4OS6A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk604 (bicyclic 2)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os6A01
1ZGVA 1Y3UA 3TPIZ 1O3NA 2TRMA 4UFEH 4RKOB 4ZKOU 4NWLA 3TIUA 3BTKE 3SNBA 3Q3XA 1P2OA 2SFAA 1PPEE 2DE8A 2HOBA 4ABGA 3PMAB 6ESTA 3UREA 2RG3A 4HI3A 5CMXH 3ZVGA 2A32A 3RXRA 1C1MA 3RMOH 1DX5M 1C2KA 2UUFB 2PW8H 1C9PA 1QRZA 1V6DA 1QR3E 1GI7B 2XXLA 1TIOA 2TGPZ 1GMDF 5EQRA 4GUXA 1THPB 3IG6B 5CHAB 1N1LA 1AWFH 1YLCA 2Y7XA 3TITA 4TWYA 1BRCE 1GJ7B 3VXEH 6GCHF 1RD3B 2ZZUH 1ARBA 3HKIB 1L0ZA 3GYLB 2FI5E 2XYAA 5FCKA 2VNTA 1GBEA 3RXSA 1UVPA 3RXDA 2NWNA 2HPQH 1QBVH 1YPMH 5TCAA 5JDUB 4AYYB 8GCHF 4K1TA 4UD9H 1LO6A 3AVZA 4ZKRU 4ABJA 4JZEH 5A8YA 1FZZA 2GKVE 3LIWA 1H8DH 1P2QA 3UFAA 3VB7A 5JPMH 3ESTA 3SW2B 1VR1H 1C2LA 3T27A 4IC5A 2ZIQH 3HK3B 1BDAA 1TGNA 2Y6TA 3BEUA 1W8BH 3K65B 1G2LA 3BTFE 1GI5A 2TGDA 2ZC9H 2XNIA 1GMCF 1XXFA 2BLQA 1SGQE 2C8WB 4HGCA 3LU9B 1ELEE 5EODA 1P05A 4TPYA 1O3OA 1KYNA 2OC1A 1SQOA 4JYVH 3T28A 1ID5H 3PROA 4JYTA 1P0SH 2A4QA 2BD9A 1OWDA 1GBBA 2WV4A 2FESH 2B8OH 4UFDH 3UWIA 1QFKH 1WCZA 1G3BA 1O3IA 4IMQA 2ZA5A 2BLVA 2G5NA 3EAJA 3W94A 1NFWA 1FPHH 4ZKSU 3VB6A 4LXBH 3HPTB 5C20A 2A5AA 4FUDA 1EPTA 1LHFH 3ZVBA 1PQAA 3SNAA 4BXWA 1BRAA 4WF8A 1GBKA 4F49A 2C3SA 1P3CA 1QHRB 2PTNA 3DFLA 1NN6A 3ZVDA 1EPTC 5HXFA 3M36A 3NWUA 3AASA 2IJOB 4NIWA 1ANEA 2QAAA 3Q77A 4ZUHA 1GG6C 4X1RU 5A8ZA 1AB9C 1LPGB 1JRSA 2BY8X 2WPMS 3UY9A 1C4Y2 4ASHA 1ESAA 1ZPZA 1TFXA 2WPIS 3W95A 2EA3A 2OC0A 1SLXB 2A2QH 1K21H 2AFQB 3SHCH 1MAYA 2XRCA 2BY9X 1CT2E 4FU7A 3ODDA 2OQ5A 2ZHFH 3M5LA 4GCHF 4Q2KA 4ZAEA 2ZDKA 3LJOA 4X2VA 4DURA 1QJ1B 5BRRE 1SGTA 2XCFA 3GYMA 1GJCB 1K1LA 2ZTYA 2KAIB 1E0FD 1JRTA 4KGAA 1TE0A 1BTWA 4NZQA 4X8VH 2Z3EA 4UFFH 2Z9IA 3OY5U 3TJVA 2A7JA 1QQUA 2OP9A 3JZ1B 1KXDA 2GZ7A 2ZHQH 2HPPH 3OTJE 4XE4A 1BTPA 2QY0B 2QXIA 3VXFH 4KTUA 1Y3WA 3RXGA 1W11U 4FUEA 1OWIA 1ZTJA 1DLKB 1WU1A 1AE5A 2G4TA 3MFJA 2QN5T 1G37A 4JZIA 4XBCA 5FCRA 2CN0H 1BB0B 2ZCLP 4JZFH 3ZVAA 4TPIZ 6CHAB 1TQ7B 1XM1A 1CGHA 1OS8A 3LGUA 2F9VA 1O2YA 4K60A 4TY7A 3A84A 1LVMA 4K1EA 3RXPA 1FNIA 1RTLA 1ETRH 2CV3A 3MH6A 3P92A 2FOBA 4YTAA 1AVGH 3ZZAA 3A7XA 1C2IA 1RFNA 1S81A 4R0IA 3NXPA 1GJ4H 2VGCC 4CHAC 1C1UH 1O3JA 5E2OA 1DDJA 1EJAA 1PFXC 4MPVA 1SGYE 1HV7A 2G4UA 2VWLA 4BTIB 3M3SA 3GY7A 4ABAA 3ITIA 1VITF 3ATKA 3F68H 4MNXA 4UDWH 1TNHA 5DP4A 3SU2A 1W0ZU 1BBRE 2ZECA 1AI8H 1GL0E 1Q2WA 3A81A 3SGBE 2NU3E 1F0TA 2VVUA 3RLYH 1Q3XA 5C2ZA 3FANA 3RU4D 1IQNA 4ZHLU 4K1SA 3M7UA 1ZMNA 4A5TS 1O3MA 4FUBA 1TQ0B 1Z1IA 3A82A 1QBNA 2F9BH 4X2YA 5AFZH 3T29A 4HFPB 1V2UT 4OS1A 1C1VH 1LKBA 3I77A 1GBLA 1TNJA 2F9NA 4XDEA 1GCTB 4Z6AH 1TABE 1BA8B 2CMYA 5J4SA 1TAWA 1F2SE 1SI5H 3BEIB 1C5TA 1DT2A 1TGSZ 1UVUH 4INLA 4ZKNU 3PMJA 1MTVA 1BRBE 1KXFA 1PPZA 4Y11E 4ABDA 3KQEA 1UTMA 3UQVA 3SV7A 2AMDA 1O2UA 3AW1A 2C8YB 2KAIA 2QXHA 3VPKA 3EYDA 1ZR0A 3E16B 1OXGA 1GBHA 3PMHB 4X6OA 4D7FA 1MKWH 1ZRKA 2R0LA 1SGRE 1V2PT 4MDSA 1W10U 3V3MA 4FVDA 3EDXB 1RS0A 4AN7A 1F5RA 5K7RA 1AMHA 4AYVB 3GCHC 4ISLA 2BY5X 1AFQC 1XMNB 1C5VA 5FBIA 4JMYA 1SMFE 1NY22 4K8BA 5AF9H 1C1SA 4KKDA 1GMDG 2Z6BD 2YNAA 1BJVA 3NK8A 2BZ6H 2ZFFH 3E0NB 1F92A 4U01A 1ZMJA 1E34B 3FVFB 1P3EA 5EW1H 1V3XA 3MNSA 3A87A 4UONA 3QWCH 4SGAE 6GCHG 3ZZCA 5IDKA 1O2RA 1FAXA 1HRTH 4U30A 3ELAH 1C5OH 5SGAE 2VIOA 1ELTA 3KGPA 1W0YH 2H9EH 1DSUA 2PWXA 1PQ8A 3DT0H 3SHAH 3BTGE 5AVDA 3TJOA 5DP6A 1ORFA 3ZVCA 1Z8JB 1PPFE 2SGAA 5EG4A 2VH6A 1BT7A 1UCYH 3GY3A 4WH8A 5FHTA 1DXPA 3SQHE 3EA8A 1AN1E 1ZJKA 4DGJA 1O37A 1MBMA 3P6ZB 1IQIA 3SU6A 1E36B 1FY4A 3HK6B 2ZGJA 1GDUA 1NT1A 3RXTA 1FDPA 3O8BA 4PROA 3GOVB 1XVMA 1V2VT 1LPKB 3RC6A 1FUJA 2Z9KA 3UR6A 1GMCG 3STIA 2BM2A 2WUCA 4B74A 1JXPA 2AIQA 1PPBH 2IN2A 3S9AA 1O31A 1NRNH 1SGDE 5LH8A 1F7ZA 2THFB 5ESBA 1Y5UT 3M7QA 1Y3VA 1DY8A 1FJSA 1GI9B 1TB6H 3LGYA 1FN6A 5C1XA 2XCNA 3NPSA 4RN6A 3U8TH 1BIOA 3SUEA 2PLXA 1FIZA 2W3IA 2Y5HA 1BMMH 1SGCA 2PKAB 1V2WT 1V2OT 4HTCH 1BMNH 2XBYA 2SGQE 1NU9A 1DWCH 2JKHA 5GDSH 1O2VA 4ISHH 3D62A 1TA6A 2PUQH 3SJOA 5JBCS 3LC3A 3RXAA 2P95A 1C5SA 4Y8XA 3SNCA 1EUFA 4OS4A 3STJA 1SFIA 4B76A 1ESTA 2FYQA 1CGIE 1C2EA 2P8OC 2ZFPH 3M5OA 4WMDA 1MBQA 3LOXA 1GBFA 1UHBA 3E1XB 5B6OA 1D3TB 3NZIA 1A7SA 2GCTC 1QURH 5EOKA 2GMTB 1GVKB 2G55A 1WQSA 2Q6FA 3EA9A 2FZZA 1DLEA 1OP0A 1YCPH 4AB9A 2O8WA 1S82A 1VGCC 2Z7FE 4KTCA 3RXQA 5FAHA 1DVAH 3RMMH 2J38A 1HFDA 3ZZ3A 1A46H 1FONA 1CE5A 2BTCE 3FP8E 1KTSB 1G3EA 4X2WA 4GCHG 1Z8RA 1O3EA 4ZHAA 1S85A 4B71A 1OWJA 1XKAC 4GHTA 1VCPA 1O39A 1ELAA 2FOMB 1EOJA 1Z7KA 1YF4A 3M37A 3ZZ5A 3A80A 3H5CB 4I8GA 1U6QA 2BDIA 1KIGH 1T4UH 2VIDA 1TOMH 5JB9S 2ZCKP 3CP7A 2ZPQA 1DICA 5DPAA 1TALA 2Y5FA 2XBVA 2GCHF 5DP9A 2BLWA 3MNCA 7GCHF 2F9OA 4K8YA 1TRYA 1TGBA 1ZZZA 1CHOF 1QJ7B 4DVAU 1H9LB 4D9QA 2VIWA 3SBKA 4E05H 4VGCB 1UVTH 1LDTT 4UE7H 5EQQA 3U8RH 1HJ9A 4I8JA 1FV9A 5HM2A 3UUZA 1TRNA 2ULLA 1O2XA 1CBWC 1FPCH 1TPAE 1HAGE 1FY1A 4BOHA 4WMFA 5A2MH 4Q7ZA 5LPFA 3RDZA 2FIRH 3OX7U 2JETC 1HAHH 2QCYA 3K6ZA 3A7ZA 3TVJB 3E3TA 2H9HA 1WOFA 3TNTA 3WY8A 3SV2H 7LPRA 1SHHB 2GDDA 1MKWK 1P2NA 2B0FA 5E0HA 1DE7H 3UIRA 3A86A 1QNJA 4B2BA 1J8AA 2FOCA 