4OS6A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk604 (bicyclic 2)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os6A01
2ZHDA 3MOCA 1O38A 1V2ST 1TRNA 1FIZA 1O2WA 1P01A 4TPYA 5B6OA 1NESE 5JBAS 4BXSA 1SLUB 3LU9B 1QRWA 5DP7A 3QK1A 1GHYH 1NRNH 3SOSA 1SVPA 1BDAA 1O3FA 1GBMA 3QUMP 4FVBA 3BTKE 1PPHE 1SGRE 3ZVGA 5GIBA 3QZRA 1IQLA 3TJNA 2PKAB 1O35A 4CHAB 1GMHF 1JWTA 1EP6A 4XFQA 2NU2E 5A8ZA 3QO6A 1L2EA 4MDSA 3VGCB 1HAXB 1GMCF 4NG9H 4BOHA 1O2HA 2ZPSA 1GJAB 3LGWA 3OX7U 5FCKA 2RCEA 2WUCA 1T8NA 2H5CA 4NA7A 1S0RA 2Q6FA 2FZZA 1LHGH 2GMTB 3GCTG 2TGAA 1OX1A 1O2MA 3PROA 1TNLA 2VIWA 1ZOMA 1AWFH 4RKOB 2OINA 2ODQA 3GISB 3NPSA 4O3TA 1GCDA 1YYY1 5C2ZA 1GHWH 1C2IA 2BZAA 2HNTE 3ZZCA 1D4PB 1P2NA 2OTVA 5FBEA 1UHBB 1BMAA 2IOTA 2SNWA 1ARCA 1ZPBA 5TJXA 1O2RA 4CBNA 1OWDA 3BTDE 2QA9E 3HGNA 5AFZH 1OP8A 1W0ZU 1ZSKA 1TAWA 3BTME 3HK3B 4K5ZA 4IC5A 1SGEE 3LC5A 4DJZB 1Z8JB 2A5IA 4ESTE 3AW1A 4AX9H 5F8XA 4YESB 5HMAA 2BDHA 1HAOH 2XBVA 3MH7A 4X8VH 1OWEA 3GY6A 1L0ZA 4YO9A 1UK3A 1GI4A 3ZZ9A 1YPHC 1QRXA 1O5BB 1GPZA 1Y59T 1THRH 1BMLA 1QURH 1O3AA 2QXHA 3RXHA 2AMQA 3NUMA 1ZTJA 4AYYB 1C1WH 3SV7A 4I7YH 1PJPA 4YT6H 4E06H 1P2QA 3MNSA 3GY8A 2VVCA 1UVSH 3IG6B 1S6HA 2FOBA 1D6WA 5A8YA 2FEQH 1ZR0A 3KEEA 1PPBH 1NFXA 4Z0KA 2J34A 1DY8A 1V2WT 3SV9A 1K2I1 4GVUA 2FS9A 1S0QA 2ASUB 1LHFH 1SMFE 3MNBA 1OP0A 2P8OC 3FZZA 1DXWA 1C2EA 1UHBA 1YBWA 1SQTA 4K3JA 2OUAA 1GWAA 1YC0A 2G8TA 3EDXB 1B0EA 4NZLA 3U9AH 3ELAH 3PLBA 1ZRBA 1F2SE 1GJ7B 2WYJA 2BY7X 1RRKA 1FIWA 4VGCC 4TWYA 3KQCA 1C9TA 2FTMA 1OSSA 1P12E 3EA8A 3U8TH 1V2UT 4ISOA 3RXGA 2QV1A 1E35B 1V2KT 3SUGA 1Y3VA 3ZZBA 1LVYA 2F9PA 3QX5H 3VGCC 1GI7B 4FUEA 1ZRKA 3KHVA 7GCHG 1SHYA 4Y7AA 2O8WA 1W0YH 1RS0A 1C5WB 2PFEA 7KMEH 5I46H 5EPYA 3QN7A 5BPEA 4IC6A 2HOBA 3OSYA 4AN7A 2FESH 4E05H 3O8BA 3KN2A 1NY22 1MBMA 4GCHG 1BRAA 1MTNB 2NU1E 1AKSA 1KXEA 3A87A 4UE7H 5DP4A 1EPTB 2BD2A 3FP6E 3ZZDA 2P95A 3U8OH 3A8CA 5FHTA 3VB5A 2FYRA 4UEHH 1GBIA 3KQDA 2WPMS 2STAE 4K69A 2QC2A 1SFIA 1V2PT 2UWOA 1UVPA 1EOJA 1O3JA 1C9PA 1EOLA 4TPIZ 1C1MA 5DP6A 1NPMA 1CT4E 1XXFA 2Y5FA 6LPRA 2FDAA 1WOFA 5EXLA 2HNTF 3EGKH 1HJ9A 2Z6BD 1H9IE 3QLPH 3SV6A 1TBRH 1C1UH 1L4ZA 3SHCH 1LHEH 5LGOA 1AQ7A 1FAKH 1O36A 2VWNA 3SV2H 1DDJA 5E0HA 1OYTH 3R3GB 3SZNA 4HZHA 1YPHE 1XUFA 2B8OH 1MAXA 2XBYA 2G55A 4GAWA 2WPIS 3SU0A 1SL3A 3O8RA 1MTSA 1BHXF 1YLDA 3A8DA 3GDSA 2B9LA 1EZSC 3PTBA 4JZFH 4YZUA 2OC0A 1ZTKA 3SNCA 1SSXA 2VIVA 3B8JA 1ETTH 4JZ1A 3MNXA 5DGJA 5JBCS 3DD2H 1TABE 4A6LA 1H4WA 1KYNA 3BF6H 4CH8B 2WPJS 1Y3YA 1AUTC 3VB3A 1BBRE 3KQEA 3U69H 1BTPA 1EXFA 1BT7A 1P9UA 4XBCA 3GDUA 5ABWA 1DWDH 1TFXA 3PMHB 3L33A 3BSQA 1C5ZB 4ISLA 3RXKA 1QJ1B 3SU6A 5T6GA 1S84A 3RXIA 1LPZB 5EPNA 1C5VA 3BEUA 1QL8A 1PPEE 1QB1A 1VCQA 1JIMA 2A0QB 2OQ5A 2D2DA 4DG4A 1GHZA 1SFQB 2BDCA 1GDQA 3UFAA 3UQOA 1W2KH 5F8TA 2P59A 3GY7A 5BRRE 1QQUA 6GCHF 1HJAC 2EI7A 1QL9A 1PQ7A 4WY3A 1AVWA 1E0FD 2A4RA 1O2SA 3D23A 4DY7B 1ZTLA 4D7FA 1EAIA 3C1KA 3M3SA 3HATH 3KL6A 2V6NA 1A5GH 2FLRH 4OS1A 1XMNB 1K1OA 2A31A 2VWOA 4DGJA 2ZCLP 3F1SB 1NRQH 3TLOA 1CT2E 3EA9A 1KXCA 5K7RA 1UCYH 1C5PA 1O5GH 2AFQB 1JXPA 2TBSA 1UTOA 1FN8A 3RXJA 1C2KA 1T8LA 2VVUA 3RXSA 3QGJA 4X0WU 1EJMA 8GCHG 5E0JA 1SGTA 4WMEA 4TYDA 2ZWLH 5A0CA 1DWBH 3GY5A 3TGKE 4NCYA 3FVFB 2Z3EA 2QGRA 1IOEA 2ZPQA 2A7CA 4X6PA 3T27A 1V2RT 4ZXXH 1E38B 1P03A 3MH6A 4BNRA 1O3KA 1UO6A 3FP7E 3MNCA 5L30H 2Z3CA 2XC4A 2FOMB 3ZVCA 4GHTA 4ASHA 1EZXC 1DT2A 1CVWH 1MCTA 1T8MA 2ZPRA 2XBXA 4ZKSU 4F49A 2FOGA 4OS7A 3M5LA 1O33A 2R3UA 4OS6A 1TBZH 1J15A 1RTKA 4Y0ZE 1N1LA 4FXGH 4MPUA 3LGVA 2Z94A 1RXPA 2Z9GA 4AFQA 5EXMA 3Q3YA 2PWXA 1O2NA 3SV8A 1LO6A 3Q00A 3NK8A 6CHAB 1EB1H 1HAHH 5CHAB 2WUBA 2VWLA 4IN2A 1MTWA 1YF4A 3I29A 3P8FA 4FVDA 3PYHA 1MD7A 3HGPA 5EXNA 4I32A 1N6XA 1QBOA 1CA0C 1OWIA 3PWCA 2XXLA 3NCLA 2FTLE 1GMCG 2CHAC 1IHSH 2GV6A 1GL1A 2R9PA 2CV3A 1GI8B 1C1QA 2ZFTA 1O5AB 3A8BA 1L1NA 4X8UH 1C4U2 4I8LA 4Q2KA 4MPVA 1T4UH 1FY5A 3GDVA 4NSYA 4IN1A 2G51A 2ZTYA 4AGKA 1A2CH 2W7UA 4B2CA 1C5UA 4KP0A 1BA8B 4Y71A 2VINA 1N8OC 4HFPB 5T3HA 1K9OE 1ETSH 3C27B 1QHRB 2OC7A 1TPPA 1LHDH 5AF9H 1BRBE 1VITF 1C2JA 2R3YA 4WVPE 3RM0H 1HPGA 1FPCH 3D62A 4WH6A 3LH1A 1BTZA 4BAMB 4I8JA 3UWIA 3UREA 2J2UA 2BY5X 4BAOB 1EB2A 3DUXH 3PB1E 1GGDB 1CHOF 1F5RA 3Q77A 2A7HA 2GCHF 1DXPA 2W3KA 1BQYA 2BDAA 1FY4A 4HTCH 3RC4A 3T26A 2QF3A 2BQ6B 2VGCB 1JRTA 3TK9A 2BHGA 3CS7A 1ACBE 4K1EA 3A84A 2A32A 4B71A 1F7ZA 3B9FH 5EU8A 1MMJN 1IQFA 3GY3A 3TH2H 1XXDA 1TPAE 2C93B 2RA3A 2CF9H 2GDEH 1O5FH 1Y3UA 3F9EA 1ZJDA 1YLCA 2C4FH 2ULLA 3N7OA 1BRCE 1GBAA 3AASA 5A0BA 1GBCA 2GZ9A 3MMGA 1XUKA 1Z8IB 3RXLA 1D9IA 1XKBC 4YOIA 2ZFSA 5H4IB 1XVOA 1O0DH 1GI1A 2ZGCA 2ZHQH 3SBKA 4OS5A 2R0LA 4TY7A 3FAOA 3SU1A 1MKWH 1ZJKA 4AOQA 6CHAC 2HPQH 3LGUA 3SJKA 1C2GA 8LPRA 5EOKA 5EODA 1AZ8A 1UTMA 1ZLRA 1TPOA 2F91A 3A86A 4CRBA 5ESTE 1V3XA 4Q80A 3H5CB 3ZZAA 2XRCA 1EX3A 1F0RA 1T4VH 4NA8A 1SGYE 2JH0D 2ODPA 2HNTC 1O3CA 1SBWA 1P02A 1JOUB 1BMMH 1GI9B 1UTKA 4DW2U 5DP9A 1PQ8A 3RMOH 3MFJA 2STBE 2FODA 1OWJA 2BD8A 1SG8B 3RM2H 3DT0H 2BYAX 2CJIA 2IN2A 1HFDA 1O34A 5JDUB 2XWAA 1ZPCA 1GG6C 1GCTB 