4OS6A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk604 (bicyclic 2)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os6A01
2K1QA 1O2GH 1KTTB 1Y3VA 1GI3A 5C20A 2SNVA 1P2IA 1P57B 2R0LA 1K22H 3GDSA 5F8XA 1TRYA 3W94A 1C2IA 1V2LT 1QBVH 2XBXA 1GBMA 1O2JA 4CH8B 1KXCA 1V2QT 3ZZAA 4J1YA 2R3UA 2XTTB 1P10A 4DW2U 2A32A 1A0JA 2BDCA 3A84A 3AASA 3T25A 3L3TA 4BAMB 4NZLA 1D6RA 3QO6A 1C5NH 5AF9H 3LGVA 1A5GH 2EI8A 1C1OA 2F9OA 1SG8B 3SJIA 4ASHA 1ESBA 2ZFSA 1HNEE 4GVUA 1O3DA 1W12U 2FOGA 4Y0YE 3BTEE 1UK2A 4CBNA 4GPGA 3V3MA 2C90B 3PWBA 4B2BA 4K5ZA 1PPCE 1LHCH 2OP9A 1BRUP 2BDYA 4FUBA 4BAKB 3LC3A 3UR6A 1TGTA 2AFQB 2VWNA 4Y71A 1ZSJA 1PQ7A 3OYPA 4GHTA 1ZMJA 1OYTH 1IQGA 3KQBA 1P2KA 3LGWA 1TX8A 1AB9C 4IC5A 1AB9B 2BLOA 3QX5H 4GLYA 2FESH 3LH3A 2A5KA 5EW2H 1K1MA 2FYRA 3PMBB 4ZXYH 1FONA 3KGPA 3PYHA 1C4U2 1ANEA 1SL3A 4IW4E 3KF2A 3MOCA 1FQ3A 1NC6A 3V7TA 2GVFA 2EI6A 4A1TA 2JKHA 1TONA 4QT8C 2R2MB 1CBWC 4GCHG 1N8OB 3DD2H 2ZHQH 1MTUA 1TGCA 3GCNA 5CHAC 3LGTA 4FUIA 3OY6U 2EEKA 1HLTH 2P3TB 2GX4A 2OCVB 5E2PA 1O34A 2BVSH 1LMWB 3ZYEA 1OOKB 1PJPA 2BQWB 1W2KH 1V2UT 1XX9A 5GIBA 1H8IH 1D4PB 1HFDA 2BX3A 1C5XB 5C3NA 2W7UA 2G8TA 5C5NA 1LHDH 1FN6A 1SGRE 2TGPZ 1TWXB 2UWLA 2UUJB 2XBVA 1QA0A 2ODPA 1LPGB 3M5NA 5JPMH 1ZHRA 1WAYB 1GCDA 2OTVA 4MNVA 1M9UA 1H1BA 1XXFA 2OXSA 1OWIA 3GY2A 2SGEE 2BY7X 2ZU5A 7GCHG 1BT7A 2C8WB 3F9FA 3RXIA 3AAUA 3RXLA 4ABBA 1P01A 1LDTT 2GDEH 2GCHF 3ZZ7A 4D8NA 2QIQA 1MCVA 1SLUB 2GZ7A 2FXRA 1DLKB 3MNCA 1LHGH 3TNTA 1UVSH 1V2KT 3M3SA 4YO9A 1SFIA 1GBAA 2P95A 4TY7A 2WV4A 1YPJH 1EOJA 1P05A 4YM9A 3T2NA 1Y5UT 5G4BA 1SHYA 4ZKSU 2A2XH 1S6HA 1F0RA 1ELGA 1SGPE 2YOLA 4U32A 4JYUH 2SGAA 5CHAB 1C5OH 4WMEA 1C1MA 3A7WA 3O8BA 4OGYA 5GJ4B 1TMTH 4H6SB 1QBOA 1YCPK 2J38A 4UFDH 3SV6A 1AQ7A 2J94A 2ZHWH 2BDGA 1RTLA 4YT6H 1MTNB 1EKBB 3SUFA 1GDQA 2A2QH 5A8ZA 4JYTA 1G3DA 3BTWE 1GG6B 4AZ2B 1IAUA 4K8BA 2PTNA 3BTDE 4ZKRU 2FI3E 1C5WB 1ZSKA 4X1RU 4FVBA 3ZZ6A 2TRMA 2R3YA 2BD7A 1ZMNA 1P9SA 2A4RA 5JB8S 5T6GA 4KKDA 3AAVA 3UNQA 4IC6A 1UHBB 2ZFRH 1HRTH 2ZDNA 2BOKA 1OPHB 2PGBB 3TJNA 1EP6A 1GI9B 3ATIA 2GTBA 1HAVB 6GCHG 2Y80A 4X2YA 1BTZA 4AB9A 5T6DA 4ZUHA 4Q7ZA 4K3JA 1A3BH 1QURH 1NFWA 4Y7AA 3ZVFA 4YOJA 5LH8A 4NA7A 4TY6A 3MYWA 1ACBE 4Y0ZE 4YOIA 2XRCA 3EE0B 3NKKA 1XVOA 1NFUA 2V3HH 2Z9LA 1V2NT 4I8HA 2VVCA 2JETC 4UFEH 2ZQ1A 1SFQB 3T29A 3TK6A 2ZHDA 1MKWK 1BHXF 1FDPA 4YLUA 3L33A 1XKBC 1GI4A 2GKVE 2PKSB 4Y8ZA 1C1PA 4OS1A 4WF8A 5K0HA 2P94A 3P8FA 1O3IA 1CHOG 1W0ZU 2SFAA 2AMQA 2GMTB 4GAWA 1GGDC 1LHFH 4FXGH 5EXNA 2P8OC 5L30H 2BD5A 3A81A 4WXVA 3ZVDA 1Y3YA 1W14U 6CHAC 1CHOF 2BX4A 1MMJN 1VITG 2HPQH 2VIOA 1L1NA 3PO1B 1BBRE 1FLEE 4NSYA 1KYNA 1OKXA 2ZIQH 1ANDA 1AU8A 1QB9A 1SGDE 1C5MD 1P2JA 2EC9H 3SI4H 2VJ1A 1RJXB 3ITIA 4YZUA 6LPRA 8ESTE 1NESE 1ZRBA 1MBMA 3BTKE 4I8GA 3LGUA 3SZNA 1HPGA 8LPRA 4ABHA 1GHBG 1OX1A 4JK6A 1HAVA 3BEIB 5T3HA 1YPGH 3T5FH 1XUFA 1V6DA 1SGYE 1GBIA 2CN0H 3MNSA 3RLWH 1G30B 4FU7A 3SJOA 2EA3A 2O8WA 2C93B 3P8GA 2J2UA 1VITH 1RIWC 2ZI2H 2BXUH 3L6PA 7LPRA 2HNTC 4X0WU 2ANYA 1C4Y2 4K1EA 4MPWA 2C8ZB 1UTMA 1NZQH 4INLA 3U1JB 1IHTH 1SOTA 3GYLB 2FOMB 4BTTB 2SGQE 2VU8E 4A5TS 1A1RA 1OSSA 4OS4A 2OC7A 3TPIZ 3SGQE 3SI3H 5JYIA 4O9VA 1G2MA 1A7SA 1GGDB 4KGAA 2BTCE 1T4VH 1W7XH 1AVWA 1C5LH 1IHSH 5AFYH 2I6QA 4K1SA 2NU1E 4CR9A 3NXPA 1HAXB 1Z8JB 1GJCB 3D23A 2UUKB 1GMCG 1V2MT 3V13A 2BXTH 2SGDE 2HNTE 2ZFFH 1BTHH 1TBRH 1AN1E 1YYY1 2ZPRA 2GV7A 1BRAA 1RTFB 5HMAA 1HB0B 4RN6A 1EZXC 3M37A 2VGCB 5ESTE 3TH2H 1GJBB 4A7IB 1BB0B 2OC1A 3ZVAA 2HLCA 1DOJA 1HIAA 3S9CA 3QDZB 2AS9A 2OUAA 8GCHG 1TNKA 1MZAA 1N6XA 1YCPH 2ZKSA 4YT7H 1NT1A 3BF6H 1S85A 2BB4A 1PQAA 1UCYH 2BDHA 2O8MA 3FP8E 4F49A 2WPMS 2VWMA 1KLTA 3BIUH 3M5MA 3ZV8A 3Q00A 1GCTB 1P12E 1CA8B 4Y6DA 1INCA 2GT7A 3MNBA 1SGIB 4AN7A 3M7TA 4DY7B 3M3VA 1D6WA 4Y76A 2ZDLA 2VIDA 1RGQA 2FP7B 2J92A 5GDSH 3ATMA 1BUIA 1EOLA 5FHTA 1TBZH 1TBQH 1KDQA 1T8NA 1HJ9A 4NIYA 1GHXH 3Q3KA 2B9LA 1BRCE 1FN8A 3UY9A 4AGJA 2GZ9A 1NU9A 3SV7A 4J2YB 2AEIH 1VGCC 1VCPA 1K21H 4NIXA 3TGJE 4A1XA 1BQYA 4B75A 1GI2A 1P11E 1YPLH 1V2JT 1CA0B 1GJ8B 1KXEA 1N1LA 4Y7BA 1GJ7B 1TQ7B 3K9XB 3BTGE 1DE7H 1TNIA 4ABEA 4A6LA 1LKAA 1PPZA 1A4WH 1SB1H 3I77A 1BTPA 2THFB 5A09A 4WWYA 1ZLRA 1UVTH 1CU1A 1ORFA 1GHVH 5HM9A 3RXKA 1TNHA 1HJAB 5DP3A 4H4FA 1YM0A 1DY9A 1NRNH 2RDLA 3EGKH 2ZGCA 1SGFG 1V2WT 1P04A 2BY5X 3PV4A 1OWKA 3ZZ4A 5A8YA 5GCHF 1YF4A 3QZQA 2OBQA 3UREA 2FOEA 2FS8A 2B8OH 3F9GA 3SJ8A 2AGGX 1JBUH 1QQ4A 5FXLA 4NGAH 5TJXA 3A83A 2R2WU 2TPIZ 4Q7YA 1EXFA 2XWBI 4FUJA 4XBBA 1F0TA 2G4UA 1TPPA 3BTTE 1AI8H 1MAYA 2B5TB 2M5TA 3ODDA 1WTHD 2BYAX 3E16B 4KTCA 4LZ1H 3BTFE 4Y8XA 2FWWA 4K2YA 3KQEA 1T31A 4FU9A 3SU3A 4IS5A 2V3OH 4ABFA 5DK1A 1BDAA 1VCWA 4ZROA 5CMXH 4OS2A 4DCDA 2TGAA 3KEEA 1QHRB 1F0UA 2TGDA 4CR5A 5FPTA 1P2OA 5EQRA 3EA9A 1CGHA 2ZPSA 5EXMA 1PPGE 1QB1A 2VIQA 3NZIA 3PMHB 4JMYA 6GCHF 1G32B 3MNXA 2UWOA 4DIIH 1V3XA 1AZZA 1ANBA 1QJ1B 1XUJA 4IMQA 2BM2A 1ZTJA 3GYMA 1EAUA 4AB8A 3BV9B 5A0CA 1UTKA 3S69A 4HZHA 1TGNA 1VGCB 1O2RA 5E2OA 4E05H 1KTSB 4F4OC 2YNAA 1AUTC 4TPIZ 2PR3A 1LQEA 5TCCA 1TB6H 2FLBH 4MPVA 4Y8YA 1HXFH 