1W3CA 3MH5A 1GVLA 1AFEH 1ZMLA 3K2UA 3SV9A 1NC6A 2BQ6B 1HJ8A 4D76A 3A7VA 3TH4H 2D8WA 1P2IA 8LPRA 1V2JT 2PKAA 2BD3A 1GJDB 3KCGH 4Y0ZE 1UTJA 1O2SA 3TU7H 5A0BA 1SVPA 3RXJA 5J4QA 3UNRA 4Y76A 1C1OA 4ZHMU 2PGQB 4YLUA 1BOQA 2D2DA 2P3FH 1GBMA 1ZHPA 1VITG 4Y79A 3MO6A 2Y5GA 1HYLA 1EJNA 4KTSA 4DT7B 2AH4X 3QO6A 1F0SA 4ISOA 1ESBA 1GI6A 3A8AA 1RIWC 3U8OH 1XUHA 1MU6B 2NU1E 1EB2A 1BQYA 1W13U 2PKSB 1GL1A 3S69A 1C1QA 2OBOA 1S83A 3MHWU 4IC6A 4FUFA 1S0QA 2PSXA 2ZQ1A 1O2QA 3E6PH 1WUNH 2BDAA 4AG1A 2G52A 2WYJA 1H8IH 3KQCA 3SGQE 1E37B 1JMOH 4KELA 2IPHA 1O3KA 4OGYA 2V3OH 1DWDH 2OBQA 4OS6A 1UTLM 1GMHG 2VWNA 4OS5A 4I32A 1NTPA 1IHSH 3S9CA 4CRGA 1C2MA 1FLEE 5JBTA 2CXVA 2FOHA 3RXBA 4A6LA 3LGTA 1B0FA 2G51A 4AB8A 2A45B 5ESTE 3AW0A 3IWMA 3ZZ8A 5FXLA 4CRFA 1KTTB 1N8OB 1P03A 1FXYA 2J9NA 3SU1A 4Y6DA 1QTFA 3GY2A 1SGIB 1K1NA 1INCA 4AFSA 1EJMA 1P10A 1UTPA 2ZHDA 3OSYA 4NGAH 5T6DA 5LPRA 1IAUA 3P17H 1RGQA 2H5CA 3LH1A 1YLDA 1ZGIA 4O03A 1JWTA 1BZXE 1EAIA 2FOFA 1HCGA 1L1GA 3MOCA 3VB5A 1EP5A 3TK6A 1VZQH 3O8DA 1P06A 2C4FH 3GY8A 4CRDA 2RA0A 1O2GH 4CH2B 1FY8E 2F9UA 2FEQH 1FY5A 2NU4E 1BTUA 1EOLA 2BDBA 2V0BA 4IN2A 2AS9A 1QY6A 2FPZA 1T32A 3GY6A 1KXEA 1MUEB 3L6PA 1W12U 1GBIA 1GGDB 1ZHMA 1IQFA 2OC8A 1P02A 2GDEH 3KQDA 3GY4A 4K2YA 1KDQA 1MCTA 2H2ZA 3BTME 2HVXA 1SL3A 3RUOA 2CHAB 2Y7ZA 1O36A 1BHXB 1YPHE 3MNXA 2OC7A 1KY9A 1ZPBA 2GZ8A 4K69A 1K1IA 4YM9A 1H1BA 1P9SA 1MCVA 1SSXA 3MH7A 1YCPK 5C1UA 2VB0A 5AFYH 3FP6E 3ZYEA 3M7TA 3RU4T 1OWKA 1UTOA 2UUYA 1O0DH 1T8NA 2PHBA 4X1QU 2FOGA 4GVUA 4ESTE 2BOHB 2OXSA 3RC5A 1GBTA 3O8CA 1F0UA 1GBDA 1O2KA 5EQSA 1AY6H 3R3GB 3QGNB 1A0JA 5TCCA 1NZQH 2TIOA 1VJ9U 1DFPA 4ZXXH 1Y3YA 3I29A 1MZAA 1ABJH 4NIVA 2BLOA 1D6WA 1WSSH 1NRPH 3E91A 3DA9B 1TRMA 1HPGA 3HKJB 3QN7A 2ZF0H 3TK5A 2BVSH 3SORA 4CREA 1EZQA 1TX8A 2Z94A 3URCA 1TGCA 1X7AC 5CHAC 1UTKA 1BITA 2FI3E 3URDA 1AZZA 2C93B 3A88A 1L2EA 1OP2A 1TBZH 1CQQA 2BD2A 1ZPCA 3DD2H 1G3CA 2SNVA 4INHA 5DP7A 5A0CA 3SI4H 3BG4B 1EX3A 5JBBS 1LMWB 1RTKA 3ZV8A 1QQ4A 1O2NA 2PR3A 3T2NA 2W5EA 2ZDNA 1T31A 4I8LA 2ZCHP 1GPZA 2UUKB 1YPJH 4A1TA 3ATLA 1DPOA 2BY6X 3ZZBA 4R8TB 1C1NA 2A1DB 1D3PB 1ZJDA 5GXPA 5HYOA 4ABHA 3MYWA 1YGCH 4HZHA 2PTCE 2AGGX 1WYKA 1EASA 3PWCA 1ELBA 2VWMA 1QA0A 1DANH 4WY3A 5E0JA 3V12A 2R2WU 1Z8GA 2J92A 2A31A 3PLBA 3L3TA 3ZYDA 4H6SB 3A7TA 3B9FH 2QF3A 1GJ8B 1V2TT 5EXLA 1GJBB 2VVVA 1ELCA 3V0XA 2YNBA 5ABWA 3Q00A 1HGTH 3B23B 1HXEH 3KF2A 1ARCA 1O3HA 1RTFB 2FTLE 1TNKA 3SGAE 1ZSLA 4A1XA 1OP8A 2GCHG 4IN1A 4NA9H 1IQLA 1GBJA 2VWOA 3TJNA 1EAUA 1QL8A 5FX5A 3P70B 7GCHG 3V7TA 4A7IB 2PGBB 3RXIA 1GI4A 4AX9H 1HAXB 1CHOG 1SLWB 4Y10E 1K2I1 2H1UA 1NS3A 4B75A 1QCPA 2GGVB 2ZFRH 4J1YA 3NUMA 1PPHE 2ZDLA 3LDXH 4B1TA 2P59A 3IITA 3LKWA 4DG4A 1NU7B 3BN9A 2BD4A 2H5DA 3SU0A 1P04A 3MU1A 4ABFA 4YOJA 2BDCA 1HAVB 2VINA 4MTBA 2FLBH 5L30H 1QJ6B 2FLRH 4GAWA 1WV7H 1GMHF 3MO9A 3LH3A 2OCVB 3A85A 1TNLA 4JZ1A 1C5NH 2ZU4A 1EKBB 2A7CA 3FFGA 1E38B 3O8RA 3A8BA 5EPNA 1MZDA 1ZSKA 2ZO3H 4JK6A 4WVPE 5FBEA 3RXLA 1HJAB 1ZHRA 1YM0A 3C1KA 2W26A 2UWPA 3EGKH 1EZUC 1TMTH 5EGMA 4FVBA 2ZQ2A 1IQJA 1J17T 4TWWA 1BHXF 2WPKS 3UWJH 5GCHF 3KL6A 4DJZB 2H9TH 3UQOA 4U32A 9ESTA 3FP7E 3SO3A 4MNYA 2ZU2A 2HNTE 2WINI 4FUHA 1HBTH 2FMJA 1A5GH 4OGXA 2ZU1A 2XTTB 2WPLS 3QTVH 1XUIA 1C1WH 1NPMA 5I25A 3TGKE 2FYRA 1GBCA 2F9PA 1GBAA 1P11E 2CJIA 3Q76A 2EI8A 3I78A 4J2YB 1QIXB 3BEFB 3SQEE 1BRUP 4E7RG 1CA0B 3RMLH 3UNSA 1TYNA 1O2WA 1Y8TA 3RC4A 2XWAA 3SUDA 2ZP0H 2SNWA 1NESE 2BVXH 1D3QB 3GCNA 1AE8H 3PTNA 1GI3A 1C5UA 2R3UA 2VVCA 3RLWH 2QYIA 1CGJE 1NROH 6CHAC 3BIUH 1O33A 1UO6A 3PO1B 1W7XH 4MPXA 1DWBH 1A5HA 2D26C 1G2MA 3LGIA 3SZNA 5DG6A 4BAHB 1AHTH 3MU5A 4XBDA 1OWEA 3G01A 3LGWA 1IQKA 1VCWA 1O3BA 4KP0A 1HAPH 1GDQA 2C8XB 1CU1A 2UWOA 3DUXH 3A8DA 3RMNH 1O5AB 1QL9A 1C5MD 1K22H 1GJ6A 1V2NT 2Q1JA 1G32B 3GY5A 3TH3H 2AYWA 2ZGCA 1AUJA 3GCOA 5DP5A 1GHYH 3ENSB 2RCEA 2SGDE 1C2DA 3KQBA 1FQ3A 2NU2E 1DSTA 3M5NA 1QRWA 1V2RT 3AAUA 1YPKH 1ZRBA 4FU9A 3VB4A 1DY9A 1ACBE 1B5GH 1DWEH 2FXRA 1BMLA 2P16A 3VGCB 5HM9A 3OY6U 1KLJH 3QK1A 4I8KA 1DM4B 4CBOA 5C1YA 3RM2H 1MTNB 2ODPA 3SJ8A 1BCUH 1UTNA 3B8JA 2XBWA 2Q6DA 1VCQA 4WJG2 2O9QA 1BJUA 1BTXA 1ETTH 1TPPA 1YPEH 3PLKA 3L33A 1NFUA 3RXVA 5A0AE 3BV9B 1B7XB 4DIIH 2BX4A 1Y5BT 1GJAB 2XBXA 1NRQH 4NCYA 1ANCA 1ETSH 1GHBF 2ZGXH 1GCTC 1OSSA 3PMBB 2O8LA 2PSYA 3SJKA 2FTMA 4I7YH 1KXBA 1WAYB 4Y8ZA 2BZAA 1EB1H 4F4OC 4XOJA 1KSNA 4X6NA 1T7CA 4D8NA 1O2OA 3P8FA 4NG9H 1JIMA 3EQ0H 1SQTA 1O32A 2O8UA 4NA7A 2ZFQH 2OUAA 1O2IA 1SBWA 2ZG0H 3F9FA 1P57B 1MQ6A 2BD8A 2XW9A 4NIXA 3KNXA 4H6TA 1K1MA 4CBNA 4ABBA 1G30B 1DOJA 1SG8B 1A61H 1S6FA 2XC0A 4WWYA 3BTWE 4I31A 2WV5A 3EE0B 3LGVA 5C67A 1O2MA 4NZLA 4X6MA 4OS2A 1JOUB 3RXKA 2P93A 3RXEA 1VJAU 1LVBA 2FOAA 2BOKA 5LPEA 1OOKB 1XX9A 1A3BH 1L1NA 4YO9A 3KHVA 3ZVFA 1MTUA 1SGFG 1O35A 2PV9B 4WMEA 2R2MB 3UPEA 1LTOA 1ABIH 2Y80A 1AKSB 3V13A 1V2LT 1LPZB 3TGIE 1XXDA 1IQEA 2C90B 4CRCA 3RU4E 4DCDA 2CF9H 3ZZ6A 1HAOH 1BMAA 2P94A 3SUFA 1MH0A 3DFJA 3M61U 1NRSH 3UOPA 5C5NA 1P2KA 3H7OA 1MTWA 3PM3A 2QXJA 4AFUA 1DUAA 2VIVA 1LHEH 1HAIH 4Y7AA 2VIPA 1QB1A 4AFZA 3A8CA 