1BJVA 5LPEA 4A1TA 4OS4A 2UWPA 1RTFB 1GHAF 3TITA 3QTOH 3T28A 3S7HB 1NZQH 4RKJB 1ELGA 2C8XB 4GSOA 1F92A 2XC5A 4MVNA 4O97A 1V6DA 2YNAA 4ZMAH 1TPSA 4WWYA 1C2MA 2FS8A 3UR6A 4ABEA 5J4SA 4MG3A 2GZ8A 1ZHPA 5JBTA 3IITA 1DUAA 1P09A 3DFLA 1UJ1A 1Q2WA 3P8NA 3BTQE 3OU0A 2ZFRH 1QCPA 1SLVB 3I77A 3A89A 2VNTA 2QXGA 3D65E 1GI2A 2P3TB 4FU8A 2F9OA 4D76A 3PMBB 5E2PA 1OOKB 1MAYA 1QBVH 4VGCB 2TPIZ 3SQEE 4B76A 4ZHAA 4UFGH 1AE5A 1S6FA 3F9HA 1V2LT 3RLWH 4KKDA 1W10U 1O2IA 1QB6A 5ESBA 1C1NA 1JRSA 4H6SB 5FCRA 3URCA 1HAZB 3LIWA 1AZZA 3U1IB 1XVMA 2CGAA 4ZKNU 4FUJA 1SGFA 1TIOA 1UTQA 1AD8H 2VJ1A 1TE0A 2JETB 1TALA 4WH8A 1ZZZA 3LGIA 4X1QU 2Y80A 1W3CA 1NU9A 1GHVH 1BBRH 1ZHMA 1O5EH 2ZG0H 2Q6DA 1DS2E 4YLUA 2K1QA 2XYAA 2PTNA 3Q3KA 6GCHG 3RXAA 1QIXB 1TBQH 4XE4A 2WYGA 4GHQA 2AIPA 4A92A 1P0SH 8ESTE 3PO1C 1K21H 1BTWA 3RDZA 3DFJA 1RFNA 1V2QT 1MZAA 2ZP0H 2F3CE 1BIOA 4INKA 1G3DA 1UK4A 1A7SA 2ZCKP 4FUDA 1ZSLA 3M36A 8KME2 5EW2H 1WSSH 4INHA 1O31A 1GJDB 3IWMA 2AGIX 4KTUA 2G81E 1DE7H 2GX4A 1VR1H 3E6PH 1K1MA 2NWNA 3SNBA 3RXOA 4X2YA 4B2AA 1GCTC 1TNKA 4UDWH 2PKAA 3SNAA 2ZU5A 1HCGA 3BIVH 3BTFE 4ZXYH 1WAYB 3ZVBA 3PM3A 3RC6A 1MU8B 3M5OA 4ABIA 1WTHD 2BX4A 1IQJA 2CF8H 1SGDE 1RTLA 1A0HB 4X2WA 2Y6TA 3RMNH 3TGJE 1AGJA 1O3NA 1YM0A 1BCUH 1RJXB 3E8LA 3VB7A 3BG8A 1EZQA 2J95A 4UONA 3MU1A 2FX4A 4A1VA 1TQ0B 3FP8E 1HAGE 1FI8A 1GHBF 1CO7E 3PMJA 4I8KA 3KQBA 5LPRA 1J16A 5LH8A 4K8BA 1OWHA 2BLVA 2O8MA 1P04A 2HWLB 4YOGA 1W7XH 3MU0A 2OP9A 4ISIH 1VCPA 1RD3B 1TNIA 1CQQA 2GVFA 1FMGA 1HJAB 3BTHE 3HKIB 3UNRA 1TX7A 1FY3A 1FXYA 1FONA 1O2QA 2BVSH 2JETC 2FPZA 1KTSB 1L1JA 1GVZA 1Z6JH 2AGEX 1VGCC 2C3SA 1SB1H 2B7DH 3LH3A 3A83A 1KDQB 5A2MH 1NTPA 2B0FA 2HPPH 2SGFE 4ABAA 3LJJA 2ZDNA 2ZHFH 1Y5UT 2SGAA 4MNXA 3RP2A 3K2UA 2W3IA 2UWLA 4BXWA 1ZGVA 1HIAB 2TRMA 1FQ3A 1ID5H 1GMDF 1LVBA 2P93A 2V3HH 2ZTXA 1KXFA 4WXVA 1TGNA 5FXLA 1F0TA 1K28D 4IMZA 2PGQB 5C1XA 1BTXA 2SFAA 4Y8XA 1GI3A 3RXEA 4IS5A 4K2YA 2QF0A 1GBDA 4JK6A 5JBBS 2BQ7B 1ANEA 1FAXA 1XM1A 1AVXA 1MKXH 2D8WA 1P05A 4NIXA 1P2JA 5C20A 1CHOG 1TMUH 2OD3B 4FU9A 2GCHG 2AH4X 1BITA 3M61U 3TNSA 4GPGA 1LCYA 2OXSA 2BDYA 2PGBB 4X2XA 2ZQ2A 2A4OA 2ZF0H 1O3BA 4NFFA 3SU2A 1LQEA 3ZYDA 1QB9A 1Y8TA 3SUFA 2GT8A 3TVJB 3RXVA 5T6DA 4DIHH 1HAYB 1CGIE 5A0AE 5AFYH 2BLWA 4CRCA 2ZEBA 3NWUA 1J9CH 2GCTB 4TWWA 4DOQA 3KGPA 1K1IA 1EPTA 1A46H 2ANKH 1HIAA 1MU6B 2P16A 2RDLA 4KELA 1FJSA 3SNEA 2J38A 3VB4A 1QFKH 2ZHEH 1WQSA 3S9AA 2FOAA 2ZKSA 1C2DA 1CA0B 6ESTA 4TY6A 1BRUP 2ZGBH 2A45B 2CHAB 2TGPZ 1MD8A 3H7OA 1TONA 3AVZA 1Z6EA 3EQ0H 1C2LA 4BTTB 1O2YA 3ATLA 4R8TB 1UMAH 4B74A 4A1XA 1NFUA 1V2JT 3JZ1B 1HXFH 5PTPA 1GJ6A 4ABFA 1NC6A 2OQUA 2O9QA 5EG4A 1N8OB 1G30B 5DP5A 4E7RG 2NU3E 4NSVA 5JYIA 4X6OA 3VPKA 2VIPA 1ZHRA 5J4QA 1GVKB 3A80A 2BXTH 3PLPA 3AW0A 3T29A 3F6UH 2GP9B 2WV5A 3BG4C 5HYOA 4D9QA 2YNBA 1EJNA 1OP2A 3GCHC 4Y8YA 4X1PU 1C2FA 1CE5A 1PQ5A 3MU8A 4HGCA 5DKMA 1O2UA 2GDDA 1G36A 1KIGH 4X8SH 5T6FA 3D49H 1TRMA 1SR5C 2AMPA 4R0IA 2ZU4A 1VJ9U 1C5MD 1NFWA 3U98H 4GUXA 2ZZUH 3UPEA 1D6RA 2SGPE 1Y3WA 1O3LA 1Z71A 2HRVA 3SUDA 3RXPA 1QNJA 4JZIA 1DLEA 3GY4A 4ZAEA 1OXGA 1K1JA 1UVUH 1A1RA 1EUFA 1XKAC 1NO9H 1WV7H 2EI6A 4MQAA 2ZGJA 1ESBA 4Y8ZA 1ETRH 2JKHA 1TGTA 1G2MA 3A81A 4AORA 1QBNA 1YCPK 1EAXA 5C3NA 1EZUC 3ZZ5A 3SGBE 1GDUA 1TNHA 2GCTC 1KLIH 1C5SA 1YPJH 3UOPA 1TRYA 3OYPA 3ZZ6A 1GVLA 2HALA 3MH4A 2SGDE 4CRGA 1CSOE 3LOXA 3OY5U 3FZDA 1SHHB 1GMHG 1NRRH 1CT0E 2O8LA 2BD7A 1SOTA 5FPYA 2ZIQH 4X6MA 1GBKA 2EC9H 4MNYA 5L6NH 3UNQA 4NWKA 2ANWA 1TWXB 2FOHA 1SGNE 2BD4A 1FV9A 2J9NA 2R0KA 1ZMNA 3BTEE 4NFEA 2PW8H 1BHXB 4ABDA 2Y5GA 1GG6B 1LPGB 3M7QA 1O2TA 2VIQA 3RXCA 4AFSA 2BD5A 4JK5A 1Q3XA 4U32A 2Q1JA 2FXRA 1AFEH 1HRTH 3FFGA 1K22H 1KY9A 2BXUH 4MPWA 1DY9A 1QA7A 3BEFB 2WPKS 4INLA 2SGEE 1G3CA 4OGYA 1ABIH 1M9UA 3TJVA 3LONA 2P94A 3MU5A 1HXEH 5GJ4B 1Z1JA 4MNVA 2ANYA 1A5IA 1ELTA 3FANA 1HUTH 3RXTA 3UOUA 2G00A 7LPRA 2RA0A 4ZHLU 1P2IA 5HXFA 1G32B 3RXFA 4AB9A 4XBBA 1UVOA 3MU4A 3ZV8A 4DT7B 5L2ZH 3SI4H 1ELCA 1ZYOA 5DK1A 2BD3A 2G4TA 1TMTH 1D3TB 3KNXA 2PSXA 1S83A 1AMHA 2VB0A 3M5NA 2BDBA 1UTLM 3OTJE 5HM9A 3Q76A 5DPAA 1C1RA 2FI4E 1DM4B 2VH6A 4B1TA 5C1UA 2GTBA 3RLYH 3SU5A 4CR5A 1IQMA 1GHBG 2LPRA 1EQ9A 2XCFA 4ISHH 1MKWK 4X1RU 5IYTA 1WTGH 4H42U 2ZFPH 1ANDA 5GCHF 5TCCA 3LGYA 1IHTH 1Z7KA 2Z9KA 4ISNA 1GJ4H 1ORFA 1TNJA 1O2VA 3UUZA 1ZPZA 2G5NA 5C1YA 1YCPM 1SGQE 4FUGA 2XW9A 1AU8A 2W26A 2BY8X 5G4BA 2F9UA 4FUFA 1CBWC 2OC8A 1INCA 2QIQA 3E0NB 2C90B 2A5AA 4LXBH 4MNWA 3MTYA 2G52A 1S85A 4O3UA 5C67A 1LKBA 3T25A 3PO1B 2ALPA 3ZVFA 3UNSA 1Z8RA 2PKSC 9LPRA 2PV9B 3O8CA 1PFXC 1OYQA 2VU8E 3TH4H 5E2OA 2J4IA 2BQWB 1UK2A 2WV4A 3TJOA 1K1NA 4Q7ZA 1LTOA 1WUNH 1LMWB 1SGPE 1F0UA 1W12U 3DA9B 1OPHB 2A4GA 1VJAU 5EQRA 3V0XA 1TA2A 1W14U 1A3EH 4GLYA 4LZ1H 1GMDG 3ZZ8A 3SU4A 1HAPH 2FI3E 1DITH 5A8XA 1HB0B 2A2QH 2PTCE 2WPLS 2UUJB 5A09A 1C1TA 1IQKA 4CR9A 1U6QA 2NU4E 1YPEH 2VIOA 3SQHE 4K60A 3SUEA 1LPKB 1XUGA 1HLTH 1FY8E 3BTGE 1OKXA 2FMJA 1CA8B 1C1SA 4Y0YE 3MHWU 2QY0B 3RXBA 4JYTA 8GCHF 1AVGH 2I6SA 2FP7B 3NZIA 3MYWA 4PROA 1NFYA 1O37A 3KIDU 4IW4E 1C1VH 3GYMA 1YPMH 1YPKH 