1ELBA 1JOUB 4B74A 1JIRA 3ATLA 3M36A 4PROA 3RXAA 5LGOA 2Q1JA 2ZDVH 1GBEA 2ZO3H 2A4GA 1WSSH 3LGYA 3O8CA 1QJ7B 3TGIE 3UTUH 2ZCLP 2P3FH 3PLBA 2FOBA 2ZF0H 2P59A 3M5LA 2HWLB 4M7GA 1C2HA 1C1VH 5EQSA 1BTYA 1ZRKA 1DXPA 1O3BA 1O38A 4B2AA 3MI4A 3TK9A 1TX6A 1S0RA 3BG4C 2FMJA 1C1QA 1PYTC 4Z0KA 3A85A 4XOJA 3HGNA 1W7GH 2ZGBH 1ZMLA 1WQVH 3K6ZA 5E0HA 3GOVB 1K9OE 1TPAE 2FODA 4ZHLU 2VIWA 5BRRE 1SSXA 3SN8A 2PW8H 1P9UA 1O5CB 1YPMH 4JZFH 1O5BB 1QL7A 2QA9E 3M61U 1ARBA 1VJ9U 2UWPA 3IWMA 2BD4A 3EA7A 1NRQH 1SHHB 2B0FA 1LKBA 3JZ2B 3K65B 4JK5A 5C5OA 4FUEA 1O5AB 1C1RA 1YKTA 2QV1A 3M7UA 2PHBA 1O3JA 1UO6A 1FIWA 4GSOA 1ZOMA 5F03A 5AHGH 2ASUB 2Z94A 4B73A 1UJ1A 2CHAB 3FANA 5C1UA 3O8RA 2WYJA 1HCGA 1GMHF 2IOTA 2FOFA 4LXBH 1EP5A 1MTVA 3SHCH 1H9HE 3JZ1B 1YGCH 1TALA 3U69H 3CS7A 2VB0A 1WOFA 3H7TA 3SV2H 1DWBH 1F92A 2H9EH 5DJ7A 3FFGA 3H5CB 4AG1A 1O2XA 4OS7A 1L4DA 1Y59T 2PLXA 3S9AA 2GV6A 2ILNA 4ZHAA 3VEQB 1EAXA 2FOCA 5C1YA 3RMOH 1JMOH 3O8DA 3P70B 3RXUA 2FEQH 3B23B 4Z6AH 3RC5A 5DGJA 1TGBA 3UOPA 5PTPA 1NN6A 4ISNA 1GBBA 1ESTA 3LT3A 1IQFA 1GBTA 3UOUA 2JH6D 2BY6X 2ZGHA 2ZU4A 3SBKA 4TWWA 3Q77A 1KLIH 4UDWH 1GHWH 3SJ9A 1Z1IA 1FV9A 3RXMA 3MWIU 3E90B 1CE5A 1Z8GA 4AGKA 1KXFA 3SUEA 1TA6A 1TYNA 5DP7A 1XMNB 1QCPA 1D3QB 1GMDG 3DHKH 2V6NA 1ZZZA 1O5DH 1O35A 2ANKH 4FUCA 4DURA 3I78A 2AMDA 4K8YA 3U8TH 4X6NA 5F8TA 3RXHA 3A7TA 1LQDB 2FPZA 2AYWA 2ZTZA 5EODA 3M3TA 1DWEH 3UR9A 2J34A 1V2RT 2AMPA 3SNCA 4DG4A 3FZDA 4CRFA 1G2LA 1ZGIA 1CQQA 2FM2A 1O5FH 1HV7A 3A88A 5DO4H 3MO6A 4I33A 1HUTH 1GBDA 2GGVB 1DS2E 1CGJE 3VB4A 3E6PH 3AW1A 4WXIA 1F5KU 5F8ZA 3Q76A 1NU7B 4U30A 1GMCF 3SV9A 3UWIA 2FI4E 2UUFB 3SGAE 5K7RA 1ZGVA 1E35B 2ZC9H 1GJ4H 4XBDA 2XBYA 4YESB 1EX3A 3MH5A 3UIRA 1H4WA 1ESAA 1ZTLA 4X8UH 1SQAA 1RXPA 3RXPA 2CMYA 1WYKA 4UFFH 5JBBS 1S5SA 1PYTD 1VR1H 7ESTE 1C4V2 5A0AE 1TRNA 1QTFA 2BD9A 1EATA 1SOZA 3PLPA 1IQNA 3GY7A 1O2WA 2PTCE 1J14A 1FJSA 4BAHB 1FMGA 3QTOH 3ZZ9A 3QZRA 1LCYA 3SJKA 4ZKNU 3RUOA 3M7QA 1DUEA 3F9HA 1YP9A 3SQHE 1K1JA 1C1TA 1IQHA 1GMDF 1F7ZA 3RXBA 5AFZH 1IQEA 2A31A 1C5VA 2VVVA 1Y3WA 3TH4H 1YPHC 1TGSZ 1GCTC 4JYVH 1O3AA 2G55A 1GI5A 1TQ0B 1P2QA 4E06H 1W8BH 8GCHF 4WH6A 3NPSA 1NFXA 5FAHA 3BN9A 1Q31A 1EQ9A 1DUAA 1A61H 3TK5A 2ALPA 3TLOA 1LVBA 3A7YA 2WYGA 3KQDA 1J9CH 1BCUH 6ESTA 4DJZB 4JZIA 1QNJA 1Y3UA 1Z1JA 7KMEH 1YLDA 2H9TH 2CGAA 2ESTE 1GI0A 1EAWA 4Q7XA 1SVPA 1SQTA 2HVXA 3TGKE 1O5GH 3MU5A 3S7KB 4XSKU 4FUDA 1YPEH 3SHAH 2Y6TA 1QIXB 1BBRK 1RTKA 4THNH 1ABIH 1PFXC 2ZPQA 2G00A 1EPTC 1OP8A 2P16A 3ZZBA 2BVXH 2NWNA 1S6FA 1XKAC 2W3KA 4ZMAH 2ZG0H 3LJOA 5TCAA 1NRRH 1K1NA 3C1KA 1UCYK 1SR5C 1F2SE 4INKA 2FIRH 1Y3XA 2XC5A 3TJOA 5DP4A 1XUKA 2R9PA 5EXLA 1GHBF 4TWYA 2RG3A 1Y5BT 5DP9A 2BZAA 2J4IA 5EPNA 3RXJA 3ZZCA 3A7XA 1C5SA 1V2PT 2BZ6H 3E3TA 3QWCH 3BIVH 1DLEA 1LVMA 1F0SA 4XDEA 1O2ZA 2ZU1A 3T27A 1GJDB 4X1PU 2GZ8A 1OWEA 1NRPH 2WUBA 1TMUH 3NK8A 3PMAB 2QAAA 3OU0A 1J17T 4BOHA 1IQJA 2GD4B 5IDKA 4Q2KA 5JBCS 3VB6A 4NG9H 1P8VC 5FCRA 1UVPA 1L4ZA 4TPYA 4ZHMU 1QA7A 1GJ9B 1T7CA 5FX5A 2ZECA 4D9RA 2Q6FA 4H6TA 1N6YA 3CS0A 3F68H 3GCTF 3SORA 1MQ5A 3LJJA 1G3EA 1BMNH 1C5TA 1ETRH 2A5IA 1VZQH 1G37A 3RC4A 3K6YA 4CREA 3SNBA 1LVYA 4ABIA 1GBFA 4NFFA 3U8RH 4KTSA 4IN2A 3HK3B 1FY1A 2CF8H 4OGXA 3QGNB 3MTYA 1O2IA 4U2WA 1JIMA 4K1TA 1C5YB 1LTOA 1CO7E 1E34B 1WQSA 2PWXA 3KL6A 2C4FH 4LK4A 1ID5H 3TJUA 1KY9A 4HGCA 1GJ5H 2YNBA 2KAIA 4D9QA 5HGGA 1TNGA 1MQ6A 5ETXA 3GY4A 1GBHA 3RXVA 5ABWA 1JWTA 3LH1A 1ETSH 1UK4A 1ETTH 4AFSA 1UK3A 1CA0C 3MU8A 1FUJA 1NPMA 1IQLA 1THSH 1E38B 3GDUA 2Q6DA 1GJAB 3S0NA 4ABGA 1KXDA 2ZTXA 1AE8H 2QXIA 3ZVBA 1RS0A 2I6SA 1NY22 2EI7A 5FBIA 1SGCA 1O3OA 1GI6A 2ZTYA 1TA2A 5DG6A 2ZU3A 1WTGH 4OS5A 3F9EA 1XUHA 4O3TA 2AIQA 3QK1A 2XW9A 2FDAA 4B76A 2XBWA 3P92A 1K1OA 1C2EA 4ABDA 1FAKH 1KXAA 1XUIA 2WPLS 1TLDA 1AKSB 1C1SA 1C5UA 1QGFA 3EAJA 3VB7A 3ZVGA 2DUCA 1O30A 1AVXA 3TU7H 4KP0A 2VIVA 3MH7A 1K1PA 1ZJKA 2XCNA 3VFEA 4BTIB 1GJ6A 3LKWA 1P06A 1C5RA 1O2VA 1SLXB 2ZU2A 3SNEA 1O36A 1GG6C 3A86A 4YTAA 3SW2B 1O2LA 1SGFA 1FXYA 1AGJA 1Z6JH 5JDUB 1MAXA 4IGDA 2QXHA 4FUGA 5JBAS 1QRXA 5I25A 1A46H 4X6PA 3BTME 1O2QA 2IN2A 1O3EA 2XYAA 3PMJA 1UTQA 4NZQA 4D76A 1UMAH 2PGQB 2ODQA 4ZKOU 1O3KA 1HIAB 3PO1C 3T28A 1YBWA 2Y81A 1E37B 2AERH 1U6QA 2O8UA 2A4OA 2C8YB 5L6NH 1SPJA 5JBTA 4WJG2 1GHAG 3RDZA 1AHTH 3OX7U 1GMHG 2ZA5A 3RLYH 2FI5E 1C5ZB 1FI8A 2G5NA 2QGRA 4LOYH 1WV7H 1THPB 3SQEE 2AH4X 3PM3A 3V12A 1TNLA 1O33A 2FX4A 2ZQ2A 4X2XA 2VINA 2H6MA 2A7CA 4NIWA 4YOGA 3PB1E 3FP7E 1W11U 2ZCHP 4FUHA 3VPKA 1SBWA 5J4QA 1SQOA 1FAXA 4O97A 2WPKS 3NCLA 2XC0A 4X2VA 2KAIB 1CT0E 5FBEA 5SGAE 1AIXH 3ZV9A 3DA9B 1DX5M 1TOCB 1GVKB 3ZZ5A 3E1XB 1RIWB 4AFZA 1MU8B 2RA0A 2Y5GA 4E7RG 2WPHS 3GISB 1UTPA 3UUZA 3MFJA 3RXRA 1V2TT 1A0HB 6CHAB 3A8CA 1DPOA 2STAE 4AOQA 2ANWA 3STJA 4GCHF 4D7GA 4O03A 3H7OA 1ELEE 1XVMA 1DT2A 1ELCA 1HYLA 1O3NA 2ZDMA 5I46H 3ZVCA 3GCOA 2WPIS 2CHAC 1A2CH 4X2WA 1T8LA 2CXVA 3DFLA 5EW1H 5FX6A 2P8OB 3I29A 2OC8A 2XWAA 4VGCB 4WY3A 2BQ6B 1GBJA 2V0BA 4SGBE 1DSTA 2O8TA 1ZYOA 1C2GA 3QUMP 2FOAA 1C2DA 2ULLA 4AYYB 1O2TA 4IMZA 1Q3XA 2CF9H 1JXPA 2VVUA 5B6OA 1D9IA 