3A89A 1C5XB 2QA9E 3JZ2B 1ELVA 1YYY1 3PWBA 2AMQA 1Y59T 2EEKA 2BD5A 4BAQB 1OWHA 3E90B 1AU8A 1MTSA 3BTDE 2AIPA 3CS7A 2LNCA 1UMAH 1GHZA 2GVFA 1Q31A 1RXPA 1J15A 2JH0D 2Z3DA 3F9GA 1PYTC 4MLFB 2CGAA 4NWKA 3RXUA 1T4VH 1O30A 2VJ1A 3GISB 4CRBA 2D1JA 3BG8A 3MU0A 1F0RA 1OYQA 1MMJN 4CRAA 2Z9GA 1QL7A 1O3LA 2FDAA 1H9IE 1O5CB 3BIVH 1HAZB 1EPTB 6LPRA 1K1PA 1O2PA 2A4RA 5F03A 1VITH 4Y8YA 3MU4A 2J34A 1GG6B 2H6MA 1AB9B 1C5QA 1D9IA 2ZPRA 3KIDU 1G36A 2C8ZB 3GDUA 3TGJE 4NFEA 1NFYA 9LPRA 3HATH 1C2FA 1SB1H 4YOIA 2BXUH 2K1QA 2ALVA 1AD8H 5E8EH 3S0NA 2ANMH 4RKJB 3ODFA 1EZSC 1SC8U 3FAOA 1O5DH 2OQUA 2Z3CA 2ZDMA 1O3AA 2JH6D 1IQHA 1C5LH 2FM2A 1Y5AT 2A5KA 2AGIX 2ZWLH 1UCYK 2FODA 2GZ9A 2FP7B 3QUMP 2JH5D 4QT8C 4DOQA 2PFEA 2ANYA 2GMTC 5E2PA 4LK4A 4WH6A 2LPRA 1QRXA 2FX4A 1ZOMA 2CF8H 1LVOA 4O3TA 8ESTE 1A0LA 1S84A 1C2GA 1XVOA 4Q80A 3UTUH 1TLDA 1AZ8A 1LVYA 2PUXB 3GCTF 1NM6A 4UFGH 3QZQA 1THSH 4Y71A 1A2CH 1JBUH 4YLQH 1A5IA 1BTHH 1EXFA 2ZFSA 2J4IA 3U1JB 2HNTF 3SU3A 1A4WH 4TY6A 4XFQA 4MPWA 2A4OA 3TH2H 1J14A 3N7OA 4BAKB 1GHWH 2ZTZA 3BTQE 1NRRH 2Y82A 1LQDB 2GV7A 1DS2E 5GCHG 1GHXH 2BYAX 4TYDA 4X1PU 2FO9A 3T25A 2A7HA 1F5KU 2P3TB 3M3VA 2ZTXA 1AKSA 4XBBA 2BY7X 1UJ1A 2UWLA 3QX5H 1PYTD 2GP9B 1P12E 1FAKH 2G8TA 2I6SA 3PYHA 4BNRA 4E06H 2YOLA 3M5MA 4IBLH 4IW4E 1B0EA 3GDSA 4VGCC 4A92A 2Z9LA 1E35B 1L4DA 3P8GA 5EXMA 1CHGA 4MPUA 1LKAA 2ZKSA 3A83A 4ZH8A 2SGPE 2DUCA 3BF6H 2AEIH 5JYIA 1SGFA 2VGCB 4BAOB 4CHAB 2OTVA 1N6YA 3OYPA 4AG2A 2F91A 3U98H 3QLPH 1UK4A 3D23A 1ANDA 3MO3A 3RM0H 4YZUA 2ZGBH 1ANBA 2R0KA 4JYUH 1S6HA 5EU8A 5JBAS 3Q3KA 2ZDAH 2ANWA 5GIBA 3SI3H 2AMPA 5GWZA 1IQMA 3ATMA 4Z0KA 1ZTKA 1GDNA 2FS8A 1A0HB 1PJPA 1O3CA 4YOGA 2STBE 4INKA 3BTTE 1D4PB 3K9XB 1EATA 2W3KA 3NCLA 3VB3A 4YT7H 1S0RA 4E7NA 2WUBA 2V35A 4JK5A 2XC5A 4X8UH 1V2QT 1FIWA 1UVOA 2ZU5A 4H42U 1MAXA 1TX7A 4X8TH 2UUJB 4YESB 4FUIA 1UTQA 2PKSC 1IOEA 7KMEH 3RXHA 1LQEA 5DP3A 1GJ9B 5FPYA 3SJIA 1C2HA 4RSPA 2A0QB 2QC2A 2F83A 2NU0E 3FZDA 1CT4E 1K1OA 1TBRH 1GHBG 1O2TA 1GWAA 1SPJA 1QBOA 1A1RA 1Z1JA 1TPSA 3GCHB 3HGNA 1C1TA 2HGTH 2A5IA 2STAE 2BQWB 3PTBA 4MVNA 1O38A 5HGGA 1GI1A 1GJ5H 1K9OE 1AFQB 2FX6A 4K3JA 3VEQB 1FY3A 4O9VA 1SGEE 4ISIH 3ZZ7A 3E8LA 1ELDE 4H4FA 5L6NH 1C4U2 1Z6EA 3BSQA 1EP6A 1N8OC 1L1JA 1SQAA 1FMGA 1GI8B 2FS9A 3S9BA 1TGTA 1TA2A 2J95A 3EA7A 3KN2A 2QV1A 1HDTH 2G5VA 2GT7A 4B2AA 4CH8B 5JB8S 1TNGA 1XKBC 1KXAA 5T6FA 5TJXA 5HMAA 1HIAB 1YKTA 2VU8E 3PLPA 4WXVA 2WYGA 3NKKA 3U69H 2WPHS 2BDHA 1AVWA 1H9HE 2GT8A 3A7WA 3BTHE 1LCYA 1GHAF 2SGFE 3UNQA 2VIQA 3OU0A 4FU8A 1GGDC 2ZPSA 4LOYH 5ETXA 5C5OA 2G00A 1D6RA 4X8SH 4LZ1H 1GI0A 4FXGH 3QDZB 3LT3A 4X1NU 1M9UA 2BMGB 4GSOA 1T8OA 3LPRA 1AO5A 5I46H 4ZROA 2CHAC 5EPYA 4Q7YA 2RDLA 4GPGA 3SV6A 1O2LA 4OS7A 5GPIB 2HRVA 1AUTC 2ZU3A 3TJUA 4AORA 3KEEA 3QZRA 1OX1A 4MNVA 1Y3XA 2Y81A 1H4WA 1SGNE 2BD7A 2V6NA 1P2JA 5C3NA 3PV4A 1W14U 5G4BA 3P8NA 4ABEA 1LHGH 1AGJA 1SOTA 1EAWA 1YPGH 2V3HH 3SV8A 1IHTH 1S5SA 1TBQH 2TGAA 1MU8B 1EQ9A 5FPSA 4IGDA 1AIXH 2XWBI 1C5YB 1C1PA 1V2KT 1OKXA 4B73A 3ZZ9A 5AHGH 2ZFTA 2HLCA 5FPTA 5K0HA 2BX3A 3TLOA 1ELFA 1IQGA 1YCPM 3MTYA 1CA8B 1LHDH 2B7DH 1CVWH 4MNWA 1WTHD 1BBRH 4ISNA 1EAXA 1HNEE 4THNH 1D3DB 1KXCA 2P8OB 3SUGA 1L4ZA 3LONA 3U9AH 5EW2H 5BPEA 1TWXB 1QGFA 2GCTB 3SU4A 3AAVA 1SR5C 2R9PA 3HGPA 5PTPA 3RXOA 1DUEA 5GJ4B 2HWLB 1O5GH 1PPCE 3BTEE 1F5LA 4Y0YE 4XSKU 1UHBB 2WPJS 1SGPE 3CENA 3VFEA 3TNSA 5DP8A 4MQAA 4AOQA 8KME2 5L2ZH 1VGCB 1CO7E 1XUGA 1K28D 1TPOA 4K5ZA 1FI8A 1Z8IB 2A2XH 1C5WB 2GD4B 2GTBA 3BG4C 1J9CH 5DGJA 1AQ7A 2ZDVH 1O2HA 4Q7XA 1WBGB 4NFFA 4IMZA 1YPHC 2O8TA 2TBSA 4D7GA 1UCYE 1WTGH 5F6MA 1UK3A 1AWHB 4O3UA 2O8MA 3MH4A 1XUKA 1GCDA 1MKXH 1C9TA 5IYTA 2BVRH 3GCTG 5A09A 2W7UA 5DO4H 2P3UB 3F6UH 4X0WU 1HXFH 3C27B 1C4V2 3D49H 4JZDH 1HIAA 5DJ7A 1W2KH 2ZEBA 2RA3A 3RXFA 3ZZDA 3U1IB 1GI2A 1THRH 4GLYA 1SHYA 1C5RA 5H4IB 4AGKA 4BXSA 2ZHWH 1C5PA 2QIQA 2R3YA 4IS5A 2BDGA 4CR5A 1HLTH 2M5TA 1CSOE 3GICB 1CBWB 1TONA 4BTUB 2ZGHA 8GCHG 1TX6A 1QB9A 4FUCA 4LZ4B 4A1VA 3LJJA 4AFQA 1C5ZB 5F8XA 2VH0A 1P09A 5LGOA 4M7GA 2JETB 3MNBA 1DITH 4MG3A 2ZNKH 2TPIZ 2ANKH 4DY7B 2OD3B 3A7YA 3GDVA 1EZXC 1XUJA 3R0FA 1O34A 4I33A 2AGEX 5DK1A 3CS0A 4I8HA 1HAVA 4AZ2B 2ILNA 3Q3YA 2ODQA 1ZLRA 4X2XA 5L2YH 3RXMA 3QGJA 4CR9A 3F9EA 4O97A 1ZYOA 2ZHEH 2Z9JA 1UK2A 1HUTH 1SFQB 1PPGE 1RRKA 1P9UA 1TOCB 2FI4E 1RJXB 4ABIA 5F8TA 2AERH 1BTYA 3RP2A 2FOEA 4UEHH 3QTOH 3T26A 1O2JA 5A8XA 3T62A 3PB1E 3F9HA 3M3TA 3SJ9A 1YP9A 2EI7A 1RIWB 1YBWA 1T8MA 1G3DA 1N6XA 4SGBE 4Y7BA 1HJAC 2B9LA 2OLGA 1GHVH 3ATIA 1SLVB 4GHQA 2I6QA 2W7SA 2BHGA 4NA8A 1KLIH 2ALPA 3M35A 1J16A 2B5TB 1NFXA 2BQ7B 2F3CE 1XUFA 5F8ZA 1HAYB 2J2UA 1PQ5A 3MI4A 1MQ5A 2DE9A 1O2ZA 3UOUA 2QXGA 1T8LA 3MWIU 2FWWA 1CA0C 3P95A 1DXWA 2BDYA 2XC4A 1TNIA 3F1SB 1P8VC 1Z6JH 1O5BB 4BAMB 1HB0B 1O3DA 1SOZA 4DW2U 1P2MA 3SNDA 1ZSJA 1QA7A 2ASUB 5EXNA 4D9RA 4JCNA 1OPHB 1KLTA 3D65E 3E0PB 3FZZA 4X6PA 4FUGA 4NSYA 3SN8A 2A4GA 5T6GA 3UR9A 1O3FA 1O3GA 2GX4A 5E0GA 3S7HB 3PO1C 1O5EH 1MD7A 1SLUB 4ZXYH 3SNEA 4U2WA 2IOTA 3S7KB 1Z71A 3TK9A 1V2MT 1G9IE 4YT6H 3ZV9A 3RXCA 3ZVEA 1QB6A 4WXIA 1JIRA 3ATWA 5T3HA 1BBRK 1O5FH 1WQVH 2QF0A 1MD8A 5FX6A 3ZZ4A 2J94A 4AGJA 7ESTE 4FUJA 1CT0E 3MU8A 3H7TA 4NSVA 4BTTB 1V2ST 2G81E 1GVZA 1UVSH 3SOSA 2TGTA 3P8OA 1P01A 2BXTH 2EI6A 1AVXA 2EC9H 1BUIA 2OINA 1OYTH 5CE1A 4DIHH 1K1JA 4NIYA 1KDQB 3MMGA 1PQ7A 1O3PB 1GHAG 1TMBH 3VGCC 1FN8A 1TMUH 4BANB 2HNTC 1MTNC 3K6YA 4ZMAH 3SU5A 1YC0A 4B2CA 3T5FH 1C1RA 2BB4A 3LC5A 1YPLH 2ODYB 4X1SU 5DKMA 1BTZA 1ZTLA 1ELGA 2ZI2H 1NO9H 1A3EH 2QGRA 1W7GH 2SGEE 2GV6A 3DHKH 1LHCH 2Q6GA 2HALA 2ESTE 1C2JA 1MKXK
