1Z6KA 4PMDA 4GX9A 4IP4A 1UROA 2ZZ6A 4P5UA 1W1VA 1BG9A 1GVFA 3SY5A 3BK0A 5T8GA 3NL5A 4ADSA 4PMQA 3TC7A 2B81A 5I3KA 1IZCA 2D3LA 2OO0A 4OZOA 4AH7A 2YKKA 2VD9A 1EYWA 1R7AA 4H01A 3FNDA 2ISVA 1PEZA 4YPJA 2NX1A 5CQ1A 3IJLA 1EJSC 1R3WA 4LEQA 3HFYA 2ZX8A 1W3LA 3PAJA 2J24A 2PB1A 3I6RA 1KBKA 4GWEA 3V36A 1TSIA 3L4UA 1ML1A 3URNA 2C8NA 5GJNA 2J7EA 3NVDA 4XWUA 4MJMA 4EANA 5AHEA 3CQJA 4NASA 1LBMA 1KFBA 3KOFA 1V02E 3TSBA 1TRIA 3TA9A 1J0ZA 5FSEC 2IXUA 1PL9A 3GLCA 1F6KA 1OFPA 4OVXA 4G8TA 7ENLA 4N4QA 3C8NA 2P50A 4KRTA 4QQUA 1ZRQA 1ECQA 4HOWA 2Z6IA 3QQ1A 1I2NA 4QDMA 2C13A 3EA2A 1GPFA 4M3PA 1UR0A 4BWLA 3OGRA 4PMRA 1F2JA 1NU5A 4UNLA 3TKFA 2QCMA 4A3UA 2NQLA 3BAWA 3QF0A 2QV4A 3PZOA 3ZT5A 3OBKA 1CLXA 4S3AA 5BU9A 2PC8A 3CAWA 3FSTA 4QIUA 3P5YA 4XISA 1TQXA 2FDMA 2OR2A 2FHFA 5JQ9A 3THQA 3FCPA 1J2BA 3E74A 3LYEA 1I0DA 2B7QA 5FJOA 3UR5A 3UZYA 1C7TA 3OVQA 2VNCA 3OVPA 4F79A 4XZBA 1DQUA 1XYCA 4IP5A 4ZB0A 3VE7A 5HNRA 2VQTA 1V3HA 4S3KA 5CZTA 2RGMA 4LUTB 1YXYA 1C93A 1J6OA 1US2A 5I3DA 3WD3A 1NQ6A 3P0WA 3UU0A 1CGXA 3DFSA 1EJWC 1P0BA 3VFLA 3V5CA 1EEXA 1LWJA 1XFCA 3WLHA 1ZB5A 2VEPA 2C71A 4WSJA 3CL7A 3ABZA 5LIXX 4FK9A 3OVGA 2P76A 3QHNA 4YTUA 2X42A 3KTSA 3UJFA 4KWOA 2NQ9A 4I5UA 2GGEA 1VBGA 1EQPA 1QATA 3T2OA 2H6RA 3UBPC 4GACA 2PE4A 4M6PA 3LGEA 2JKPA 4EIVA 4GIRA 4HOZA 4MMWA 4GXWA 3CEUA 3HQPA 3MCOA 2REQA 3ARWA 3TJXA 2YIHA 4Z1AA 3LG3A 3B0YA 3W3OA 3FJ6A 2VVSA 3AS3A 2A79A 5EBUA 1MNZA 2QUUA 4UZUA 1E1CB 2JK2A 5D2VA 3AHZA 3A9IA 2R1KA 1C7SA 3IVSA 4M7TA 4AIOA 3W73A 1O68A 5AZ0A 2G3FA 1FKWA 3LUTA 4ML9A 2EBNA 2VX4A 4PUJA 5HWNA 3CQHA 3FYYA 2EKGA 1HKVA 1SGJA 2X7WA 1UMLA 4DYJA 3RLGA 4P8XA 3WL1A 4CN6A 4IICA 1KW1A 3L65A 3NGJA 1Q2RA 3EX3A 1TYGA 3W1NA 3LZ3A 4US5A 3OA5A 1AMKA 