4JCNA 4NIVA 3STJA 1O2JA 2BD9A 3RUOA 4JMYA 3TU7H 4NIWA 1J8AA 4OS2A 3CENA 2Y81A 4NGAH 4Q7XA 1ELEE 2QXJA 3GOVB 2BVRH 2QCYA 1Y5AT 1JIRA 4KGAA 1Z8GA 1AFQC 2F83A 1TGBA 4XOJA 2JH5D 1AIXH 2ZDAH 1S5SA 2H2ZA 3LT3A 3HPTB 3K65B 2C8YB 4KTCA 3E90B 4MTBA 3SN8A 4NA9H 1EAUA 1ELVA 1O3MA 4AFUA 5FX5A 1T8OA 3SJIA 2FWWA 4XBDA 1TX8A 1X7AC 2CN0H 1QQ4A 2A1DB 1BBRK 3RXRA 3A7TA 1SLXB 2ZDLA 2BLOA 2O8TA 1YPLH 1VGCB 4F4OC 3S7KB 4YOJA 1O39A 1TLDA 1BTUA 4AZ2B 1DLKB 1JBUH 1P2KA 3T2NA 3E1XB 3SJ8A 4B2BA 1UTNA 3Q3XA 2ANMH 1FY1A 3EE0B 3ATWA 2ZTZA 1A61H 2BY9X 3MI4A 3MH5A 3SW2B 3E3TA 3NKKA 4MLFB 2SNVA 1UTJA 1EASA 3QZQA 1O5CB 2TGDA 1O3DA 2YOLA 3W94A 1K1LA 3JZ2B 1FLEE 2AGGX 1AI8H 1GBTA 1H8DH 3F9GA 1EAWA 2PUXB 1C5XB 1C2HA 1QL7A 1SLWB 2Z9LA 4ABHA 4A7IB 3UWJH 1YP9A 2GT7A 2C8ZB 1F5LA 1IQHA 2W7SA 1VITH 3GICB 4KTSA 4D9RA 2Y5HA 2PR3A 1MQ5A 3P70B 2XCNA 4ZKOU 1DPOA 2ILNA 1QJ7B 1BOQA 1O2KA 1QY6A 3MO3A 4B75A 4Y11E 4XDEA 1RIWC 2FYQA 3EYDA 1E36B 4IMQA 2OCVB 4ZHMU 1SI5H 2FM2A 3GCOA 5E8EH 4RN6A 5C5OA 1O5DH 4DVAU 3RC5A 3TH3H 4Y7BA 1PQAA 2BMGB 2P3FH 3S9CA 1V2NT 1AUJA 3M3TA 3P6ZB 1GBHA 1OWKA 1DX5M 5IDKA 2BDGA 2H5DA 1ZMJA 1ESAA 1HAIH 1TNGA 2ZU1A 3BTTE 1BTHH 1SQAA 4LK4A 1H9HE 3S69A 1UTPA 3ZVAA 5EQSA 1QGFA 1SGIB 3EAJA 2ZDVH 1H8IH 2Y7ZA 4IBLH 2AMDA 5F03A 2QXIA 1AB9B 2ZHWH 2H1UA 2M5TA 3PMAB 1W8BH 1AKSB 3ZV9A 3HK6B 2QN5T 1OS8A 1A5HA 1DFPA 4X1NU 2FOCA 1KXAA 2UUFB 2ZC9H 3B23B 1PPFE 1Q31A 1C5YB 3A7ZA 3PLKA 1HNEE 4BTUB 4E7NA 4WMFA 4JYUH 2V0BA 1O2XA 4IGDA 3URDA 1W7GH 5F8ZA 3LKWA 1SGFG 2IJOB 3ZZ3A 1NT1A 2KAIB 3QTVH 1GL0E 4BAHB 4Y76A 1A0JA 1BB0B 1SC8U 2G4UA 3V12A 5F6MA 2ZA5A 2RG3A 1DWEH 3A88A 2GD4B 5C5NA 4CRFA 3MWIU 4CHAC 2VWMA 3BG4B 1S82A 2F9VA 2Z3DA 4YLQH 3TK5A 3CP7A 3GYLB 3ZYEA 3TPIZ 1V2TT 3GCHB 1A0LA 3RXUA 4CH2B 7ESTE 4D8NA 2ZFFH 3RXDA 2FO9A 2SGQE 2B5TB 1PYTD 2BOKA 2Z7FE 1VITG 2GMTC 1MCVA 3V3MA 5EW1H 1HJ8A 1V2OT 2GGVB 1ZSJA 4X2VA 1GJ8B 1B7XB 2QYIA 1MKXK 1IQIA 3VXEH 1V2MT 3TIUA 5SGAE 4WJG2 1C1PA 4HI3A 4OGXA 2UUYA 1YGCH 1O3IA 4WF8A 3RU4E 2H6MA 1P06A 5FBIA 2OC1A 1NRSH 4NWLA 1CHGA 4O9VA 1PPGE 5ETXA 1NRPH 1TB6H 1HBTH 3ATKA 1SQOA 1LHCH 1P3CA 1ABJH 1T31A 2BOHB 2WPHS 2KAIA 3ZZ7A 1DWCH 3M7UA 2ZU3A 1C4Y2 1KDQA 1KXBA 1L1GA 1P9SA 2GKVE 2BX3A 2AS9A 5DO4H 1DUEA 1ELAA 3P8GA 2HGTH 2BM2A 4ZUHA 4FUCA 1HDTH 1AO5A 2H9HA 3VB6A 1O3EA 1CGJE 1PPCE 5EGMA 2ZDMA 3EA7A 1HGTH 3L3TA 2UUKB 4DIIH 1KLJH 1FPHH 1HYLA 5TCAA 3KF2A 1KTTB 5DJ7A 3MO6A 3S9BA 5GCHG 1NROH 1AB9C 3RXMA 3M3VA 1V2VT 4UFFH 2AEIH 2LNCA 1EKBB 3QWCH 1CU1A 2G5VA 1MBQA 3STIA 2FIRH 2PHBA 5L2YH 2ZO3H 3ESTA 3TGIE 3RU4T 4ZH8A 5JB8S 2CMYA 1O2LA 1P3EA 1VCWA 4AFZA 1C4V2 3NXPA 4YT7H 1P2MA 4BTIB 1N6YA 4A5TS 1MH0A 1AHTH 5GWZA 1QA0A 3VXFH 1C5RA 4MPXA 1UCYK 3GCTF 1ANCA 3SORA 3ZZ4A 1GDNA 3QDZB 3SO3A 1H9LB 2EEKA 5DG6A 3RMMH 3P95A 1BZXE 3BV9B 1E34B 5CMXH 3SJOA 3ZVDA 2HVXA 3WY8A 2R2MB 3CS0A 4Y10E 1S81A 1BMNH 1GHAG 1NU7B 2Y82A 2J92A 1ARBA 1GBEA 1GBBA 1D3QB 1C5TA 4JZEH 4BAQB 1NN6A 3OY6U 1G9IE 2HLCA 1MTNC 1Y5BT 1EP5A 3E16B 2NU0E 1WU1A 4AG1A 3DHKH 1LKAA 3ODFA 1EPTC 3P8OA 1RGQA 2BZ6H 1JMOH 2O8UA 4CRAA 4FUHA 3M35A 4ABBA 2D1JA 2BY6X 2PSYA 3SGQE 2QAAA 5FAHA 1G2LA 1FNIA 1SPJA 2ZGXH 1D3PB 1XUJA 3MO9A 3SGAE 3L6PA 4WXIA 1MZDA 2ZCHP 3LPRA 4ABJA 1WCZA 5AHGH 1DANH 3UTUH 1THPB 1Y3XA 1ZGIA 1T32A 3M37A 2ALVA 1J17T 2R2WU 3BEIB 3G01A 1P10A 3F68H 2VVVA 2VIDA 3PWBA 1HAVB 4I33A 4YTAA 1L4DA 5JB9S 5FX6A 2C8WB 3ATIA 2DE8A 1TGCA 1PYTC 2XWBI 4FUBA 4LZ4B 1BJUA 4CBOA 1B5GH 1YPGH 1G3BA 1W13U 1IQEA 1CBWB 4BANB 3TJUA 2GZ7A 2FX6A 1BUIA 1TGSZ 3LJOA 4H4FA 5CE1A 1WBGB 1O2OA 1PPZA 1TQ7B 1GI6A 1TYNA 1YCPH 1AWHB 3VEQB 3E0PB 2D26C 2A4QA 4K8YA 3H7TA 1AN1E 4WMDA 2V35A 2PKSB 2ZQ1A 1DVAH 4SGBE 3SI3H 1GJBB 5HGGA 4AYVB 1YKTA 2OBOA 4ZROA 1O3PB 1UVTH 2ZNKH 3V13A 1XUHA 4K1TA 1H1BA 1C5OH 1ELFA 1AY6H 2TIOA 1G37A 2F9BH 3SJ9A 2IPHA 5AVDA 7GCHF 2Z9JA 2AERH 1O2ZA 3LGTA 2ODYB 4B73A 5FPSA 4DURA 2TGTA 4ZKRU 3M7TA 3LDXH 2EI8A 1G3EA 4X8TH 4U30A 4AG2A 1E37B 1P8VC 2BVXH 1O3OA 1MUEB 3RXQA 1HAVA 1QJ6B 3PTNA 4I8HA 4GCHF 3F9FA 4JYVH 2FOFA 3SHAH 1FUJA 2ZDKA 5DP3A 3UQVA 4Q7YA 1T7CA 3ITIA 2BLQA 4AGJA 1P2OA 4DCDA 1QRZA 4AB8A 1KLTA 3HKJB 5GXPA 5LPFA 2W5EA 2ZU2A 4BAKB 1DSUA 3S0NA 1Z1IA 1WYKA 3P17H 3K6ZA 1FDPA 1MTVA 2A5KA 3ENSB 4I8GA 2F9NA 1ESTA 2A2XH 3A85A 3RMLH 2I6QA 2ZGHA 1GBFA 2FOEA 2DE9A 1AFQB 4U2WA 5E0GA 2V3OH 4RSPA 3ODDA 3AAVA 9ESTA 1ELDE 1FZZA 4H6TA 3PV4A 2Z9IA 4K1SA 4U01A 4FUIA 1GBJA 2ZECA 3K9XB 3P92A 1XX9A 1IQNA 1TX6A 1GHXH 1TMBH 4FU7A 1NM6A 1NS3A 1MQ6A 2VH0A 4JZDH 4Y79A 3V7TA 1P57B 1VZQH 3AAUA 2THFB 2DUCA 3W95A 4Z6AH 1ELBA 3GCNA 3RU4D 3T62A 3R0FA 3U8RH 5K0HA 1DSTA 2BB4A 4UFEH 4J2YB 3BN9A 3LC3A 3O8DA 4QT8C 4CREA 1C5QA 4NZQA 1DICA 3K6YA 4I31A 1TOMH 3U1JB 2XTTB 4ABGA 1GI0A 3UR9A 2GV7A 3SU3A 4M7GA 4YM9A 2OLGA 3UIRA 2J94A 4SGAE 2Y7XA 2H9EH 2ZI2H 2XC0A 2AYWA 1GI5A 3I78A 2A7JA 4J1YA 3KCGH 4NIYA 4CRDA 4XSKU 5CHAC 3A7YA 1F5KU 2PLXA 1EJAA 5GDSH 2FI5E 1KXDA 2XNIA 1GJ9B 5FPTA 1HV7A 1UCYE 2AIQA 2OBQA 3ATMA 3UY9A 1B0FA 5EQQA 3E91A 4THNH 1SGCA 3A8AA 1P11E 1AE8H 4D7GA 1ANBA 4O03A 1A3BH 2H9TH 1C5NH 5HM2A 1LVMA 1RIWB 1O2GH 1FN6A 2P3UB 1O3GA 4LOYH 1TA6A 4X1SU 1C1OA 1C5LH 1WQVH 5JPMH 1KSNA 1QTFA 3M5MA 2PUQH 1THSH 1EATA 1K1PA 1MTUA 3A7XA 1GJCB 2BDIA 3QGNB 1O3HA 1DOJA 1ZMLA 1F0SA 5DP8A 5I25A 1SOZA 1LDTT 1IQGA 1O30A 1GBLA 1XUIA 1O2PA 3VFEA 2FLBH 1GJ5H 4UFDH 3TNTA 2JH6D 2CXVA 2WINI 1IAUA 3T5FH 2ZFQH 3BTWE 3BIUH 1GGDC 1LVOA 3GY2A 1LQDB 1CGHA 2BTCE 4Y6DA 2ESTE 3A82A 1O32A 1QR3E 1J14A 4X6NA 2Q6GA 1A4WH 3SNDA 1W11U 2EA3A 3A7VA 3TK6A 2XBWA 2VGCC 5GPIB 1TOCB 1D3DB 4UD9H 3A7WA 1BTYA 3ZVEA 2P8OB
