4OS7A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk607 (bicyclic)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 58
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os7A01
1O2SA 1GI7B 5EODA 2BVSH 1GHBF 3UFAA 1MU8B 1EAUA 2IJOB 2OC7A 1GBKA 1E0FD 2PKAA 1ZSKA 3L6PA 1O38A 4B1TA 3A80A 3GCHB 4FUIA 5JBAS 1K1LA 1G3BA 1DUAA 1Z8IB 3KHVA 1TX6A 1P01A 4BAKB 4B76A 3GCTF 2ZPRA 3NWUA 1PPCE 2XTTB 3HKJB 4UFEH 4U30A 2H2ZA 3QUMP 2BD4A 1ZJKA 1UTLM 2V6NA 1O2NA 4FUDA 2ZP0H 4FUFA 1C1UH 2QF0A 3VGCB 3ZYDA 5JB8S 2GCHF 1QB1A 4LZ4B 2QXGA 1ZR0A 4WY3A 2BZAA 1XUIA 2H1UA 3A7TA 3U69H 1OP8A 4AG1A 3ZZAA 5A09A 2ANYA 1C1MA 1MTWA 3M36A 4D7FA 5A0AE 1PPFE 4X8SH 1Y3VA 2BOHB 2A5IA 3RMOH 2J4IA 1ZMLA 3AASA 1HIAB 2BY5X 3SNAA 2VWNA 4CBNA 2VVCA 4O3TA 2BVXH 3P8OA 1BTWA 1TBQH 1YKTA 3MO3A 3UR9A 3TH3H 2G81E 4KP0A 3UQOA 1SPJA 1ESBA 1C1QA 3GY3A 1K1IA 2ZGBH 5JBTA 1BJUA 1ZTKA 2ZG0H 2CHAB 2KAIB 4UFFH 1TPAE 3R0FA 2B0FA 2OUAA 2GX4A 4H4FA 5FHTA 5EW1H 1X7AC 1GBBA 1HAOH 3RXHA 2VU8E 1GJAB 1C2GA 3A86A 5I25A 2ZFPH 4XBBA 2YOLA 2ZDKA 1WQSA 3RM2H 2UUJB 3KIDU 1SQOA 5DP8A 1A2CH 1NRNH 1TPOA 1WCZA 2AYWA 1EJNA 4ZXXH 3UUZA 5C1YA 4K1TA 4ZROA 4DY7B 4Q2KA 3TLOA 3P8NA 4CRBA 1KTSB 2BQ6B 1MKXK 4DVAU 1TIOA 1UTKA 4A1TA 3KL6A 7GCHG 1HJ8A 1H9HE 1DSTA 1FIZA 1Z6JH 3U8OH 2F9UA 1DSUA 1ETSH 2DE9A 4K1EA 1E35B 1FDPA 1MH0A 1O2XA 3SOSA 1D3DB 4HGCA 3A81A 1UK4A 3RLYH 1ZPZA 3GY6A 4CR5A 2STBE 3W95A 2BQWB 2XBYA 1GMCF 3TGKE 1ESAA 1AZ8A 5TJXA 1T7CA 1FNIA 4MNXA 4UONA 3O8CA 1TE0A 1NRQH 5J4QA 1O3KA 3VXEH 4Y7AA 3E1XB 5FX5A 4A1VA 1YPHE 1LVMA 1ZMNA 4OS6A 4CRGA 1GMHF 1V2TT 3ATKA 1H9LB 2JETB 1N6YA 5A0BA 1A7SA 3RXEA 1O3JA 3LJJA 2PUQH 4D76A 3HGNA 3ZZCA 1TX8A 3RDZA 8KME2 1K1NA 3DFLA 3SJIA 2R9PA 2PLXA 2Z3EA 3LGTA 6CHAB 2OTVA 4D8NA 1YCPM 2V3HH 4ZKSU 3RXFA 1P10A 3P70B 2CGAA 1KLIH 1CVWH 4FXGH 2J38A 1C5MD 2D1JA 2R3YA 1F5KU 1IQLA 1NO9H 5DPAA 5JYIA 4GUXA 4Q7YA 3AVZA 1FMGA 4ABIA 3KN2A 5E2OA 1OWDA 4FUJA 1BMAA 1QFKH 1C5OH 4KTCA 3UWJH 1AWHB 5EXMA 1PYTC 2W3IA 2BDAA 1NESE 1HGTH 4ZKRU 1FLEE 3SV7A 4CREA 1W10U 1O37A 2FMJA 3URDA 1Y5AT 3ZZ8A 2R0LA 4ABEA 1D4PB 2BLQA 3LPRA 2FESH 4IBLH 1GHZA 2ODQA 1G30B 3KQEA 3ESTA 1O5EH 1CT4E 1VR1H 3BEIB 4IMZA 1S83A 5EW2H 4Q7XA 3KF2A 3PLPA 5JBBS 2ZDMA 4O97A 3MU5A 2UWPA 4XSKU 3S9CA 1QL8A 1UO6A 2A7JA 3GYLB 2R2MB 4CBOA 4X2YA 4BAQB 3SNCA 4NFFA 4LXBH 4HTCH 5ETXA 1C5RA 3TU7H 1BJVA 1TOCB 1EZXC 1RJXB 1AQ7A 3UIRA 5DO4H 2PTCE 1O31A 2ZFTA 2BYAX 2Z9IA 1EJAA 3SHAH 1BRCE 1TPPA 4WF8A 2PGBB 3DUXH 3P6ZB 3SJOA 4D9RA 3SU6A 1C1NA 2ULLA 1DICA 5EOKA 4DT7B 2EI7A 4SGAE 1D3QB 1QRWA 2GP9B 3BTDE 1YGCH 1C4V2 5AHGH 2NU3E 1GI1A 2J34A 4Y0ZE 1G32B 3C1KA 3P95A 2W3KA 2O8UA 3LDXH 2G00A 1Z6EA 3I29A 1O2KA 1OP2A 3MU0A 1PJPA 1F5LA 5GIBA 4E7RG 2OP9A 2QCYA 3ATWA 5EQRA 5GPIB 3K6YA 5E2PA 1C2DA 1AMHA 1O3LA 2ZI2H 3E3TA 3RMMH 3UR6A 3SW2B 1YBWA 2PUXB 3KQBA 2XC4A 5JPMH 4ZKOU 4ISHH 1GGDB 3PTBA 3TGIE 3RXLA 4H6TA 3QWCH 4OGYA 4ABGA 1BTHH 1UTJA 3TNSA 2UWOA 1UTMA 1GHVH 4BOHA 1ZRKA 3EA9A 1QQ4A 1SLXB 1AU8A 1ELCA 1V2UT 2A45B 3QN7A 1GL0E 1HDTH 4IGDA 5A8ZA 1THPB 5LPEA 1ORFA 2W26A 2GCHG 1WTHD 2WYJA 1SGQE 1PQ7A 1OOKB 2JETC 2STAE 1MCTA 1OYTH 1F0TA 1GBCA 2H9EH 1DWBH 1EOLA 5SGAE 1GJ6A 1Z8RA 3PB1E 1B0FA 1GBMA 1O0DH 1HAPH 4A92A 2TPIZ 1G9IE 1SR5C 2BDGA 2BDCA 2VWOA 3SJ8A 3LKWA 3TVJB 1SGIB 4MNYA 3QDZB 3SU0A 2BDYA 3Q3KA 1JXPA 2Z9GA 5H4IB 4LZ1H 2ZHEH 1HAVB 4FU7A 5FX6A 2F9NA 1AE5A 2F9BH 4B2AA 1BDAA 8GCHG 1NU9A 1P2IA 1RIWB 3TH2H 2QXIA 1GJ7B 5K0HA 3LGYA 2RA3A 2ZU3A 1JOUB 4NA9H 2WV5A 4BAMB 4NZLA 5EXNA 1TFXA 3MWIU 1T8NA 2F3CE 3T5FH 1D6WA 3R3GB 1O2QA 2ZKSA 3SNBA 1VCQA 3RXCA 1QR3E 3BTGE 3FZDA 1YPMH 1F5RA 2ANMH 2GMTC 1AE8H 1BMNH 4IC6A 3IG6B 3LGVA 1W3CA 5ESTE 1NRPH 2HLCA 5AVDA 1BMMH 2A7HA 1C1PA 1FY3A 1UCYE 4MTBA 4BNRA 1W7XH 1LVYA 1FY5A 1RGQA 1GBEA 3MNCA 2PTNA 3Q3XA 3T2NA 2BX4A 1BB0B 3BIVH 2PV9B 3BTTE 2GMTB 1ELDE 3UPEA 1HJAC 2PKSB 5DP7A 3GY7A 2ZZUH 1GBAA 4XFQA 3GOVB 2FOBA 1T4UH 1K1MA 3GY2A 3QZQA 3MH6A 3VB7A 1TGBA 1ZYOA 4MPWA 2XCFA 4Y7BA 1GG6B 1A61H 1O2GH 9LPRA 2J2UA 2H5CA 2J95A 3TJOA 2Y5GA 4JZEH 4AGKA 3ZZ9A 3P8FA 1MBMA 3RXKA 1ELAA 1XKBC 1IAUA 3MU8A 1SGTA 2BQ7B 1JIMA 3GDSA 5C2ZA 2BXUH 2ZFFH 1TAWA 2UUKB 2F91A 2Z9KA 6LPRA 4RKOB 2BM2A 1LKBA 5JDUB 3SQHE 1O5CB 4MG3A 