4PUKA 1U33A 3B0UX 2NW0A 1YLVA 4F2UA 1JAEA 3G0UA 1U5HA 2QV5A 1HT6A 3VKKA 4NP7A 3NWRA 1SUXA 4FNUA 2IPWA 4PTDA 1FWIC 1KM3A 3RF9A 3DFTA 3OJGA 2J66A 2PDJA 3N19B 4PL2A 4O1DA 3GW0A 1UP2A 4U4MA 3NFUA 4UQCA 1IT7A 1HJSA 4CCZA 3ABXA 4GJIA 5EMMA 1TKKA 4J2MA 3F1QA 1XI3A 3P67A 5C8BB 3M5XA 5FEXA 1J2WA 3REQA 1XD1A 2VC6A 1W31A 3WCZA 3ZWSA 4X2RA 1H5VA 2GDUA 2EO7A 3M1ZA 1NDYA 1HNYA 3L0KA 2F8QA 3H2AA 2WJEA 2WMIB 1IZKA 4ASTA 4DJEC 4JAWA 1E9IA 1ME7A 1W3TA 4O18A 3KXQA 2R1LA 4MB4A 3BLLA 3WLIA 1V0MA 4Y2WA 2ZXQA 1VYPX 3JW7A 2PU0A 4ZCWA 5AHMA 3N2OA 2BTMA 4ILSA 2G5WA 4AU0A 2XIQA 1KQZA 4ZSTA 2W92A 4C90A 4JTHA 1E6ZA 1J79A 3GR7A 3G5EA 3FY1A 1TMLA 4OV4A 3STGA 3W7IA 1BVWA 3M5ZA 1X7FA 4H7VA 1SW3A 3BJTA 1A0CA 1NM9A 3KBNA 3BMWA 4Y9OA 3WUFA 4LVFA 3L4XA 1E6RA 3MYOA 3BQ6A 3L5AA 3MHGA 1OC5A 3EDDA 1R2RA 1UUOA 4RJEA 2IMRA 1LORA 2H90A 1V6YA 5EBAA 1VEMA 4O14A 3Q4DA 5GJMA 4YMZA 4AD2A 2XVPA 1ALDA 2I5GA 2ZVIA 3UCDA 1WXZA 1GVIA 3M0JA 2INZA 4ATWA 4X63A 2DV0A 4JFVA 3PSVA 1XQLA 1X98A 4ZOCA 2OZTA 3W86A 4AVFA 2J13A 4CNPA 1UW9A 3S5NA 3GHRA 2IS7A 1OBAA 2PRHA 3P8IA 3R13A 1F3TA 3W7KA 2HBXA 4V1XA 3QY6A 2VFDA 2CZFA 3AXHA 4JQAA 4H6KA 2QW5A 1PCKA 2NX9A 5D32A 2GOUA 3DENA 2TYSA 2NSXA 1MEHA 1M7PA 1QHZA 2RKXA 3W1RA 3T40A 1RK6A 1FP9A 5LNSA 4JFWA 1UP3A 4Z2GA 3GIPA 2WKLA 1OFRA 3BG3A 4TXEA 2BODX 2ZX9A 3IGHX 4C7FA 4ERAA 1C9DA 4F40A 4AD4A 4B5TA 4H1ZA 4IMFA 3QZAA 1XRSA 3HPZA 3MC5A 3RNDA 1I8JA 5HATA 4CQCA 2BZNA 3B8TA 1E5JA 4WHBA 2R24A 2BVWA 3BOFA 4WCJA 3WDJA 2V5DA 4C1LA 3ES8A 3TN6A 2D1ZA 2GWNA 1ZBVA 3HV9A 3M0KA 1JUBA 4B4HA 3KDOA 4QTGA 5DMYA 3K8LA 4DLFA 4P7RA 3TP4A 3P81A 4A2RA 3VZZA 3MDUA 1PWMA 3DHDA 3TK7A 1M68A 3CM4A 3TTOA 4HA1A 5GNYA 4MAZA 4AXNA 3VTRA 1H3GA 4ACYA 4AZGA 1FA2A 