chains in the Genus database with same CATH superfamily
2ZHDA 3MOCA 1O38A 1V2ST 1TRNA 1FIZA 1O2WA 1P01A 4TPYA 5B6OA 1NESE 5JBAS 4BXSA 1SLUB 3LU9B 1QRWA 5DP7A 3QK1A 1GHYH 1NRNH 3SOSA 1SVPA 4M9FA 1BDAA 1O3FA 1GBMA 3QUMP 4FVBA 3BTKE 1PPHE 1SGRE 3ZVGA 5GIBA 3QZRA 1IQLA 3TJNA 2PKAB 1O35A 4CHAB 1GMHF 1JWTA 5HIYA 1EP6A 4XFQA 2NU2E 5A8ZA 3QO6A 4Q63A 1L2EA 4MDSA 3VGCB 1HAXB 1GMCF 4NG9H 4BOHA 1O2HA 2ZPSA 1GJAB 3LGWA 3OX7U 5FCKA 2RCEA 2WUCA 1T8NA 2H5CA 4NA7A 1S0RA 2Q6FA 2FZZA 1LHGH 2GMTB 3GCTG 2TGAA 1OX1A 3WWFA 1O2MA 3PROA 1TNLA 2VIWA 1ZOMA 1AWFH 4RKOB 2OINA 2ODQA 3GISB 3NPSA 4O3TA 1GCDA 1YYY1 5C2ZA 1GHWH 1C2IA 1E1RD 2BZAA 2HNTE 3ZZCA 1D4PB 1P2NA 2OTVA 5FBEA 1UHBB 1BMAA 2IOTA 2SNWA 5IK2D 1ARCA 1ZPBA 5TJXA 1O2RA 4CBNA 1OWDA 5F53A 3BTDE 2QA9E 3HGNA 5AFZH 1OP8A 1W0ZU 1ZSKA 1TAWA 1WDIA 3BTME 3HK3B 4K5ZA 4IC5A 1SGEE 3LC5A 4DJZB 1Z8JB 2A5IA 4ESTE 3AW1A 4AX9H 5F8XA 4YESB 5HMAA 2BDHA 1HAOH 2XBVA 3MH7A 4X8VH 4XRNA 1OWEA 3GY6A 1L0ZA 4YO9A 1UK3A 3DSGA 1GI4A 3ZZ9A 1YPHC 1QRXA 1O5BB 1GPZA 1Y59T 1THRH 1BMLA 2M2AA 1QURH 1O3AA 2QXHA 3RXHA 2AMQA 3NUMA 1ZTJA 4AYYB 1C1WH 3SV7A 4I7YH 1PJPA 4YT6H 4E06H 1P2QA 3MNSA 3GY8A 2VVCA 1UVSH 3IG6B 1S6HA 2FOBA 1D6WA 5A8YA 2FEQH 1ZR0A 3KEEA 1PPBH 1NFXA 4Z0KA 2J34A 1DY8A 3SZEA 1V2WT 3SV9A 1K2I1 4GVUA 2FS9A 1S0QA 2ASUB 1LHFH 3F2HA 1SMFE 3MNBA 1OP0A 2P8OC 3FZZA 1DXWA 1C2EA 1UHBA 1YBWA 1SQTA 4K3JA 2OUAA 1GWAA 1YC0A 2G8TA 3EDXB 1B0EA 4NZLA 2W6ID 3U9AH 3ELAH 3PLBA 1ZRBA 1F2SE 1GJ7B 2WYJA 2BY7X 1RRKA 1FIWA 4VGCC 4TWYA 3KQCA 1C9TA 2FTMA 1OSSA 1P12E 3EA8A 3U8TH 1V2UT 4ISOA 3RXGA 2QV1A 1E35B 1V2KT 3SUGA 2KM0A 1Y3VA 3ZZBA 1LVYA 2F9PA 3QX5H 3VGCC 1GI7B 4FUEA 1ZRKA 3KHVA 7GCHG 1SHYA 4Y7AA 2O8WA 1W0YH 1RS0A 1C5WB 2PFEA 7KMEH 5I46H 5EPYA 3QN7A 5BPEA 4IC6A 2HOBA 3OSYA 4AN7A 2FESH 4E05H 3O8BA 3KN2A 1NY22 1MBMA 4GCHG 1BRAA 1MTNB 2NU1E 1AKSA 1KXEA 3A87A 4UE7H 5DP4A 1EPTB 2BD2A 3FP6E 3ZZDA 2P95A 3KYFA 3U8OH 2KCOA 3A8CA 5FHTA 3VB5A 2FYRA 4UEHH 1GBIA 3KQDA 2WPMS 2STAE 4K69A 2QC2A 1SFIA 1V2PT 2UWOA 1UVPA 3FN8A 1EOJA 1O3JA 1C9PA 1EOLA 4TPIZ 1C1MA 5DP6A 1NPMA 2RDEA 1CT4E 1W0JD 1XXFA 2Y5FA 6LPRA 2FDAA 1WOFA 5EXLA 2HNTF 3EGKH 1HJ9A 2Z6BD 1H9IE 3QLPH 3SV6A 1TBRH 1C1UH 1L4ZA 3SHCH 1LHEH 5LGOA 1AQ7A 1FAKH 1O36A 2VWNA 3SV2H 1DDJA 5E0HA 1OYTH 3R3GB 3SZNA 4HZHA 1YPHE 1XUFA 2B8OH 1MAXA 2XBYA 2G55A 4GAWA 2WPIS 3SU0A 1SL3A 3O8RA 1MTSA 1BHXF 1YLDA 3A8DA 3GDSA 2B9LA 1EZSC 3PTBA 4JZFH 4YZUA 2OC0A 1ZTKA 3SNCA 1SSXA 2VIVA 3B8JA 1ETTH 4JZ1A 3MNXA 5DGJA 5JBCS 3CNRA 1TABE 3DD2H 2RFKC 4A6LA 2WSSD 1H4WA 1KYNA 3BF6H 4CH8B 2WPJS 1Y3YA 1AUTC 3VB3A 1BBRE 3KQEA 3U69H 1BTPA 1EXFA 1BT7A 1P9UA 4XBCA 3GDUA 5ABWA 1DWDH 1TFXA 3PMHB 3VG8A 3L33A 3BSQA 1C5ZB 4ISLA 3RXKA 1QJ1B 3SU6A 5T6GA 1S84A 3RXIA 1LPZB 5EPNA 5C0TA 1C5VA 3BEUA 1QL8A 1PPEE 1QB1A 1VCQA 3F2FA 1JIMA 2A0QB 2OQ5A 2D2DA 4DG4A 1GHZA 1SFQB 2BDCA 1GDQA 3UFAA 3UQOA 1W2KH 5F8TA 2P59A 3GY7A 5BRRE 1QQUA 2QE7D 6GCHF 1HJAC 2EI7A 1QL9A 1PQ7A 4WY3A 1AVWA 1E0FD 2A4RA 1O2SA 3D23A 4DY7B 1ZTLA 4D7FA 1EAIA 3C1KA 3M3SA 3HATH 3KL6A 2V6NA 1A5GH 2FLRH 3NRLA 4OS1A 1XMNB 1K1OA 2A31A 2VWOA 4DGJA 2ZCLP 3F1SB 1NRQH 3TLOA 3UAIC 1CT2E 3EA9A 1KXCA 5K7RA 1UCYH 1C5PA 1O5GH 2AFQB 1JXPA 2TBSA 1UTOA 1FN8A 3RXJA 1C2KA 1T8LA 2VVUA 2YMSD 3QGJA 4X0WU 3RXSA 1EJMA 8GCHG 5E0JA 1SGTA 4WMEA 4TYDA 2ZWLH 5A0CA 1DWBH 3GY5A 3TGKE 4NCYA 3FVFB 2Z3EA 2QGRA 2PP6A 1IOEA 2ZPQA 2A7CA 4X6PA 3T27A 1V2RT 4ZXXH 1E38B 1P03A 3MH6A 4BNRA 1O3KA 1UO6A 3FP7E 3MNCA 5L30H 2Z3CA 2XC4A 2FOMB 3ZVCA 4GHTA 4ASHA 1EZXC 1DT2A 1CVWH 3FOAA 1MCTA 1T8MA 2ZPRA 2XBXA 4ZKSU 4F49A 2FOGA 4OS7A 3M5LA 1O33A 2R3UA 4OS6A 1TBZH 1J15A 1RTKA 4Y0ZE 1N1LA 4FXGH 4MPUA 3LGVA 2Z94A 1RXPA 2Z9GA 4AFQA 5EXMA 3Q3YA 2PWXA 1O2NA 2YMSB 3SV8A 2J97A 1LO6A 3Q00A 3NK8A 6CHAB 1EB1H 1HAHH 1VKYA 5CHAB 2WUBA 2VWLA 4IN2A 1MTWA 1YF4A 3I29A 3P8FA 4TSFD 4FVDA 3PYHA 1MD7A 3HGPA 5EXNA 4I32A 1N6XA 3AK5A 1QBOA 1CA0C 1OWIA 3PWCA 2XXLA 3NCLA 2FTLE 1GMCG 2CHAC 1IHSH 2GV6A 1GL1A 2R9PA 2CV3A 1GI8B 1C1QA 2ZFTA 1O5AB 3A8BA 1L1NA 4X8UH 1C4U2 4I8LA 4Q2KA 4MPVA 1T4UH 1FY5A 3GDVA 4NSYA 4IN1A 2G51A 2ZTYA 4AGKA 1A2CH 2W7UA 4B2CA 1C5UA 4KP0A 1BA8B 4Y71A 2VINA 1N8OC 5T1VA 4B6EA 4HFPB 5T3HA 1K9OE 1ETSH 3C27B 1QHRB 2OC7A 1TPPA 1LHDH 2K8IA 3GS9A 1BRBE 5AF9H 1VITF 1C2JA 2R3YA 4WVPE 3RM0H 1HPGA 1FPCH 3D62A 4WH6A 3LH1A 1BTZA 4BAMB 4I8JA 3UWIA 1NBME 3UREA 2J2UA 2BY5X 4BAOB 1EB2A 3DUXH 3PB1E 1GGDB 1CHOF 1F5RA 3Q77A 2A7HA 2GCHF 1DXPA 2W3KA 1BQYA 2BDAA 1FY4A 4HTCH 3RC4A 3T26A 2QF3A 2BQ6B 2VGCB 1JRTA 3TK9A 2BHGA 2WPDD 3CS7A 1ACBE 4K1EA 