chains in the Genus database with same CATH superfamily
1ZGVA 1Y3UA 3TPIZ 1O3NA 2TRMA 4UFEH 4RKOB 4ZKOU 4NWLA 3TIUA 3BTKE 3SNBA 3Q3XA 1P2OA 2SFAA 4I86A 1PPEE 2DE8A 2WSSD 2HOBA 4ABGA 3PMAB 6ESTA 3UREA 2RG3A 4HI3A 5CMXH 3ZVGA 2A32A 3RXRA 1C1MA 3RMOH 3F2FA 1DX5M 1C2KA 2UUFB 2PW8H 1C9PA 1QRZA 1V6DA 1QR3E 4XD7D 1GI7B 2XXLA 1TIOA 2TGPZ 3OE7D 1GMDF 5EQRA 4GUXA 1THPB 3IG6B 5CHAB 1N1LA 1AWFH 1YLCA 2Y7XA 3TITA 4TWYA 1BRCE 3N99A 1GJ7B 3VXEH 6GCHF 2L74A 1RD3B 2ZZUH 1ARBA 3MQKC 3HKIB 4RT0A 2HLDD 1L0ZA 1NBMD 2FI5E 2XYAA 3GYLB 5FCKA 2VNTA 3OFND 1GBEA 3RXSA 1UVPA 3RXDA 2NWNA 2HPQH 1QBVH 5EIYA 1YPMH 5TCAA 2EQNA 4AYYB 5JDUB 2WV9A 8GCHF 4K1TA 4UD9H 1LO6A 3AVZA 4ZKRU 4ABJA 4JZEH 5A8YA 1FZZA 2GKVE 3LIWA 1H8DH 1P2QA 3UFAA 3VB7A 5JPMH 3ESTA 3SW2B 1VR1H 1C2LA 3T27A 4IC5A 2ZIQH 3HK3B 1BDAA 1TGNA 2Y6TA 3BEUA 1W8BH 3K65B 1G2LA 3BTFE 1GI5A 2TGDA 2ZC9H 2XNIA 1GMCF 1XXFA 2BLQA 1SGQE 2C8WB 4HGCA 3LU9B 1ELEE 5EODA 1P05A 4TPYA 1O3OA 2KX4A 1KYNA 2OC1A 1SQOA 4JYVH 3T28A 1ID5H 3PROA 4JYTA 1P0SH 2A4QA 2BD9A 1OWDA 1GBBA 2WV4A 2FESH 2B8OH 4UFDH 3UWIA 1QFKH 1WCZA 2V3MA 1G3BA 1O3IA 2JDID 4IMQA 2ZA5A 2BLVA 2G5NA 3EAJA 2W6JD 3W94A 1S6LA 1NFWA 3DCLA 1FPHH 4ZKSU 3VB6A 4LXBH 3HPTB 5C20A 2A5AA 4FUDA 1EPTA 1LHFH 3ZVBA 2KCAA 1PQAA 3SNAA 4BXWA 1BRAA 4WF8A 1GBKA 4F49A 2C3SA 4Q4LA 1P3CA 1QHRB 2PTNA 3DFLA 3AK5A 1NN6A 3ZVDA 1EPTC 5HXFA 3M36A 3NWUA 3AASA 2IJOB 5C94A 4NIWA 1ANEA 2QAAA 3Q77A 4ZUHA 1GG6C 4X1RU 5A8ZA 1AB9C 1LPGB 1JRSA 2BY8X 2WPMS 3UY9A 1C4Y2 4ASHA 1ESAA 1ZPZA 1TFXA 2WPIS 3W95A 2EA3A 2OC0A 1SLXB 2A2QH 1K21H 2AFQB 3SHCH 1MAYA 2XRCA 2BY9X 1CT2E 4FU7A 3ODDA 2OQ5A 2ZHFH 3M5LA 4GCHF 4Q2KA 4ZAEA 2ZDKA 3LJOA 2KZ4A 4X2VA 4DURA 1QJ1B 5BRRE 1SGTA 2XCFA 3GYMA 1GJCB 1K1LA 5FL7D 2ZTYA 2KAIB 1E0FD 1JRTA 4KGAA 1TE0A 1BTWA 4NZQA 4X8VH 2Z3EA 4UFFH 2RDEA 2Z9IA 3OY5U 3TJVA 2A7JA 1QQUA 2LELA 2OP9A 3JZ1B 1KXDA 2GZ7A 2ZHQH 2HPPH 3OTJE 4XE4A 2YMSC 1BTPA 2QY0B 2QXIA 3VXFH 4KTUA 1Y3WA 3RXGA 1W11U 4FUEA 1OWIA 1ZTJA 1DLKB 1W0KD 1WXRA 1WU1A 1AE5A 2G4TA 3MFJA 2QN5T 1G37A 4JZIA 4XBCA 5FCRA 2CN0H 1BB0B 2ZCLP 4JZFH 3ZVAA 4TPIZ 6CHAB 1TQ7B 1XM1A 3DSOA 1CGHA 1OS8A 3LGUA 2F9VA 1O2YA 4K60A 4TY7A 3A84A 1LVMA 4K1EA 3RXPA 1FNIA 1RTLA 1ETRH 2CV3A 3MH6A 3P92A 2FOBA 4YTAA 1AVGH 3ZZAA 3A7XA 1C2IA 1RFNA 1S81A 4R0IA 3NXPA 1GJ4H 1EFRD 2VGCC 4CHAC 1C1UH 1O3JA 5E2OA 1DDJA 1E1QD 1EJAA 1PFXC 4MPVA 1SGYE 1HV7A 2G4UA 2VWLA 4BTIB 3M3SA 3GY7A 4ABAA 3ITIA 5C0TA 1VITF 3ATKA 3F68H 4MNXA 4UDWH 1TNHA 5DP4A 3SU2A 1W0ZU 1BBRE 2ZECA 1AI8H 1GL0E 1Q2WA 3A81A 3SGBE 2NU3E 1F0TA 2PP6A 2VVUA 1Q3XA 3RLYH 5C2ZA 3FANA 3RU4D 1IQNA 4ZHLU 4K1SA 3M7UA 1ZMNA 4A5TS 1O3MA 4FUBA 1TQ0B 1Z1IA 3A82A 1QBNA 2F9BH 4X2YA 5HIYA 5AFZH 3T29A 4HFPB 1V2UT 4OS1A 1C1VH 1LKBA 3I77A 1GBLA 1TNJA 2F9NA 4XDEA 1GCTB 4Z6AH 1TABE 1BA8B 3KQ5A 2CMYA 5J4SA 1TAWA 1F2SE 1SI5H 3BEIB 1C5TA 1DT2A 1TGSZ 1UVUH 2YMSD 4INLA 4ZKNU 3PMJA 1MTVA 1BRBE 1KXFA 1PPZA 4Y11E 4ABDA 3KQEA 1UTMA 3UQVA 3SV7A 2AMDA 1O2UA 3AW1A 2C8YB 4OM9A 2KAIA 2QXHA 3VPKA 3EYDA 1ZR0A 3E16B 1OXGA 1GBHA 3PMHB 4X6OA 4D7FA 1MKWH 1ZRKA 2R0LA 1SGRE 1V2PT 4MDSA 1W10U 3V3MA 4FVDA 3EDXB 1RS0A 4AN7A 1F5RA 5K7RA 1AMHA 4AYVB 3GCHC 4ISLA 2BY5X 1AFQC 1XMNB 1C5VA 5FBIA 4JMYA 1SMFE 1NY22 3PRBA 4K8BA 5AF9H 1C1SA 4KKDA 1GMDG 2Z6BD 2YNAA 1BJVA 3NK8A 2BZ6H 2ZFFH 3E0NB 1F92A 4U01A 1ZMJA 1E34B 3FVFB 1P3EA 5EW1H 1V3XA 3MNSA 3A87A 4UONA 3QWCH 4SGAE 6GCHG 3ZZCA 5IDKA 1O2RA 1FAXA 1HRTH 4U30A 3ELAH 1C5OH 5SGAE 2VIOA 1ELTA 3KGPA 1W0YH 2H9EH 1DSUA 2PWXA 1PQ8A 3DT0H 3SHAH 3BTGE 5AVDA 3TJOA 5DP6A 1ORFA 3ZVCA 1Z8JB 1PPFE 2SGAA 5EG4A 2VH6A 1BT7A 4RT1A 1UCYH 3GY3A 4WH8A 5FHTA 1DXPA 3SQHE 3EA8A 1AN1E 1ZJKA 4DGJA 1K0HA 1O37A 1MBMA 3P6ZB 1IQIA 3SU6A 1E36B 1FY4A 3HK6B 2ZGJA 1GDUA 1NT1A 2KCOA 1FDPA 3RXTA 3O8BA 4PROA 3GOVB 1XVMA 1V2VT 1LPKB 3RC6A 1FUJA 2Z9KA 3UR6A 1GMCG 3STIA 2BM2A 2WUCA 2QE7D 4B74A 1JXPA 2AIQA 1PPBH 2IN2A 3S9AA 1O31A 1NRNH 1SGDE 5LH8A 1F7ZA 2THFB 5ESBA 1Y5UT 3M7QA 1Y3VA 1DY8A 1FJSA 1GI9B 1TB6H 3LGYA 1FN6A 5EJLA 5C1XA 2XCNA 3NPSA 4RN6A 3U8TH 1BIOA 1WDIA 3SUEA 2PLXA 1FIZA 2W3IA 2Y5HA 1BMMH 1SGCA 2PKAB 1V2WT 1V2OT 4HTCH 1BMNH 2XBYA 4Q63A 2SGQE 1NU9A 1DWCH 2JKHA 5GDSH 1O2VA 4ISHH 3D62A 5CHBA 1TA6A 2PUQH 3SJOA 5JBCS 3LC3A 3RXAA 2P95A 1C5SA 4M9FA 4Y8XA 1EUFA 4OS4A 3SNCA 3STJA 1SFIA 4B76A 1ESTA 2FYQA 1CGIE 1C2EA 2P8OC 2ZFPH 3M5OA 4WMDA 1MBQA 3LOXA 1GBFA 1UHBA 3E1XB 4P02A 5B6OA 1D3TB 3NZIA 1A7SA 2GCTC 1QURH 3WWBA 5EOKA 2GMTB 1GVKB 2G55A 1WQSA 2Q6FA 3EA9A 2FZZA 1DLEA 1OP0A 1YCPH 4AB9A 2O8WA 1S82A 1VGCC 2Z7FE 4KTCA 3RXQA 