3GR4A 1RHCA 1Q7QA 1S2UA 3WQ8A 4PCFA 3G3MA 2VRQA 5ABFB 4I8YA 1UBSA 3TH6A 1Y5WA 1ZBCA 1X1ZA 2PF8A 5HPCA 1W3NA 5K4XA 1AQHA 3KCOA 3EXTA 1F5ZA 3SZ8A 5DMLA 3H2EA 5JXQA 1DIOA 1BWVA 4US5D 1E6XM 6ENLA 3QFWA 4F0LA 1XINA 3AXIA 3UP8A 4GISA 3A21A 2ZYFA 5CPLA 1IEWA 4XAZA 2QNEA 2A3CA 3P74A 2W62A 1QOPA 3GNPA 3HQ1A 1EQCA 1QNVA 5JBEA 3EA1A 4CNNA 3R2GA 1GNXA 4HNTA 3L0GA 1LL7A 3AXMA 4ZFCA 4NZJA 2ATMA 4BWLC 1KA9F 3PSWA 3BMVA 4M51A 4B9YA 4P8VA 2YB4A 1GK8A 4BQ2A 2GQ9A 1YADA 1XW8A 3WDRA 4LWWA 4WIWA 3QKEA 1XP3A 4HMCA 2ONEA 1PZ0A 3WUBA 4XZLX 2JE8A 4ATDA 1OT2A 3ITXA 4W88A 4DJFA 4AX7A 3RG6A 5HJXA 3O6YX 1TCDA 5CPQA 5A6AA 1YE6A 4KFNA 4MKSA 2GL5A 2GVJA 2Z1VA 5J04A 3EPOA 2RDTA 1BYBA 4L9YA 4B4FA 3FLUA 3ITVA 2CLFA 1YNYA 3I3EA 3MI6A 4LVAA 4H9UA 2W27A 1E9YB 2ANUA 4C1NA 2OX1A 3ZM8A 3RO6A 2OCZA 3UPBA 4DN1A 4Z42C 2X41A 4R85A 1XYFA 4K7VA 4W9TA 1MUMA 3JU2A 2FVLA 2G96A 4Q33A 4JD4A 3GHSA 1GTHA 3DBNA 1GYNA 5DEZA 1H0IA 5FSDC 3W83A 4O1BA 4MGGA 1C90A 2X09A 3P3BA 3CH0A 3IK2A 3G77A 1UWTA 1ZP3A 4AG0A 4QAIA 3W9ZA 3ABQA 3VO0A 3H7RA 2WHMA 4XSMA 4HYVA 4FLSA 5LGZA 5TQLA 4HK5A 5E6ZA 1JPHA 3CWNA 2WMGA 2PBGA 4LYPA 4GIAA 4RPPA 4RE0A 3NURA 3KS5A 1XCXA 5CPNA 5FL0A 1U1UA 4NL1A 3SQMA 4Z2LA 3IRSA 4BR1A 1Z7AA 2ZZ5A 3MHUA 5DELA 4JIIX 1Y7VA 1Z48A 3QR0A 3IEBA 3THDA 1UJPA 3NSNA 3CNYA 1L6FA 1OX4B 3PTQA 2CLEA 4IQEA 2XM1A 3DUGA 2FGLA 4WY0F 4HJFA 1YW1A 3H2NA 3W2MA 3WQCA 3LM7A 1TUXA 3STCA 4IT1A 4S3CA 1XRFA 1DJGA 3NUKA 1XLJA 1CGWA 4GQRA 1MFUA 4NF7A 3G8RA 3RJYA 1D3GA 4RX0A 1MYRA 4K8GA 3T7VA 2OKOA 4Z1DA 3FHAA 3CV6A 3CHCA 4B92A 2YBUA 2FLIA 1XSJA 4J3TA 2VXNA 3ARRA 1LL4A 2D0HA 1XH2A 5EU9A 1GOOA 3OBAA 2GGGA 4F3HA 3I3DA 5FESA 5HINA 3W2LA 4TOQA 2WJDA 2C7FA 1T40A 1OD8A 4O1AA 4LSBA 5A8MA 1H7RA 