3A8BA 2BDAA 5DP6A 2STBE 1C1WH 3EA8A 2AGEX 3ENSB 2PV9B 1A5IA 1Z71A 3R0FA 1C2KA 3IITA 2HRVA 2ANMH 2H5CA 3LIWA 2NU4E 1ELFA 3SU1A 4I7YH 4ISLA 1AFEH 1HXEH 3OTJE 4HTCH 1EZQA 3TITA 2XXLA 5LPEA 2Z7FE 3SUGA 1BA8B 2FO9A 2FYQA 3F6UH 5A8XA 3D65E 4MPXA 3RXDA 2SNWA 5GWZA 2DE9A 3ZZ3A 1TNJA 2ZGXH 2AGIX 2HPPH 3LU9B 1DFPA 2R0KA 1W0YH 1AWFH 1OP2A 1CSOE 8KME2 3GY5A 1YCPM 1FNIA 2A7JA 1C1NA 3URCA 1X7AC 3S7HB 1E36B 2PUXB 2ZHEH 1F5LA 5DP5A 1YLCA 1LPZB 3OY5U 4CRCA 2G81E 3MU1A 2Z9KA 1O3HA 1AZ8A 2ZZUH 3HKJB 3N7OA 1QBNA 1O3LA 2J95A 2A45B 2J9NA 4ESTE 1UTNA 1P2MA 1L1GA 2Z3EA 1UHBA 2XC4A 3GY3A 3KCGH 4BTUB 3SO3A 3MU4A 5E0JA 1O5EH 2PKSC 2FZZA 3MMGA 2WV5A 2F9VA 2Z9IA 1O2MA 2BLWA 1BOQA 1OXGA 3ELAH 2QF0A 1O2UA 1B5GH 1HJ8A 4RSPA 2PKAA 3T62A 1PPFE 3PTBA 2Y5FA 3GCHC 2IJOB 2Y7ZA 1O32A 3P8NA 4I32A 4CHAC 5C2ZA 2AIPA 4X1QU 4NWLA 3RM2H 1OS8A 5DPAA 3GY8A 1AFQC 4ABJA 2WPJS 1P0SH 1BHXB 1EZUC 3D49H 1J16A 5HM2A 2XCFA 1C2FA 3LONA 1QJ6B 4WVPE 2OBOA 3P8OA 1PPBH 2FX6A 4Q80A 2H2ZA 4X6OA 1C9PA 3VGCB 5BPEA 3KHVA 1CGIE 3A80A 3PLKA 2CJIA 4JZDH 3RXGA 2H5DA 4ZAEA 1EAIA 1EPTA 4MNWA 1GBLA 1O2HA 1AE5A 1NROH 1NS3A 1S83A 1GWAA 1HAYB 1TAWA 3M5OA 1HAZB 3E8LA 3FAOA 1NFYA 1DSUA 2FLRH 4RKOB 1XUGA 1HAIH 4BAOB 1CBWB 1GDNA 2VGCC 3HPTB 2WINI 1DDJA 1B0EA 1GL1A 3BSQA 5E8EH 4NFEA 3AW0A 2G5VA 2A4QA 3UQOA 2LNCA 4IBLH 1PPHE 3SU5A 4CHAB 3AVZA 3NUMA 1O2SA 1O3CA 5EOKA 1YC0A 5C1XA 1GI8B 2PSYA 4NA9H 4NWKA 3QLPH 1PQ8A 3MO9A 3E91A 1BMMH 5IYTA 1TX7A 1AWHB 2BMGB 3BTHE 4SGAE 1XM1A 2ZEBA 2Q6GA 2ODYB 1OP0A 1OWHA 1W10U 7GCHF 5FPYA 2V35A 1EB2A 2D1JA 1AY6H 1FY3A 2W5EA 5A0BA 3WY8A 2F9UA 2BDIA 4X8VH 2A5AA 3ATKA 4A1VA 2ZFQH 1FPCH 4MG3A 4A92A 1PPEE 1ABJH 2QYIA 3UWJH 3RU4E 5LPFA 2ZFPH 1DY8A 3RC6A 2C8XB 5H4IB 2F9NA 1VITF 3C27B 3P6ZB 4XFQA 1CT4E 3BG4B 3BEUA 4E7NA 4B71A 4X1SU 1NRSH 1TABE 4AG2A 1MTNC 1Q2WA 1H8DH 1QRWA 1CVWH 1MCTA 1RD3B 3UNSA 3TNSA 3E0PB 1FPHH 5GCHG 2NU3E 4JCNA 3QTVH 2QCYA 1IQMA 1CHGA 3VXEH 1OWJA 4UONA 2QF3A 1GBCA 4ZXXH 1P02A 2QY0B 3SV8A 4Y10E 3RMLH 1O3PB 3VB3A 2LPRA 2H1UA 1T32A 5T6FA 5FCKA 5AVDA 1O2KA 4JZ1A 1JRTA 1T4UH 2F9PA 2ALVA 5DKMA 2TGTA 1Y8TA 3SU6A 1K2I1 1O37A 1DVAH 1OYQA 3ZVEA 1FY4A 1MD8A 5HYOA 3B8JA 1SLWB 3MU0A 4B2CA 2OC0A 1ZTKA 3EDXB 4MVNA 3P95A 1G3BA 2VH0A 4XE4A 1GVZA 1BZXE 3EQ0H 1D3PB 3R3GB 2P3UB 1C1UH 1IQKA 1TPOA 2GCTC 1DM4B 4WH8A 3UPEA 1MKXH 4UEHH 3BG8A 4MPUA 3TVJB 1EJNA 1UVOA 4TYDA 1A3EH 3MH4A 1HGTH 1GHZA 5EGMA 3FVFB 4ISIH 2XNIA 2CV3A 1GHYH 2O9QA 1CT2E 1V2ST 3HK6B 1K1IA 2C3SA 3URDA 1BTXA 4CBOA 2Z9GA 3VXFH 4AYVB 1NM6A 2BHGA 1TIOA 3VB5A 1F5RA 3SUDA 5GXPA 3SU2A 2H9HA 3B9FH 1G3CA 3UQVA 4MNYA 1MUEB 1BRBE 3SOSA 1THRH 1SGNE 1AVGH 1WUNH 1XXDA 4DT7B 5CE1A 2W26A 3RXTA 1C9TA 4CRGA 3RXEA 3U9AH 2BQ7B 1L0ZA 4I8LA 2TBSA 1Z6EA 3M35A 3SU0A 4AFUA 1O3GA 2GMTC 1O3FA 2GDDA 4BANB 1MTWA 3G01A 4WMDA 3A89A 4H42U 4Y79A 5HXFA 1SGEE 4Y11E 3TJVA 2F83A 2VWLA 2Y5HA 1T8OA 4R0IA 2ZDAH 2OQ5A 3SU4A 4LZ4B 5ESBA 1QB6A 4INHA 4YLQH 1ZR0A 4GHQA 2F9BH 1RRKA 1P2NA 1ANCA 1Z7KA 1SI5H 1AFQB 4AORA 4NSVA 3HKIB 2VNTA 1YPKH 1B7XB 2A1DB 3ATWA 1FY5A 2GCTB 4B1TA 1C5QA 2ZGJA 2B7DH 4CH2B 1BBRH 1VCQA 1UTJA 2Z9JA 2QN5T 2P93A 3E0NB 1DANH 3A7VA 2OLGA 2BY8X 1Y5AT 3IG6B 2HNTF 5DP8A 2BVRH 3HATH 3DT0H 1MKWH 1YPHE 1W13U 3S9BA 1EPTB 1GBKA 4I8JA 2PUQH 1KLJH 1O0DH 1GPZA 1EJMA 1ZHPA 2FS9A 2D26C 1H9LB 2JH0D 3PWCA 1DWCH 1IQIA 1AMHA 4OS6A 9LPRA 3ZYDA 1KSNA 4UE7H 2NU0E 3TH3H 3T26A 1P09A 4CRDA 3LDXH 3P17H 1ZPBA 1TPSA 3LGIA 2SGPE 1HAPH 9ESTA 1UVUH 1O2PA 1T8MA 1SMFE 4BAQB 5GPIB 2G4TA 4WMFA 1MU6B 3KIDU 3LPRA 3W95A 5JB9S 3GCTG 5C67A 1A0LA 4FU8A 1QRZA 1DICA 1C2MA 2ZDKA 1JRSA 2DE8A 4ISHH 4UD9H 3VGCC 4I8KA 2GT8A 3F1SB 1OWDA 2RA3A 1A5HA 2SGFE 4NIVA 1GVLA 2W7SA 1TFXA 2FTLE 1LHEH 4MQAA 2PKAB 1O2YA 1ZPCA 4O3UA 4FUFA 2Y82A 1SGQE 2Y7XA 3FZZA 1QL8A 2HOBA 1G9IE 3CP7A 2OD3B 1BITA 2A7HA 2ZCKP 1C2LA 2BD2A 2ZHFH 4CRBA 1QFKH 2VH6A 2ZWLH 1WCZA 3SNDA 2BD3A 1SLVB 1ZJDA 3LOXA 3PTNA 1QL9A 1HDTH 1BTUA 1S84A 1P03A 3LC5A 1DITH 3U8OH 1TMBH 3RU4D 4DGJA 1G36A 1L2EA 1RFNA 3RMMH 2WUCA 5EU8A 2TIOA 1HAGE 1BTWA 2Z3DA 1QQUA 1FY8E 3KNXA 3Q3YA 5EQQA 1O3MA 2GCHG 1AUJA 3ODFA 1WBGB 2JETB 3QGJA 4VGCC 2D8WA 3OSYA 1KXBA 1TRMA 5J4SA 3TIUA 1S82A 1MKXK 1KDQB 1IOEA 4D7FA 2QXGA 4MNXA 1GDUA 1P3EA 4HFPB 1H9IE 5L2YH 4NCYA 1MBQA 1MZDA 4AX9H 1V2OT 1UTLM 1QR3E 3NWUA 4NA8A 1HAHH 1Z8IB 1ZSLA 4ZH8A 3RXQA 3A87A 1BJVA 2QXJA 1KIGH 1P3CA 2VWOA 2BY9X 5LPRA 2G51A 1S0QA 3RXFA 1ELDE 1K1LA 1MD7A 2RCEA 1W3CA 1E0FD 3A8AA 5EPYA 1Z8RA 2ZP0H 4ABAA 1NO9H 1TOMH 1DXWA 2Z3CA 3DUXH 4R8TB 4FVDA 3ESTA 3MHWU 1FZZA 3K2UA 1O39A 1J15A 2HALA 1VJAU 3A7ZA 1GI7B 2W3IA 2QC2A 5FPSA 5E0GA 1AD8H 3RXOA 2F3CE 2D2DA 3Q3XA 1SGTA 1BJUA 3U1IB 1UCYE 1HAOH 4MTBA 4ISOA 1D3TB 1GHAF 2HGTH 3UNRA 4KTUA 3U98H 2Z6BD 2PSXA 1FIZA 3GY6A 1DWDH 1LVOA 1ARCA 4K69A 4GUXA 2ZFTA 4RKJB 1L1JA 1TE0A 1O2NA 4IN1A 4HI3A 3V0XA 3UFAA 1J8AA 1EUFA 2BLQA 4BXWA 4I31A 2VIPA 1MTSA 2OQUA 2BD8A 1AO5A 2O8LA 1WU1A 2UUYA 3RP2A 2GP9B 3BEFB 1S81A 1B0FA 1LO6A 1EASA 1ELVA 2F91A 4BNRA 1MH0A 3BTQE 1SC8U 5F6MA 1GI1A 1QY6A 1LPKB 2PFEA 3RM0H 4X6MA 1HJAC 1O31A 4XBCA 3GDVA 1ELTA 2OINA 3QN7A 4AFQA 4BXSA 3RXSA 1ZHMA 3RMNH 1EB1H 2FOHA 2BLVA 1EZSC 5L2ZH 4DVAU 3HGPA 3EYDA 3ZZDA 3CENA 3GCHB 3RXCA 1BMLA 4JZEH 4MDSA 4X8SH 3SGBE 4DIHH 3KN2A 4U01A 3DFJA 3ZZ8A 4CRAA 2BDBA 4UFGH 3GICB 4KELA 3STIA 1BMAA 1PQ5A 1N8OC 3MH6A 4X8TH 1ZPZA 3FP6E 5A2MH 2JH5D 2G52A 1NTPA 2BOHB 3PROA 4DOQA 1O2OA 3KQCA 1C5PA 1UTOA 2ZNKH 1HBTH 3D62A 4X1NU 3RU4T 2NU2E 1ELAA 2IPHA 3A8DA 4MLFB 1D3DB 1EJAA 1GL0E 1C2JA 1V2VT 3A82A 5EG4A 1BIOA 3MO3A 1K28D 3SNAA 4K60A 1AKSA 2FTMA 2A0QB