1GBHA 2SGEE 2Z3CA 2FOGA 1O30A 1ANCA 5HM2A 3S9AA 4DGJA 4TY7A 4WJG2 1P05A 1XXFA 3TITA 3SBKA 2ZGCA 5HXFA 4ZHMU 1WYKA 5A0CA 1WV7H 1GHBG 3LH3A 4BXWA 3B23B 2Y5HA 3GCHC 3T28A 4ABDA 4YTAA 1G37A 2QF3A 1L4DA 1Z1JA 2GCTC 1AKSA 4IC5A 4LOYH 2K1QA 1EB2A 1IQIA 1UK2A 1QHRB 2ZNKH 2GZ8A 3G01A 1LQEA 3PMBB 3I78A 1WOFA 4YLQH 4X6PA 2QN5T 3KCGH 2BZ6H 1ELVA 1UVOA 1NFUA 8ESTE 4TYDA 1ZTLA 1WBGB 1RTKA 3F9HA 4OS4A 3BV9B 3MU1A 4JZ1A 1MAXA 1AFEH 3SV6A 1P2JA 2ZECA 1C5QA 4JYUH 3C27B 2BD8A 2ZU1A 3A8BA 3CENA 1GI5A 3PO1C 1O3BA 2BY9X 1LVBA 3MH4A 1DWDH 3GDVA 5EQQA 1P3EA 3RUOA 1C5PA 3OTJE 3CS0A 3U1JB 4ZHLU 1QURH 3UNSA 1DX5M 2TGTA 1O2LA 1HLTH 2ZQ1A 1VITH 2FI5E 4NZQA 4CR9A 1C5TA 1C5NH 2M5TA 4NA7A 2WPJS 4ABHA 1EX3A 3E16B 2PSXA 1OXGA 2F83A 1SQTA 1UCYK 4F4OC 4AX9H 1C2HA 1P04A 2XRCA 4M7GA 3E90B 1KXCA 5CHAC 1AUTC 3SQEE 4CH2B 1L1GA 4K69A 1IOEA 2ZFRH 1T8MA 4K60A 3SUEA 6GCHF 1V2VT 1HAIH 2VGCB 2QC2A 1EAIA 1SBWA 1NS3A 3D23A 4XDEA 4E7NA 2ZHFH 1B0EA 1BCUH 1GCTC 1S5SA 5FAHA 1VGCC 1ZPCA 4GCHG 1SGRE 3RXTA 2Q6GA 2RCEA 1GI4A 1J9CH 1RS0A 4XBCA 4RN6A 3GCTG 2O8WA 4X8VH 2GVFA 4NCYA 1QIXB 4DG4A 1DOJA 3EQ0H 1CHOG 2FTMA 2BMGB 4DIHH 5A8XA 2Z3DA 2PW8H 1J14A 1TLDA 1TBZH 1C4Y2 2BHGA 3ZVBA 4X1NU 1GVKB 1XMNB 1EZUC 1NN6A 3RMLH 2R2WU 1OWHA 4MLFB 1O34A 3QGJA 5C20A 1O3CA 2G5VA 5A8YA 3PYHA 2OBOA 3GCNA 3B9FH 3E0PB 3TNTA 4OS2A 3B8JA 5C5OA 3S9BA 4WXIA 1Z71A 1HAVA 3DT0H 2Y81A 4YESB 1ZHPA 1QJ6B 3ZZDA 1HAYB 2VWMA 1H1BA 3AAUA 1BRUP 2ZA5A 1L0ZA 1SG8B 1GMDF 1O2WA 2BLOA 3ZVEA 2OCVB 3OY6U 3SN8A 3MH7A 4CHAC 3U9AH 3QK1A 4X6OA 1GJDB 5T6GA 1TPSA 3BTQE 2QGRA 1EKBB 1GJ4H 1HPGA 2NU1E 4UDWH 1OWEA 4MPVA 2ODYB 1SOZA 1E34B 5ESBA 2AGIX 3MMGA 2AIPA 4AFSA 1DLKB 2BTCE 1AIXH 1KDQB 2GTBA 2OC0A 4FUBA 1A3EH 5DK1A 4BTUB 3RXDA 2EI6A 2WUBA 1TONA 2GZ7A 2EI8A 1S0RA 1IHTH 3FVFB 2C4FH 3SZNA 2Y5FA 1BTZA 1OWKA 1O3OA 2FS9A 3BTKE 2ZPSA 1MCVA 2P59A 1ZGVA 1GWAA 4UEHH 5TCAA 1O5GH 2G55A 3DFJA 1YPLH 2HALA 1D9IA 4B73A 1GHYH 4XE4A 1MU6B 4O9VA 3NK8A 1ZTJA 2C8WB 1O3IA 3VXFH 2GGVB 1XX9A 1V2MT 4ASHA 1TNJA 1O32A 3P92A 3U98H 1UCYH 5E8EH 1O33A 1ETTH 1MBQA 2UWLA 2XCNA 2ZGXH 2CV3A 1PPEE 3H7OA 4NIYA 3A8CA 1TQ0B 1P06A 1C5XB 1O3HA 2LPRA 3Q77A 3TPIZ 1HIAA 1NM6A 1F92A 1TQ7B 1VGCB 2OBQA 3P8GA 1Y3YA 1LCYA 1AO5A 2QAAA 1C9PA 5G4BA 3AW0A 2ZTZA 4OGXA 1VJAU 2F9PA 1MD8A 2WINI 1VCWA 3W94A 4GHTA 1ELBA 1SLUB 1N8OC 4IN2A 1GMHG 1LHGH 4K1SA 1QQUA 1GBLA 1EOJA 1QJ7B 4WH8A 4X8UH 3SU5A 4BAOB 1FONA 4AYYB 1V2ST 1S84A 1S0QA 3M37A 3SJKA 3PMHB 2ALPA 3ZZ5A 1BTPA 1RXPA 3BEFB 1SGNE 2EA3A 4NWKA 2FX6A 3KNXA 3QTOH 1MTUA 1HAZB 3RXJA 1QNJA 1AVGH 1CA0C 4DURA 1DE7H 4AB8A 1SSXA 1YPJH 5JBCS 1O2OA 1MAYA 2OXSA 1CGJE 2DE8A 4K8BA 1NFXA 1T8LA 8GCHF 1K28D 3E8LA 2I6SA 1LDTT 2TRMA 1XXDA 4FUCA 3A82A 1P2QA 1LVOA 6ESTA 1BQYA 1YPEH 4X6NA 1W7GH 4BAHB 3KQCA 2BLWA 1BTXA 1QB6A 1AFQB 2XXLA 5DG6A 2A4GA 1WQVH 3FP7E 4OS7A 1P8VC 1CU1A 4X1PU 1UVPA 3SUGA 1SL3A 1G3EA 4ZUHA 4IW4E 1XKAC 4X2WA 2GCTB 1Y8TA 2HPQH 1ELGA 4MVNA 3STIA 1O2JA 2D26C 1ELTA 1F0UA 1FAXA 2ZU4A 3E6PH 3GCOA 4NSVA 1K2I1 2GDDA 2WYGA 2RA0A 4AORA 3E0NB 1D3TB 3U1IB 1AB9C 3V7TA 1KYNA 2VIVA 1CBWC 1O2TA 2TBSA 2BX3A 3A7WA 5F8XA 1ZHRA 1SHHB 1KXEA 2BD5A 3QX5H 5C5NA 3SV9A 3BTFE 1GGDC 3F6UH 2BLVA 1MTSA 3SGAE 1GDUA 2ZGHA 2ALVA 4X2XA 2EC9H 4FUEA 3LT3A 1KXAA 1QL7A 3BTWE 1P2KA 2W7SA 3T62A 1A0HB 1LPGB 3RXOA 3VB4A 2FODA 3NCLA 3HGPA 2FDAA 3PV4A 1SGYE 2VWLA 4XOJA 5HM9A 3BSQA 3L3TA 3UNQA 1AB9B 4Y71A 3BTEE 1F0SA 2P3FH 4GSOA 3S0NA 5HYOA 1CHOF 1DXWA 4NWLA 4I8HA 2Y82A 5CMXH 3Q00A 4I8LA 2P8OC 2ZDVH 4ESTE 2R3UA 2ZU2A 1K1JA 1DY9A 4THNH 1LMWB 1TGNA 5CE1A 2AEIH 2QY0B 2VH6A 4Y79A 5F8TA 1BBRE 2C3SA 2ZWLH 2XBWA 4GCHF 4NGAH 1BUIA 1MQ5A 1WSSH 2VIPA 3RXVA 1AY6H 7ESTE 1S81A 1FN6A 2J94A 2Q6FA 3PM3A 3EAJA 1O2IA 2V0BA 2HNTF 2VIWA 1GJ5H 2GT7A 4DW2U 1GBDA 3SU1A 1IQGA 2AS9A 4YT7H 1GI0A 1V3XA 4BXSA 1ELFA 4OS1A 2BD3A 4DOQA 1GI8B 2TGDA 1BBRH 1GJBB 2QYIA 2G4TA 1GMDG 1ANBA 1MUEB 1SGDE 1INCA 2FYRA 3PROA 2SNVA 3ODFA 1H9IE 1ETRH 1C5LH 2WPIS 1AI8H 4I8JA 3VB5A 8LPRA 2GD4B 3K9XB 2BDHA 2Z7FE 4ABBA 1E36B 4CH8B 3HATH 4X6MA 3BTHE 1SOTA 4UE7H 1C1VH 1G36A 5ABWA 3MYWA 1GG6C 2AMPA 1Z7KA 3CS7A 1TABE 1C1SA 2Y7XA 1OWIA 4MPXA 2Q1JA 4MNVA 1J15A 1EPTA 1XUGA 2FPZA 5T6DA 4HFPB 4ZMAH 2XC0A 1B7XB 1FQ3A 