3IJ7A 1IXQA 3BG9A 3UYCA 1AL7A 2Z28A 3G1FA 5D09A 4A8IA 1X6LA 1T8XA 1PTGA 3F4NA 4FMVA 5D8ZA 2G3IA 3NZ1A 1GUVA 1KXVA 1UUMA 3BW4A 4RZ5A 1VYRA 2EGZA 6XIMA 2YFNA 1OGSA 2BDQA 3J7HA 5FJTA 1KM1A 4PCSA 1KGWA 4D72A 3KOYA 4XTDA 1RY0A 5BZAA 3WLPA 5I3FA 3L2IA 2Z1KA 3GRIA 1G4TA 4JPGA 4NILA 4A8RA 2F6KA 4BJHA 5C54A 2WMJA 3RMEA 4RDYA 3LXAA 1I2OA 1UD4A 4MSSA 4JNZA 3OLDA 2HPMA 2OEJA 4X9YA 1UG6A 3EDJA 2V81A 3W02A 4C6DA 4DPPA 4N7QA 4BHYA 4PULA 3W23A 2DY3A 3CGTA 2YCKX 1I60A 2JBMA 3SFKA 5HXMA 1W1A1 3GHTA 4JFSA 1BKSA 4JFTA 1T99A 1KLYA 4LX4A 4REQA 5LHFA 4HU3A 3HPAA 1SFSA 1Q6QA 3QBUA 4EAYA 3TROA 1HVXA 4IPNB 1KCXA 3URQA 1NEYA 4H6RA 1TJ2A 1E40A 3T4WA 3HGOA 1ZALA 2DZWA 2CFFA 3T1GA 4E4FA 2BBFA 3CV1A 4DUVA 4C1KA 1REQB 1XIMA 1IHIA 2W5FA 3R58A 4NNAA 3S2NA 2YJQA 3ISIX 1BYAA 4S2CA 4LVDA 1X6UA 3NQFA 3WQEA 3W76A 3WLKX 5D38A 2BWGA 4C6CA 4JX5A 5E9XA 4NKCA 4J4KA 5EL1A 2CIPA 1RQHA 3C4UA 3CIXA 1VCVA 4DRSA 2BG5A 2B31A 4IUOA 1XH1A 9XIAA 2Y8VA 3UWZA 3NSXA 3LNPA 3W72A 4C6QA 3ZR6A 1MWOA 2NXIA 2OLHA 2WHKA 1CTNA 2WK2A 3PTMA 3MANA 2OB3A 4GCAA 4M56A 3FVMA 9XIMA 5CC3A 4D9PA 3RMJA 1K1DA 2BY0A 3DFNA 4GKTA 2VGIA 5FJIA 2EPMX 4NT0A 3C2FA 1V6TA 1XGEA 2H3DA 2J7HA 1H11A 1XRTA 4JDBA 3SY1A 7PTDA 4WKFA 2P53A 2J75A 2R82A 3C61A 1LOSA 4H8UA 5CSYA 1T0OA 4MWAB 4N0RA 5BXRA 3QZEA 4ZBCA 5A6LA 4LRSA 3C56A 2GPTA 2UY4A 1B5TA 4DUXA 1A5LC 4UTFA 2CPUA 2YW3A 3CYJA 2AQOA 1EDQA 5M2FX 2YCIX 4GY0A 3NGFA 3F2BA 1JYWA 3AIEA 1UWRA 4TV5A 3CIVA 3CS2A 1H63A 2ICSA 2Z6JA 5H8PA 2HROA 3B9NA 2Z1XA 4V27A 4CQBA 3EMZA 1AW5A 1J18A 1DORA 2RJHA 5DRCA 4L4OA 5BROA 2CXEA 5G1TA 2O9PA 3ANUA 3K4DA 4OGZA 2P8CA 1WE5A 2O4QA 3AU2A 2V2CA 3FXGA 1LYXA 3EB3A 3CLWA 4LBSA 3W1QA 2FKPA 2PLCA 4MB3A 1X7IA 2O7SA 2Y5JA 3CHFA 2DZXA 