chains in the Genus database with same CATH superfamily
2K1QA 1O2GH 1KTTB 1Y3VA 1GI3A 5C20A 2SNVA 1P2IA 1P57B 2R0LA 1K22H 3GDSA 5F8XA 1TRYA 3W94A 1C2IA 1V2LT 1QBVH 2XBXA 1GBMA 1O2JA 4CH8B 1KXCA 1V2QT 3OEHD 3ZZAA 4J1YA 2R3UA 2XTTB 1P10A 4DW2U 2A32A 1A0JA 2BDCA 3A84A 3AASA 3T25A 2VBCA 3L3TA 4BAMB 4NZLA 1D6RA 3QO6A 1C5NH 5AF9H 3LGVA 1A5GH 2EI8A 2WHXA 1C1OA 2F9OA 1SG8B 3SJIA 4ASHA 1ESBA 2ZFSA 1HNEE 4GVUA 1YLNA 1O3DA 1W12U 2FOGA 4Y0YE 4F48B 3BTEE 1UK2A 4CBNA 4GPGA 3V3MA 2C90B 3PWBA 4B2BA 3PRDA 4K5ZA 1PPCE 1LHCH 2OP9A 1BRUP 2BDYA 4FUBA 4BAKB 2KR7A 3LC3A 3UR6A 1TGTA 2AFQB 2VWNA 4Y71A 1ZSJA 1PQ7A 2KFWA 3OYPA 4GHTA 1ZMJA 1OYTH 1IQGA 3KQBA 1P2KA 3LGWA 1TX8A 1AB9C 4IC5A 1AB9B 2BLOA 3QX5H 4GLYA 2GJGA 2FESH 5EJZA 3LH3A 2A5KA 5EW2H 1K1MA 2FYRA 3PMBB 4ZXYH 1FONA 3KGPA 3PYHA 1C4U2 1ANEA 1SL3A 4IW4E 3KF2A 3MOCA 1FQ3A 1NC6A 3V7TA 2GVFA 2EI6A 4A1TA 2JKHA 1TONA 4QT8C 2R2MB 1CBWC 4GCHG 1N8OB 4ASUD 3DD2H 2ZHQH 1MTUA 1TGCA 3GCNA 5CHAC 3LGTA 4FUIA 3OY6U 2EEKA 1HLTH 2P3TB 2GX4A 2OCVB 5E2PA 1O34A 2BVSH 1LMWB 3ZYEA 1OOKB 1PJPA 2BQWB 1W2KH 1V2UT 1XX9A 5GIBA 5HIZA 1H8IH 4P00A 1D4PB 1HFDA 2BX3A 1C5XB 5C3NA 2W7UA 2G8TA 5C5NA 1LHDH 1FN6A 1SGRE 2TGPZ 1TWXB 2UWLA 3W1EA 2UUJB 1YWUA 2J98B 2XBVA 3OAAD 1QA0A 2ODPA 2IPQX 1LPGB 3M5NA 5JPMH 1ZHRA 1WAYB 1GCDA 2OTVA 4MNVA 1M9UA 1H1BA 1XXFA 2OXSA 1OWIA 3GY2A 2SGEE 2BY7X 2ZU5A 7GCHG 1BT7A 2C8WB 3F9FA 3RXIA 3AAUA 3RXLA 4ABBA 1P01A 1LDTT 2GDEH 2GCHF 3ZZ7A 4D8NA 2QIQA 1MCVA 1SLUB 2GZ7A 2FXRA 1DLKB 3MNCA 1LHGH 3TNTA 1UVSH 1V2KT 3M3SA 4YO9A 1SFIA 1GBAA 2P95A 4TY7A 2WV4A 1YPJH 1EOJA 1P05A 4YM9A 3T2NA 1Y5UT 5G4BA 1SHYA 4ZKSU 2A2XH 2WSSD 1H8ED 1S6HA 4M9FA 1F0RA 1ELGA 1SGPE 2YOLA 4U32A 4JYUH 2SGAA 5CHAB 1C5OH 4WMEA 1C1MA 3A7WA 3O8BA 4OGYA 5GJ4B 1TMTH 4H6SB 1QBOA 1YCPK 2J38A 4UFDH 3SV6A 1AQ7A 2J94A 2ZHWH 2BDGA 1RTLA 4YT6H 1MTNB 1EKBB 3SUFA 1GDQA 2A2QH 5A8ZA 4JYTA 1G3DA 3BTWE 1GG6B 4AZ2B 1IAUA 4K8BA 2PTNA 3BTDE 4ZKRU 2FI3E 1C5WB 1ZSKA 4X1RU 4FVBA 3ZZ6A 2TRMA 3UAIC 2R3YA 2BD7A 1ZMNA 1P9SA 3F2GA 2A4RA 5JB8S 5DSFA 5T6GA 4KKDA 3AAVA 3UNQA 4IC6A 1UHBB 2ZFRH 1HRTH 2ZDNA 2BOKA 1OPHB 2PGBB 3TJNA 1EP6A 1GI9B 3ATIA 3WWBA 2GTBA 4F55A 1HAVB 6GCHG 3F3BA 2Y80A 1VKYA 4X2YA 2LELA 1BTZA 4AB9A 5T6DA 4ZUHA 4Q7ZA 4K3JA 1A3BH 1QURH 1NFWA 4Y7AA 3ZVFA 4YOJA 5LH8A 2AHME 4NA7A 4TY6A 3MYWA 1ACBE 4Y0ZE 4YOIA 2XRCA 3EE0B 3NKKA 1XVOA 1NFUA 2V3HH 2Z9LA 1V2NT 4I8HA 2VVCA 2JETC 4UFEH 2ZQ1A 1SFQB 4HG6A 3T29A 3TK6A 2ZHDA 1MKWK 1BHXF 1FDPA 4YLUA 1UW7A 3L33A 1XKBC 1GI4A 2GKVE 2PKSB 4Y8ZA 1C1PA 4OS1A 4WF8A 5K0HA 2P94A 3P8FA 1O3IA 1CHOG 1W0ZU 2SFAA 2AMQA 2GMTB 4GAWA 1GGDC 2J98A 1LHFH 4DT4A 4FXGH 5EXNA 2P8OC 5L30H 2BD5A 3A81A 4WXVA 3ZVDA 5CDFE 1Y3YA 1W14U 6CHAC 1CHOF 2BX4A 4XRNA 1MMJN 1VITG 2HPQH 2VIOA 1L1NA 3PO1B 1BBRE 1FLEE 4NSYA 1KYNA 1OKXA 2ZIQH 5KECA 1ANDA 1AU8A 1QB9A 1SGDE 1C5MD 1P2JA 2EC9H 3SI4H 2VJ1A 1RJXB 3ITIA 4YZUA 6LPRA 8ESTE 1NESE 2WPDD 1ZRBA 1MBMA 3BTKE 4RT0A 4I8GA 3LGUA 2L74A 3SZNA 1HPGA 8LPRA 4ABHA 1GHBG 1OX1A 4JK6A 1HAVA 3BEIB 5T3HA 1YPGH 3T5FH 1XUFA 1V6DA 1SGYE 1GBIA 2CN0H 3MNSA 3RLWH 1G30B 4FU7A 3SJOA 2EA3A 2O8WA 2C93B 3P8GA 2J2UA 1VITH 1RIWC 2ZI2H 2BXUH 3L6PA 7LPRA 2HNTC 4X0WU 2ANYA 1C4Y2 3FKSD 4K1EA 2C8ZB 1UTMA 4MPWA 1NZQH 4INLA 5HIYA 3U1JB 1IHTH 1SOTA 3GYLB 2FOMB 5KGOA 3PV2A 4BTTB 2SGQE 2VU8E 4A5TS 1A1RA 1OSSA 4OS4A 2OC7A 3TPIZ 2V7QD 3SGQE 3SI3H 5JYIA 4O9VA 1G2MA 1A7SA 1GGDB 4KGAA 2BTCE 2YMSD 1T4VH 1W7XH 1AVWA 1C5LH 1IHSH 5AFYH 2I6QA 4K1SA 2NU1E 4CR9A 3NXPA 2W6ID 1HAXB 1Z8JB 1GJCB 3D23A 2UUKB 2JJ1D 1GMCG 1COWD 1V2MT 3V13A 2BXTH 2SGDE 2HNTE 2ZFFH 1BTHH 1TBRH 1AN1E 1YYY1 2ZPRA 2GV7A 1BRAA 1BMFD 1RTFB 5HMAA 1HB0B 4RN6A 1EZXC 3M37A 2VGCB 5ESTE 3TH2H 1GJBB 4A7IB 1BB0B 1FX0B 2OC1A 3ZVAA 2HLCA 1DOJA 1HIAA 3S9CA 3QDZB 2AS9A 2OUAA 8GCHG 1TNKA 1W0KD 1MZAA 1N6XA 1YCPH 2ZKSA 4YT7H 1NT1A 3BF6H 1S85A 2BB4A 1PQAA 1UCYH 2BDHA 2O8MA 3FP8E 4F49A 2WPMS 2VWMA 1KLTA 3BIUH 3M5MA 3ZV8A 2K8IA 3Q00A 1GCTB 1P12E 1CA8B 4Y6DA 1INCA 2GT7A 3MNBA 1SGIB 4AN7A 3M7TA 4DY7B 3M3VA 1D6WA 4Y76A 2ZDLA 2VIDA 1RGQA 2FP7B 2J92A 5GDSH 3ATMA 2M2AA 1BUIA 1EOLA 5FHTA 1TBZH 1TBQH 1KDQA 1T8NA 1HJ9A 4NIYA 1GHXH 3Q3KA 2B9LA 1BRCE 1FN8A 3UY9A 4AGJA 2GZ9A 1NU9A 3SV7A 4J2YB 2AEIH 1VGCC 1VCPA 1K21H 4NIXA 5C0TA 5EIYA 5F53A 3TGJE 3CNRA 4A1XA 1BQYA 4B75A 1GI2A 1P11E 1YPLH 1V2JT 1CA0B 1GJ8B 1KXEA 1N1LA 4Y7BA 1GJ7B 1TQ7B 3K9XB 3BTGE 1DE7H 1TNIA 4ABEA 4A6LA 1LKAA 1PPZA 1A4WH 1SB1H 2EY4C 3I77A 1BTPA 2THFB 5A09A 4WWYA 1ZLRA 2KX4A 2KCYA 2W6JD 1UVTH 1CU1A 1ORFA 1GHVH 2EQNA 5HM9A 3RXKA 1TNHA 