1TWXB 3M7UA 4JK6A 3RM0H 3TJNA 1YF4A 1O3NA 2SFAA 1AWFH 3A7YA 1TMBH 3RU4D 4MDSA 3M61U 1DXPA 1ZRBA 3IWMA 4FVDA 3JZ2B 4OS5A 3S7KB 3PLKA 2CHAC 4I33A 3VB6A 1NU7B 1P12E 3PWBA 1ID5H 3V13A 4Y11E 2HOBA 2SGPE 5EPYA 2GDEH 4YO9A 3RC4A 1IQNA 3F68H 3UREA 2C8XB 1K1PA 1KLTA 2XBXA 1H8IH 3SI3H 4B71A 3N7OA 1ZGIA 5A2MH 1V2RT 2BD7A 2ZIQH 4Z6AH 1Y3WA 4ZH8A 2P95A 2CJIA 2VIDA 1C5VA 5FCRA 1TNHA 1CO7E 1J16A 2ILNA 2BXTH 2G52A 4AZ2B 1HFDA 1EP5A 2Z94A 4X2VA 2SGDE 1W0YH 1SI5H 2Y7ZA 1EUFA 1JRTA 1SHYA 1GCTB 3AW1A 2VIOA 1QBVH 1SGPE 4TPYA 1PQ5A 2Q6DA 1P3CA 3RMNH 1GHAG 2ZDNA 1GMCG 3GY8A 3GY5A 4INHA 5E0HA 1Z1IA 4U2WA 3ZVAA 4JYVH 2HVXA 3ZVCA 4D7GA 4Q7ZA 1O3GA 2TGPZ 1PQ8A 2AMQA 4DJZB 1ESTA 4YOGA 1T4VH 2FOMB 4K2YA 5IYTA 5I46H 1SVPA 1K1OA 1ABIH 1ZOMA 2A32A 1A5GH 4H6SB 2P93A 1OWJA 5FPYA 1YPHC 4FUGA 4CRDA 2OC8A 1FY8E 1KTTB 3OU0A 4A7IB 2VINA 3HPTB 1C2JA 2ZDAH 2WPMS 1DLEA 4CRAA 2D8WA 5BRRE 4Y76A 3NKKA 2A4RA 3VB3A 1AFQC 1C4U2 2G4UA 3STJA 1O36A 1FV9A 4VGCB 1IQKA 1C9TA 1BIOA 3BF6H 3ZZ7A 3GY4A 3A85A 1QA7A 3EE0B 2B5TB 4ABFA 3K6ZA 2Z9JA 2H5DA 4AFUA 1GCDA 1KXDA 3UOPA 3TK9A 2ESTE 4X1RU 1FI8A 1HBTH 1MZDA 3SU2A 1Y3XA 1C1RA 4Y8ZA 1CSOE 1ZMJA 1LO6A 1YYY1 4Y0YE 3M3SA 4IN1A 1N1LA 3SU3A 1ZLRA 5FBIA 3A7XA 3TIUA 1GBJA 1O35A 4NSYA 4MPUA 1TNIA 2FOFA 3T25A 3MTYA 1BTUA 2KAIA 3AAVA 4E06H 1QB9A 1XM1A 1TX7A 3F1SB 2O8TA 1TGTA 5FBEA 3ITIA 3GYMA 4DIIH 1DM4B 1GJ8B 3LC5A 3LC3A 1O2ZA 1MTNB 1DVAH 2IN2A 1RTLA 1FPCH 1RD3B 3HK6B 1HXEH 4B75A 1ANDA 1EZSC 3I77A 1MKWK 5DJ7A 1PPBH 1AHTH 1C2MA 2C8ZB 3SV8A 1L1NA 1TA2A 1UK3A 1SGEE 1S6FA 1O2VA 1G3CA 1FN8A 3UNRA 5T3HA 3M3VA 1BT7A 1J8AA 1V2PT 1AN1E 2CN0H 2OINA 4FU9A 3SHCH 1LHEH 1AD8H 1GBTA 1NTPA 3F9EA 3FANA 4U01A 1F0RA 3FAOA 3K65B 1MTNC 5DGJA 2PHBA 1V2QT 1TNKA 1XVOA 5F6MA 1UVTH 1O5AB 5GJ4B 5BPEA 4KELA 3SUDA 1EP6A 3EA7A 4J1YA 2TIOA 4A1XA 1JWTA 2AH4X 3PMAB 3Q3YA 3ZZ4A 2UUFB 4A6LA 1BRBE 2H9HA 1GI3A 4TWWA 4Z0KA 2FWWA 5F03A 4I7YH 1O3PB 4YLUA 3FP6E 3M3TA 5LH8A 1WUNH 5LGOA 5FXLA 1MTVA 1Y59T 2WPKS 2LNCA 2FI3E 1VJ9U 1OS8A 1VZQH 3SO3A 4X8TH 1W13U 3ZYEA 2UUYA 2FTLE 2XW9A 4E05H 1GHXH 9ESTA 1NFWA 1ZPBA 2A2XH 1SB1H 1QRXA 1SC8U 4GPGA 2ZDLA 2FP7B 2IPHA 3LGUA 3MOCA 4J2YB 5E0GA 1NFYA 1QBNA 3T29A 1TYNA 3QLPH 2BVRH 2CXVA 2GZ9A 1O3FA 2FXRA 3V0XA 2VVUA 1GI9B 1BRAA 3H5CB 3A8DA 1NY22 2ZCHP 3F9FA 1W8BH 4K3JA 1SMFE 2A5KA 1TRNA 1TMTH 4QT8C 3BTME 1XUJA 1O2YA 2CF8H 2PWXA 2GV6A 2C93B 4NIXA 3OX7U 4SGBE 1QY6A 3RLWH 1EZQA 3RU4T 1FAKH 1G3DA 1SGFA 1UMAH 2D2DA 3ZZBA 2OLGA 1Y5UT 1IQFA 4O03A 3H7TA 1KXBA 2AIQA 2F9VA 1LKAA 1QTFA 1AGJA 3TK5A 4PROA 4HI3A 2ZO3H 1LTOA 3DA9B 3E91A 1YP9A 1S6HA 3VPKA 1LPZB 1OSSA 2B9LA 3M7TA 4B2BA 4ISNA 2F9OA 1XVMA 2A2QH 2PR3A 3A89A 3TK6A 1FY4A 4YZUA 5C3NA 1TGSZ 1PPGE 1BMLA 3RXRA 1KLJH 1GL1A 2YNBA 4X1SU 1QRZA 3SJ9A 4AG2A 1XUKA 2OC1A 1F2SE 3ODDA 3UY9A 4TWYA 2W5EA 5GCHG 2XWAA 4GAWA 1LPKB 4TY6A 4R8TB 1FZZA 1IHSH 1NT1A 1RFNA 4JCNA 4BANB 1EPTB 5C67A 1DANH 1GHWH 1NPMA 4WH6A 2AMDA 2FOEA 1NROH 1YM0A 5L2ZH 3FZZA 1Z8GA 1DFPA 3MFJA 2FX4A 4YOIA 2VNTA 1V2JT 3A8AA 3Q76A 1L4ZA 2ZTXA 1NC6A 2P16A 1EPTC 2TGAA 3TJVA 3NXPA 1O2HA 4IMQA 1O3AA 2SGFE 1GJCB 4ZAEA 3MI4A 1P0SH 3D62A 3BIUH 3MO6A 1A0LA 2THFB 3QZRA 1A5HA 1Z8JB 2JKHA 3SUFA 1DUEA 2GT8A 1GVZA 1TA6A 1BOQA 4FUHA 1ZJDA 1GI2A 2A4OA 3URCA 4UD9H 4K8YA 1V2OT 2G51A 2SGQE 3LIWA 1N8OB 2FIRH 1DWCH 1Y3UA 4MNWA 1MQ6A 4ISLA 3M5OA 3PWCA 1PPHE 1T31A 1Y5BT 1YLDA 1A1RA 1GBIA 1UTQA 1BHXF 4I8KA 1P11E 2FM2A 3LGIA 4HZHA 3ZZ6A 2GV7A 3BG4C 2ZF0H 4I8GA 5K7RA 2VGCC 4AGJA 3A7VA 2BDIA 1GHAF 1T32A 1UVSH 2O8MA 3RXMA 3SI4H 3MNBA 3P17H 4VGCC 1PQAA 4UFGH 2FS8A 1KDQA 4DCDA 2ZCKP 2SGAA 1MZAA 1SGFG 2JH6D 2ZPQA 5IDKA 5PTPA 1CT0E 3GDUA 2A4QA 1CBWB 3TJUA 3VEQB 3ZV9A 4NA8A 1C2IA 3DD2H 4NFEA 4ABAA 2NU0E 3V3MA 1QCPA 1THSH 4RKJB 1H4WA 5AFYH 4YOJA 1P57B 1SLVB 4WMEA 1KIGH 1DY8A 1TALA 4R0IA 3SNDA 1C1TA 1Q31A 1SFQB 3BN9A 5E0JA 2O8LA 1HAXB 1KY9A 4GLYA 1C5ZB 1KXFA 3PLBA 1OYQA 2BOKA 3O8DA 1LHFH 1BTYA 2VJ1A 3KGPA 1P2NA 4D9QA 5F8ZA 1EASA 1P2OA 1FJSA 1G2MA 3L33A 4AFQA 5DP6A 1HYLA 3O8RA 4INLA 4JMYA 1A5IA 4WMDA 2G8TA 4IS5A 2ANKH 5AFZH 2QXHA 2ZFQH 3SU4A 1TOMH 2FOAA 5GWZA 1V6DA 3BEUA 3LU9B 4F49A 3RU4E 3TH4H 2XWBI 1XUHA 2QA9E 2VB0A 3RC6A 5EXLA 3LONA 5L30H 5DP5A 2PGQB 1ZSLA 5GCHF 1P9UA 