3MTWA 4US6A 5U4NA 4B90A 2ZRVA 3QPZA 2C15A 4QAWA 4CQDA 4L6HA 4C6NA 1F7BA 3G0XA 3T44A 2Q8ZA 5GVJA 1AH0A 1XFBA 1YDYA 1TTPA 2WVVA 3UWWA 3HURA 5D03A 4E2VA 3ZO9A 1V8EA 2NXGA 1E1EA 5HK4A 3M0ZA 3TXZA 2GJLA 1QPRA 1EFZA 1WKYA 1GVSA 1RPKA 3T8QA 3HTWA 4XD6A 4E2OA 1LQ0A 1SFTA 5T9CE 2CHNA 1XS2A 2FH8A 3ONCA 1SSDA 3RUBL 3WNMA 1HTIA 4FNSA 3CQKA 2V2HA 3FOKA 2W0UA 4FAMA 1W5OA 2PDKA 1MW3A 4P7LA 1UKSA 1HVQA 4O28A 1REQA 2ZRWA 3I7QA 4IPJA 4YNGA 1ZQ5A 3WF2A 2F2HA 5CSSA 4B5NA 1A5KC 3OZMA 1HQTA 1XHGA 4C5YA 3FYOA 1V0KA 4E8DA 1D8CA 2PUZA 2XIMA 1DL3A 5JVLA 3E9AA 3VOCA 4MNMA 2ATSA 1OFDA 5GQBA 3IIZA 3TJLA 4DWSA 1BF2A 1MW0A 3M43A 3K4WA 3NXLA 1UWAA 1K7XA 4XUGA 1ONEA 3SFWA 4PZVA 4ZQNA 2BY1A 4UFHA 2ZC8A 5DBTA 1ME8A 4GGBA 3U2EA 1HW6A 1P6BA 5M03A 3AIQA 1QXLA 3UXLA 3A64A 1PCWA 2GSEA 4UMCA 2VWSA 3VD5A 1YEYA 3RIKA 3CZ8A 1BXCA 4UTMA 1MI3A 5HNUA 1M7OA 3GTIA 2PDMA 3XISA 3AMCA 4ZQOA 1YBQA 3TCSA 1Q6GA 2YCEA 1DJQA 2ZZ2A 4D6GA 2IPFA 4HK6A 1H2JA 3UF9A 4AZ6A 2BB0A 3DYPA 2DZTA 4CCCA 3CU2A 1J93A 1AQFA 4RW3A 2DVUA 3N2BA 4GJ1A 4X60A 3TQPA 1ITUA 3MBDA 8A3HA 1JL8A 1KTCA 3DFOA 1TIMA 3E96A 1GVQA 3H8AA 5CJ5A 2WWDA 2PODA 2CLKA 4EOUA 3UCQA 2VDIA 3ATYA 4WKAA 2QJIA 2ALDA 1DIKA 3KBMA 4Y96A 4JQ1A 1ISVA 5FCZA 3NL2A 2FHCA 2J9ZA 3D5HA 4IQJA 2VP8A 2GVLA 4DNMA 1W1YA 1PKYA 2NT1A 3NQVA 3FS2A 1AFSA 4LAZA 7XIMA 2YGYA 1CIUA 5K4ZA 2GGIA 1UR1A 3WLNA 4YHEA 2QULA 2KAUC 3GH5A 4IFKA 3IIPA 3OGVA 4R9XA 4PMVA 5IOBA 1IEVA 5BW6A 7A3HA 1RA0A 3DI0A 3QTGA 3BAYA 1JZ8A 4XKMA 4LUSA 1KFLA 4C6FA 4GABA 3KVKA 1TZ9A 4M24A 5AC6A 1QHOA 2O4MA 3M07A 1HP5A 1Q2SA 2R1NA 4O50A 1L6SA 1A5CA 3T0TA 1IEQA 1B3YA 5A8PA 1QI2A 3VIKA 2PS2A 5I3IA 4B91A 4OHQA 1UD3A 2FTWA 3SY8A 1Q7MA 1ME9A 3WBXA 3SAZA 3EAUA 1GEHA 1V51A 