5FAHA 1DVAH 3RMMH 2J38A 1HFDA 2OK5A 3ZZ3A 1A46H 1FONA 1CE5A 2BTCE 3FP8E 1KTSB 1G3EA 4X2WA 1YWUA 4GCHG 1Z8RA 1O3EA 4ZHAA 1S85A 4B71A 1OWJA 1XKAC 4GHTA 1SKYE 1VCPA 1O39A 1ELAA 2FOMB 1EOJA 1Z7KA 1YF4A 3M37A 3ZZ5A 3A80A 3H5CB 4I8GA 1U6QA 2BDIA 1KIGH 1T4UH 2VIDA 1TOMH 5JB9S 2ZCKP 3CP7A 2ZPQA 1DICA 2WZQA 5DPAA 1TALA 2Y5FA 2XBVA 5DSFA 2GCHF 5DP9A 2BLWA 3MNCA 3ZIAD 3OEED 7GCHF 2F9OA 4K8YA 1TRYA 1TGBA 1ZZZA 1CHOF 1QJ7B 4DVAU 1H9LB 4D9QA 2VIWA 3SBKA 4E05H 4VGCB 1UVTH 1LDTT 4UE7H 5EQQA 3U8RH 1HJ9A 4I8JA 1FV9A 5HM2A 3UUZA 1TRNA 2ULLA 1O2XA 1CBWC 1FPCH 1TPAE 1HAGE 1FY1A 4BOHA 4WMFA 5A2MH 4Q7ZA 2LP6A 5LPFA 3RDZA 2FIRH 3OX7U 2JETC 1HAHH 2QCYA 3K6ZA 3A7ZA 3TVJB 3E3TA 2H9HA 1WOFA 3TNTA 3WY8A 3SV2H 7LPRA 1SHHB 2GDDA 1MKWK 1P2NA 2B0FA 5E0HA 1DE7H 3UIRA 3A86A 1QNJA 4B2BA 1J8AA 2FOCA 1W3CA 3MH5A 1GVLA 1AFEH 1ZMLA 3K2UA 3SV9A 1NC6A 2BQ6B 1HJ8A 4D76A 3A7VA 3TH4H 2D8WA 1P2IA 8LPRA 1V2JT 2J98A 1COWD 2PKAA 2BD3A 1GJDB 3KCGH 4Y0ZE 4ACBA 1UTJA 1O2SA 3TU7H 5A0BA 1SVPA 3RXJA 5J4QA 3UNRA 4Y76A 1C1OA 4ZHMU 2PGQB 4YLUA 1BOQA 2D2DA 2P3FH 1GBMA 1ZHPA 1VITG 4Y79A 3MO6A 2Y5GA 1HYLA 1EJNA 4KTSA 4DT7B 3N7EA 2AH4X 3QO6A 1F0SA 4ISOA 1ESBA 1GI6A 3A8AA 1RIWC 3U8OH 1XUHA 1MU6B 2NU1E 1EB2A 1BQYA 1W13U 2PKSB 1GL1A 3S69A 1C1QA 2OBOA 1S83A 3MHWU 4IC6A 4FUFA 1S0QA 2PSXA 2ZQ1A 1O2QA 3E6PH 1MABB 1WUNH 2BDAA 4AG1A 2G52A 2WYJA 1H8IH 3KQCA 3SGQE 1E37B 1JMOH 4KELA 2IPHA 1O3KA 4OGYA 2V3OH 1DWDH 2OBQA 4OS6A 1UTLM 1GMHG 2VWNA 4OS5A 4I32A 1NTPA 1IHSH 3S9CA 4CRGA 1C2MA 1FLEE 5JBTA 2CXVA 2FOHA 3RXBA 4A6LA 3LGTA 1B0FA 2G51A 4AB8A 2A45B 5ESTE 3AW0A 3IWMA 3ZZ8A 5FXLA 4CRFA 1KTTB 1N8OB 1P03A 1FXYA 2J9NA 3SU1A 4Y6DA 1QTFA 3GY2A 1SGIB 1K1NA 1INCA 4AFSA 1EJMA 1P10A 1UTPA 2ZHDA 3OSYA 4NGAH 5T6DA 5LPRA 1IAUA 3P17H 1RGQA 2H5CA 3LH1A 1YLDA 1ZGIA 4O03A 1JWTA 1BZXE 1EAIA 2FOFA 1HCGA 1L1GA 3MOCA 3VB5A 4TSFD 1EP5A 3TK6A 1VZQH 3O8DA 1P06A 2C4FH 3GY8A 4CRDA 2RA0A 1O2GH 4CH2B 1FY8E 2F9UA 2FEQH 1FY5A 2NU4E 1BTUA 1EOLA 2BDBA 4YXWD 2V0BA 4IN2A 2AS9A 1QY6A 2FPZA 1T32A 3GY6A 1KXEA 1MUEB 3L6PA 1W12U 1GBIA 1GGDB 1ZHMA 3UAIC 1IQFA 2OC8A 1P02A 2GDEH 3KQDA 3GY4A 4K2YA 1KDQA 1MCTA 2H2ZA 3BTME 2HVXA 1SL3A 3RUOA 2CHAB 2Y7ZA 1O36A 1BHXB 1YPHE 3MNXA 1KY9A 1ZPBA 2OC7A 2GZ8A 4K69A 1K1IA 4YM9A 1H1BA 1P9SA 1MCVA 1SSXA 3MH7A 1YCPK 5C1UA 2VB0A 5AFYH 3FP6E 3ZYEA 3M7TA 3RU4T 1OWKA 1UTOA 2UUYA 1O0DH 1T8NA 2PHBA 3FN8A 4X1QU 2FOGA 4GVUA 4XRNA 4ESTE 2BOHB 2OXSA 3RC5A 1GBTA 3O8CA 1F0UA 1GBDA 1O2KA 5EQSA 1AY6H 3R3GB 3QGNB 1A0JA 5TCCA 1NZQH 2TIOA 1VJ9U 2WPDD 1DFPA 4ZXXH 2J97A 1Y3YA 3I29A 1MZAA 1ABJH 4NIVA 2BLOA 1D6WA 1WSSH 1NRPH 5HKKD 3E91A 3DA9B 1TRMA 1HPGA 3HKJB 3QN7A 2AHME 2ZF0H 3TK5A 2BVSH 3SORA 4CREA 1EZQA 1TX8A 2Z94A 3URCA 1TGCA 1X7AC 5CHAC 1UTKA 1BITA 2FI3E 2IPQX 3URDA 1AZZA 2C93B 3A88A 1L2EA 1OP2A 2BD2A 1CQQA 1TBZH 1ZPCA 3DD2H 1G3CA 2SNVA 4INHA 5DP7A 5A0CA 3SI4H 3BG4B 1EX3A 5JBBS 1LMWB 1RTKA 3ZV8A 1QQ4A 1O2NA 2PR3A 3T2NA 2W5EA 2ZDNA 1T31A 4I8LA 2ZCHP 1GPZA 2UUKB 1YPJH 3FKSD 4A1TA 3ATLA 1DPOA 2BY6X 3ZZBA 4R8TB 1C1NA 2A1DB 1D3PB 1ZJDA 5GXPA 5HYOA 4ABHA 3MYWA 1YGCH 4HZHA 2PTCE 2AGGX 1WYKA 1EASA 3PWCA 1ELBA 2VWMA 1QA0A 1DANH 4WY3A 5E0JA 3V12A 2R2WU 1Z8GA 2J92A 2A31A 3PLBA 3L3TA 3ZYDA 4H6SB 3A7TA 3B9FH 2QF3A 1GJ8B 1V2TT 5EXLA 1GJBB 2VVVA 1ELCA 3V0XA 2YNBA 5ABWA 3Q00A 1HGTH 3B23B 1HXEH 3KF2A 1ARCA 1O3HA 4ASUD 1RTFB 2FTLE 1TNKA 3SGAE 1ZSLA 4A1XA 1OP8A 2GCHG 4IN1A 3UB0A 4NA9H 1IQLA 1GBJA 2VWOA 3TJNA 1EAUA 1QL8A 3F0PA 5FX5A 3P70B 7GCHG 3V7TA 2L6OA 4A7IB 2PGBB 3RXIA 1GI4A 4AX9H 1HAXB 1CHOG 1SLWB 4Y10E 1K2I1 1E1RD 2H1UA 1NS3A 4B75A 5KEDA 1QCPA 4B6EA 2GGVB 3PRDA 2ZFRH 4J1YA 1YY3A 3NUMA 1PPHE 2ZDLA 3LDXH 4B1TA 2P59A 3IITA 3LKWA 4DG4A 1BMFD 1NU7B 3BN9A 2BD4A 2H5DA 3SU0A 1P04A 3MU1A 4ABFA 4YOJA 2BDCA 1NBME 1HAVB 2VINA 4MTBA 2FLBH 5L30H 1QJ6B 2FLRH 4GAWA 1WV7H 1GMHF 3MO9A 3LH3A 2OCVB 3A85A 1TNLA 4JZ1A 1C5NH 2ZU4A 1EKBB 2A7CA 2KFWA 3FFGA 1E38B 3O8RA 3A8BA 5EPNA 1MZDA 1ZSKA 2ZO3H 4JK6A 4WVPE 5FBEA 3RXLA 1HJAB 1ZHRA 1YM0A 3C1KA 2W26A 2UWPA 3EGKH 1EZUC 1TMTH 5EGMA 4FVBA 2ZQ2A 1IQJA 1J17T 4TWWA 1BHXF 2WPKS 3UWJH 5GCHF 3KL6A 4DJZB 2H9TH 3UQOA 4U32A 9ESTA 3FP7E 3SO3A 4MNYA 2ZU2A 2HNTE 2WINI 4FUHA 1HBTH 2FMJA 1A5GH 4OGXA 2ZU1A 2XTTB 2WPLS 3QTVH 1XUIA 1C1WH 1NPMA 5I25A 3TGKE 2FYRA 1GBCA 2F9PA 1GBAA 1P11E 2CJIA 1H8HD 3Q76A 2EI8A 3I78A 4J2YB 1QIXB 3BEFB 3SQEE 1BRUP 4E7RG 1CA0B 3RMLH 3UNSA 1TYNA 1O2WA 2RFKC 1Y8TA 3RC4A 2XWAA 3SUDA 2ZP0H 2SNWA 1NESE 2BVXH 1D3QB 3GCNA 1AE8H 5DN6D 3PTNA 2KCYA 1GI3A 2GJGA 1E79D 1C5UA 2R3UA 2VVCA 3RLWH 2QYIA 1CGJE 1NROH 6CHAC 3BIUH 1O33A 1UO6A 3PO1B 1W7XH 4MPXA 1DWBH 1A5HA 2D26C 4F48B 1G2MA 3LGIA 3SZNA 5DG6A 4BAHB 3F3BA 1AHTH 3MU5A 4XBDA 1OWEA 3G01A 3LGWA 1IQKA 5B6LA 1VCWA 1O3BA 4KP0A 1HAPH 1GDQA 2C8XB 1CU1A 2CK3D 2UWOA 3DUXH 3A8DA 3RMNH 1O5AB 1QL9A 1C5MD 1K22H 1GJ6A 1V2NT 2Q1JA 1G32B 3GY5A 3TH3H 2AYWA 2ZGCA 1AUJA 3GCOA 5DP5A 1GHYH 3ENSB 2RCEA 2SGDE 1C2DA 3KQBA 1FQ3A 2NU2E 1DSTA 3M5NA 1QRWA 1V2RT 3AAUA 1YPKH 1ZRBA 4FU9A 3VB4A 4AC9A 1DY9A 1ACBE 1B5GH 1DWEH 2FXRA 1BMLA 2P16A 3VGCB 