3MNXA 3SGBE 1ELEE 1OP0A 1CGIE 3UQVA 3S69A 1SQAA 4I31A 4JZDH 1CHGA 2P3TB 7KMEH 2Y80A 1CA0B 5EU8A 2XYAA 1W11U 1BITA 1IQEA 4AFZA 1ARBA 1QGFA 2FEQH 3RP2A 1W0ZU 4ISOA 1QBOA 3HKIB 1HJAB 2PKAB 2PKSC 2PFEA 2AGGX 1FUJA 1EB1H 3OY5U 1C2EA 1UTPA 1C1WH 2XC5A 4ABJA 1DPOA 1K22H 1MKXH 3RXAA 4YM9A 2FI4E 4A5TS 2A7CA 2VH0A 1PYTD 1PPZA 2B8OH 3QGNB 1THRH 2NWNA 3UOUA 2ZGJA 2ANWA 5DP9A 2ZU5A 2RDLA 3EGKH 1ACBE 1P09A 3M5NA 6CHAC 2VIQA 2FO9A 2B7DH 1GI6A 1C2LA 2NU2E 3BG8A 1FXYA 3ATIA 2DUCA 1YLCA 2SNWA 1HB0B 2A0QB 5GXPA 2QV1A 1BA8B 1GJ9B 1Q2WA 2HPPH 1ARCA 5AF9H 4ZKNU 3JZ1B 3M7QA 1H8DH 5EGMA 5HMAA 1G2LA 1TNGA 4H42U 3T27A 3ATMA 3VGCC 2HWLB 2CMYA 1ABJH 5FPTA 2P3UB 1T8OA 2JH0D 3D49H 1NRRH 4MQAA 1TRYA 5C1XA 5J4SA 1RRKA 1O3DA 4LK4A 4WXVA 3OSYA 1O2PA 3LOXA 3UWIA 4Y6DA 1GDQA 1O5BB 1FY1A 1TMUH 2J9NA 2ZEBA 3TGJE 4ZHAA 1GVLA 1UVUH 1VITG 2JH5D 1EXFA 1TB6H 3GICB 1E37B 1AVWA 1JRSA 1A3BH 1V2NT 1VCPA 1RTFB 1NZQH 4O3UA 2ZCLP 1O5DH 1V2LT 1W12U 2BDBA 2IOTA 4JZFH 3OYPA 4I32A 1UTOA 1CT2E 4WMFA 1K21H 1WU1A 1AVXA 1LQDB 1ZSJA 1DT2A 2G5NA 1YC0A 1C5SA 3WY8A 4Y8YA 1DITH 4Q80A 1OKXA 1MKWH 1HRTH 3S7HB 2H9TH 1YCPH 2ZQ2A 2VVVA 1RIWC 4UFDH 1YCPK 1S85A 1W2KH 6GCHG 2V3OH 4U32A 2HNTE 3ATLA 1FPHH 3M5MA 1D6RA 1JMOH 2ASUB 3ENSB 1L1JA 5T6FA 1HUTH 1O5FH 2FLBH 4NIWA 7GCHF 1O2UA 3ZVGA 1BHXB 1BBRK 2BY8X 4INKA 5DP3A 3VFEA 1YPKH 1IQMA 3ZVFA 4KKDA 1IQJA 3LH1A 1F7ZA 2ZTYA 3RXQA 1MD7A 2OQ5A 1C1OA 1A46H 2P8OB 3MU4A 2PSYA 3SORA 1C2FA 1LHDH 4KTUA 1TNLA 1CQQA 5JB9S 4CHAB 1AUJA 1LHCH 2NU4E 5HGGA 4K5ZA 1U6QA 1WTGH 3MO9A 2C90B 1M9UA 1ANEA 3PMJA 5DP4A 1TBRH 3KEEA 2R0KA 4ZXYH 1C5UA 2OQUA 2XBVA 3EDXB 2HNTC 3BG4B 1FIWA 7LPRA 4XBDA 1E38B 3NPSA 2ODPA 3ZVDA 1JBUH 3RXSA 1SLWB 3RXBA 3RXGA 3A83A 1NRSH 3NZIA 1GDNA 1P9SA 3T26A 1Q3XA 3RXUA 1QJ1B 1SGCA 1TRMA 5CHAB 1SFIA 4NIVA 1BZXE 2HRVA 5LPFA 3MHWU 3A87A 1AKSB 2A5AA 2XNIA 4WVPE 4KTSA 1V2KT 4X0WU 1W14U 5L2YH 1YPGH 2Y6TA 4FU8A 1OX1A 1UTNA 2WUCA 1P2MA 1IQHA 5EG4A 2FOCA 2A31A 2YNAA 5DKMA 4JK5A 1S82A 1GBFA 2Z9LA 2BB4A 2GKVE 2ZHWH 2I6QA 2W7UA 4B2CA 3FP8E 4X1QU 3NUMA 1UJ1A 3PO1B 2BY6X 4Y8XA 2WPLS 4AB9A 2BD9A 4JYTA 1KSNA 4BTTB 4GVUA 1K9OE 2HGTH 3A84A 3F9GA 1HAHH 1O3MA 4RSPA 1EATA 2FZZA 5L6NH 3ELAH 3GISB 1B5GH 3A88A 1P03A 3U8RH 1UHBB 4BTIB 1C5WB 4TPIZ 5FCKA 1VITF 4B74A 3O8BA 3QTVH 2FYQA 5FPSA 3M35A 1QA0A 5C1UA 4AN7A 4Y10E 1DS2E 2FOHA 1V2WT 1A4WH 1AZZA 1ZHMA 1O2RA 3MH5A 1WAYB 3PTNA 1DDJA 1ZZZA 3U8TH 1P02A 2H6MA 1HCGA 2AGEX 3LGWA 1TGCA 2CF9H 1HJ9A 3QO6A 1HXFH 2C8YB 4ISIH 3D65E 3SV2H 3LJOA 3CP7A 1HV7A 2A1DB 5EPNA 2O9QA 1C2KA 2WV4A 1CA8B 2J92A 2V35A 3UTUH 5GDSH 4CRCA 2BY7X 1O2MA 2RG3A 4CRFA 1J17T 2EEKA 5TCCA 2P94A 4KGAA 1O39A 3FFGA 2BD2A 3EA8A 2AERH 4AOQA 3M5LA 1GPZA 1EJMA 2ZHQH 1DWEH 3HK3B 2OD3B 1JIRA 2ZFSA 1XUFA 4JZIA 1D3PB 3KQDA 1EAXA 2ZHDA 2FLRH 4WWYA 1HAGE 2ZC9H 3RXIA 1A0JA 3IITA 3ZV8A 2Z6BD 3RC5A 1UHBA 3RXPA 1C5YB 1N6XA 1CGHA 1OPHB 3DHKH 3SGQE 1MMJN 2WPHS 3MNSA 1O3EA 4YT6H 1QL9A 1CE5A 3ZZ3A 1PFXC 4AYVB 2QIQA 4NG9H 5B6OA 1L2EA 3A7ZA 2QXJA 3EYDA 3SNEA 4FVBA 3K2UA 1EAWA 4GHQA 5LPRA 2AFQB 3V12A 1EQ9A 1HNEE 5EQSA
chains in the Genus database with same CATH superfamily
1O2SA 1GI7B 5EODA 2BVSH 1GHBF 3UFAA 1MU8B 3OEED 1EAUA 2QF4A 2IJOB 2OC7A 1GBKA 1E0FD 2PKAA 1ZSKA 3L6PA 1O38A 4B1TA 3A80A 3GCHB 4FUIA 5JBAS 1K1LA 1G3BA 1DUAA 1Z8IB 3KHVA 1TX6A 1P01A 4BAKB 4B76A 3GCTF 2ZPRA 3NWUA 1PPCE 2XTTB 3HKJB 4UFEH 4U30A 2H2ZA 3QUMP 2BD4A 1ZJKA 1UTLM 2V6NA 1O2NA 4FUDA 2ZP0H 3ZIAD 4FUFA 1C1UH 2AHME 2QF0A 3VGCB 3ZYDA 5JB8S 2GCHF 4B6FA 1QB1A 4LZ4B 2QXGA 1ZR0A 2QE7D 4WY3A 2BZAA 1XUIA 2H1UA 3A7TA 3U69H 1OP8A 4AG1A 3ZZAA 5A09A 2ANYA 1C1MA 1MTWA 3M36A 4D7FA 5A0AE 1PPFE 4X8SH 1Y3VA 2BOHB 2A5IA 3RMOH 4F48B 2J4IA 1ZMLA 3AASA 1HIAB 2BY5X 3SNAA 2VWNA 4CBNA 2VVCA 4O3TA 2BVXH 3P8OA 1BTWA 1TBQH 1YKTA 3MO3A 3UR9A 3TH3H 2G81E 4KP0A 3UQOA 1SPJA 1ESBA 1WXRA 1C1QA 3GY3A 1K1IA 2ZGBH 5JBTA 1BJUA 1ZTKA 2ZG0H 2CHAB 2KAIB 2YMSC 4UFFH 1TPAE 3R0FA 2B0FA 2OUAA 2GX4A 4FOUC 4H4FA 5FHTA 5EW1H 1X7AC 1GBBA 1HAOH 3RXHA 2VU8E 3FN8A 1GJAB 1C2GA 3A86A 5I25A 2ZFPH 4XBBA 2YOLA 2ZDKA 1WQSA 3RM2H 2UUJB 3KIDU 1SQOA 5DP8A 1A2CH 1NRNH 1TPOA 1WCZA 2AYWA 1EJNA 4ZXXH 3UUZA 5C1YA 4K1TA 4ZROA 4DY7B 4Q2KA 3TLOA 3P8NA 4CRBA 