1WV2A 1FWCC 3PBMA 4WVXA 2FTPA 4AIUA 2G41A 4GC3A 2VKZG 2E3ZA 3LX9A 4JFUA 3M64A 2DVTA 1C9WA 4QNEA 1EC8A 1HKWA 2QCDA 1JPIA 3T6CA 3N17A 2VFEA 1HX0A 1E73M 3AROA 3A4WA 3VXGA 3NEVA 3H24A 3R0KA 2DW6A 3NO5A 4CVUA 1TV8A 3MJYA 3QYQA 5DBUA 4CD7A 4GYFA 1UD6A 3BARA 4X0NA 1EOMA 2R8WA 1ZJBA 1S2CA 3SECA 2AL1A 5EFFA 1NP2A 2C0AA 4ZODA 3LV5A 3A4AA 2I5IA 4UFIA 3TYDA 4Q4QA 4YIWA 3IIOA 5IHSA 1N8WA 1GZGA 1FUYA 3N12A 4J3VA 4LF1A 3G1VA 4GO8A 5F4WA 5D4YA 3C8FA 3TJ4A 5JU6A 1BEUA 3N2CA 2WZEA 3U57A 2ISDA 5BRBA 4E3VA 2ZUWA 3WJXA 4EK7A 1LM1A 2Z29A 1KFEA 1F07A 2I57A 2CLMA 7REQB 5HMEA 2V5LA 3GKAA 4FB7A 3TYCA 1WA3A 1UZ1A 2XN2A 4NU7A 4C60A 1YHTA 3TTYA 3F4CA 4BQ4A 2PP1A 4AC1X 3L12A 1JUEA 2PRMA 4QSHA 3RX4A 4JNYA 4LV4A 3WJYA 2Q6ZA 3UGRA 4O1EA 3N29A 3E3HA 1Y5XA 3WO8A 1CGYA 4YTTA 2GK1B 3AHYA 3WDIA 1M65A 1IGSA 1E72M 2OWCA 4XZIA 4AXKA 4NZ4A 1XJBA 1E3XA 4AEOA 3TV8A 4PC8A 1TREA 3LHWA 2CHRA 3DESA 1XLDA 3SUSA 5AC7A 1QOQA 3UWYA 1SR0A 4JTDA 3E1F1 1WBHA 5I02A 1MFVA 3E2RA 5BMWA 3RYSA 3K30A 3R43A 7TAAA 3UEQA 1TV4A 2Z1WA 4QE1A 3VIJA 1VHCA 3OYXA 7ODCA 4LVGA 2QCNA 5M3WA 1ODUA 3VUPA 4EAMA 1CXIA 1LQ2A 4N9EA 2PWHA 5DCBA 5AHLA 1P0EA 5DMMA 3W7DA 3MWAA 2Z1BA 4UTWA 5D2YA 3C2OA 5K2ZA 1NJJA 4G56A 1VFSA 4XZMX 4B3KA 3UWUA 2X1RA 1EJRC 3VDAA 2J27A 1BRLB 1V6VA 2I14A 3I68A 3CYVA 4OU1A 3GUWA 4UC5A 4FNQA 4JTKA 4RXGA 3WNKA 5LNWA 1CBGA 5FJUA 3M0VA 1L6GA 3T09A 3SCRA 4AUBA 3UPMA 1THFD 5E93A 3NQBA 3H21A 1UASA 5SWUA 1XIEA 2E09A 2E77A 1OFOA 3MZNA 4MZ1A 3W6MA 2XVLA 1OD0A 1J9YA 3U48A 4RDWA 5KZMA 4A4AA 1W3HA 3BMXA 1V0NA 1W37A 5TF0A 1CCWB 2CWXA 1O12A 4A3QA 3GTHA 4GKLA 4QCFA 1TPB1 1E4MM 1LZOA 2Z7KA 2AMXA 1VJSA 3AIRA 3BCDA 4CNSA 3GTXA 4E6MA 3NOYA 4Z2HA 3O3RA 2WMHA 2Z27A 4R7WA 5LNUA 4ADUA 3WQWA 