1HJAB 5DP3A 4H4FA 1YM0A 1DY9A 1NRNH 2RDLA 3EGKH 2ZGCA 1SGFG 1V2WT 1P04A 2BY5X 3PV4A 1OWKA 3ZZ4A 5A8YA 5GCHF 1SKYE 1YF4A 2OBQA 3QZQA 3UREA 2FOEA 2FS8A 2B8OH 3F9GA 3SJ8A 2AGGX 1JBUH 1QQ4A 3H09A 5FXLA 4NGAH 5TJXA 3A83A 2R2WU 2TPIZ 4Q7YA 1EXFA 2XWBI 4FUJA 4XBBA 1F0TA 2G4UA 1TPPA 3BTTE 1AI8H 1MAYA 2B5TB 2M5TA 3ODDA 1WTHD 2BYAX 3E16B 4KTCA 4LZ1H 3BTFE 4Y8XA 2HVYB 2FWWA 4K2YA 3KQEA 1T31A 4FU9A 3SU3A 4IS5A 2V3OH 4ABFA 5DK1A 1BDAA 1VCWA 4ZROA 5CMXH 4OS2A 4XD7D 4DCDA 2TGAA 3KEEA 1QHRB 1F0UA 2TGDA 4CR5A 5FPTA 1P2OA 5EQRA 3EA9A 1CGHA 2ZPSA 5EXMA 1PPGE 1QB1A 2VIQA 3NZIA 3PMHB 4JMYA 6GCHF 1G32B 3MNXA 5EJ1A 2UWOA 4DIIH 1V3XA 1AZZA 1ANBA 1QJ1B 1XUJA 2YMSB 4IMQA 2BM2A 1ZTJA 3GYMA 1EAUA 4AB8A 3BV9B 5A0CA 1UTKA 3S69A 4HZHA 1TGNA 1VGCB 1O2RA 5E2OA 4E05H 3F2FA 1KTSB 4F4OC 2YNAA 2JJ2D 1AUTC 4TPIZ 2PR3A 1LQEA 5TCCA 1TB6H 2FLBH 4MPVA 4RT1A 2PP6A 4Y8YA 1HXFH 1ELBA 4Q4LA 1JOUB 4B74A 1JIRA 3ATLA 3M36A 4PROA 3RXAA 5LGOA 2Q1JA 1YY3A 2ZDVH 1GBEA 2ZO3H 2A4GA 1WSSH 3LGYA 3O8CA 1QJ7B 3TGIE 3UTUH 2ZCLP 2P3FH 3PLBA 2FOBA 2ZF0H 2P59A 3M5LA 3SZEA 2HWLB 4M7GA 1C2HA 1C1VH 5EQSA 1BTYA 1ZRKA 1DXPA 1O3BA 1O38A 4B2AA 3MI4A 3TK9A 1TX6A 1S0RA 3BG4C 2FMJA 1C1QA 1PYTC 4Z0KA 3A85A 4XOJA 3HGNA 1W7GH 2ZGBH 1ZMLA 2WZQA 1WQVH 3K6ZA 5E0HA 3GOVB 1K9OE 1TPAE 2FODA 4ZHLU 2VIWA 5BRRE 1SSXA 3SN8A 2PW8H 1P9UA 3KYGA 1O5CB 1YPMH 4JZFH 1O5BB 1QL7A 2QA9E 3M61U 1ARBA 1VJ9U 2UWPA 3IWMA 2BD4A 3EA7A 1NRQH 1SHHB 2B0FA 1LKBA 3JZ2B 3K65B 4JK5A 5C5OA 4FUEA 1O5AB 1C1RA 1YKTA 2KCAA 2QV1A 3M7UA 2PHBA 1O3JA 1UO6A 1FIWA 4GSOA 1ZOMA 5F03A 5AHGH 2ASUB 2Z94A 4B73A 1UJ1A 2CHAB 3FANA 5C1UA 3O8RA 2WYJA 1HCGA 1GMHF 2IOTA 2FOFA 4LXBH 1EP5A 1MTVA 3SHCH 1H9HE 3JZ1B 1YGCH 1TALA 3U69H 3CS7A 2VB0A 1WOFA 3H7TA 3SV2H 1DWBH 1F92A 2H9EH 5DJ7A 3FFGA 3H5CB 4AG1A 1O2XA 4OS7A 1L4DA 1Y59T 2PLXA 3S9AA 2GV6A 2ILNA 2L6OA 4ZHAA 3VEQB 1EAXA 2FOCA 5C1YA 2WV9A 3OE7D 1E1RD 3RMOH 1JMOH 3O8DA 2OK5A 5T1VA 3P70B 3RXUA 2FEQH 3B23B 4Z6AH 3RC5A 5DGJA 4FETA 1TGBA 3F0OA 3UOPA 5PTPA 1NN6A 4ISNA 1GBBA 5IK2D 1ESTA 3LT3A 1IQFA 1GBTA 3UOUA 2JH6D 2BY6X 2ZGHA 2ZU4A 3SBKA 4TWWA 3Q77A 1KLIH 1E79D 4UDWH 1GHWH 3SJ9A 1Z1IA 1FV9A 3RXMA 3MWIU 3E90B 1CE5A 1Z8GA 4AGKA 1KXFA 3SUEA 1TA6A 1TYNA 5DP7A 1XMNB 1QCPA 1D3QB 1GMDG 3DHKH 2V6NA 5C17A 3U28C 1ZZZA 1O5DH 1O35A 2ANKH 4FUCA 4DURA 3I78A 2AMDA 4K8YA 3U8TH 4X6NA 5F8TA 3RXHA 3A7TA 1LQDB 2FPZA 2AYWA 2ZTZA 5EODA 3M3TA 1DWEH 3UR9A 2J34A 3WWFA 1V2RT 2AMPA 3SNCA 4DG4A 3FZDA 4CRFA 1G2LA 1ZGIA 1CQQA 2FM2A 1O5FH 1HV7A 3A88A 5DO4H 3N99A 3MO6A 4I33A 1HUTH 1GBDA 2GGVB 1DS2E 1CGJE 3VB4A 3E6PH 3AW1A 4WXIA 1F5KU 5F8ZA 3Q76A 1NU7B 2KM0A 4U30A 1GMCF 3SV9A 3UWIA 2FI4E 2UUFB 3SGAE 5K7RA 1ZGVA 3DCLA 1E35B 2ZC9H 1GJ4H 4XBDA 2XBYA 4YESB 1EX3A 3MH5A 3UIRA 1H4WA 1ESAA 1ZTLA 4X8UH 1SQAA 1RXPA 3RXPA 1MABB 2CMYA 1WYKA 4UFFH 5JBBS 1S5SA 1PYTD 1VR1H 7ESTE 1C4V2 5A0AE 1TRNA 1QTFA 2BD9A 1EATA 1SOZA 3PLPA 1IQNA 3GY7A 1O2WA 2PTCE 1J14A 1FJSA 4BAHB 1FMGA 3QTOH 3N7EA 3ZZ9A 3QZRA 1LCYA 3SJKA 4ZKNU 3RUOA 3M7QA 1DUEA 3F9HA 1YP9A 3SQHE 1K1JA 1C1TA 3F2HA 1IQHA 1GMDF 1F7ZA 3RXBA 5AFZH 1IQEA 2A31A 1C5VA 2VVVA 1Y3WA 3TH4H 1YPHC 1TGSZ 1GCTC 4JYVH 1O3AA 2G55A 1GI5A 1TQ0B 1P2QA 4E06H 1W8BH 8GCHF 4WH6A 3NPSA 1NFXA 5FAHA 3BN9A 1Q31A 1EQ9A 1DUAA 1A61H 3TK5A 2ALPA 3TLOA 1LVBA 3A7YA 2WYGA 3KQDA 1J9CH 1BCUH 6ESTA 4DJZB 4JZIA 1QNJA 1Y3UA 1Z1JA 7KMEH 1YLDA 2H9TH 2CGAA 2ESTE 1GI0A 1EAWA 4Q7XA 1SVPA 1SQTA 2HVXA 3TGKE 1O5GH 3MU5A 3S7KB 4XSKU 4FUDA 1YPEH 3SHAH 2Y6TA 1QIXB 1BBRK 1RTKA 4THNH 1ABIH 1PFXC 2ZPQA 2G00A 1EPTC 1OP8A 2P16A 3ZZBA 2J5UA 2BVXH 2NWNA 1S6FA 1XKAC 2W3KA 4ZMAH 2ZG0H 3LJOA 5TCAA 1NRRH 1WXRA 1K1NA 3C1KA 1UCYK 2YMSC 1SR5C 1F2SE 4INKA 2KCPA 2FIRH 1Y3XA 2XC5A 3FOAA 3TJOA 5DP4A 1XUKA 2R9PA 5EXLA 1GHBF 4TWYA 2RG3A 3KYFA 1Y5BT 5DP9A 2BZAA 2J4IA 5EPNA 3RXJA 3ZZCA 3A7XA 1C5SA 1V2PT 2BZ6H 1K0HA 3PV5A 3E3TA 3QWCH 3BIVH 1DLEA 1LVMA 1F0SA 4XDEA 1O2ZA 2ZU1A 3T27A 1GJDB 4X1PU 2GZ8A 1OWEA 1NRPH 2WUBA 3AK5A 1TMUH 3NK8A 3PMAB 2QAAA 3OU0A 1J17T 4BOHA 1IQJA 2GD4B 5IDKA 2F4LA 4Q2KA 5JBCS 3VB6A 4NG9H 1P8VC 5FCRA 1UVPA 1L4ZA 4TPYA 4ZHMU 1QA7A 1GJ9B 1T7CA 5FX5A 2ZECA 4D9RA 2Q6FA 4H6TA 1N6YA 3CS0A 3F68H 3GCTF 3SORA 1MQ5A 3VG8A 3LJJA 4TSFD 1G3EA 1BMNH 1C5TA 1ETRH 2A5IA 1VZQH 1G37A 3RC4A 3K6YA 4CREA 3SNBA 1LVYA 4ABIA 1GBFA 4NFFA 3U8RH 4KTSA 4IN2A 3HK3B 3UB0A 1FY1A 2CF8H 4OGXA 5C0UA 3QGNB 3MTYA 1O2IA 4U2WA 1JIMA 4K1TA 1C5YB 1LTOA 1CO7E 1E34B 1WQSA 2PWXA 3KL6A 2C4FH 2LP6A 4LK4A 1ID5H 3TJUA 5FL7D 1KY9A 4HGCA 1GJ5H 2YNBA 2KAIA 4D9QA 5HGGA 1TNGA 1MQ6A 5ETXA 3GY4A 1GBHA 3RXVA 5ABWA 1JWTA 5EJLA 3LH1A 1ETSH 1UK4A 2KZ4A 1ETTH 4AFSA 1UK3A 1CA0C 3MU8A 1FUJA 1NPMA 1IQLA 1THSH 1E38B 3GDUA 2Q6DA 1GJAB 3S0NA 1W0JD 4ABGA 3KQ5A 1KXDA 2ZTXA 1AE8H 2QXIA 3ZVBA 1RS0A 2I6SA 1NY22 2EI7A 5FBIA 1SGCA 1O3OA 1GI6A 2ZTYA 1TA2A 5DG6A 2ZU3A 1WTGH 4OS5A 3F9EA 1XUHA 4O3TA 2AIQA 3QK1A 2XW9A 2FDAA 4B76A 2XBWA 3P92A 1K1OA 1C2EA 4ABDA 1FAKH 1KXAA 1XUIA 2WPLS 1OHHD 1TLDA 1AKSB 1C1SA 1C5UA 1QGFA 3EAJA 3VB7A 3ZVGA 2DUCA 1O30A 1AVXA 3TU7H 4KP0A 2VIVA 3MH7A 1K1PA 1ZJKA 