3A84A 2A32A 4B71A 1F7ZA 3B9FH 5EU8A 1MMJN 1IQFA 3GY3A 3TH2H 1XXDA 1TPAE 2C93B 2RA3A 2CF9H 2GDEH 1O5FH 1Y3UA 3F9EA 1ZJDA 1YLCA 2C4FH 2ULLA 3N7OA 1BRCE 1GBAA 3AASA 5A0BA 1GBCA 2GZ9A 1SKYE 3MMGA 1XUKA 1Z8IB 3RXLA 1D9IA 1XKBC 4YOIA 2ZFSA 5H4IB 1XVOA 1O0DH 1GI1A 2ZGCA 2ZHQH 3SBKA 4OS5A 2R0LA 2YMSC 4TY7A 3FAOA 3SU1A 1MKWH 1ZJKA 4AOQA 6CHAC 2HPQH 3LGUA 3PRDA 3SJKA 1QZ8A 1C2GA 8LPRA 3KYGA 5EOKA 5EODA 1AZ8A 1UTMA 1ZLRA 1TPOA 2EQNA 2F91A 3A86A 4CRBA 5ESTE 1V3XA 4Q80A 3H5CB 3ZZAA 2XRCA 1EX3A 1F0RA 1T4VH 4NA8A 1SGYE 2JH0D 2ODPA 2HNTC 1O3CA 1SBWA 1P02A 1JOUB 1BMMH 1GI9B 5C17A 1UTKA 4DW2U 5DP9A 1PQ8A 3RMOH 3MFJA 2STBE 2FODA 1OWJA 2BD8A 1SG8B 3RM2H 3DT0H 2BYAX 2CJIA 2IN2A 2F4LA 1HFDA 1O34A 5JDUB 2XWAA 1ZPCA 1GG6C 1GCTB 1BJVA 5LPEA 4A1TA 4OS4A 2UWPA 1RTFB 1GHAF 3TITA 3QTOH 3T28A 3S7HB 1NZQH 4RKJB 1ELGA 2C8XB 4GSOA 1F92A 2XC5A 4MVNA 4O97A 1V6DA 2YNAA 4ZMAH 4DT4A 1TPSA 4WWYA 1C2MA 2K0QA 2FS8A 3UR6A 4ABEA 5J4SA 4MG3A 2GZ8A 1ZHPA 5JBTA 3IITA 1DUAA 1P09A 3DFLA 1UJ1A 1Q2WA 3P8NA 3BTQE 3OU0A 2ZFRH 1QCPA 1SLVB 3I77A 3A89A 2VNTA 2QXGA 3D65E 1GI2A 1KMHB 2P3TB 4FU8A 2F9OA 4D76A 3PMBB 5E2PA 1OOKB 1MAYA 1QBVH 4VGCB 2TPIZ 3SQEE 4B76A 4ZHAA 4UFGH 1AE5A 1S6FA 3F9HA 1V2LT 3RLWH 4KKDA 1FX0B 1W10U 1O2IA 1QB6A 5ESBA 1C1NA 1JRSA 4H6SB 5FCRA 3URCA 1HAZB 3LIWA 1AZZA 3U1IB 1XVMA 2CGAA 4ZKNU 4FUJA 1SGFA 1TIOA 1UTQA 1AD8H 2VJ1A 1W0KD 1TE0A 2JETB 1TALA 4WH8A 1ZZZA 3LGIA 4X1QU 2Y80A 1W3CA 1NU9A 1GHVH 1BBRH 1ZHMA 1O5EH 2ZG0H 2Q6DA 1DS2E 4YLUA 2K1QA 2XYAA 2PTNA 3Q3KA 6GCHG 3RXAA 1QIXB 1TBQH 1YLNA 4XE4A 2WYGA 4GHQA 2AIPA 4A92A 1P0SH 8ESTE 3PO1C 1K21H 1BTWA 3RDZA 3DSOA 3DFJA 1RFNA 1V2QT 2J98B 1MZAA 2ZP0H 2F3CE 1BIOA 4INKA 1G3DA 1UK4A 1A7SA 2ZCKP 4FUDA 1ZSLA 3M36A 8KME2 5EW2H 1WSSH 3N7EA 4INHA 5EJZA 1O31A 1GJDB 3IWMA 2AGIX 4KTUA 3SYJA 2G81E 1DE7H 2GX4A 1VR1H 3E6PH 1K1MA 2NWNA 3SNBA 3RXOA 4X2YA 4B2AA 1GCTC 1TNKA 4UDWH 2PKAA 3SNAA 2ZU5A 1HCGA 3BIVH 3BTFE 4ZXYH 1WAYB 3ZVBA 3PM3A 3RC6A 1MU8B 3M5OA 2KCAA 4ABIA 1WTHD 2BX4A 1IQJA 2CF8H 1SGDE 1EFRD 1RTLA 1A0HB 2IJD1 2WZQA 4X2WA 1UW7A 2Y6TA 3RMNH 3TGJE 3F0OA 1AGJA 1O3NA 1YM0A 1BCUH 1RJXB 3E8LA 3VB7A 3BG8A 1NBMD 1EZQA 2J95A 4UONA 3MU1A 4ZCNA 2FX4A 4A1VA 1TQ0B 3FP8E 1HAGE 1FI8A 1GHBF 1CO7E 3PMJA 4I8KA 3KQBA 5LPRA 1J16A 1E79D 1YY3A 4K8BA 1OWHA 5LH8A 2BLVA 2O8MA 1P04A 2HWLB 4YOGA 1W7XH 3DSPA 3MU0A 2OP9A 4ISIH 1VCPA 1RD3B 1TNIA 1CQQA 2GVFA 1FMGA 1HJAB 3BTHE 3HKIB 3UNRA 1TX7A 1FY3A 1FXYA 1FONA 1O2QA 2BVSH 2JETC 2FPZA 1KTSB 1L1JA 1GVZA 1Z6JH 2AGEX 1VGCC 2C3SA 1SB1H 2B7DH 3LH3A 3N7DA 3A83A 1KDQB 5B6LA 5A2MH 1NTPA 2B0FA 2HPPH 2SGFE 4ABAA 3LJJA 2ZDNA 2ZHFH 1Y5UT 2SGAA 4MNXA 3RP2A 3K2UA 5GNDA 2W3IA 2UWLA 4BXWA 1ZGVA 1HIAB 2TRMA 1FQ3A 1ID5H 1GMDF 1LVBA 2P93A 2V3HH 2ZTXA 1KXFA 4WXVA 1TGNA 4RT0A 5FXLA 1F0TA 1K28D 4IMZA 2PGQB 5C1XA 1BTXA 2SFAA 4Y8XA 1GI3A 2WV9A 3RXEA 4IS5A 4K2YA 2QF0A 1GBDA 2EY4C 2QF4A 4JK6A 2BQ7B 5JBBS 1ANEA 1FAXA 1XM1A 2JIZD 1AVXA 1MKXH 2D8WA 1P05A 4NIXA 1P2JA 5C20A 1CHOG 1TMUH 2OD3B 4FU9A 2GCHG 2AH4X 1BITA 2KCPA 3M61U 3TNSA 4GPGA 1LCYA 2OXSA 2BDYA 2PGBB 4X2XA 2ZQ2A 2A4OA 2ZF0H 1O3BA 2OK5A 4NFFA 3DCLA 3UB0A 3SU2A 1LQEA 3ZYDA 1QB9A 1Y8TA 3SUFA 2GT8A 3TVJB 3RXVA 5T6DA 5HKKD 4DIHH 1HAYB 1CGIE 5A0AE 5AFYH 2BLWA 4CRCA 2J5UA 5CDFE 2ZEBA 3NWUA 1J9CH 2GCTB 4TWWA 4DOQA 3KGPA 1K1IA 1EPTA 1A46H 2ANKH 1HIAA 1MU6B 2P16A 2RDLA 4KELA 5KECA 1FJSA 3SNEA 2J38A 3VB4A 1QFKH 3WWBA 2ZHEH 1WQSA 3S9AA 2FOAA 2ZKSA 1C2DA 1CA0B 6ESTA 4TY6A 1BRUP 2ZGBH 2A45B 2CHAB 2TGPZ 1MD8A 3H7OA 1TONA 3AVZA 1Z6EA 3EQ0H 1C2LA 1S6LA 4BTTB 1O2YA 3ATLA 4R8TB 1UMAH 4B74A 4A1XA 1NFUA 2LP6A 1V2JT 3JZ1B 1HXFH 5PTPA 1GJ6A 2CK3D 4ABFA 1NC6A 2OQUA 2O9QA 5EG4A 5EIYA 1N8OB 1G30B 5DP5A 4E7RG 2NU3E 4NSVA 5JYIA 4X6OA 3VPKA 2VIPA 1ZHRA 2L6OA 5J4QA 1GVKB 3A80A 2BXTH 3F3BA 3PLPA 3AW0A 3T29A 3F6UH 2GP9B 2WV5A 3BG4C 5HYOA 4D9QA 2YNBA 1EJNA 1OP2A 3GCHC 4Y8YA 4X1PU 1C2FA 1CE5A 1PQ5A 2W6JD 3MU8A 4HGCA 5DKMA 1O2UA 2GDDA 3OEHD 1G36A 1KIGH 4X8SH 5T6FA 3D49H 1TRMA 1SR5C 2AMPA 1MABB 4R0IA 2KX4A 2ZU4A 1VJ9U 1C5MD 1NFWA 3U98H 4GUXA 2ZZUH 2HLDD 3UPEA 1D6RA 2SGPE 1Y3WA 1O3LA 1Z71A 2HRVA 3SUDA 3RXPA 1QNJA 4JZIA 1DLEA 3GY4A 4ZAEA 1OXGA 3FKSD 1K1JA 1UVUH 1A1RA 1EUFA 1XKAC 1NO9H 1WV7H 2EI6A 4MQAA 2ZGJA 1ESBA 4Y8ZA 1ETRH 2JKHA 1TGTA 1G2MA 3A81A 4AORA 1QBNA 1YCPK 1EAXA 5C3NA 1EZUC 3ZZ5A 3SGBE 1GDUA 1TNHA 2GCTC 1KLIH 1C5SA 1YPJH 3UOPA 1TRYA 3OYPA 3ZZ6A 1GVLA 2HALA 3MH4A 2SGDE 4CRGA 1CSOE 3LOXA 3OY5U 3FZDA 1SHHB 1GMHG 1NRRH 1CT0E 2O8LA 2BD7A 4FETA 1SOTA 5FPYA 2ZIQH 2KCYA 4X6MA 1GBKA 2EC9H 4MNYA 5L6NH 3UNQA 4NWKA 2ANWA 4P00A 1TWXB 2FOHA 1SGNE 2BD4A 1FV9A 2J9NA 2R0KA 1ZMNA 3BTEE 4NFEA 2PW8H 1BHXB 4ABDA 2Y5GA 4B6FA 1GG6B 1LPGB 3F2GA 1O2TA 2VIQA 3M7QA 3RXCA 4AFSA 2BD5A 4JK5A 1Q3XA 4U32A 2Q1JA 2FXRA 1AFEH 1HRTH 3FFGA 1K22H 1KY9A 2BXUH 4MPWA 1DY9A 1QA7A 3BEFB 2WPKS 4INLA 2SGEE 1G3CA 4OGYA 1ABIH 1M9UA 3TJVA 3LONA 2P94A 3MU5A 1HXEH 5GJ4B 1Z1JA 4MNVA 2ANYA 1A5IA 1ELTA 3FANA 4RT1A 1HUTH 3RXTA 3UOUA 2G00A 7LPRA 2RA0A 4ZHLU 1P2IA 5HXFA 1G32B 3RXFA 4AB9A 4XBBA 1UVOA 3MU4A 3ZV8A 