1KTSB 2BQ6B 5EJZA 1MKXK 4DVAU 1TIOA 1UTKA 5EJ1A 4A1TA 3KL6A 7GCHG 1HJ8A 1H9HE 3N7EA 1DSTA 1FIZA 1Z6JH 3U8OH 2F9UA 2KCYA 1DSUA 1ETSH 2DE9A 4K1EA 1E35B 1FDPA 1MH0A 1O2XA 3SOSA 1D3DB 4HGCA 3A81A 1UK4A 3RLYH 1ZPZA 3GY6A 4CR5A 2STBE 3W95A 2BQWB 2XBYA 1GMCF 3TGKE 1ESAA 5CHBA 1AZ8A 5TJXA 1T7CA 1FNIA 4MNXA 4UONA 3O8CA 1TE0A 1NRQH 5J4QA 1O3KA 3VXEH 4Y7AA 3E1XB 5FX5A 4A1VA 1YPHE 1LVMA 1ZMNA 4OS6A 4CRGA 1GMHF 3U28C 1V2TT 3ATKA 1H9LB 2JETB 1N6YA 5A0BA 1A7SA 3RXEA 1O3JA 3LJJA 2PUQH 4D76A 3HGNA 3ZZCA 1TX8A 3RDZA 8KME2 1K1NA 3DFLA 3SJIA 2R9PA 5EJLA 2PLXA 2Z3EA 3LGTA 6CHAB 2OTVA 4D8NA 1YCPM 2V3HH 4ZKSU 3RXFA 1P10A 3P70B 2CGAA 1KLIH 1CVWH 4FXGH 2J38A 1C5MD 4DT4A 2D1JA 2R3YA 1F5KU 1IQLA 1NO9H 2LP6A 5DPAA 5JYIA 4GUXA 4Q7YA 3AVZA 1FMGA 4ABIA 3KN2A 5E2OA 1OWDA 4FUJA 5C94A 1BMAA 1QFKH 1C5OH 4KTCA 3UWJH 1AWHB 5EXMA 1PYTC 2W3IA 2BDAA 1NESE 1HGTH 4ZKRU 1FLEE 3SV7A 4CREA 1W10U 1O37A 2FMJA 3URDA 1Y5AT 3ZZ8A 2R0LA 4ABEA 1D4PB 2BLQA 3LPRA 2FESH 4IBLH 1GHZA 2ODQA 1G30B 3KQEA 3ESTA 1O5EH 1CT4E 1VR1H 3BEIB 4IMZA 1S83A 5EW2H 4Q7XA 5C17A 2J98A 3KF2A 2J98B 3PLPA 5JBBS 2ZDMA 4O97A 3MU5A 2UWPA 4XSKU 3S9CA 1QL8A 1UO6A 2A7JA 3GYLB 2R2MB 4CBOA 5F53A 4X2YA 4BAQB 3SNCA 4NFFA 4LXBH 4HTCH 5ETXA 1C5RA 3TU7H 1BJVA 1TOCB 1EZXC 1RJXB 1AQ7A 3UIRA 3WWFA 5DO4H 2PTCE 1O31A 2ZFTA 1YY3A 2BYAX 2Z9IA 1EJAA 3SHAH 1BRCE 1TPPA 4WF8A 2PGBB 3DUXH 3P6ZB 4HG6A 3SJOA 4D9RA 3SU6A 2ULLA 1C1NA 1DICA 5EOKA 4DT7B 2EI7A 4SGAE 1D3QB 1QRWA 2GP9B 3BTDE 1YGCH 1C4V2 5AHGH 2NU3E 1GI1A 3KYFA 2J34A 4Y0ZE 1G32B 3C1KA 3P95A 2W3KA 2O8UA 3LDXH 2G00A 1Z6EA 3I29A 1O2KA 1OP2A 3MU0A 1PJPA 1F5LA 5GIBA 4E7RG 2OP9A 2QCYA 3ATWA 5EQRA 5GPIB 3K6YA 5E2PA 1C2DA 1AMHA 1O3LA 2ZI2H 3E3TA 3RMMH 3UR6A 3SW2B 1YBWA 2PUXB 3KQBA 2XC4A 2JIZD 5JPMH 4ZKOU 4ISHH 1GGDB 3PTBA 3TGIE 3RXLA 4H6TA 3QWCH 4OGYA 4ABGA 1BTHH 2GJGA 1UTJA 3TNSA 5IK2D 2UWOA 1UTMA 4Q63A 1GHVH 4BOHA 1ZRKA 3EA9A 1QQ4A 1SLXB 1AU8A 1ELCA 1V2UT 2A45B 3QN7A 1GL0E 1HDTH 4IGDA 5A8ZA 1THPB 5LPEA 1ORFA 2W26A 2GCHG 1WTHD 2WYJA 1SGQE 1PQ7A 1OOKB 2JETC 2STAE 1MCTA 1OYTH 1F0TA 1GBCA 2H9EH 2XOKD 3H09A 1DWBH 1EOLA 5SGAE 1GJ6A 1Z8RA 3PB1E 1B0FA 4ASUD 1GBMA 1O0DH 1HAPH 4A92A 2TPIZ 1G9IE 1SR5C 2BDGA 2BDCA 2VWOA 3SJ8A 3LKWA 3TVJB 1SGIB 4MNYA 3QDZB 3SU0A 2BDYA 3Q3KA 1JXPA 2Z9GA 5H4IB 3CNRA 4LZ1H 2ZHEH 1HAVB 4FU7A 5FX6A 2F9NA 1AE5A 2F9BH 4B2AA 1BDAA 8GCHG 1NU9A 1P2IA 2KM0A 1RIWB 3TH2H 2QXIA 1GJ7B 5K0HA 3LGYA 2RA3A 2ZU3A 1JOUB 4NA9H 2WV5A 2K0QA 4BAMB 4NZLA 5EXNA 1TFXA 2HLDD 3MWIU 1T8NA 2F3CE 3T5FH 1D6WA 3R3GB 4B6EA 1O2QA 2ZKSA 3SNBA 4P00A 1VCQA 3RXCA 1QR3E 3BTGE 3FZDA 1YPMH 1F5RA 2ANMH 4M9FA 2GMTC 1AE8H 1BMNH 4IC6A 3IG6B 3LGVA 1W3CA 5ESTE 1NRPH 2HLCA 5AVDA 1BMMH 2A7HA 1C1PA 1FY3A 1UCYE 4MTBA 4BNRA 1W7XH 1LVYA 1FY5A 1RGQA 1GBEA 3MNCA 2PTNA 3Q3XA 3T2NA 2BX4A 1BB0B 3BIVH 2PV9B 3BTTE 2GMTB 1ELDE 3UPEA 1HJAC 2PKSB 5DP7A 3GY7A 2ZZUH 1GBAA 4XFQA 3GOVB 2FOBA 1T4UH 1K1MA 3GY2A 3QZQA 3MH6A 3VB7A 1TGBA 1ZYOA 4MPWA 2XCFA 4Y7BA 1GG6B 1A61H 1O2GH 9LPRA 2J2UA 2H5CA 2J95A 3TJOA 2Y5GA 4JZEH 4AGKA 3ZZ9A 3P8FA 1MBMA 3RXKA 1ELAA 1XKBC 1IAUA 3MU8A 1SGTA 2BQ7B 1JIMA 3GDSA 5C2ZA 2BXUH 2ZFFH 1TAWA 2UUKB 2F91A 2Z9KA 6LPRA 4RKOB 4YXWD 2BM2A 1LKBA 5JDUB 3SQHE 1O5CB 4MG3A 1GBHA 1MABB 2SGEE 2Z3CA 2FOGA 1O30A 1ANCA 5HM2A 3S9AA 4DGJA 4TY7A 4WJG2 1P05A 1XXFA 3TITA 3SBKA 2ZGCA 1K0HA 5HXFA 4ZHMU 1WYKA 5A0CA 1WV7H 1GHBG 3LH3A 2OK5A 4BXWA 3B23B 2Y5HA 3GCHC 3T28A 4ABDA 4YTAA 1G37A 2QF3A 1L4DA 1Z1JA 2GCTC 1AKSA 3NRLA 4IC5A 4LOYH 2K1QA 1EB2A 1IQIA 1UK2A 1QHRB 2ZNKH 2GZ8A 3G01A 4I86A 1LQEA 3PMBB 3I78A 1WOFA 2IJD1 4YLQH 4X6PA 2QN5T 3KCGH 2BZ6H 1ELVA 1UVOA 1NFUA 8ESTE 4TYDA 1ZTLA 1WBGB 4Q4LA 1RTKA 3F9HA 4OS4A 3BV9B 3MU1A 4JZ1A 1MAXA 1AFEH 3SV6A 1P2JA 2ZECA 1C5QA 4JYUH 3C27B 2BD8A 2ZU1A 3PRBA 3A8BA 3CENA 1GI5A 3PO1C 1O3BA 2BY9X 1LVBA 3OEHD 3F2FA 3MH4A 1DWDH 3GDVA 5EQQA 1P3EA 3RUOA 1C5PA 3OTJE 3CS0A 3U1JB 4ZHLU 1QURH 3UNSA 1DX5M 2TGTA 1O2LA 1HLTH 2ZQ1A 1VITH 2FI5E 4NZQA 4CR9A 1C5TA 1C5NH 2M5TA 4NA7A 2WPJS 4ABHA 1EX3A 3E16B 2PSXA 2L6OA 1OXGA 2F83A 1SQTA 2EY4C 1UCYK 4F4OC 4AX9H 1C2HA 1P04A 2XRCA 4M7GA 2JJ2D 3E90B 1KXCA 3PV2A 5CHAC 1AUTC 3SQEE 4CH2B 1L1GA 4K69A 1IOEA 2ZFRH 1T8MA 2WHXA 4K60A 3SUEA 6GCHF 1V2VT 