3AHVA 3GG8A 3URAA 2XHYA 3U0HA 1TV3A 2VEKA 1A49A 1FFQA 1JR1A 4JL2A 4KEZA 4FF7A 3V1HA 2WCSA 2DZBA 4UTHA 2DZVA 3MB9A 3CXOA 3SCOA 4U2YA 4NQ1A 3ZSTA 5H8MA 2V82A 3PBWA 4JEQA 2J8TA 2EEXA 5CCZA 3EBVA 3M0LA 3RFAA 2GUUA 4YXGA 2VZOA 1C8QA 2VUNA 2HPIA 4H4IA 5D8WA 3STEA 1DWJM 4M6QA 3DFPA 3DFHA 2YDAA 4A6GA 5KITA 3NL3A 1R2TA 3KBSA 2WNNA 3IGSA 4FALA 4WK9A 3CIWA 1WO2A 1IWAA 4K39A 4AZBA 4WSKA 1HJXA 3DH7A 2LLEA 4MPQA 3S9ZA 1SQ7A 3AIBA 4GX8A 3QC0A 5F7UA 1BD0A 4WDXA 3CPGA 4YVPA 3MUY1 4BF7A 2FPTA 1X8FA 2F38A 2JIEA 2CLHA 2QS8A 1WZMA 1H09A 1TIWA 3K1DA 3QQWA 4TV6A 4IPLA 3LLFA 3PNUA 1D7FA 3B04A 1VFOA 1R87A 1W91A 1TJPA 3TFCA 4IGMA 2ZX5A 1H0GA 3U8GA 1B54A 3GQYA 2OU4A 1E4LA 4GXMA 1JCMP 1UP0A 1B57A 4LYKA 1N7KA 3EWDA 1XBZA 3EWCA 1LRTA 4H9VA 3OQ8A 1VCFA 1HFBA 3WMCA 1FWFC 2J7FA 1O94A 5HUPA 1GJWA 4GZEA 3SB0A 4AIEA 1R3RA 1Z89A 2BXVA 2GOKA 3BJSA 3BZGA 5DANA 4J7RA 1G5AA 4CU8A 4XTIA 4D71A 1VEOA 3CMFA 1O95A 2XH2A 1IV8A 2BXYA 3IUHA 3TYEA 4H8VA 4PL1A 1ZAHA 1MZHA 5LA0A 2GQ8A 4Y90A 1VAHA 1XLGA 3S6TA 1U83A 1XKJA 3QRHA 1IT8A 4JTSA 1XYMA 4GLEA 4H2HA 2Y7GA 1KFCA 3S5SA 1H51A 3PZUA 1R86A 3VNIA 1WNOA 2E40A 4JCMA 3YPIA 4LY4A 1QI3A 4G5DA 4GNVA 1UMYA 1QOXA 5A6KA 2IQTA 4BQ5A 4D1IA 3VNYA 3GHUA 4FLQA 4AHQA 3EX2A 3BXWA 1VIZA 1QPKA 4PCPA 4WDWA 5REQB 3PBUA 4K1WA 1GQLA 4XBSA 2QUTA 3CT7A 4LUJA 4CQAA 4D8ZA 4NZ1A 3B4UA 1KFWA 2WKGA 1E71M 4H8HA 4M6UA 5CAKA 3G6LA 4QJ3B 5TAOA 3EGJA 3QTPA 1QNOA 4W8AA 2F2KA 2OPJA 1UJQA 3TMLA 5F2GA 1V5XA 4ENLA 4XKYB 2A2IA 3HO8A 1O4UA 5EA9A 1AQ0A 2H8XA 4LAMA 2ZZ4A 4JTCA 4DEFA 5G1YA 2P8BA 3W00A 4HNOA 1DXEA 3GNDA 4UTTC 2AMGA 1BAGA 1DJZA 1A5AA 4Q7BA 2OQLA 5A6BA 4ACZA 1CECA 3PR2A 5CSRA 5F1UA 2VOMA 3TN3A 1OINA 3GE7A 2VM8A 1AVAA 2VFIA 5CJNA 2Y8KA 5BCAA