4DT7B 5L2ZH 3SI4H 1ELCA 1ZYOA 5DK1A 2BD3A 2G4TA 1TMTH 1D3TB 3KNXA 2PSXA 1S83A 1AMHA 2VB0A 3M5NA 2BDBA 1UTLM 3OTJE 5HM9A 3Q76A 5DPAA 1C1RA 2FI4E 1DM4B 2VH6A 4B1TA 5C1UA 2GTBA 3RLYH 3SU5A 4CR5A 1IQMA 1GHBG 2LPRA 1EQ9A 2XCFA 4ISHH 1MKWK 4X1RU 5IYTA 1WTGH 3OTPA 4H42U 2ZFPH 1ANDA 5GCHF 5TCCA 3LGYA 4HG6A 1IHTH 1Z7KA 2Z9KA 4ISNA 1GJ4H 1ORFA 3MQKC 1TNJA 1O2VA 3UUZA 1ZPZA 2G5NA 5C1YA 1YCPM 1SGQE 1K0HA 4FUGA 2XW9A 1AU8A 2W26A 2BY8X 5G4BA 2F9UA 4FUFA 1CBWC 2OC8A 1INCA 2QIQA 3E0NB 2V3MA 2C90B 2A5AA 4LXBH 4MNWA 3MTYA 2G52A 1S85A 4O3UA 5C67A 1LKBA 2QF5A 3PO1B 3T25A 2ALPA 3ZVFA 3UNSA 1Z8RA 2PKSC 5C94A 2PV9B 9LPRA 3O8CA 1PFXC 1OYQA 2VU8E 3TH4H 5E2OA 2J4IA 2BQWB 1UK2A 2WV4A 3TJOA 1K1NA 4P02A 4Q7ZA 1LTOA 1WUNH 2KFWA 1LMWB 1SGPE 4I86A 1F0UA 1W12U 3DA9B 1OPHB 2A4GA 1VJAU 5EQRA 3V0XA 1TA2A 1W14U 1A3EH 4GLYA 4LZ1H 1GMDG 3ZZ8A 3SU4A 1HAPH 2FI3E 1DITH 5A8XA 1HB0B 2A2QH 2PTCE 2WPLS 2UUJB 5A09A 1C1TA 1IQKA 4CR9A 1U6QA 2NU4E 1YPEH 2VIOA 3SQHE 4K60A 3SUEA 1BMFD 1LPKB 1XUGA 1HLTH 1FY8E 3BTGE 1OKXA 2FMJA 1CA8B 1C1SA 4Y0YE 3MHWU 2QY0B 3RXBA 4JYTA 8GCHF 1AVGH 2I6SA 2FP7B 3NZIA 3MYWA 4PROA 1NFYA 1O37A 3KIDU 4IW4E 1C1VH 3FO8D 1YPMH 1YPKH 3GYMA 4JCNA 4NIVA 3STJA 1O2JA 2BD9A 3RUOA 4JMYA 3TU7H 4YXWD 4NIWA 1J8AA 4OS2A 3CENA 2Y81A 4NGAH 4Q7XA 1ELEE 2QXJA 3GOVB 2BVRH 2QCYA 1Y5AT 1JIRA 4KGAA 1Z8GA 2JDID 1AFQC 2F83A 1TGBA 4XOJA 2JH5D 1AIXH 2ZDAH 1S5SA 2H2ZA 3LT3A 3HPTB 3K65B 2C8YB 4KTCA 3U28C 3E90B 4MTBA 3SN8A 4NA9H 5CHBA 1EAUA 1ELVA 1O3MA 4AFUA 5FL7D 5FX5A 1T8OA 3SJIA 2FWWA 4XBDA 1TX8A 3PV2A 1X7AC 2CN0H 1QQ4A 2A1DB 1BBRK 3RXRA 3A7TA 1SLXB 2ZDLA 2BLOA 2O8TA 1YPLH 1VGCB 4F4OC 3S7KB 4YOJA 1O39A 1TLDA 1BTUA 4AZ2B 1DLKB 1JBUH 1P2KA 3T2NA 3W1EA 3E1XB 3SJ8A 4B2BA 1UTNA 3Q3XA 2ANMH 1FY1A 3EE0B 3ATWA 2ZTZA 1A61H 2BY9X 3MI4A 3MH5A 4TT3D 3SW2B 3E3TA 3NKKA 4MLFB 2SNVA 1UTJA 1EASA 3QZQA 1O5CB 2TGDA 1O3DA 2YOLA 3W94A 1K1LA 3JZ2B 1FLEE 2AGGX 1AI8H 1GBTA 1H8DH 3F9GA 1EAWA 1E1QD 1C5XB 1C2HA 1QL7A 1SLWB 2PUXB 2Z9LA 4ABHA 4A7IB 3UWJH 1YP9A 2GT7A 2C8ZB 1F5LA 1IQHA 3OE7D 2W7SA 1VITH 3GICB 4KTSA 4D9RA 2Y5HA 2PR3A 1MQ5A 3P70B 2XCNA 4ZKOU 1DPOA 2ILNA 1QJ7B 1BOQA 1O2KA 1QY6A 3MO3A 4B75A 4Y11E 4XDEA 1RIWC 2FYQA 3EYDA 1E36B 3F0PA 4IMQA 2OCVB 4ZHMU 1SI5H 2FM2A 3GCOA 5E8EH 4RN6A 5C5OA 1O5DH 4DVAU 3RC5A 3TH3H 4Y7BA 1PQAA 2V7QD 2BMGB 3KQ5A 2P3FH 3S9CA 1V2NT 2HVYB 1AUJA 3M3TA 3P6ZB 1GBHA 2KR7A 3ZIAD 1OWKA 1DX5M 5IDKA 2BDGA 2H5DA 1ZMJA 1ESAA 4AC9A 1HAIH 1TNGA 2ZU1A 3BTTE 1BTHH 1SQAA 4LK4A 1H9HE 3S69A 1UTPA 3ZVAA 5EQSA 1QGFA 2J98A 1SGIB 3EAJA 2ZDVH 1H8IH 2Y7ZA 4IBLH 2AMDA 5F03A 2QXIA 1AB9B 2ZHWH 4ACAA 2H1UA 2M5TA 3PMAB 1W8BH 1AKSB 3ZV9A 3HK6B 2QN5T 1OS8A 1A5HA 1DFPA 4X1NU 2FOCA 1KXAA 2UUFB 2ZC9H 3B23B 1PPFE 1Q31A 2F43B 1C5YB 3A7ZA 3PLKA 1HNEE 4BTUB 4E7NA 4WMFA 4JYUH 2V0BA 1O2XA 4IGDA 3URDA 1W7GH 4F55A 5F8ZA 3LKWA 1SGFG 2IJOB 3ZZ3A 1NT1A 2KAIB 3QTVH 1GL0E 3OAAD 4BAHB 4Y76A 1A0JA 1BB0B 1SC8U 2G4UA 3V12A 5F6MA 2ZA5A 2RG3A 1DWEH 3A88A 2GD4B 5C5NA 4CRFA 3MWIU 5EJ1A 4CHAC 2VWMA 3BG4B 1S82A 2F9VA 2Z3DA 4YLQH 3TK5A 3CP7A 3GYLB 3ZYEA 3TPIZ 1V2TT 3GCHB 1A0LA 3RXUA 4CH2B 7ESTE 4D8NA 2ZFFH 3RXDA 2FO9A 2SGQE 2XOKD 2B5TB 1PYTD 2BOKA 2Z7FE 1VITG 2GMTC 1MCVA 3V3MA 5EW1H 1HJ8A 1V2OT 2GGVB 1ZSJA 4X2VA 1GJ8B 1B7XB 2QYIA 1MKXK 1IQIA 2XNDD 3VXEH 1V2MT 3TIUA 5SGAE 4WJG2 2KZ4A 1C1PA 4HI3A 4OGXA 2UUYA 1YGCH 2AHME 1O3IA 4WF8A 1YWUA 3RU4E 4Q4LA 2H6MA 1P06A 5FBIA 2OC1A 1NRSH 4NWLA 1CHGA 4O9VA 1PPGE 5ETXA 1NRPH 1TB6H 1HBTH 3ATKA 1SQOA 1LHCH 1P3CA 1ABJH 1T31A 2BOHB 2WPHS 2KAIA 3ZZ7A 1DWCH 3M7UA 2ZU3A 1C4Y2 1KDQA 1KXBA 1L1GA 1P9SA 3OFND 2GKVE 2BX3A 2AS9A 5DO4H 1DUEA 1ELAA 3P8GA 2HGTH 2BM2A 4ZUHA 4FUCA 1HDTH 4RI0A 3EE7A 1AO5A 2H9HA 3VB6A 1O3EA 1CGJE 1PPCE 5EGMA 2ZDMA 5KGOA 3EA7A 1HGTH 3L3TA 2L74A 2UUKB 4DIIH 1KLJH 1FPHH 1HYLA 5TCAA 3KF2A 1KTTB 5DJ7A 3MO6A 3S9BA 5DSFA 5GCHG 1NROH 1AB9C 3RXMA 3M3VA 1V2VT 4UFFH 1WXRA 2AEIH 2LNCA 1EKBB 3QWCH 1CU1A 3PV5A 2G5VA 1MBQA 3STIA 2FIRH 2JJ1D 2PHBA 5L2YH 2ZO3H 3ESTA 3TGIE 3RU4T 4ZH8A 5JB8S 2CMYA 1O2LA 1P3EA 1VCWA 4AFZA 1C4V2 3NXPA 4YT7H 1P2MA 4BTIB 1N6YA 4A5TS 1MH0A 1AHTH 5GWZA 1QA0A 3VXFH 1C5RA 4MPXA 1UCYK 3GCTF 1ANCA 3SORA 3ZZ4A 1GDNA 3QDZB 3SO3A 5HIZA 1H9LB 2EEKA 5DG6A 3RMMH 3P95A 1BZXE 3BV9B 1E34B 5CMXH 3SJOA 3ZVDA 2HVXA 3WY8A 2R2MB 3CS0A 4Y10E 1S81A 1BMNH 1GHAG 1NU7B 2Y82A 2J92A 1ARBA 1GBEA 1GBBA 1D3QB 1C5TA 4JZEH 4BAQB 1NN6A 3OY6U 1G9IE 2HLCA 1MTNC 1Y5BT 1EP5A 3E16B 2NU0E 1WU1A 4AG1A 3DHKH 1LKAA 3ODFA 1EPTC 3P8OA 4ASUD 1RGQA 2BZ6H 1JMOH 2O8UA 4CRAA 4FUHA 3M35A 5KEDA 4ABBA 2D1JA 2BY6X 2PSYA 3SGQE 2QAAA 5FAHA 1G2LA 1FNIA 1SPJA 2ZGXH 1D3PB 1H8ED 1XUJA 3MO9A 3SGAE 3L6PA 4WXIA 1MZDA 2ZCHP 3LPRA 4ABJA 1WCZA 5AHGH 1DANH 3UTUH 1THPB 1Y3XA 1ZGIA 1T32A 3M37A 4ACBA 2ALVA 1J17T 2R2WU 4XD7D 3BEIB 3G01A 1P10A 3F68H 2VVVA 2VIDA 3PWBA 1HAVB 4I33A 4YTAA 1L4DA 5JB9S 5FX6A 2C8WB 3ATIA 2DE8A 1TGCA 1PYTC 2XWBI 4FUBA 4LZ4B 1BJUA 4CBOA 1B5GH 1YPGH 1G3BA 1W13U 1IQEA 1CBWB 4BANB 3TJUA 2GZ7A 2FX6A 1BUIA 1TGSZ 3LJOA 4H4FA 5CE1A 1WBGB 1O2OA 1PPZA 2GJGA 1TQ7B 1GI6A 1TYNA 1YCPH 