5HM9A 3OY6U 1KLJH 3QK1A 4I8KA 1DM4B 4CBOA 5C1YA 3RM2H 1MTNB 2ODPA 4FETA 3SJ8A 1BCUH 1UTNA 3B8JA 2XBWA 2Q6DA 1VCQA 4WJG2 2O9QA 1BJUA 1BTXA 1ETTH 1TPPA 1YPEH 3PLKA 3L33A 1NFUA 3RXVA 5A0AE 3BV9B 1B7XB 4DIIH 2BX4A 1Y5BT 1GJAB 2XBXA 1NRQH 4NCYA 4DT4A 1ANCA 1ETSH 1GHBF 2ZGXH 1GCTC 1OSSA 3PMBB 2O8LA 2PSYA 3SJKA 2FTMA 4I7YH 1KXBA 1WAYB 4Y8ZA 2BZAA 1EB1H 4F4OC 2QF5A 4XOJA 1KSNA 4X6NA 1T7CA 4D8NA 3KYFA 2F43B 1O2OA 3P8FA 4NG9H 1JIMA 3EQ0H 1YLNA 1SQTA 1O32A 2O8UA 4NA7A 2ZFQH 2OUAA 1O2IA 1SBWA 2ZG0H 3F9FA 1P57B 1MQ6A 3U28C 2BD8A 2XW9A 4NIXA 3KNXA 4H6TA 1K1MA 4CBNA 3OAAD 4ABBA 1G30B 3VG8A 2KR7A 1DOJA 1SG8B 1A61H 1S6FA 2XC0A 4WWYA 3BTWE 4I31A 2WV5A 3EE0B 3LGVA 5C67A 1O2MA 4NZLA 4ZCNA 4X6MA 4OS2A 1JOUB 3F0OA 2P93A 3RXKA 3RXEA 1VJAU 1LVBA 2FOAA 2BOKA 5LPEA 1OOKB 1XX9A 1A3BH 1L1NA 4YO9A 3KHVA 3ZVFA 1MTUA 1SGFG 1O35A 2PV9B 2XOKD 4WMEA 2R2MB 3UPEA 1LTOA 1ABIH 2Y80A 1AKSB 3V13A 1V2LT 1LPZB 3TGIE 1XXDA 1IQEA 2C90B 4CRCA 3RU4E 4DCDA 2CF9H 3ZZ6A 1HAOH 5KECA 1BMAA 2P94A 3SUFA 1MH0A 3DFJA 3M61U 1NRSH 3UOPA 5C5NA 1P2KA 3H7OA 1MTWA 3PM3A 2QXJA 4AFUA 1DUAA 2VIVA 1LHEH 1HAIH 4Y7AA 2VIPA 1QB1A 4AFZA 3H09A 3A8CA 3A89A 1C5XB 2QA9E 3JZ2B 1ELVA 1YYY1 3PWBA 2AMQA 1Y59T 2EEKA 2BD5A 1FX0B 4BAQB 1KMHB 3SZEA 1OWHA 3E90B 1AU8A 1MTSA 3BTDE 2AIPA 3CS7A 2LNCA 1UMAH 1GHZA 2GVFA 1Q31A 1RXPA 1J15A 5EJ1A 2JH0D 2Z3DA 3F9GA 1PYTC 4MLFB 2CGAA 4NWKA 3RXUA 1T4VH 1O30A 2VJ1A 3GISB 4CRBA 2D1JA 3BG8A 3MU0A 1F0RA 1OYQA 1MMJN 4CRAA 2Z9GA 1QL7A 1O3LA 2FDAA 1H9IE 1O5CB 3BIVH 1HAZB 1EPTB 4TT3D 5IK2D 6LPRA 1K1PA 1O2PA 2A4RA 5F03A 1VITH 4Y8YA 3MU4A 2J34A 1GG6B 2H6MA 1AB9B 1C5QA 1D9IA 2ZPRA 3KIDU 1G36A 2C8ZB 3GDUA 3TGJE 4NFEA 1NFYA 9LPRA 3HATH 1C2FA 1SB1H 4YOIA 2BXUH 2K1QA 2ALVA 1AD8H 5E8EH 3S0NA 2ANMH 4RKJB 3ODFA 1EZSC 1SC8U 3FAOA 1O5DH 2OQUA 2Z3CA 2ZDMA 3N7DA 1O3AA 2JH6D 1IQHA 1C5LH 2FM2A 1Y5AT 2A5KA 2AGIX 2ZWLH 1UCYK 2FODA 2GZ9A 2FP7B 3QUMP 2JH5D 4QT8C 4DOQA 2PFEA 1VKYA 2ANYA 2GMTC 5E2PA 4LK4A 4WH6A 2LPRA 1QRXA 2FX4A 1ZOMA 2CF8H 1LVOA 4O3TA 4RI0A 8ESTE 1A0LA 1S84A 1C2GA 1XVOA 4Q80A 3UTUH 1TLDA 1AZ8A 1LVYA 2PUXB 3GCTF 1NM6A 4UFGH 5EJZA 3QZQA 1THSH 4Y71A 1A2CH 1JBUH 3KYGA 4YLQH 1H8ED 1A5IA 1BTHH 1EXFA 2ZFSA 2J4IA 3U1JB 2HNTF 3SU3A 1A4WH 4TY6A 4XFQA 4MPWA 2A4OA 2YMSB 3TH2H 1J14A 3N7OA 5F53A 4BAKB 1GHWH 2ZTZA 3BTQE 1NRRH 2Y82A 1LQDB 2GV7A 1DS2E 5GCHG 1GHXH 2BYAX 4TYDA 4X1PU 2FO9A 3T25A 2A7HA 1F5KU 2P3TB 3M3VA 2ZTXA 1AKSA 4XBBA 2BY7X 1UJ1A 2UWLA 3QX5H 1PYTD 2GP9B 1P12E 1FAKH 2G8TA 2I6SA 3PYHA 4BNRA 4E06H 2YOLA 3M5MA 4IBLH 4IW4E 1B0EA 3F2HA 3GDSA 4VGCC 4A92A 2Z9LA 1E35B 1L4DA 1OHHD 3P8GA 4FOUC 4Z1MD 5EXMA 1CHGA 4MPUA 1LKAA 2ZKSA 3A83A 4ZH8A 2SGPE 2DUCA 3BF6H 2AEIH 5JYIA 1SGFA 2VGCB 4BAOB 4CHAB 2OTVA 1N6YA 1SQRA 2K8IA 3OYPA 2XNDD 4AG2A 3OTPA 2F91A 2KM0A 3U98H 3QLPH 1UK4A 3D23A 1ANDA 3MO3A 3RM0H 2VBCA 4YZUA 2ZGBH 1ANBA 2R0KA 4JYUH 1S6HA 5EU8A 5JBAS 3Q3KA 2ZDAH 2ANWA 5GIBA 3SI3H 2AMPA 5GWZA 1IQMA 1W0JD 3ATMA 2F4LA 4Z0KA 1ZTKA 1GDNA 2FS8A 1A0HB 1PJPA 1O3CA 4YOGA 2STBE 4INKA 3BTTE 1D4PB 3K9XB 1EATA 2W3KA 3NCLA 3VB3A 4YT7H 1S0RA 4E7NA 2WUBA 2V35A 4JK5A 2XC5A 4X8UH 1V2QT 1FIWA 1UVOA 2ZU5A 4H42U 1MAXA 1TX7A 4X8TH 2UUJB 4YESB 4FUIA 1UTQA 2PKSC 1IOEA 7KMEH 3RXHA 1LQEA 5DP3A 1GJ9B 3WWFA 5FPYA 3SJIA 1C2HA 4RSPA 2A0QB 2QC2A 2F83A 2NU0E 3FZDA 1CT4E 1K1OA 1TBRH 1GHBG 1O2TA 1GWAA 1SPJA 1QBOA 1A1RA 1Z1JA 3EE7A 1TPSA 3GCHB 3HGNA 1C1TA 2HGTH 2A5IA 2STAE 2BQWB 3PTBA 4MVNA 1O38A 5HGGA 1GI1A 3GS9A 1GJ5H 1K9OE 1AFQB 3CNRA 2FX6A 4K3JA 5T1VA 3VEQB 1FY3A 4O9VA 1SGEE 4ISIH 3ZZ7A 3E8LA 1ELDE 4H4FA 5L6NH 1C4U2 1Z6EA 3BSQA 1EP6A 1N8OC 1L1JA 1SQAA 1FMGA 1GI8B 2FS9A 3S9BA 1TGTA 5C0UA 1TA2A 2J95A 2W6ID 3EA7A 3KN2A 2QV1A 1HDTH 2G5VA 2GT7A 4B2AA 4CH8B 5JB8S 1TNGA 1XKBC 1KXAA 2JJ2D 5T6FA 5TJXA 5HMAA 1HIAB 5KGOA 1YKTA 2VU8E 3DSGA 3PLPA 4WXVA 2WYGA 3NKKA 3U69H 2WPHS 2BDHA 1AVWA 1H9HE 3PV2A 2GT8A 3A7WA 3BTHE 1LCYA 2WHXA 1GHAF 2SGFE 3UNQA 2VIQA 3OU0A 4FU8A 1GGDC 2ZPSA 4LOYH 5ETXA 5C5OA 2G00A 1D6RA 4X8SH 4LZ1H 4B6FA 1QZ8A 1GI0A 4FXGH 3QDZB 3LT3A 4X1NU 1M9UA 2BMGB 4GSOA 1T8OA 3LPRA 1AO5A 5I46H 4ZROA 2CHAC 5EPYA 4Q7YA 2RDLA 4GPGA 3SV6A 1O2LA 4OS7A 3FO8D 2HRVA 1AUTC 2ZU3A 5GPIB 3TJUA 4AORA 3KEEA 3QZRA 4F55A 1OX1A 4MNVA 2QF4A 1Y3XA 2Y81A 1H4WA 1SGNE 2BD7A 2KCPA 2V6NA 1P2JA 5C3NA 3PV4A 1W14U 5G4BA 3P8NA 4ABEA 1LHGH 1AGJA 1SOTA 1EAWA 1YPGH 2V3HH 3SV8A 1IHTH 1S5SA 1TBQH 2TGAA 1MU8B 1EQ9A 5FPSA 4IGDA 1AIXH 2XWBI 5GNDA 3SYJA 1C5YB 1C1PA 1V2KT 1OKXA 4B73A 3ZZ9A 5AHGH 2ZFTA 2HVYB 2EY4C 2HLCA 5FPTA 5K0HA 2BX3A 3F2GA 3TLOA 1ELFA 1IQGA 1YCPM 3MTYA 1CA8B 1LHDH 2B7DH 1CVWH 4MNWA 1WTHD 1BBRH 4ISNA 1EAXA 1HNEE 4THNH 1D3DB 1KXCA 2P8OB 3SUGA 1L4ZA 3LONA 3U9AH 5EW2H 2JJ1D 5BPEA 1TWXB 1QGFA 2GCTB 3SU4A 3OEHD 3AAVA 1SR5C 2R9PA 3HGPA 5PTPA 3RXOA 1DUEA 5GJ4B 2HWLB 1O5GH 1PPCE 3BTEE 1F5LA 4Y0YE 4HG6A 1UHBB 4XSKU 2WPJS 1SGPE 3CENA 3VFEA 3WW7A 3TNSA 5DP8A 4MQAA 4AOQA 8KME2 5L2ZH 1VGCB 1CO7E 1XUGA 5C17A 1K28D 1TPOA 4K5ZA 1FI8A 1Z8IB 4P00A 2A2XH 1C5WB 2GD4B 2GTBA 3BG4C 1J9CH 5DGJA 1AQ7A 2ZDVH 1O2HA 4Q7XA 1WBGB 4NFFA 4IMZA 