1HAIH 2VGCB 2QC2A 1EAIA 1SBWA 1NS3A 3D23A 4XDEA 4E7NA 2ZHFH 1B0EA 1BCUH 1GCTC 1S5SA 5FAHA 1VGCC 1ZPCA 4GCHG 5C0TA 1SGRE 3RXTA 2Q6GA 2RCEA 1GI4A 1J9CH 1RS0A 4XBCA 4RN6A 3GCTG 2O8WA 4X8VH 2GVFA 4NCYA 1QIXB 4DG4A 1DOJA 3EQ0H 1CHOG 2FTMA 2BMGB 4DIHH 5A8XA 1H8ED 2Z3DA 2PW8H 3OAAD 1J14A 1TLDA 1TBZH 1C4Y2 2BHGA 3ZVBA 4X1NU 1GVKB 1XMNB 4OM9A 1EZUC 1NN6A 3RMLH 2M2AA 2R2WU 1OWHA 4MLFB 1O34A 2VBCA 3QGJA 5C20A 1O3CA 2G5VA 5A8YA 3PYHA 2OBOA 3GCNA 3B9FH 3E0PB 3TNTA 4P02A 4OS2A 3B8JA 5C5OA 3S9BA 4WXIA 1Z71A 1HAVA 3DT0H 2Y81A 4YESB 1ZHPA 1QJ6B 3ZZDA 1HAYB 2VWMA 1H1BA 3AAUA 1BRUP 2ZA5A 1L0ZA 1SG8B 1GMDF 1O2WA 2BLOA 3ZVEA 2OCVB 3OY6U 2KX4A 3SN8A 3MH7A 4CHAC 3U9AH 3QK1A 4X6OA 1GJDB 5T6GA 1TPSA 3BTQE 2QGRA 1EKBB 1GJ4H 1HPGA 2NU1E 4UDWH 1OWEA 4MPVA 2ODYB 1SOZA 4RT1A 1E34B 5ESBA 2AGIX 3MMGA 2AIPA 4AFSA 1DLKB 2BTCE 1AIXH 1KDQB 2GTBA 2OC0A 4FUBA 1A3EH 5DK1A 4BTUB 3OFND 3RXDA 2EI6A 2WUBA 2YMSB 1TONA 2GZ7A 2KCPA 2EI8A 1S0RA 1IHTH 3FVFB 2C4FH 3SZNA 1BTZA 1OWKA 2Y5FA 1O3OA 2FS9A 3BTKE 2ZPSA 1MCVA 2P59A 1ZGVA 1GWAA 4UEHH 5TCAA 1O5GH 2G55A 3DFJA 1YPLH 2HALA 1D9IA 4B73A 1GHYH 4XE4A 1MU6B 4O9VA 3UB0A 3NK8A 1ZTJA 2C8WB 1O3IA 3VXFH 2GGVB 1XX9A 1V2MT 2IPQX 4ASHA 1TNJA 1O32A 3P92A 3U98H 1UCYH 5E8EH 1O33A 1ETTH 1MBQA 2UWLA 2XCNA 2ZGXH 2CV3A 1PPEE 3H7OA 4NIYA 3A8CA 1TQ0B 1P06A 1C5XB 1O3HA 2LPRA 3Q77A 3TPIZ 1HIAA 1NM6A 1F92A 1TQ7B 1VGCB 2OBQA 3P8GA 1Y3YA 1LCYA 1AO5A 2QAAA 1C9PA 5G4BA 3AW0A 2F43B 2ZTZA 4OGXA 1VJAU 2F9PA 1MD8A 2WINI 1VCWA 3W94A 4GHTA 1ELBA 1SLUB 1N8OC 1W0JD 4IN2A 1GMHG 1LHGH 4K1SA 1QQUA 1GBLA 1EOJA 1QJ7B 4WH8A 4X8UH 3SU5A 4BAOB 1FONA 4AYYB 1V2ST 1S84A 1S0QA 3M37A 1W0KD 3SJKA 3PMHB 2ALPA 3F3BA 3ZZ5A 1BTPA 1RXPA 3BEFB 1SGNE 2EA3A 4NWKA 2FX6A 3KNXA 3QTOH 1MTUA 1HAZB 3RXJA 1QNJA 1AVGH 1CA0C 4DURA 1DE7H 4AB8A 1SSXA 1YPJH 5JBCS 1O2OA 1MAYA 2OXSA 1CGJE 2DE8A 4K8BA 1NFXA 1T8LA 4AC9A 8GCHF 1K28D 3E8LA 2I6SA 1LDTT 2TRMA 1XXDA 4FUCA 3A82A 1P2QA 1LVOA 4RI0A 6ESTA 1BQYA 1YPEH 4X6NA 1W7GH 4BAHB 3KQCA 2BLWA 1BTXA 1QB6A 1AFQB 2XXLA 5DG6A 2A4GA 1WQVH 3FP7E 4OS7A 1P8VC 1CU1A 4X1PU 1UVPA 3SUGA 1SL3A 1G3EA 4ZUHA 5CDFE 4IW4E 1XKAC 4X2WA 2GCTB 1Y8TA 2HPQH 1ELGA 4MVNA 3STIA 1O2JA 2D26C 1ELTA 1F0UA 1FAXA 2ZU4A 3E6PH 3GCOA 4NSVA 1K2I1 2GDDA 2WYGA 2RA0A 4AORA 3E0NB 1D3TB 3U1IB 1AB9C 3V7TA 1KYNA 2VIVA 1CBWC 1O2TA 2TBSA 2BX3A 2WV9A 3A7WA 5F8XA 1ZHRA 1SHHB 5B6LA 1KXEA 2BD5A 3QX5H 5C5NA 3SV9A 3BTFE 3N99A 3GS9A 1GGDC 3F6UH 2BLVA 1MTSA 2J97A 3SGAE 1GDUA 1UW7A 2ZGHA 2ALVA 4X2XA 2EC9H 4FUEA 3LT3A 1KXAA 1QL7A 3BTWE 1P2KA 2W7SA 3T62A 1A0HB 1LPGB 2QF5A 3RXOA 3VB4A 2FODA 3NCLA 3HGPA 2FDAA 3PV4A 1SGYE 2VWLA 4XOJA 5HM9A 3BSQA 3L3TA 3UNQA 1AB9B 4Y71A 3BTEE 1F0SA 2P3FH 4GSOA 3S0NA 5HYOA 1CHOF 1DXWA 4NWLA 4I8HA 2Y82A 5CMXH 4F55A 1H8HD 3Q00A 4I8LA 2P8OC 2ZDVH 4ESTE 2R3UA 2ZU2A 1K1JA 1DY9A 4THNH 1LMWB 1TGNA 5CE1A 2AEIH 2QY0B 2VH6A 4Y79A 5F8TA 1BBRE 2C3SA 2ZWLH 2XBWA 4GCHF 3WWBA 3DSPA 4NGAH 1BUIA 1MQ5A 1WSSH 2VIPA 3RXVA 1AY6H 7ESTE 1S81A 1FN6A 2J94A 2Q6FA 3PM3A 3EAJA 1O2IA 2RFKC 2V0BA 2HNTF 2VIWA 1GJ5H 2GT7A 4DW2U 1GBDA 3SU1A 1IQGA 2AS9A 4YT7H 1GI0A 1V3XA 4BXSA 1ELFA 4OS1A 2BD3A 4DOQA 1GI8B 2TGDA 1BBRH 1GJBB 2QYIA 2G4TA 1GMDG 1ANBA 1MUEB 2LELA 1SGDE 1INCA 3SZEA 2FYRA 3PROA 2SNVA 3ODFA 1H9IE 1ETRH 1C5LH 2WPIS 1AI8H 4I8JA 3VB5A 8LPRA 2GD4B 3K9XB 2BDHA 3DCLA 2Z7FE 4ABBA 1E36B 4CH8B 3HATH 4X6MA 3BTHE 1SOTA 4UE7H 1C1VH 1G36A 5ABWA 3MYWA 1GG6C 2AMPA 1Z7KA 3CS7A 1TABE 1C1SA 2Y7XA 1OWIA 4MPXA 2Q1JA 4MNVA 1J15A 1EPTA 1XUGA 2FPZA 5T6DA 4HFPB 4ZMAH 2XC0A 1B7XB 1FQ3A 1TWXB 2EQNA 3M7UA 4JK6A 5DN6D 3RM0H 3TJNA 1YF4A 1O3NA 2SFAA 1AWFH 3A7YA 1TMBH 3RU4D 4MDSA 3M61U 1DXPA 1ZRBA 3IWMA 4FVDA 3JZ2B 4OS5A 3S7KB 3PLKA 2CHAC 4I33A 3VB6A 1NU7B 1P12E 3PWBA 1ID5H 3V13A 4Y11E 2HOBA 2KCOA 2SGPE 3F0OA 5EPYA 2GDEH 4YO9A 3RC4A 1IQNA 3F68H 3UREA 2C8XB 1K1PA 1KLTA 2XBXA 1H8IH 3SI3H 4B71A 3N7OA 1ZGIA 5A2MH 1V2RT 2BD7A 2ZIQH 3MQKC 4Z6AH 1Y3WA 4ZH8A 2P95A 2CJIA 2VIDA 1C5VA 5FCRA 1TNHA 1CO7E 1J16A 2ILNA 2BXTH 2KFWA 2G52A 4AZ2B 1HFDA 2XNDD 2W6ID 1EP5A 2Z94A 4X2VA 2SGDE 1W0YH 1SI5H 2Y7ZA 1EUFA 1JRTA 1SHYA 1GCTB 3AW1A 2VIOA 3KQ5A 1QBVH 1NBME 1SGPE 1PQ5A 2Q6DA 4TPYA 1P3CA 3RMNH 1GHAG 2ZDNA 1GMCG 3GY8A 3GY5A 4INHA 