1AWHB 3VEQB 3E0PB 2D26C 2A4QA 4K8YA 3H7TA 1AN1E 4WMDA 2V35A 3N99A 2PKSB 2ZQ1A 1DVAH 4SGBE 3SI3H 1GJBB 5HGGA 4AYVB 1OHHD 1YKTA 2OBOA 4ZROA 1O3PB 1UVTH 2ZNKH 3V13A 1XUHA 4K1TA 1H1BA 1C5OH 1ELFA 1AY6H 2TIOA 1G37A 2F9BH 5C0UA 3SJ9A 2IPHA 5AVDA 7GCHF 2Z9JA 2AERH 1O2ZA 3LGTA 2ODYB 4B73A 5FPSA 4DURA 2TGTA 4ZKRU 3M7TA 3LDXH 2EI8A 1G3EA 4X8TH 4U30A 4AG2A 1E37B 1P8VC 2BVXH 1O3OA 1MUEB 3RXQA 1HAVA 1QJ6B 3PTNA 4I8HA 4GCHF 3F9FA 4JYVH 2FOFA 3SHAH 1FUJA 2ZDKA 5DP3A 3UQVA 4Q7YA 3PRBA 1T7CA 3ITIA 2VBCA 4Z1MD 2BLQA 4AGJA 1P2OA 4DCDA 1QRZA 1SQRA 4AB8A 1KLTA 3HKJB 5GXPA 5LPFA 2WHXA 2W5EA 2ZU2A 4BAKB 1DSUA 3S0NA 1Z1IA 1WYKA 3P17H 3K6ZA 3OEED 1FDPA 1MTVA 2A5KA 3ENSB 4I8GA 4F48B 2F9NA 1ESTA 2A2XH 3A85A 3RMLH 2I6QA 2ZGHA 1GBFA 2FOEA 2DE9A 1AFQB 4U2WA 5E0GA 2V3OH 4RSPA 3ODDA 3AAVA 9ESTA 1ELDE 1FZZA 4H6TA 3PV4A 2Z9IA 4K1SA 4U01A 4FUIA 1GBJA 2ZECA 3K9XB 3P92A 1XX9A 1IQNA 1TX6A 1GHXH 1TMBH 4FU7A 1NM6A 1NS3A 1MQ6A 2VH0A 4JZDH 4Y79A 3V7TA 1P57B 1VZQH 3AAUA 2THFB 2DUCA 3W95A 4Z6AH 1ELBA 3GCNA 3RU4D 3T62A 3R0FA 1COWD 3U8RH 5K0HA 1DSTA 2BB4A 4UFEH 4J2YB 3BN9A 3LC3A 3O8DA 4QT8C 4CREA 1C5QA 4NZQA 1DICA 3K6YA 4I31A 1TOMH 3U1JB 2XTTB 4ABGA 1GI0A 3UR9A 2GV7A 3SU3A 4M7GA 4YM9A 2OLGA 3UIRA 2J94A 4SGAE 2Y7XA 2H9EH 2ZI2H 2XC0A 2AYWA 1GI5A 3I78A 2A7JA 4J1YA 4OM9A 3KCGH 4NIYA 4CRDA 4XSKU 5CHAC 3A7YA 1F5KU 2PLXA 1EJAA 5GDSH 2FI5E 1KXDA 2JJ2D 2XNIA 1GJ9B 5FPTA 1HV7A 1UCYE 2AIQA 2OBQA 3ATMA 3UY9A 1B0FA 5EQQA 3E91A 4THNH 1SGCA 3A8AA 1P11E 1AE8H 4D7GA 1ANBA 4O03A 1A3BH 2H9TH 1C5NH 5HM2A 1LVMA 1RIWB 1O2GH 1FN6A 2P3UB 1O3GA 4LOYH 1TA6A 4X1SU 1C1OA 1C5LH 1WQVH 5JPMH 1KSNA 3H09A 1QTFA 3M5MA 3WW7A 2PUQH 1THSH 1EATA 1K1PA 1MTUA 3A7XA 4FOUC 1GJCB 2BDIA 3QGNB 1O3HA 1DOJA 1ZMLA 1F0SA 5DP8A 5I25A 1SOZA 2LELA 1LDTT 1IQGA 1O30A 1GBLA 1XUIA 1O2PA 1H8HD 3VFEA 2FLBH 1GJ5H 5EJLA 4UFDH 3TNTA 2JH6D 2CXVA 2WINI 1IAUA 3T5FH 2ZFQH 3BTWE 3BIUH 1GGDC 1LVOA 3GY2A 1LQDB 1CGHA 2BTCE 4Y6DA 2ESTE 3A82A 1O32A 1QR3E 1J14A 4X6NA 5DN6D 2Q6GA 1A4WH 3SNDA 1W11U 2EA3A 3A7VA 3TK6A 2XBWA 2VGCC 2IPQX 5GPIB 1TOCB 1D3DB 4UD9H 3A7WA 1BTYA 3ZVEA 2P8OB
chains in the Genus database with same CATH topology
2ZHDA 3MOCA 1O38A 1V2ST 1TRNA 1FIZA 1O2WA 1P01A 4TPYA 5B6OA 1NESE 5JBAS 4BXSA 1SLUB 3LU9B 1QRWA 5DP7A 3QK1A 1GHYH 1NRNH 3SOSA 1SVPA 1BDAA 1O3FA 1GBMA 3QUMP 4FVBA 3BTKE 1PPHE 1SGRE 3ZVGA 5GIBA 3QZRA 1IQLA 3TJNA 2PKAB 1O35A 4CHAB 1GMHF 1JWTA 1EP6A 4XFQA 2NU2E 5A8ZA 3QO6A 1L2EA 4MDSA 3VGCB 1HAXB 1GMCF 4NG9H 4BOHA 1O2HA 2ZPSA 1GJAB 3LGWA 3OX7U 5FCKA 2RCEA 2WUCA 1T8NA 2H5CA 4NA7A 1S0RA 2Q6FA 2FZZA 1LHGH 2GMTB 3GCTG 2TGAA 1OX1A 1O2MA 3PROA 1TNLA 2VIWA 1ZOMA 1AWFH 4RKOB 2OINA 2ODQA 3GISB 3NPSA 4O3TA 1GCDA 1YYY1 5C2ZA 1GHWH 1C2IA 2BZAA 2HNTE 3ZZCA 1D4PB 1P2NA 2OTVA 5FBEA 1UHBB 1BMAA 2IOTA 2SNWA 1ARCA 1ZPBA 5TJXA 1O2RA 4CBNA 1OWDA 3BTDE 2QA9E 3HGNA 5AFZH 1OP8A 1W0ZU 1ZSKA 1TAWA 3BTME 3HK3B 4K5ZA 4IC5A 1SGEE 3LC5A 4DJZB 1Z8JB 2A5IA 4ESTE 3AW1A 4AX9H 5F8XA 4YESB 5HMAA 2BDHA 1HAOH 2XBVA 3MH7A 4X8VH 1OWEA 3GY6A 1L0ZA 4YO9A 1UK3A 1GI4A 3ZZ9A 1YPHC 1QRXA 1O5BB 1GPZA 1Y59T 1THRH 1BMLA 1QURH 1O3AA 2QXHA 3RXHA 2AMQA 3NUMA 1ZTJA 4AYYB 1C1WH 3SV7A 4I7YH 1PJPA 4YT6H 4E06H 1P2QA 3MNSA 3GY8A 2VVCA 1UVSH 3IG6B 1S6HA 2FOBA 1D6WA 5A8YA 2FEQH 1ZR0A 3KEEA 1PPBH 1NFXA 4Z0KA 2J34A 1DY8A 1V2WT 3SV9A 1K2I1 4GVUA 2FS9A 1S0QA 2ASUB 1LHFH 1SMFE 3MNBA 1OP0A 2P8OC 3FZZA 1DXWA 1C2EA 1UHBA 1YBWA 1SQTA 4K3JA 2OUAA 1GWAA 1YC0A 2G8TA 3EDXB 1B0EA 4NZLA 3U9AH 3ELAH 3PLBA 1ZRBA 1F2SE 1GJ7B 2WYJA 2BY7X 1RRKA 1FIWA 4VGCC 4TWYA 3KQCA 1C9TA 2FTMA 1OSSA 1P12E 3EA8A 3U8TH 1V2UT 4ISOA 3RXGA 2QV1A 1E35B 1V2KT 3SUGA 1Y3VA 3ZZBA 1LVYA 2F9PA 3QX5H 3VGCC 1GI7B 4FUEA 1ZRKA 3KHVA 7GCHG 1SHYA 4Y7AA 2O8WA 1W0YH 1RS0A 1C5WB 2PFEA 7KMEH 5I46H 5EPYA 3QN7A 5BPEA 4IC6A 2HOBA 3OSYA 4AN7A 2FESH 4E05H 3O8BA 3KN2A 1NY22 1MBMA 4GCHG 1BRAA 1MTNB 2NU1E 1AKSA 1KXEA 3A87A 4UE7H 5DP4A 1EPTB 2BD2A 3FP6E 3ZZDA 2P95A 3U8OH 3A8CA 5FHTA 3VB5A 2FYRA 4UEHH 1GBIA 3KQDA 2WPMS 2STAE 4K69A 2QC2A 1SFIA 1V2PT 2UWOA 1UVPA 1EOJA 1O3JA 1C9PA 1EOLA 4TPIZ 1C1MA 5DP6A 1NPMA 1CT4E 1XXFA 2Y5FA 6LPRA 2FDAA 1WOFA 5EXLA 2HNTF 3EGKH 1HJ9A 2Z6BD 1H9IE 3QLPH 3SV6A 1TBRH 1C1UH 1L4ZA 3SHCH 1LHEH 5LGOA 1AQ7A 1FAKH 1O36A 2VWNA 3SV2H 1DDJA 5E0HA 1OYTH 3R3GB 3SZNA 4HZHA 1YPHE 1XUFA 2B8OH 1MAXA 2XBYA 2G55A 4GAWA 2WPIS 3SU0A 1SL3A 3O8RA 1MTSA 1BHXF 1YLDA 3A8DA 3GDSA 2B9LA 1EZSC 3PTBA 4JZFH 4YZUA 2OC0A 1ZTKA 3SNCA 1SSXA 2VIVA 3B8JA 1ETTH 4JZ1A 3MNXA 5DGJA 5JBCS 3DD2H 1TABE 4A6LA 1H4WA 1KYNA 3BF6H 4CH8B 2WPJS 1Y3YA 1AUTC 3VB3A 1BBRE 3KQEA 3U69H 1BTPA 1EXFA 1BT7A 1P9UA 4XBCA 3GDUA 5ABWA 1DWDH 1TFXA 3PMHB 3L33A 3BSQA 1C5ZB 4ISLA 3RXKA 1QJ1B 3SU6A 5T6GA 1S84A 3RXIA 1LPZB 5EPNA 1C5VA 3BEUA 1QL8A 1PPEE 1QB1A 1VCQA 1JIMA 2A0QB 2OQ5A 2D2DA 4DG4A 1GHZA 1SFQB 2BDCA 1GDQA 3UFAA 3UQOA 1W2KH 5F8TA 2P59A 3GY7A 5BRRE 1QQUA 6GCHF 1HJAC 2EI7A 1QL9A 1PQ7A 4WY3A 1AVWA 1E0FD 2A4RA 1O2SA 3D23A 4DY7B 1ZTLA 4D7FA 1EAIA 3C1KA 3M3SA 3HATH 3KL6A 2V6NA 1A5GH 2FLRH 4OS1A 1XMNB 1K1OA 2A31A 2VWOA 4DGJA 2ZCLP 