1YPHC 2O8TA 2TBSA 4D7GA 1UCYE 1WTGH 5F6MA 1UK3A 1AWHB 4O3UA 2O8MA 3MH4A 1XUKA 1GCDA 1MKXH 1C9TA 5IYTA 2BVRH 3GCTG 2J5UA 5A09A 2W7UA 5DO4H 2P3UB 3F6UH 4X0WU 1HXFH 3C27B 1C4V2 3D49H 4JZDH 1HIAA 5DJ7A 1W2KH 2ZEBA 2RA3A 3RXFA 3ZZDA 3U1IB 1GI2A 1THRH 4GLYA 5HIZA 1SHYA 1C5RA 2K0QA 2M2AA 5H4IB 4AGKA 4BXSA 2ZHWH 1C5PA 2QIQA 2R3YA 4IS5A 2BDGA 4CR5A 1HLTH 1UW7A 2M5TA 1CSOE 3GICB 1CBWB 1TONA 4BTUB 2ZGHA 8GCHG 1TX6A 1QB9A 4FUCA 4LZ4B 4A1VA 3LJJA 4AFQA 1C5ZB 5F8XA 2VH0A 1P09A 5LGOA 4M7GA 2JETB 3MNBA 1DITH 4MG3A 2ZNKH 2TPIZ 2ANKH 4DY7B 3PV5A 2OD3B 3A7YA 3GDVA 1EZXC 1XUJA 3R0FA 1O34A 4I33A 2AGEX 5DK1A 3CS0A 2V7QD 3NRLA 4I8HA 1HAVA 4AZ2B 2ILNA 3Q3YA 2ODQA 4ACAA 1ZLRA 4X2XA 5L2YH 3RXMA 3QGJA 4CR9A 3F9EA 4O97A 1ZYOA 2ZHEH 2Z9JA 1UK2A 1HUTH 1SFQB 1PPGE 1RRKA 1P9UA 1TOCB 2FI4E 1RJXB 4ABIA 5F8TA 2AERH 1BTYA 2J98B 3RP2A 2FOEA 4UEHH 3QTOH 3T26A 1O2JA 5A8XA 3T62A 3PB1E 3F9HA 3M3TA 3SJ9A 1YP9A 2EI7A 1RIWB 1YBWA 1T8MA 1G3DA 1N6XA 4SGBE 4Y7BA 1HJAC 2B9LA 2OLGA 1GHVH 3ATIA 1SLVB 4GHQA 2I6QA 2W7SA 2BHGA 4NA8A 1KLIH 2ALPA 3M35A 1J16A 2B5TB 1NFXA 2BQ7B 2F3CE 1XUFA 5F8ZA 1HAYB 2J2UA 1PQ5A 3MI4A 1MQ5A 2DE9A 1O2ZA 2IJD1 2JIZD 2QXGA 3UOUA 5CDFE 1T8LA 3MWIU 2FWWA 1CA0C 3P95A 1DXWA 2BDYA 2XC4A 1TNIA 3F1SB 1P8VC 1Z6JH 1O5BB 4BAMB 1HB0B 1O3DA 1SOZA 4DW2U 1P2MA 3SNDA 1ZSJA 1QA7A 2ASUB 5EXNA 4D9RA 4JCNA 1OPHB 1KLTA 3D65E 3E0PB 3FZZA 4X6PA 4FUGA 4NSYA 3SN8A 2A4GA 5T6GA 3UR9A 1O3FA 1O3GA 2GX4A 5E0GA 3S7HB 3PO1C 1O5EH 1MD7A 1SLUB 4ZXYH 3SNEA 4U2WA 2IOTA 3S7KB 1Z71A 3TK9A 1V2MT 1G9IE 4YT6H 3ZV9A 3RXCA 3ZVEA 1QB6A 4WXIA 1JIRA 3ATWA 5T3HA 1BBRK 1O5FH 1WQVH 2QF0A 1MD8A 5FX6A 3ZZ4A 2J94A 4AGJA 7ESTE 4FUJA 1CT0E 3MU8A 3H7TA 4NSVA 4BTTB 1V2ST 2G81E 1GVZA 1UVSH 3SOSA 2TGTA 3P8OA 1P01A 2BXTH 2EI6A 1AVXA 2EC9H 1BUIA 2OINA 1OYTH 3DSPA 5CE1A 4DIHH 1K1JA 4NIYA 1KDQB 3MMGA 1PQ7A 1O3PB 1GHAG 1TMBH 3VGCC 3W1EA 1FN8A 1TMUH 4BANB 2HNTC 1MTNC 3K6YA 4ZMAH 3SU5A 1YC0A 4B2CA 3T5FH 1C1RA 2BB4A 3LC5A 3FOAA 1YPLH 2ODYB 4X1SU 5DKMA 1BTZA 1ZTLA 1ELGA 2ZI2H 1NO9H 1A3EH 2QGRA 1W7GH 2SGEE 2GV6A 3DHKH 1LHCH 2Q6GA 2HALA 2ESTE 1C2JA 1MKXK
chains in the Genus database with same CATH topology
1ZGVA 1Y3UA 3TPIZ 1O3NA 2TRMA 4UFEH 4RKOB 4ZKOU 4NWLA 3TIUA 3BTKE 3SNBA 3Q3XA 1P2OA 2SFAA 1PPEE 2DE8A 2HOBA 4ABGA 3PMAB 6ESTA 3UREA 2RG3A 4HI3A 5CMXH 3ZVGA 2A32A 3RXRA 1C1MA 3RMOH 1DX5M 1C2KA 2UUFB 2PW8H 1C9PA 1QRZA 1V6DA 1QR3E 1GI7B 2XXLA 1TIOA 2TGPZ 1GMDF 5EQRA 4GUXA 1THPB 3IG6B 5CHAB 1N1LA 1AWFH 1YLCA 2Y7XA 3TITA 4TWYA 1BRCE 1GJ7B 3VXEH 6GCHF 1RD3B 2ZZUH 1ARBA 3HKIB 1L0ZA 3GYLB 2FI5E 2XYAA 5FCKA 2VNTA 1GBEA 3RXSA 1UVPA 3RXDA 2NWNA 2HPQH 1QBVH 1YPMH 5TCAA 5JDUB 4AYYB 8GCHF 4K1TA 4UD9H 1LO6A 3AVZA 4ZKRU 4ABJA 4JZEH 5A8YA 1FZZA 2GKVE 3LIWA 1H8DH 1P2QA 3UFAA 3VB7A 5JPMH 3ESTA 3SW2B 1VR1H 1C2LA 3T27A 4IC5A 2ZIQH 3HK3B 1BDAA 1TGNA 2Y6TA 3BEUA 1W8BH 3K65B 1G2LA 3BTFE 1GI5A 2TGDA 2ZC9H 2XNIA 1GMCF 1XXFA 2BLQA 1SGQE 2C8WB 4HGCA 3LU9B 1ELEE 5EODA 1P05A 4TPYA 1O3OA 1KYNA 2OC1A 1SQOA 4JYVH 3T28A 1ID5H 3PROA 4JYTA 1P0SH 2A4QA 2BD9A 1OWDA 1GBBA 2WV4A 2FESH 2B8OH 4UFDH 3UWIA 1QFKH 1WCZA 1G3BA 1O3IA 4IMQA 2ZA5A 2BLVA 2G5NA 3EAJA 3W94A 1NFWA 1FPHH 4ZKSU 3VB6A 4LXBH 3HPTB 5C20A 2A5AA 4FUDA 1EPTA 1LHFH 3ZVBA 1PQAA 3SNAA 4BXWA 1BRAA 4WF8A 1GBKA 4F49A 2C3SA 1P3CA 1QHRB 2PTNA 3DFLA 1NN6A 3ZVDA 1EPTC 5HXFA 3M36A 3NWUA 3AASA 2IJOB 4NIWA 1ANEA 2QAAA 3Q77A 4ZUHA 1GG6C 4X1RU 5A8ZA 1AB9C 1LPGB 1JRSA 2BY8X 2WPMS 3UY9A 1C4Y2 4ASHA 1ESAA 1ZPZA 1TFXA 2WPIS 3W95A 2EA3A 2OC0A 1SLXB 2A2QH 1K21H 2AFQB 3SHCH 1MAYA 2XRCA 2BY9X 1CT2E 4FU7A 3ODDA 2OQ5A 2ZHFH 3M5LA 4GCHF 4Q2KA 4ZAEA 2ZDKA 3LJOA 4X2VA 4DURA 1QJ1B 5BRRE 1SGTA 2XCFA 3GYMA 1GJCB 1K1LA 2ZTYA 2KAIB 1E0FD 1JRTA 4KGAA 1TE0A 1BTWA 4NZQA 4X8VH 2Z3EA 4UFFH 2Z9IA 3OY5U 3TJVA 2A7JA 1QQUA 2OP9A 3JZ1B 1KXDA 2GZ7A 2ZHQH 2HPPH 3OTJE 4XE4A 1BTPA 2QY0B 2QXIA 3VXFH 4KTUA 1Y3WA 3RXGA 1W11U 4FUEA 1OWIA 1ZTJA 1DLKB 1WU1A 1AE5A 2G4TA 3MFJA 2QN5T 1G37A 4JZIA 4XBCA 5FCRA 2CN0H 1BB0B 2ZCLP 4JZFH 3ZVAA 4TPIZ 6CHAB 1TQ7B 1XM1A 1CGHA 1OS8A 3LGUA 2F9VA 1O2YA 4K60A 4TY7A 3A84A 1LVMA 4K1EA 3RXPA 1FNIA 1RTLA 1ETRH 2CV3A 3MH6A 3P92A 2FOBA 4YTAA 1AVGH 3ZZAA 3A7XA 1C2IA 1RFNA 1S81A 4R0IA 3NXPA 1GJ4H 2VGCC 4CHAC 1C1UH 1O3JA 5E2OA 1DDJA 1EJAA 1PFXC 4MPVA 1SGYE 1HV7A 2G4UA 2VWLA 4BTIB 3M3SA 3GY7A 4ABAA 3ITIA 1VITF 3ATKA 3F68H 4MNXA 4UDWH 1TNHA 5DP4A 3SU2A 1W0ZU 1BBRE 2ZECA 1AI8H 1GL0E 1Q2WA 3A81A 3SGBE 2NU3E 1F0TA 2VVUA 3RLYH 1Q3XA 5C2ZA 3FANA 3RU4D 1IQNA 4ZHLU 4K1SA 3M7UA 1ZMNA 4A5TS 1O3MA 4FUBA 1TQ0B 1Z1IA 3A82A 1QBNA 2F9BH 4X2YA 5AFZH 3T29A 4HFPB 1V2UT 4OS1A 1C1VH 1LKBA 3I77A 1GBLA 1TNJA 2F9NA 4XDEA 1GCTB 4Z6AH 1TABE 1BA8B 2CMYA 5J4SA 1TAWA 1F2SE 1SI5H 3BEIB 1C5TA 1DT2A 1TGSZ 1UVUH 4INLA 4ZKNU 3PMJA 1MTVA 1BRBE 1KXFA 1PPZA 4Y11E 4ABDA 3KQEA 1UTMA 3UQVA 3SV7A 2AMDA 1O2UA 3AW1A 2C8YB 2KAIA 2QXHA 3VPKA 3EYDA 1ZR0A 3E16B 1OXGA 1GBHA 3PMHB 4X6OA 4D7FA 1MKWH 1ZRKA 2R0LA 1SGRE 1V2PT 4MDSA 1W10U 3V3MA 4FVDA 3EDXB 1RS0A 4AN7A 1F5RA 5K7RA 1AMHA 4AYVB 3GCHC 4ISLA 2BY5X 1AFQC 1XMNB 1C5VA 