2XCNA 3VFEA 1NBMD 4BTIB 1GJ6A 3LKWA 1P06A 1C5RA 1O2VA 1SLXB 2ZU2A 3SNEA 1O36A 1GG6C 3A86A 4YTAA 3SW2B 1O2LA 1SGFA 1FXYA 1AGJA 1Z6JH 5JDUB 1MAXA 4IGDA 2QXHA 3F0PA 4FUGA 5JBAS 1QRXA 5I25A 1A46H 4X6PA 3BTME 1O2QA 2IN2A 1O3EA 2XYAA 3PMJA 1UTQA 4NZQA 4D76A 1UMAH 2PGQB 2ODQA 4ZKOU 1O3KA 1HIAB 3PO1C 3T28A 4Z1MD 1YBWA 2Y81A 1E37B 2AERH 1U6QA 2O8UA 2A4OA 2C8YB 5L6NH 1SPJA 5JBTA 4WJG2 1GHAG 3RDZA 1AHTH 3OX7U 1GMHG 2ZA5A 3RLYH 2FI5E 1C5ZB 1FI8A 2G5NA 2QGRA 4LOYH 1WV7H 1THPB 3SQEE 2AH4X 3PM3A 3V12A 1TNLA 1O33A 2FX4A 2ZQ2A 4X2XA 2VINA 2H6MA 2A7CA 4NIWA 4YOGA 3PB1E 3FP7E 1W11U 2ZCHP 4FUHA 3VPKA 1SBWA 5J4QA 1SQOA 3SYJA 1FAXA 4O97A 2WPKS 3NCLA 2XC0A 1WDIA 4X2VA 4P02A 2KAIB 1CT0E 5FBEA 5SGAE 1AIXH 1NBME 3ZV9A 3DA9B 1DX5M 1TOCB 1GVKB 3ZZ5A 3E1XB 1RIWB 4AFZA 1MU8B 2RA0A 2Y5GA 4E7RG 2WPHS 3GISB 1UTPA 3UUZA 3MFJA 3RXRA 1V2TT 1A0HB 6CHAB 3A8CA 1DPOA 2STAE 4AOQA 2ANWA 3STJA 4GCHF 4D7GA 4O03A 3H7OA 1ELEE 1XVMA 3PRBA 1DT2A 1ELCA 1HYLA 1O3NA 2ZDMA 5I46H 3ZVCA 3GCOA 2WPIS 2CHAC 1A2CH 4X2WA 1T8LA 2CXVA 3DFLA 5EW1H 5FX6A 2P8OB 3I29A 2OC8A 2XWAA 4VGCB 4WY3A 2BQ6B 1GBJA 2V0BA 4SGBE 1DSTA 2O8TA 1ZYOA 1C2GA 3QUMP 2FOAA 1C2DA 2ULLA 4AYYB 1O2TA 4IMZA 1Q3XA 2CF9H 2QF5A 1JXPA 2VVUA 5B6OA 1D9IA 3A8BA 2BDAA 5DP6A 2STBE 1C1WH 3EA8A 2AGEX 3ENSB 2PV9B 1A5IA 1Z71A 3R0FA 1C2KA 3IITA 2HRVA 2ANMH 2H5CA 3LIWA 2NU4E 1ELFA 3SU1A 4I7YH 4ISLA 1AFEH 1HXEH 3GS9A 3OTJE 4HTCH 1EFRD 1EZQA 3TITA 2XXLA 5LPEA 2Z7FE 3SUGA 1BA8B 2FO9A 2FYQA 3F6UH 2QE7D 5A8XA 3D65E 4MPXA 3RXDA 2SNWA 5GWZA 2DE9A 3ZZ3A 1TNJA 2ZGXH 2AGIX 2HPPH 3LU9B 1DFPA 2R0KA 1W0YH 1AWFH 1OP2A 1CSOE 8KME2 3GY5A 1YCPM 1FNIA 2A7JA 1C1NA 3URCA 4ZCNA 1X7AC 3S7HB 1E36B 2PUXB 2ZHEH 1F5LA 5DP5A 1YLCA 1LPZB 2JDID 3OY5U 4CRCA 2G81E 3MU1A 2Z9KA 1O3HA 1AZ8A 2ZZUH 3HKJB 3N7OA 1QBNA 2KCOA 1O3LA 2J95A 2A45B 2J9NA 4ESTE 1UTNA 1P2MA 1L1GA 2Z3EA 1UHBA 2XC4A 3GY3A 3KCGH 4BTUB 3SO3A 3MU4A 5E0JA 1O5EH 2PKSC 2FZZA 3MMGA 2WV5A 5DN6D 2F9VA 2Z9IA 1O2MA 2BLWA 1BOQA 1OXGA 3ELAH 2QF0A 1O2UA 1B5GH 1HJ8A 4RSPA 2PKAA 3T62A 1PPFE 3PTBA 2Y5FA 3GCHC 2IJOB 2Y7ZA 1O32A 3P8NA 4I32A 4CHAC 5C2ZA 2AIPA 4X1QU 4NWLA 3RM2H 1OS8A 5DPAA 3GY8A 1AFQC 4ABJA 2WPJS 1P0SH 1BHXB 5CHBA 1EZUC 3D49H 1J16A 5HM2A 2XCFA 1C2FA 3LONA 1QJ6B 4WVPE 2OBOA 3WW7A 3P8OA 4B6EA 1PPBH 4TT3D 2FX6A 4Q80A 2H2ZA 4X6OA 1C9PA 3VGCB 5BPEA 3KHVA 1CGIE 3A80A 3PLKA 2CJIA 4JZDH 3RXGA 2H5DA 4ZAEA 1EAIA 1EPTA 3OEED 4MNWA 1GBLA 1O2HA 1AE5A 1NROH 1NS3A 1S83A 1GWAA 1HAYB 1TAWA 3M5OA 1HAZB 3E8LA 3FAOA 1NFYA 1DSUA 2FLRH 4RKOB 1XUGA 4AC9A 1HAIH 4BAOB 1CBWB 1GDNA 2VGCC 3HPTB 2WINI 1DDJA 1B0EA 1GL1A 3BSQA 5E8EH 4NFEA 1E1QD 3AW0A 2G5VA 2A4QA 2XOKD 3DSOA 3UQOA 2LNCA 4IBLH 1PPHE 3SU5A 4CHAB 3AVZA 3NUMA 1O2SA 1O3CA 5EOKA 1YC0A 5C1XA 1GI8B 2PSYA 4NA9H 4NWKA 3QLPH 1PQ8A 3MO9A 2RFKC 3E91A 1BMMH 5IYTA 1TX7A 1AWHB 2BMGB 3BTHE 4SGAE 1XM1A 2ZEBA 2Q6GA 2ODYB 1OP0A 1OWHA 1W10U 7GCHF 5FPYA 2V35A 5GNDA 1EB2A 2D1JA 1AY6H 1FY3A 2W5EA 3FO8D 5A0BA 3WY8A 2F9UA 2BDIA 4X8VH 2A5AA 3ATKA 4A1VA 2ZFQH 1FPCH 4MG3A 4A92A 1PPEE 1ABJH 2QYIA 3UWJH 3RU4E 5LPFA 2ZFPH 1DY8A 3RC6A 2C8XB 5H4IB 2F9NA 3OTPA 1VITF 3C27B 3P6ZB 4OM9A 4XFQA 1CT4E 3BG4B 3BEUA 4E7NA 4B71A 4X1SU 1NRSH 1TABE 4AG2A 1MTNC 1Q2WA 1H8DH 1QRWA 1CVWH 1MCTA 1RD3B 3UNSA 3TNSA 3E0PB 1FPHH 5GCHG 2NU3E 4JCNA 3QTVH 2QCYA 1IQMA 1CHGA 3VXEH 1OWJA 4UONA 2QF3A 1GBCA 4ZXXH 1P02A 2QY0B 3SV8A 4Y10E 3RMLH 1O3PB 3VB3A 2LPRA 2H1UA 1T32A 5T6FA 5FCKA 5AVDA 1O2KA 2CK3D 4JZ1A 1JRTA 1T4UH 2F9PA 2ALVA 5DKMA 2TGTA 1Y8TA 3SU6A 1K2I1 1O37A 1DVAH 1OYQA 3ZVEA 1FY4A 1MD8A 5HYOA 3B8JA 1SLWB 3MU0A 4B2CA 2OC0A 1ZTKA 3EDXB 4MVNA 3P95A 1G3BA 2VH0A 2F43B 1GVZA 4XE4A 1BZXE 3EQ0H 1D3PB 3R3GB 2P3UB 1C1UH 1IQKA 1TPOA 2GCTC 2RDEA 1DM4B 4WH8A 3UPEA 1MKXH 4YXWD 4UEHH 3BG8A 4MPUA 3TVJB 1EJNA 1UVOA 4TYDA 5HKKD 1A3EH 3MH4A 1HGTH 3NRLA 1GHZA 5EGMA 3FVFB 4ISIH 2XNIA 2CV3A 1GHYH 2O9QA 1CT2E 1V2ST 3HK6B 1K1IA 2C3SA 3URDA 1BTXA 4CBOA 2Z9GA 5C94A 3VXFH 4AYVB 1NM6A 2BHGA 1TIOA 3VB5A 1F5RA 3SUDA 5GXPA 3SU2A 2H9HA 3B9FH 3DSGA 1G3CA 3UQVA 4MNYA 1MUEB 1BRBE 3SOSA 1THRH 1SGNE 1AVGH 1WUNH 1XXDA 4DT7B 5CE1A 2W26A 3RXTA 1C9TA 4CRGA 3RXEA 3U9AH 2BQ7B 1L0ZA 4I8LA 2TBSA 1Z6EA 3M35A 3SU0A 4AFUA 1O3GA 2GMTC 1O3FA 2GDDA 4BANB 1MTWA 3G01A 4WMDA 3A89A 4H42U 4Y79A 5HXFA 1SGEE 4Y11E 3TJVA 2F83A 2VWLA 2Y5HA 1T8OA 4R0IA 2ZDAH 2OQ5A 3SU4A 4LZ4B 5ESBA 1QB6A 4INHA 4YLQH 1ZR0A 4GHQA 2F9BH 1RRKA 1P2NA 1ANCA 1Z7KA 1SI5H 1AFQB 4AORA 4NSVA 3HKIB 2VNTA 1YPKH 1B7XB 2A1DB 3ATWA 1FY5A 2GCTB 4B1TA 1C5QA 2ZGJA 2B7DH 4CH2B 1BBRH 1VCQA 1UTJA 2Z9JA 2QN5T 2P93A 3E0NB 1DANH 3A7VA 2OLGA 2BY8X 1Y5AT 3IG6B 2HNTF 5DP8A 5KEDA 2BVRH 4B6FA 3HATH 3DT0H 1MKWH 1YPHE 1W13U 3S9BA 1EPTB 1GBKA 4I8JA 2PUQH 1KLJH 1O0DH 1GPZA 1EJMA 1ZHPA 2FS9A 2D26C 1H9LB 2JH0D 3PWCA 1DWCH 1IQIA 1AMHA 3DSPA 4OS6A 9LPRA 3ZYDA 1KSNA 4UE7H 2NU0E 3TH3H 3T26A 1KMHB 1P09A 4CRDA 3MQKC 3LDXH 3P17H 1ZPBA 1TPSA 3LGIA 4Q63A 2SGPE 1HAPH 9ESTA 1UVUH 1O2PA 1T8MA 1SMFE 4BAQB 5GPIB 2G4TA 4WMFA 1MU6B 3KIDU 3LPRA 3W95A 5JB9S 3FN8A 1QZ8A 3GCTG 5C67A 1A0LA 4FU8A 1QRZA 1DICA 1SQRA 