5E0HA 1Z1IA 4U2WA 3ZVAA 4JYVH 2HVXA 3ZVCA 4D7GA 4Q7ZA 1O3GA 2TGPZ 1PQ8A 2AMQA 4DJZB 1ESTA 4YOGA 1T4VH 2FOMB 4K2YA 5IYTA 5I46H 1SVPA 1K1OA 1ABIH 1ZOMA 2A32A 1A5GH 4H6SB 2P93A 1OWJA 5FPYA 1YPHC 4FUGA 4CRDA 2OC8A 1FY8E 1KTTB 3OU0A 4A7IB 2VINA 3HPTB 1C2JA 2ZDAH 5KECA 2WPMS 1DLEA 4CRAA 2D8WA 5BRRE 4Y76A 3NKKA 2A4RA 3VB3A 1AFQC 1C4U2 2G4UA 3STJA 1O36A 1FV9A 4VGCB 1IQKA 1C9TA 1BIOA 3BF6H 3ZZ7A 3GY4A 4XD7D 3A85A 1QA7A 3EE0B 2B5TB 4ABFA 3K6ZA 3FOAA 2Z9JA 3OE7D 2H5DA 4AFUA 1GCDA 1KXDA 3UOPA 3TK9A 2ESTE 4X1RU 1FI8A 1HBTH 1MZDA 2KZ4A 3SU2A 1Y3XA 1C1RA 4Y8ZA 1CSOE 1ZMJA 1LO6A 1YYY1 4Y0YE 3M3SA 3F2HA 4IN1A 1N1LA 3SU3A 1ZLRA 5FBIA 3A7XA 3TIUA 1GBJA 1O35A 4NSYA 4MPUA 1TNIA 2FOFA 3T25A 3MTYA 1BTUA 2KAIA 3AAVA 4E06H 1QB9A 1XM1A 1TX7A 3F1SB 2O8TA 5DSFA 1TGTA 5FBEA 3ITIA 3GYMA 4DIIH 1DM4B 1GJ8B 3LC5A 3LC3A 1O2ZA 1MTNB 1DVAH 2IN2A 1RTLA 1FPCH 1RD3B 3HK6B 1HXEH 4B75A 1ANDA 1EZSC 3I77A 1MKWK 5DJ7A 1PPBH 1AHTH 1C2MA 2C8ZB 3SV8A 1L1NA 1TA2A 1UK3A 1SGEE 1S6FA 1O2VA 1G3CA 1FN8A 3UNRA 5T3HA 3M3VA 1BT7A 1J8AA 1V2PT 1AN1E 2CN0H 2OINA 4FU9A 3SHCH 1LHEH 1AD8H 1GBTA 1NTPA 3F9EA 3FANA 4U01A 1F0RA 3FAOA 3K65B 1MTNC 5DGJA 2PHBA 1V2QT 1TNKA 1XVOA 5F6MA 1UVTH 1O5AB 5GJ4B 5BPEA 4KELA 3SUDA 1EP6A 3EA7A 4ACBA 4J1YA 2TIOA 2JJ1D 4A1XA 1JWTA 2AH4X 3PMAB 3Q3YA 3ZZ4A 2UUFB 4A6LA 1BRBE 2H9HA 1GI3A 4TWWA 4Z0KA 2FWWA 4TSFD 5F03A 4I7YH 3FKSD 1O3PB 4YLUA 3FP6E 3M3TA 5LH8A 1WUNH 5LGOA 5FXLA 5GNDA 1MTVA 1Y59T 2WPKS 2LNCA 2FI3E 1VJ9U 1OS8A 1VZQH 3SO3A 2J5UA 4X8TH 1W13U 3ZYEA 2UUYA 2FTLE 2XW9A 4E05H 1GHXH 9ESTA 3EE7A 1NFWA 1ZPBA 2A2XH 1SB1H 1QRXA 1SC8U 4GPGA 2ZDLA 2FP7B 2IPHA 3LGUA 3MOCA 4J2YB 5E0GA 1NFYA 1QBNA 3T29A 1TYNA 3QLPH 2BVRH 2CXVA 2GZ9A 1O3FA 2FXRA 3V0XA 2VVUA 1GI9B 1BRAA 3H5CB 3A8DA 1NY22 2ZCHP 3F9FA 1W8BH 5T1VA 4K3JA 1SMFE 2A5KA 1TRNA 1TMTH 4QT8C 3BTME 1XUJA 1O2YA 3N7DA 2CF8H 2PWXA 2GV6A 2C93B 4NIXA 3OX7U 4SGBE 1QY6A 3RLWH 1EZQA 3RU4T 1FAKH 1G3DA 1SGFA 1UMAH 2D2DA 3ZZBA 2OLGA 1Y5UT 1IQFA 4O03A 3H7TA 1KXBA 2AIQA 2F9VA 1LKAA 1QTFA 1AGJA 3TK5A 4PROA 4HI3A 2ZO3H 1LTOA 3DA9B 3E91A 1YP9A 1S6HA 3VPKA 1LPZB 1EFRD 2KR7A 1OSSA 2K8IA 2B9LA 3M7TA 4B2BA 4ISNA 2F9OA 1XVMA 2A2QH 2PR3A 3A89A 3TK6A 1FY4A 4YZUA 5C3NA 1TGSZ 1PPGE 1BMLA 3RXRA 1KLJH 1OHHD 5HIYA 1GL1A 2YNBA 4X1SU 1QRZA 3SJ9A 4AG2A 1XUKA 2OC1A 1F2SE 3ODDA 3UY9A 4TWYA 2W5EA 5GCHG 2XWAA 4GAWA 1LPKB 4TY6A 4R8TB 1FZZA 1IHSH 1NT1A 1RFNA 4JCNA 4BANB 1EPTB 5C67A 1DANH 1GHWH 1NPMA 3DSOA 4WH6A 2AMDA 2FOEA 1NROH 1YM0A 2WSSD 5KEDA 5L2ZH 3FZZA 1Z8GA 1DFPA 3MFJA 2F4LA 2FX4A 4YOIA 2VNTA 1V2JT 3A8AA 3Q76A 1L4ZA 2ZTXA 1NC6A 2P16A 1EPTC 2TGAA 3TJVA 3NXPA 4XRNA 2WZQA 1O2HA 4IMQA 1O3AA 2SGFE 1GJCB 4ZAEA 3MI4A 1P0SH 3D62A 2KCAA 3BIUH 3MO6A 1A0LA 2THFB 3QZRA 1A5HA 1Z8JB 2JKHA 3SUFA 1DUEA 2GT8A 1GVZA 1TA6A 2L74A 1BOQA 4FUHA 1ZJDA 3UAIC 1GI2A 1E79D 2A4OA 3URCA 2PP6A 4K8YA 4UD9H 1V2OT 1FX0B 2G51A 2SGQE 3LIWA 1N8OB 2FIRH 1DWCH 1Y3UA 4MNWA 1MQ6A 4ISLA 3M5OA 3PWCA 1PPHE 1T31A 1Y5BT 1YLDA 1A1RA 1GBIA 1UTQA 1BHXF 4I8KA 1P11E 2FM2A 3LGIA 4HZHA 3ZZ6A 2GV7A 3BG4C 2ZF0H 4I8GA 5K7RA 2VGCC 4AGJA 3A7VA 2BDIA 1GHAF 1T32A 1UVSH 2O8MA 3RXMA 3SI4H 3MNBA 3P17H 4VGCC 1PQAA 4UFGH 2FS8A 1KDQA 4DCDA 2ZCKP 2SGAA 1MZAA 1SGFG 2JH6D 2ZPQA 5IDKA 3F2GA 5PTPA 1CT0E 2CK3D 2A4QA 1CBWB 3GDUA 5FL7D 3TJUA 3VEQB 3ZV9A 4NA8A 1C2IA 3DD2H 4NFEA 4ABAA 2NU0E 1YWUA 3V3MA 1QCPA 1THSH 4RKJB 1H4WA 5AFYH 4YOJA 1P57B 1SLVB 4WMEA 1KIGH 1DY8A 1TALA 4R0IA 3SNDA 1C1TA 1Q31A 1SFQB 3BN9A 5E0JA 2O8LA 1HAXB 1KY9A 4GLYA 1C5ZB 1KXFA 3PLBA 1OYQA 2BOKA 3O8DA 1LHFH 1BTYA 2VJ1A 3KGPA 1P2NA 4D9QA 5F8ZA 1EASA 1P2OA 1FJSA 1G2MA 3L33A 4AFQA 5DP6A 1HYLA 3O8RA 4INLA 5HIZA 4JMYA 1A5IA 4WMDA 2G8TA 4IS5A 2ANKH 5AFZH 2QXHA 2ZFQH 3SU4A 1TOMH 2FOAA 5GWZA 1V6DA 3BEUA 3LU9B 4F49A 3RU4E 3TH4H 2XWBI 2RDEA 1XUHA 2QA9E 2VB0A 2YMSD 3RC6A 5EXLA 3LONA 5L30H 5DP5A 2PGQB 1ZSLA 5GCHF 1P9UA 3MNXA 3F0PA 3SGBE 1ELEE 1OP0A 1CGIE 3UQVA 3S69A 1SQAA 3FO8D 4I31A 4JZDH 1CHGA 2P3TB 7KMEH 2Y80A 1CA0B 5EU8A 2XYAA 1W11U 1BITA 1IQEA 4AFZA 1ARBA 1QGFA 2FEQH 4ZCNA 3RP2A 1W0ZU 4ISOA 1QBOA 3HKIB 1HJAB 2PKAB 2PKSC 2PFEA 1SKYE 2AGGX 1FUJA 1EB1H 3OY5U 1C2EA 1UTPA 1C1WH 2XC5A 4ABJA 3PV5A 1DPOA 1K22H 1MKXH 3RXAA 4YM9A 3W1EA 2FI4E 4A5TS 