5FBIA 4JMYA 1SMFE 1NY22 4K8BA 5AF9H 1C1SA 4KKDA 1GMDG 2Z6BD 2YNAA 1BJVA 3NK8A 2BZ6H 2ZFFH 3E0NB 1F92A 4U01A 1ZMJA 1E34B 3FVFB 1P3EA 5EW1H 1V3XA 3MNSA 3A87A 4UONA 3QWCH 4SGAE 6GCHG 3ZZCA 5IDKA 1O2RA 1FAXA 1HRTH 4U30A 3ELAH 1C5OH 5SGAE 2VIOA 1ELTA 3KGPA 1W0YH 2H9EH 1DSUA 2PWXA 1PQ8A 3DT0H 3SHAH 3BTGE 5AVDA 3TJOA 5DP6A 1ORFA 3ZVCA 1Z8JB 1PPFE 2SGAA 5EG4A 2VH6A 1BT7A 1UCYH 3GY3A 4WH8A 5FHTA 1DXPA 3SQHE 3EA8A 1AN1E 1ZJKA 4DGJA 1O37A 1MBMA 3P6ZB 1IQIA 3SU6A 1E36B 1FY4A 3HK6B 2ZGJA 1GDUA 1NT1A 3RXTA 1FDPA 3O8BA 4PROA 3GOVB 1XVMA 1V2VT 1LPKB 3RC6A 1FUJA 2Z9KA 3UR6A 1GMCG 3STIA 2BM2A 2WUCA 4B74A 1JXPA 2AIQA 1PPBH 2IN2A 3S9AA 1O31A 1NRNH 1SGDE 5LH8A 1F7ZA 2THFB 5ESBA 1Y5UT 3M7QA 1Y3VA 1DY8A 1FJSA 1GI9B 1TB6H 3LGYA 1FN6A 5C1XA 2XCNA 3NPSA 4RN6A 3U8TH 1BIOA 3SUEA 2PLXA 1FIZA 2W3IA 2Y5HA 1BMMH 1SGCA 2PKAB 1V2WT 1V2OT 4HTCH 1BMNH 2XBYA 2SGQE 1NU9A 1DWCH 2JKHA 5GDSH 1O2VA 4ISHH 3D62A 1TA6A 2PUQH 3SJOA 5JBCS 3LC3A 3RXAA 2P95A 1C5SA 4Y8XA 3SNCA 1EUFA 4OS4A 3STJA 1SFIA 4B76A 1ESTA 2FYQA 1CGIE 1C2EA 2P8OC 2ZFPH 3M5OA 4WMDA 1MBQA 3LOXA 1GBFA 1UHBA 3E1XB 5B6OA 1D3TB 3NZIA 1A7SA 2GCTC 1QURH 5EOKA 2GMTB 1GVKB 2G55A 1WQSA 2Q6FA 3EA9A 2FZZA 1DLEA 1OP0A 1YCPH 4AB9A 2O8WA 1S82A 1VGCC 2Z7FE 4KTCA 3RXQA 5FAHA 1DVAH 3RMMH 2J38A 1HFDA 3ZZ3A 1A46H 1FONA 1CE5A 2BTCE 3FP8E 1KTSB 1G3EA 4X2WA 4GCHG 1Z8RA 1O3EA 4ZHAA 1S85A 4B71A 1OWJA 1XKAC 4GHTA 1VCPA 1O39A 1ELAA 2FOMB 1EOJA 1Z7KA 1YF4A 3M37A 3ZZ5A 3A80A 3H5CB 4I8GA 1U6QA 2BDIA 1KIGH 1T4UH 2VIDA 1TOMH 5JB9S 2ZCKP 3CP7A 2ZPQA 1DICA 5DPAA 1TALA 2Y5FA 2XBVA 2GCHF 5DP9A 2BLWA 3MNCA 7GCHF 2F9OA 4K8YA 1TRYA 1TGBA 1ZZZA 1CHOF 1QJ7B 4DVAU 1H9LB 4D9QA 2VIWA 3SBKA 4E05H 4VGCB 1UVTH 1LDTT 4UE7H 5EQQA 3U8RH 1HJ9A 4I8JA 1FV9A 5HM2A 3UUZA 1TRNA 2ULLA 1O2XA 1CBWC 1FPCH 1TPAE 1HAGE 1FY1A 4BOHA 4WMFA 5A2MH 4Q7ZA 5LPFA 3RDZA 2FIRH 3OX7U 2JETC 1HAHH 2QCYA 3K6ZA 3A7ZA 3TVJB 3E3TA 2H9HA 1WOFA 3TNTA 3WY8A 3SV2H 7LPRA 1SHHB 2GDDA 1MKWK 1P2NA 2B0FA 5E0HA 1DE7H 3UIRA 3A86A 1QNJA 4B2BA 1J8AA 2FOCA 1W3CA 3MH5A 1GVLA 1AFEH 1ZMLA 3K2UA 3SV9A 1NC6A 2BQ6B 1HJ8A 4D76A 3A7VA 3TH4H 2D8WA 1P2IA 8LPRA 1V2JT 2PKAA 2BD3A 1GJDB 3KCGH 4Y0ZE 1UTJA 1O2SA 3TU7H 5A0BA 1SVPA 3RXJA 5J4QA 3UNRA 4Y76A 1C1OA 4ZHMU 2PGQB 4YLUA 1BOQA 2D2DA 2P3FH 1GBMA 1ZHPA 1VITG 4Y79A 3MO6A 2Y5GA 1HYLA 1EJNA 4KTSA 4DT7B 2AH4X 3QO6A 1F0SA 4ISOA 1ESBA 1GI6A 3A8AA 1RIWC 3U8OH 1XUHA 1MU6B 2NU1E 1EB2A 1BQYA 1W13U 2PKSB 1GL1A 3S69A 1C1QA 2OBOA 1S83A 3MHWU 4IC6A 4FUFA 1S0QA 2PSXA 2ZQ1A 1O2QA 3E6PH 1WUNH 2BDAA 4AG1A 2G52A 2WYJA 1H8IH 3KQCA 3SGQE 1E37B 1JMOH 4KELA 2IPHA 1O3KA 4OGYA 2V3OH 1DWDH 2OBQA 4OS6A 1UTLM 1GMHG 2VWNA 4OS5A 4I32A 1NTPA 1IHSH 3S9CA 4CRGA 1C2MA 1FLEE 5JBTA 2CXVA 2FOHA 3RXBA 4A6LA 3LGTA 1B0FA 2G51A 4AB8A 2A45B 5ESTE 3AW0A 3IWMA 3ZZ8A 5FXLA 4CRFA 1KTTB 1N8OB 1P03A 1FXYA 2J9NA 3SU1A 4Y6DA 1QTFA 3GY2A 1SGIB 1K1NA 1INCA 4AFSA 1EJMA 1P10A 1UTPA 2ZHDA 3OSYA 4NGAH 5T6DA 5LPRA 1IAUA 3P17H 1RGQA 2H5CA 3LH1A 1YLDA 1ZGIA 4O03A 1JWTA 1BZXE 1EAIA 2FOFA 1HCGA 1L1GA 3MOCA 3VB5A 1EP5A 3TK6A 1VZQH 3O8DA 1P06A 2C4FH 3GY8A 4CRDA 2RA0A 1O2GH 4CH2B 1FY8E 2F9UA 2FEQH 1FY5A 2NU4E 1BTUA 1EOLA 2BDBA 2V0BA 4IN2A 2AS9A 1QY6A 2FPZA 1T32A 3GY6A 1KXEA 1MUEB 3L6PA 1W12U 1GBIA 1GGDB 1ZHMA 1IQFA 2OC8A 1P02A 2GDEH 3KQDA 3GY4A 4K2YA 1KDQA 1MCTA 2H2ZA 3BTME 2HVXA 1SL3A 3RUOA 2CHAB 2Y7ZA 1O36A 1BHXB 1YPHE 3MNXA 2OC7A 1KY9A 1ZPBA 2GZ8A 4K69A 1K1IA 4YM9A 1H1BA 1P9SA 1MCVA 1SSXA 3MH7A 1YCPK 5C1UA 2VB0A 5AFYH 3FP6E 3ZYEA 3M7TA 3RU4T 1OWKA 1UTOA 2UUYA 1O0DH 1T8NA 2PHBA 4X1QU 2FOGA 4GVUA 4ESTE 2BOHB 2OXSA 3RC5A 1GBTA 3O8CA 1F0UA 1GBDA 1O2KA 5EQSA 1AY6H 3R3GB 3QGNB 1A0JA 5TCCA 1NZQH 2TIOA 1VJ9U 1DFPA 4ZXXH 1Y3YA 3I29A 1MZAA 1ABJH 4NIVA 2BLOA 1D6WA 1WSSH 1NRPH 3E91A 3DA9B 1TRMA 1HPGA 3HKJB 3QN7A 2ZF0H 3TK5A 2BVSH 3SORA 4CREA 1EZQA 1TX8A 2Z94A 3URCA 1TGCA 1X7AC 5CHAC 1UTKA 1BITA 2FI3E 3URDA 1AZZA 2C93B 3A88A 1L2EA 1OP2A 1TBZH 1CQQA 2BD2A 1ZPCA 3DD2H 1G3CA 2SNVA 4INHA 5DP7A 5A0CA 3SI4H 3BG4B 1EX3A 5JBBS 1LMWB 1RTKA 3ZV8A 1QQ4A 1O2NA 2PR3A 3T2NA 2W5EA 2ZDNA 1T31A 4I8LA 2ZCHP 1GPZA 2UUKB 1YPJH 4A1TA 3ATLA 1DPOA 2BY6X 3ZZBA 4R8TB 1C1NA 2A1DB 1D3PB 1ZJDA 5GXPA 5HYOA 4ABHA 3MYWA 1YGCH 4HZHA 2PTCE 2AGGX 1WYKA 1EASA 3PWCA 1ELBA 2VWMA 1QA0A 1DANH 4WY3A 5E0JA 3V12A 2R2WU 1Z8GA 2J92A 2A31A 3PLBA 3L3TA 3ZYDA 4H6SB 3A7TA 3B9FH 2QF3A 1GJ8B 1V2TT 5EXLA 1GJBB 2VVVA 1ELCA 3V0XA 2YNBA 5ABWA 3Q00A 1HGTH 3B23B 1HXEH 3KF2A 1ARCA 1O3HA 1RTFB 2FTLE 1TNKA 3SGAE 1ZSLA 4A1XA 1OP8A 2GCHG 4IN1A 4NA9H 1IQLA 1GBJA 2VWOA 3TJNA 1EAUA 1QL8A 5FX5A 3P70B 7GCHG 3V7TA 4A7IB 2PGBB 3RXIA 1GI4A 4AX9H 1HAXB 1CHOG 1SLWB 4Y10E 1K2I1 2H1UA 1NS3A 4B75A 1QCPA 2GGVB 2ZFRH 4J1YA 3NUMA 1PPHE 2ZDLA 3LDXH 4B1TA 2P59A 3IITA 3LKWA 4DG4A 1NU7B 3BN9A 2BD4A 2H5DA 3SU0A 1P04A 3MU1A 4ABFA 4YOJA 2BDCA 1HAVB 2VINA 4MTBA 2FLBH 5L30H 1QJ6B 2FLRH 4GAWA 1WV7H 1GMHF 3MO9A 3LH3A 2OCVB 3A85A 1TNLA 4JZ1A 1C5NH 2ZU4A 1EKBB 2A7CA 3FFGA 1E38B 3O8RA 3A8BA 5EPNA 1MZDA 1ZSKA 2ZO3H 4JK6A 4WVPE 5FBEA 3RXLA 1HJAB 1ZHRA 1YM0A 3C1KA 2W26A 2UWPA