1C2MA 2ZDKA 1JRSA 2DE8A 4ISHH 4UD9H 3VGCC 4I8KA 2GT8A 3F1SB 1OWDA 2RA3A 1A5HA 3EE7A 2SGFE 4NIVA 1GVLA 2W7SA 1TFXA 2FTLE 2J97A 1LHEH 4MQAA 2PKAB 1O2YA 1ZPCA 4O3UA 4FUFA 2Y82A 1SGQE 2Y7XA 4I86A 3FZZA 1QL8A 2HOBA 1G9IE 3CP7A 2OD3B 1BITA 2A7HA 2ZCKP 1C2LA 2BD2A 2ZHFH 4CRBA 1QFKH 2VH6A 1S6LA 2ZWLH 1WCZA 3SNDA 2BD3A 1SLVB 1ZJDA 3LOXA 3PTNA 1QL9A 1HDTH 1BTUA 2QF4A 1S84A 1P03A 3LC5A 1DITH 3U8OH 1TMBH 3RU4D 4DGJA 1G36A 1L2EA 1RFNA 3RMMH 2WUCA 5EU8A 2TIOA 1HAGE 1BTWA 2Z3DA 1QQUA 1FY8E 3KNXA 3Q3YA 5EQQA 1O3MA 2GCHG 3ZIAD 1AUJA 3ODFA 1WBGB 2JETB 3QGJA 4VGCC 2D8WA 3OSYA 1KXBA 1TRMA 5J4SA 4RI0A 3TIUA 1S82A 1MKXK 1KDQB 1IOEA 4D7FA 2QXGA 4MNXA 1GDUA 1P3EA 4HFPB 1H9IE 5L2YH 2HLDD 4NCYA 1MBQA 1MZDA 3OFND 4AX9H 1V2OT 1UTLM 1QR3E 3NWUA 4NA8A 1HAHH 1Z8IB 1ZSLA 4ZH8A 3RXQA 3A87A 1BJVA 2QXJA 2JIZD 1KIGH 1P3CA 2VWOA 2BY9X 4ACAA 5LPRA 2G51A 1S0QA 3RXFA 1ELDE 1K1LA 1MD7A 2RCEA 1W3CA 3N7DA 1E0FD 3A8AA 5EPYA 1Z8RA 2ZP0H 5B6LA 4ABAA 1NO9H 1TOMH 1DXWA 2Z3CA 3DUXH 2IJD1 4R8TB 4FVDA 3ESTA 3MHWU 1FZZA 3K2UA 1O39A 1J15A 2HALA 1VJAU 3A7ZA 1GI7B 2W3IA 2QC2A 5FPSA 5E0GA 1AD8H 3RXOA 2F3CE 2D2DA 3Q3XA 1SGTA 1BJUA 3U1IB 1UCYE 1HAOH 4MTBA 4ISOA 1D3TB 1GHAF 2HGTH 3UNRA 4KTUA 3U98H 2Z6BD 2PSXA 1FIZA 3GY6A 1DWDH 1LVOA 1ARCA 4K69A 4GUXA 2ZFTA 4RKJB 1L1JA 1TE0A 2V3MA 1O2NA 4IN1A 4HI3A 3V0XA 3UFAA 1J8AA 1EUFA 2BLQA 4BXWA 1H8HD 4I31A 2VIPA 1MTSA 2OQUA 2BD8A 1AO5A 2O8LA 1WU1A 2UUYA 3RP2A 2GP9B 2XNDD 3BEFB 1S81A 1B0FA 1LO6A 1EASA 1ELVA 2F91A 4ACBA 4BNRA 1MH0A 3BTQE 1SC8U 5F6MA 1GI1A 1QY6A 1LPKB 2PFEA 3RM0H 4X6MA 1HJAC 1O31A 4XBCA 3GDVA 1ELTA 2OINA 3QN7A 4AFQA 4BXSA 3RXSA 1ZHMA 3RMNH 1EB1H 2FOHA 2BLVA 1EZSC 5L2ZH 4DVAU 3HGPA 3EYDA 3ZZDA 3CENA 3GCHB 3RXCA 1BMLA 4JZEH 2K0QA 4MDSA 4X8SH 3SGBE 4DIHH 3KN2A 4U01A 3DFJA 3ZZ8A 4CRAA 2BDBA 4UFGH 3GICB 4KELA 3STIA 1BMAA 1PQ5A 1N8OC 3MH6A 4X8TH 1ZPZA 3FP6E 5A2MH 2JH5D 2G52A 1NTPA 2BOHB 3PROA 4DOQA 1O2OA 3KQCA 1C5PA 1UTOA 2ZNKH 1HBTH 3D62A 4X1NU 3RU4T 2NU2E 1ELAA 2IPHA 3A8DA 4MLFB 1D3DB 1EJAA 1GL0E 1C2JA 1V2VT 3A82A 4FOUC 5EG4A 1BIOA 3MO3A 1K28D 3SNAA 4K60A 1AKSA 2FTMA 2A0QB
chains in the Genus database with same CATH topology
2K1QA 1O2GH 1KTTB 1Y3VA 1GI3A 5C20A 2SNVA 1P2IA 1P57B 2R0LA 1K22H 3GDSA 5F8XA 1TRYA 3W94A 1C2IA 1V2LT 1QBVH 2XBXA 1GBMA 1O2JA 4CH8B 1KXCA 1V2QT 3ZZAA 4J1YA 2R3UA 2XTTB 1P10A 4DW2U 2A32A 1A0JA 2BDCA 3A84A 3AASA 3T25A 3L3TA 4BAMB 4NZLA 1D6RA 3QO6A 1C5NH 5AF9H 3LGVA 1A5GH 2EI8A 1C1OA 2F9OA 1SG8B 3SJIA 4ASHA 1ESBA 2ZFSA 1HNEE 4GVUA 1O3DA 1W12U 2FOGA 4Y0YE 3BTEE 1UK2A 4CBNA 4GPGA 3V3MA 2C90B 3PWBA 4B2BA 4K5ZA 1PPCE 1LHCH 2OP9A 1BRUP 2BDYA 4FUBA 4BAKB 3LC3A 3UR6A 1TGTA 2AFQB 2VWNA 4Y71A 1ZSJA 1PQ7A 3OYPA 4GHTA 1ZMJA 1OYTH 1IQGA 3KQBA 1P2KA 3LGWA 1TX8A 1AB9C 4IC5A 1AB9B 2BLOA 3QX5H 4GLYA 2FESH 3LH3A 2A5KA 5EW2H 1K1MA 2FYRA 3PMBB 4ZXYH 1FONA 3KGPA 3PYHA 1C4U2 1ANEA 1SL3A 4IW4E 3KF2A 3MOCA 1FQ3A 1NC6A 3V7TA 2GVFA 2EI6A 4A1TA 2JKHA 1TONA 4QT8C 2R2MB 1CBWC 4GCHG 1N8OB 3DD2H 2ZHQH 1MTUA 1TGCA 3GCNA 5CHAC 3LGTA 4FUIA 3OY6U 2EEKA 1HLTH 2P3TB 2GX4A 2OCVB 5E2PA 1O34A 2BVSH 1LMWB 3ZYEA 1OOKB 1PJPA 2BQWB 1W2KH 1V2UT 1XX9A 5GIBA 1H8IH 1D4PB 1HFDA 2BX3A 1C5XB 5C3NA 2W7UA 2G8TA 5C5NA 1LHDH 1FN6A 1SGRE 2TGPZ 1TWXB 2UWLA 2UUJB 2XBVA 1QA0A 2ODPA 1LPGB 3M5NA 5JPMH 1ZHRA 1WAYB 1GCDA 2OTVA 4MNVA 1M9UA 1H1BA 1XXFA 2OXSA 1OWIA 3GY2A 2SGEE 2BY7X 2ZU5A 7GCHG 1BT7A 2C8WB 3F9FA 3RXIA 3AAUA 3RXLA 4ABBA 1P01A 1LDTT 2GDEH 2GCHF 3ZZ7A 4D8NA 2QIQA 1MCVA 1SLUB 2GZ7A 2FXRA 1DLKB 3MNCA 1LHGH 3TNTA 1UVSH 1V2KT 3M3SA 4YO9A 1SFIA 1GBAA 2P95A 4TY7A 2WV4A 1YPJH 1EOJA 1P05A 4YM9A 3T2NA 1Y5UT 5G4BA 1SHYA 4ZKSU 2A2XH 1S6HA 1F0RA 1ELGA 1SGPE 2YOLA 4U32A 4JYUH 2SGAA 5CHAB 1C5OH 4WMEA 1C1MA 3A7WA 3O8BA 4OGYA 5GJ4B 1TMTH 4H6SB 1QBOA 1YCPK 2J38A 4UFDH 3SV6A 1AQ7A 2J94A 2ZHWH 2BDGA 1RTLA 4YT6H 1MTNB 1EKBB 3SUFA 1GDQA 2A2QH 5A8ZA 4JYTA 1G3DA 3BTWE 1GG6B 4AZ2B 1IAUA 4K8BA 2PTNA 3BTDE 4ZKRU 2FI3E 1C5WB 1ZSKA 4X1RU 4FVBA 3ZZ6A 2TRMA 2R3YA 2BD7A 1ZMNA 1P9SA 2A4RA 5JB8S 5T6GA 4KKDA 3AAVA 3UNQA 4IC6A 1UHBB 2ZFRH 1HRTH 2ZDNA 2BOKA 1OPHB 2PGBB 3TJNA 1EP6A 1GI9B 3ATIA 2GTBA 1HAVB 6GCHG 2Y80A 4X2YA 1BTZA 4AB9A 5T6DA 4ZUHA 4Q7ZA 4K3JA 1A3BH 1QURH 1NFWA 4Y7AA 3ZVFA 4YOJA 5LH8A 4NA7A 4TY6A 3MYWA 1ACBE 4Y0ZE 4YOIA 2XRCA 3EE0B 3NKKA 1XVOA 1NFUA 2V3HH 2Z9LA 1V2NT 4I8HA 2VVCA 2JETC 4UFEH 2ZQ1A 1SFQB 3T29A 3TK6A 2ZHDA 1MKWK 1BHXF 1FDPA 4YLUA 3L33A 1XKBC 1GI4A 2GKVE 2PKSB 4Y8ZA 1C1PA 4OS1A 4WF8A 5K0HA 2P94A 3P8FA 1O3IA 1CHOG 1W0ZU 2SFAA 2AMQA 2GMTB 4GAWA 1GGDC 1LHFH 4FXGH 5EXNA 2P8OC 5L30H 2BD5A 3A81A 4WXVA 3ZVDA 1Y3YA 1W14U 6CHAC 1CHOF 2BX4A 1MMJN 1VITG 2HPQH 2VIOA 1L1NA 3PO1B 1BBRE 1FLEE 4NSYA 1KYNA 1OKXA 2ZIQH 1ANDA 1AU8A 1QB9A 1SGDE 1C5MD 1P2JA 2EC9H 3SI4H 2VJ1A 1RJXB 3ITIA 4YZUA 6LPRA 8ESTE 1NESE 1ZRBA 1MBMA 3BTKE 4I8GA 3LGUA 3SZNA 1HPGA 8LPRA 4ABHA 1GHBG 1OX1A 4JK6A 1HAVA 3BEIB 5T3HA 1YPGH 3T5FH 1XUFA 1V6DA 1SGYE 1GBIA 2CN0H 3MNSA 3RLWH 1G30B 4FU7A 3SJOA 2EA3A 2O8WA 2C93B 3P8GA 2J2UA 1VITH 1RIWC 2ZI2H 2BXUH 3L6PA 7LPRA 2HNTC 4X0WU 2ANYA 