3F1SB 1NRQH 3TLOA 1CT2E 3EA9A 1KXCA 5K7RA 1UCYH 1C5PA 1O5GH 2AFQB 1JXPA 2TBSA 1UTOA 1FN8A 3RXJA 1C2KA 1T8LA 2VVUA 3RXSA 3QGJA 4X0WU 1EJMA 8GCHG 5E0JA 1SGTA 4WMEA 4TYDA 2ZWLH 5A0CA 1DWBH 3GY5A 3TGKE 4NCYA 3FVFB 2Z3EA 2QGRA 1IOEA 2ZPQA 2A7CA 4X6PA 3T27A 1V2RT 4ZXXH 1E38B 1P03A 3MH6A 4BNRA 1O3KA 1UO6A 3FP7E 3MNCA 5L30H 2Z3CA 2XC4A 2FOMB 3ZVCA 4GHTA 4ASHA 1EZXC 1DT2A 1CVWH 1MCTA 1T8MA 2ZPRA 2XBXA 4ZKSU 4F49A 2FOGA 4OS7A 3M5LA 1O33A 2R3UA 4OS6A 1TBZH 1J15A 1RTKA 4Y0ZE 1N1LA 4FXGH 4MPUA 3LGVA 2Z94A 1RXPA 2Z9GA 4AFQA 5EXMA 3Q3YA 2PWXA 1O2NA 3SV8A 1LO6A 3Q00A 3NK8A 6CHAB 1EB1H 1HAHH 5CHAB 2WUBA 2VWLA 4IN2A 1MTWA 1YF4A 3I29A 3P8FA 4FVDA 3PYHA 1MD7A 3HGPA 5EXNA 4I32A 1N6XA 1QBOA 1CA0C 1OWIA 3PWCA 2XXLA 3NCLA 2FTLE 1GMCG 2CHAC 1IHSH 2GV6A 1GL1A 2R9PA 2CV3A 1GI8B 1C1QA 2ZFTA 1O5AB 3A8BA 1L1NA 4X8UH 1C4U2 4I8LA 4Q2KA 4MPVA 1T4UH 1FY5A 3GDVA 4NSYA 4IN1A 2G51A 2ZTYA 4AGKA 1A2CH 2W7UA 4B2CA 1C5UA 4KP0A 1BA8B 4Y71A 2VINA 1N8OC 4HFPB 5T3HA 1K9OE 1ETSH 3C27B 1QHRB 2OC7A 1TPPA 1LHDH 5AF9H 1BRBE 1VITF 1C2JA 2R3YA 4WVPE 3RM0H 1HPGA 1FPCH 3D62A 4WH6A 3LH1A 1BTZA 4BAMB 4I8JA 3UWIA 3UREA 2J2UA 2BY5X 4BAOB 1EB2A 3DUXH 3PB1E 1GGDB 1CHOF 1F5RA 3Q77A 2A7HA 2GCHF 1DXPA 2W3KA 1BQYA 2BDAA 1FY4A 4HTCH 3RC4A 3T26A 2QF3A 2BQ6B 2VGCB 1JRTA 3TK9A 2BHGA 3CS7A 1ACBE 4K1EA 3A84A 2A32A 4B71A 1F7ZA 3B9FH 5EU8A 1MMJN 1IQFA 3GY3A 3TH2H 1XXDA 1TPAE 2C93B 2RA3A 2CF9H 2GDEH 1O5FH 1Y3UA 3F9EA 1ZJDA 1YLCA 2C4FH 2ULLA 3N7OA 1BRCE 1GBAA 3AASA 5A0BA 1GBCA 2GZ9A 3MMGA 1XUKA 1Z8IB 3RXLA 1D9IA 1XKBC 4YOIA 2ZFSA 5H4IB 1XVOA 1O0DH 1GI1A 2ZGCA 2ZHQH 3SBKA 4OS5A 2R0LA 4TY7A 3FAOA 3SU1A 1MKWH 1ZJKA 4AOQA 6CHAC 2HPQH 3LGUA 3SJKA 1C2GA 8LPRA 5EOKA 5EODA 1AZ8A 1UTMA 1ZLRA 1TPOA 2F91A 3A86A 4CRBA 5ESTE 1V3XA 4Q80A 3H5CB 3ZZAA 2XRCA 1EX3A 1F0RA 1T4VH 4NA8A 1SGYE 2JH0D 2ODPA 2HNTC 1O3CA 1SBWA 1P02A 1JOUB 1BMMH 1GI9B 1UTKA 4DW2U 5DP9A 1PQ8A 3RMOH 3MFJA 2STBE 2FODA 1OWJA 2BD8A 1SG8B 3RM2H 3DT0H 2BYAX 2CJIA 2IN2A 1HFDA 1O34A 5JDUB 2XWAA 1ZPCA 1GG6C 1GCTB 1BJVA 5LPEA 4A1TA 4OS4A 2UWPA 1RTFB 1GHAF 3TITA 3QTOH 3T28A 3S7HB 1NZQH 4RKJB 1ELGA 2C8XB 4GSOA 1F92A 2XC5A 4MVNA 4O97A 1V6DA 2YNAA 4ZMAH 1TPSA 4WWYA 1C2MA 2FS8A 3UR6A 4ABEA 5J4SA 4MG3A 2GZ8A 1ZHPA 5JBTA 3IITA 1DUAA 1P09A 3DFLA 1UJ1A 1Q2WA 3P8NA 3BTQE 3OU0A 2ZFRH 1QCPA 1SLVB 3I77A 3A89A 2VNTA 2QXGA 3D65E 1GI2A 2P3TB 4FU8A 2F9OA 4D76A 3PMBB 5E2PA 1OOKB 1MAYA 1QBVH 4VGCB 2TPIZ 3SQEE 4B76A 4ZHAA 4UFGH 1AE5A 1S6FA 3F9HA 1V2LT 3RLWH 4KKDA 1W10U 1O2IA 1QB6A 5ESBA 1C1NA 1JRSA 4H6SB 5FCRA 3URCA 1HAZB 3LIWA 1AZZA 3U1IB 1XVMA 2CGAA 4ZKNU 4FUJA 1SGFA 1TIOA 1UTQA 1AD8H 2VJ1A 1TE0A 2JETB 1TALA 4WH8A 1ZZZA 3LGIA 4X1QU 2Y80A 1W3CA 1NU9A 1GHVH 1BBRH 1ZHMA 1O5EH 2ZG0H 2Q6DA 1DS2E 4YLUA 2K1QA 2XYAA 2PTNA 3Q3KA 6GCHG 3RXAA 1QIXB 1TBQH 4XE4A 2WYGA 4GHQA 2AIPA 4A92A 1P0SH 8ESTE 3PO1C 1K21H 1BTWA 3RDZA 3DFJA 1RFNA 1V2QT 1MZAA 2ZP0H 2F3CE 1BIOA 4INKA 1G3DA 1UK4A 1A7SA 2ZCKP 4FUDA 1ZSLA 3M36A 8KME2 5EW2H 1WSSH 4INHA 1O31A 1GJDB 3IWMA 2AGIX 4KTUA 2G81E 1DE7H 2GX4A 1VR1H 3E6PH 1K1MA 2NWNA 3SNBA 3RXOA 4X2YA 4B2AA 1GCTC 1TNKA 4UDWH 2PKAA 3SNAA 2ZU5A 1HCGA 3BIVH 3BTFE 4ZXYH 1WAYB 3ZVBA 3PM3A 3RC6A 1MU8B 3M5OA 4ABIA 1WTHD 2BX4A 1IQJA 2CF8H 1SGDE 1RTLA 1A0HB 4X2WA 2Y6TA 3RMNH 3TGJE 1AGJA 1O3NA 1YM0A 1BCUH 1RJXB 3E8LA 3VB7A 3BG8A 1EZQA 2J95A 4UONA 3MU1A 2FX4A 4A1VA 1TQ0B 3FP8E 1HAGE 1FI8A 1GHBF 1CO7E 3PMJA 4I8KA 3KQBA 5LPRA 1J16A 5LH8A 4K8BA 1OWHA 2BLVA 2O8MA 1P04A 2HWLB 4YOGA 1W7XH 3MU0A 2OP9A 4ISIH 1VCPA 1RD3B 1TNIA 1CQQA 2GVFA 1FMGA 1HJAB 3BTHE 3HKIB 3UNRA 1TX7A 1FY3A 1FXYA 1FONA 1O2QA 2BVSH 2JETC 2FPZA 1KTSB 1L1JA 1GVZA 1Z6JH 2AGEX 1VGCC 2C3SA 1SB1H 2B7DH 3LH3A 3A83A 1KDQB 5A2MH 1NTPA 2B0FA 2HPPH 2SGFE 4ABAA 3LJJA 2ZDNA 2ZHFH 1Y5UT 2SGAA 4MNXA 3RP2A 3K2UA 2W3IA 2UWLA 4BXWA 1ZGVA 1HIAB 2TRMA 1FQ3A 1ID5H 1GMDF 1LVBA 2P93A 2V3HH 2ZTXA 1KXFA 4WXVA 1TGNA 5FXLA 1F0TA 1K28D 4IMZA 2PGQB 5C1XA 1BTXA 2SFAA 4Y8XA 1GI3A 3RXEA 4IS5A 4K2YA 2QF0A 1GBDA 4JK6A 5JBBS 2BQ7B 1ANEA 1FAXA 1XM1A 1AVXA 1MKXH 2D8WA 1P05A 4NIXA 1P2JA 5C20A 1CHOG 1TMUH 2OD3B 4FU9A 2GCHG 2AH4X 1BITA 3M61U 3TNSA 4GPGA 1LCYA 2OXSA 2BDYA 2PGBB 4X2XA 2ZQ2A 2A4OA 2ZF0H 1O3BA 4NFFA 3SU2A 1LQEA 3ZYDA 1QB9A 1Y8TA 3SUFA 2GT8A 3TVJB 3RXVA 5T6DA 4DIHH 1HAYB 1CGIE 5A0AE 5AFYH 2BLWA 4CRCA 2ZEBA 3NWUA 1J9CH 2GCTB 4TWWA 4DOQA 3KGPA 1K1IA 1EPTA 1A46H 2ANKH 1HIAA 1MU6B 2P16A 2RDLA 4KELA 1FJSA 3SNEA 2J38A 3VB4A 1QFKH 2ZHEH 1WQSA 3S9AA 2FOAA 2ZKSA 1C2DA 1CA0B 6ESTA 4TY6A 1BRUP 2ZGBH 2A45B 2CHAB 2TGPZ 1MD8A 3H7OA 1TONA 3AVZA 1Z6EA 3EQ0H 1C2LA 4BTTB 1O2YA 3ATLA 4R8TB 1UMAH 4B74A 4A1XA 1NFUA 1V2JT 3JZ1B 1HXFH 5PTPA 1GJ6A 4ABFA 1NC6A 2OQUA 2O9QA 5EG4A 1N8OB 1G30B 5DP5A 4E7RG 2NU3E 4NSVA 5JYIA 4X6OA 3VPKA 2VIPA 1ZHRA 5J4QA 1GVKB 3A80A 2BXTH 3PLPA 3AW0A 3T29A 3F6UH 2GP9B 2WV5A 3BG4C 5HYOA 4D9QA 2YNBA 1EJNA 1OP2A 3GCHC 4Y8YA 4X1PU 1C2FA 1CE5A 1PQ5A 3MU8A 4HGCA 5DKMA 1O2UA 2GDDA 1G36A 1KIGH 4X8SH 5T6FA 3D49H 1TRMA 1SR5C 2AMPA 4R0IA 2ZU4A 1VJ9U 1C5MD 1NFWA 3U98H 4GUXA 2ZZUH 3UPEA 1D6RA 2SGPE 1Y3WA