1C4Y2 4K1EA 4MPWA 2C8ZB 1UTMA 1NZQH 4INLA 3U1JB 1IHTH 1SOTA 3GYLB 2FOMB 4BTTB 2SGQE 2VU8E 4A5TS 1A1RA 1OSSA 4OS4A 2OC7A 3TPIZ 3SGQE 3SI3H 5JYIA 4O9VA 1G2MA 1A7SA 1GGDB 4KGAA 2BTCE 1T4VH 1W7XH 1AVWA 1C5LH 1IHSH 5AFYH 2I6QA 4K1SA 2NU1E 4CR9A 3NXPA 1HAXB 1Z8JB 1GJCB 3D23A 2UUKB 1GMCG 1V2MT 3V13A 2BXTH 2SGDE 2HNTE 2ZFFH 1BTHH 1TBRH 1AN1E 1YYY1 2ZPRA 2GV7A 1BRAA 1RTFB 5HMAA 1HB0B 4RN6A 1EZXC 3M37A 2VGCB 5ESTE 3TH2H 1GJBB 4A7IB 1BB0B 2OC1A 3ZVAA 2HLCA 1DOJA 1HIAA 3S9CA 3QDZB 2AS9A 2OUAA 8GCHG 1TNKA 1MZAA 1N6XA 1YCPH 2ZKSA 4YT7H 1NT1A 3BF6H 1S85A 2BB4A 1PQAA 1UCYH 2BDHA 2O8MA 3FP8E 4F49A 2WPMS 2VWMA 1KLTA 3BIUH 3M5MA 3ZV8A 3Q00A 1GCTB 1P12E 1CA8B 4Y6DA 1INCA 2GT7A 3MNBA 1SGIB 4AN7A 3M7TA 4DY7B 3M3VA 1D6WA 4Y76A 2ZDLA 2VIDA 1RGQA 2FP7B 2J92A 5GDSH 3ATMA 1BUIA 1EOLA 5FHTA 1TBZH 1TBQH 1KDQA 1T8NA 1HJ9A 4NIYA 1GHXH 3Q3KA 2B9LA 1BRCE 1FN8A 3UY9A 4AGJA 2GZ9A 1NU9A 3SV7A 4J2YB 2AEIH 1VGCC 1VCPA 1K21H 4NIXA 3TGJE 4A1XA 1BQYA 4B75A 1GI2A 1P11E 1YPLH 1V2JT 1CA0B 1GJ8B 1KXEA 1N1LA 4Y7BA 1GJ7B 1TQ7B 3K9XB 3BTGE 1DE7H 1TNIA 4ABEA 4A6LA 1LKAA 1PPZA 1A4WH 1SB1H 3I77A 1BTPA 2THFB 5A09A 4WWYA 1ZLRA 1UVTH 1CU1A 1ORFA 1GHVH 5HM9A 3RXKA 1TNHA 1HJAB 5DP3A 4H4FA 1YM0A 1DY9A 1NRNH 2RDLA 3EGKH 2ZGCA 1SGFG 1V2WT 1P04A 2BY5X 3PV4A 1OWKA 3ZZ4A 5A8YA 5GCHF 1YF4A 3QZQA 2OBQA 3UREA 2FOEA 2FS8A 2B8OH 3F9GA 3SJ8A 2AGGX 1JBUH 1QQ4A 5FXLA 4NGAH 5TJXA 3A83A 2R2WU 2TPIZ 4Q7YA 1EXFA 2XWBI 4FUJA 4XBBA 1F0TA 2G4UA 1TPPA 3BTTE 1AI8H 1MAYA 2B5TB 2M5TA 3ODDA 1WTHD 2BYAX 3E16B 4KTCA 4LZ1H 3BTFE 4Y8XA 2FWWA 4K2YA 3KQEA 1T31A 4FU9A 3SU3A 4IS5A 2V3OH 4ABFA 5DK1A 1BDAA 1VCWA 4ZROA 5CMXH 4OS2A 4DCDA 2TGAA 3KEEA 1QHRB 1F0UA 2TGDA 4CR5A 5FPTA 1P2OA 5EQRA 3EA9A 1CGHA 2ZPSA 5EXMA 1PPGE 1QB1A 2VIQA 3NZIA 3PMHB 4JMYA 6GCHF 1G32B 3MNXA 2UWOA 4DIIH 1V3XA 1AZZA 1ANBA 1QJ1B 1XUJA 4IMQA 2BM2A 1ZTJA 3GYMA 1EAUA 4AB8A 3BV9B 5A0CA 1UTKA 3S69A 4HZHA 1TGNA 1VGCB 1O2RA 5E2OA 4E05H 1KTSB 4F4OC 2YNAA 1AUTC 4TPIZ 2PR3A 1LQEA 5TCCA 1TB6H 2FLBH 4MPVA 4Y8YA 1HXFH 1ELBA 1JOUB 4B74A 1JIRA 3ATLA 3M36A 4PROA 3RXAA 5LGOA 2Q1JA 2ZDVH 1GBEA 2ZO3H 2A4GA 1WSSH 3LGYA 3O8CA 1QJ7B 3TGIE 3UTUH 2ZCLP 2P3FH 3PLBA 2FOBA 2ZF0H 2P59A 3M5LA 2HWLB 4M7GA 1C2HA 1C1VH 5EQSA 1BTYA 1ZRKA 1DXPA 1O3BA 1O38A 4B2AA 3MI4A 3TK9A 1TX6A 1S0RA 3BG4C 2FMJA 1C1QA 1PYTC 4Z0KA 3A85A 4XOJA 3HGNA 1W7GH 2ZGBH 1ZMLA 1WQVH 3K6ZA 5E0HA 3GOVB 1K9OE 1TPAE 2FODA 4ZHLU 2VIWA 5BRRE 1SSXA 3SN8A 2PW8H 1P9UA 1O5CB 1YPMH 4JZFH 1O5BB 1QL7A 2QA9E 3M61U 1ARBA 1VJ9U 2UWPA 3IWMA 2BD4A 3EA7A 1NRQH 1SHHB 2B0FA 1LKBA 3JZ2B 3K65B 4JK5A 5C5OA 4FUEA 1O5AB 1C1RA 1YKTA 2QV1A 3M7UA 2PHBA 1O3JA 1UO6A 1FIWA 4GSOA 1ZOMA 5F03A 5AHGH 2ASUB 2Z94A 4B73A 1UJ1A 2CHAB 3FANA 5C1UA 3O8RA 2WYJA 1HCGA 1GMHF 2IOTA 2FOFA 4LXBH 1EP5A 1MTVA 3SHCH 1H9HE 3JZ1B 1YGCH 1TALA 3U69H 3CS7A 2VB0A 1WOFA 3H7TA 3SV2H 1DWBH 1F92A 2H9EH 5DJ7A 3FFGA 3H5CB 4AG1A 1O2XA 4OS7A 1L4DA 1Y59T 2PLXA 3S9AA 2GV6A 2ILNA 4ZHAA 3VEQB 1EAXA 2FOCA 5C1YA 3RMOH 1JMOH 3O8DA 3P70B 3RXUA 2FEQH 3B23B 4Z6AH 3RC5A 5DGJA 1TGBA 3UOPA 5PTPA 1NN6A 4ISNA 1GBBA 1ESTA 3LT3A 1IQFA 1GBTA 3UOUA 2JH6D 2BY6X 2ZGHA 2ZU4A 3SBKA 4TWWA 3Q77A 1KLIH 4UDWH 1GHWH 3SJ9A 1Z1IA 1FV9A 3RXMA 3MWIU 3E90B 1CE5A 1Z8GA 4AGKA 1KXFA 3SUEA 1TA6A 1TYNA 5DP7A 1XMNB 1QCPA 1D3QB 1GMDG 3DHKH 2V6NA 1ZZZA 1O5DH 1O35A 2ANKH 4FUCA 4DURA 3I78A 2AMDA 4K8YA 3U8TH 4X6NA 5F8TA 3RXHA 3A7TA 1LQDB 2FPZA 2AYWA 2ZTZA 5EODA 3M3TA 1DWEH 3UR9A 2J34A 1V2RT 2AMPA 3SNCA 4DG4A 3FZDA 4CRFA 1G2LA 1ZGIA 1CQQA 2FM2A 1O5FH 1HV7A 3A88A 5DO4H 3MO6A 4I33A 1HUTH 1GBDA 2GGVB 1DS2E 1CGJE 3VB4A 3E6PH 3AW1A 4WXIA 1F5KU 5F8ZA 3Q76A 1NU7B 4U30A 1GMCF 3SV9A 3UWIA 2FI4E 2UUFB 3SGAE 5K7RA 1ZGVA 1E35B 2ZC9H 1GJ4H 4XBDA 2XBYA 4YESB 1EX3A 3MH5A 3UIRA 1H4WA 1ESAA 1ZTLA 4X8UH 1SQAA 1RXPA 3RXPA 2CMYA 1WYKA 4UFFH 5JBBS 1S5SA 1PYTD 1VR1H 7ESTE 1C4V2 5A0AE 1TRNA 1QTFA 2BD9A 1EATA 1SOZA 3PLPA 1IQNA 3GY7A 1O2WA 2PTCE 1J14A 1FJSA 4BAHB 1FMGA 3QTOH 3ZZ9A 3QZRA 1LCYA 3SJKA 4ZKNU 3RUOA 3M7QA 1DUEA 3F9HA 1YP9A 3SQHE 1K1JA 1C1TA 1IQHA 1GMDF 1F7ZA 3RXBA 5AFZH 1IQEA 2A31A 1C5VA 2VVVA 1Y3WA 3TH4H 1YPHC 1TGSZ 1GCTC 4JYVH 1O3AA 2G55A 1GI5A 1TQ0B 1P2QA 4E06H 1W8BH 8GCHF 4WH6A 3NPSA 1NFXA 5FAHA 3BN9A 1Q31A 1EQ9A 1DUAA 1A61H 3TK5A 2ALPA 3TLOA 1LVBA 3A7YA 2WYGA 3KQDA 1J9CH 1BCUH 6ESTA 4DJZB 4JZIA 1QNJA 1Y3UA 1Z1JA 7KMEH 1YLDA 2H9TH 2CGAA 2ESTE 1GI0A 1EAWA 4Q7XA 1SVPA 1SQTA 2HVXA 3TGKE 1O5GH 3MU5A 3S7KB 4XSKU 4FUDA 1YPEH 3SHAH 2Y6TA 1QIXB 1BBRK 1RTKA 4THNH 1ABIH 1PFXC 2ZPQA 2G00A 1EPTC 1OP8A 2P16A 3ZZBA 2BVXH 2NWNA 1S6FA 1XKAC 2W3KA 4ZMAH 2ZG0H 3LJOA 5TCAA 1NRRH 1K1NA 3C1KA 1UCYK 1SR5C 1F2SE 4INKA 2FIRH 1Y3XA 2XC5A 3TJOA 5DP4A 1XUKA 2R9PA 5EXLA 1GHBF 4TWYA 2RG3A 1Y5BT 5DP9A 2BZAA 2J4IA 5EPNA 3RXJA 3ZZCA 3A7XA 1C5SA 1V2PT 2BZ6H 3E3TA 3QWCH 3BIVH 1DLEA 1LVMA 1F0SA 4XDEA 1O2ZA 2ZU1A 3T27A 1GJDB 4X1PU 2GZ8A 1OWEA 1NRPH 2WUBA 1TMUH 3NK8A 3PMAB 2QAAA 3OU0A 1J17T 4BOHA 1IQJA 2GD4B 5IDKA 4Q2KA 5JBCS 3VB6A 4NG9H 1P8VC 5FCRA 1UVPA 1L4ZA 4TPYA 4ZHMU 1QA7A 1GJ9B 1T7CA 5FX5A 2ZECA 4D9RA 2Q6FA