2A7CA 2VH0A 1PYTD 1PPZA 2B8OH 3QGNB 2W6JD 1THRH 2NWNA 3UOUA 1WDIA 2ZGJA 2ANWA 5DP9A 2ZU5A 2RDLA 3EGKH 1ACBE 1P09A 3M5NA 6CHAC 2VIQA 2FO9A 2B7DH 1GI6A 1C2LA 2NU2E 3BG8A 1FXYA 1E1QD 3ATIA 2DUCA 1YLCA 2SNWA 1HB0B 2A0QB 2V3MA 3SYJA 5GXPA 2QV1A 1BA8B 1GJ9B 1Q2WA 2V7QD 3WW7A 2HPPH 1ARCA 5AF9H 4ZKNU 3JZ1B 3M7QA 1H8DH 3AK5A 5EGMA 5HMAA 1G2LA 1TNGA 4H42U 3T27A 3ATMA 3VGCC 2HWLB 2CMYA 5EIYA 2HVYB 1ABJH 5FPTA 2P3UB 1T8OA 2JH0D 3D49H 1NRRH 4MQAA 1TRYA 5C1XA 5J4SA 3OTPA 1RRKA 1O3DA 4LK4A 4WXVA 3OSYA 1O2PA 3LOXA 3UWIA 4Y6DA 1GDQA 1O5BB 1FY1A 1TMUH 2J9NA 2ZEBA 3TGJE 4ZHAA 1GVLA 1UVUH 1VITG 2JH5D 1EXFA 1YLNA 1TB6H 3GICB 1E37B 1AVWA 1JRSA 1A3BH 1V2NT 1VCPA 1RTFB 1NZQH 4O3UA 1NBMD 2WPDD 2ZCLP 1O5DH 1V2LT 1W12U 2BDBA 2IOTA 4JZFH 3OYPA 4I32A 2JDID 1UTOA 1CT2E 4WMFA 1K21H 1WU1A 1AVXA 3DSGA 1KMHB 1LQDB 1BMFD 1ZSJA 1DT2A 5C0UA 2G5NA 1YC0A 1C5SA 3WY8A 4Y8YA 1DITH 4Q80A 1OKXA 1MKWH 3KYGA 1HRTH 3S7HB 2H9TH 1YCPH 2ZQ2A 2VVVA 1RIWC 4UFDH 1YCPK 1S85A 1W2KH 6GCHG 2V3OH 4U32A 2HNTE 3ATLA 1FPHH 4ACAA 3M5MA 1D6RA 1JMOH 2ASUB 3ENSB 1L1JA 5T6FA 1HUTH 1O5FH 2FLBH 4NIWA 7GCHF 1O2UA 3ZVGA 1BHXB 1BBRK 2BY8X 4INKA 5DP3A 3VFEA 1YPKH 1IQMA 3ZVFA 4KKDA 1IQJA 3LH1A 1F7ZA 2ZTYA 3RXQA 1MD7A 1QZ8A 2OQ5A 1C1OA 1A46H 2P8OB 3MU4A 2PSYA 3SORA 1C2FA 1LHDH 4KTUA 1TNLA 1CQQA 5JB9S 4CHAB 1AUJA 1LHCH 2NU4E 5HGGA 4K5ZA 1U6QA 1WTGH 3MO9A 2C90B 1M9UA 1ANEA 3PMJA 5DP4A 1TBRH 3VG8A 3KEEA 1SQRA 2R0KA 4ZXYH 1C5UA 2OQUA 2XBVA 3EDXB 2HNTC 3BG4B 1FIWA 7LPRA 4XBDA 1E38B 3NPSA 2ODPA 3ZVDA 1JBUH 5KGOA 3RXSA 1SLWB 3RXBA 3RXGA 3A83A 1NRSH 3NZIA 1GDNA 1P9SA 3T26A 1Q3XA 3RXUA 1QJ1B 1SGCA 1TRMA 5CHAB 1SFIA 4NIVA 1BZXE 2HRVA 5LPFA 3MHWU 4TT3D 3A87A 1AKSB 2A5AA 2XNIA 4WVPE 4KTSA 1V2KT 4X0WU 1W14U 5L2YH 1YPGH 2Y6TA 4FU8A 1OX1A 1UTNA 2WUCA 1P2MA 1IQHA 5EG4A 2FOCA 2A31A 2YNAA 5DKMA 4JK5A 1S82A 1GBFA 2Z9LA 2BB4A 2GKVE 2ZHWH 2I6QA 2W7UA 4B2CA 3FP8E 4X1QU 3NUMA 1UJ1A 3PO1B 2BY6X 4Y8XA 2WPLS 4AB9A 2BD9A 4JYTA 1KSNA 4BTTB 4GVUA 1K9OE 2HGTH 3A84A 3F9GA 1HAHH 1O3MA 4RSPA 1EATA 2FZZA 5L6NH 3ELAH 3GISB 5HKKD 1B5GH 3A88A 1P03A 3U8RH 1UHBB 1E1RD 4BTIB 1C5WB 1S6LA 4TPIZ 5FCKA 1VITF 4B74A 3O8BA 3QTVH 2FYQA 5FPSA 3M35A 1QA0A 5C1UA 4AN7A 4Y10E 1DS2E 2FOHA 1V2WT 1A4WH 1AZZA 1ZHMA 1O2RA 3MH5A 4FETA 1WAYB 3PTNA 1DDJA 1ZZZA 3U8TH 1P02A 2H6MA 1HCGA 2AGEX 3LGWA 1TGCA 2CF9H 1COWD 1HJ9A 3QO6A 1HXFH 2C8YB 4ISIH 3D65E 3SV2H 1VKYA 3LJOA 3CP7A 1HV7A 2A1DB 5EPNA 2O9QA 1C2KA 2WV4A 4Z1MD 1CA8B 2J92A 2V35A 3UTUH 5GDSH 4CRCA 2BY7X 1O2MA 2RG3A 4CRFA 1J17T 2EEKA 5TCCA 2P94A 4KGAA 1O39A 3FFGA 2BD2A 3EA8A 2AERH 4AOQA 3M5LA 1GPZA 1EJMA 2ZHQH 1DWEH 3HK3B 2OD3B 1JIRA 2ZFSA 1XUFA 4JZIA 1D3PB 3KQDA 1EAXA 2ZHDA 2FLRH 4WWYA 1HAGE 2ZC9H 3RXIA 1A0JA 3IITA 3ZV8A 2Z6BD 3RC5A 1UHBA 3RXPA 1C5YB 1N6XA 1CGHA 1OPHB 3DHKH 3SGQE 1MMJN 2WPHS 3MNSA 4RT0A 1O3EA 4YT6H 1QL9A 1CE5A 3ZZ3A 1PFXC 4AYVB 2QIQA 4NG9H 5B6OA 1L2EA 3A7ZA 3PRDA 2QXJA 3EYDA 3SNEA 4FVBA 3K2UA 1EAWA 4GHQA 5LPRA 2AFQB 3V12A 1EQ9A 1HNEE 5EQSA
chains in the Genus database with same CATH topology
1O2SA 1GI7B 5EODA 2BVSH 1GHBF 3UFAA 1MU8B 1EAUA 2IJOB 2OC7A 1GBKA 1E0FD 2PKAA 1ZSKA 3L6PA 1O38A 4B1TA 3A80A 3GCHB 4FUIA 5JBAS 1K1LA 1G3BA 1DUAA 1Z8IB 3KHVA 1TX6A 1P01A 4BAKB 4B76A 3GCTF 2ZPRA 3NWUA 1PPCE 2XTTB 3HKJB 4UFEH 4U30A 2H2ZA 3QUMP 2BD4A 1ZJKA 1UTLM 2V6NA 1O2NA 4FUDA 2ZP0H 4FUFA 1C1UH 2QF0A 3VGCB 3ZYDA 5JB8S 2GCHF 1QB1A 4LZ4B 2QXGA 1ZR0A 4WY3A 2BZAA 1XUIA 2H1UA 3A7TA 3U69H 1OP8A 4AG1A 3ZZAA 5A09A 2ANYA 1C1MA 1MTWA 3M36A 4D7FA 5A0AE 1PPFE 4X8SH 1Y3VA 2BOHB 2A5IA 3RMOH 2J4IA 1ZMLA 3AASA 1HIAB 2BY5X 3SNAA 2VWNA 4CBNA 2VVCA 4O3TA 2BVXH 3P8OA 1BTWA 1TBQH 1YKTA 3MO3A 3UR9A 3TH3H 2G81E 4KP0A 3UQOA 1SPJA 1ESBA 1C1QA 3GY3A 1K1IA 2ZGBH 5JBTA 1BJUA 1ZTKA 2ZG0H 2CHAB 2KAIB 4UFFH 1TPAE 3R0FA 2B0FA 2OUAA 2GX4A 4H4FA 5FHTA 5EW1H 1X7AC 1GBBA 1HAOH 3RXHA 2VU8E 1GJAB 1C2GA 3A86A 5I25A 2ZFPH 4XBBA 2YOLA 2ZDKA 1WQSA 3RM2H 2UUJB 3KIDU 1SQOA 5DP8A 1A2CH 1NRNH 1TPOA 1WCZA 2AYWA 1EJNA 4ZXXH 3UUZA 5C1YA 4K1TA 4ZROA 4DY7B 4Q2KA 3TLOA 3P8NA 4CRBA 1KTSB 2BQ6B 1MKXK 4DVAU 1TIOA 1UTKA 4A1TA 3KL6A 7GCHG 1HJ8A 1H9HE 1DSTA 1FIZA 1Z6JH 3U8OH 2F9UA 1DSUA 1ETSH 2DE9A 4K1EA 1E35B 1FDPA 1MH0A 1O2XA 3SOSA 1D3DB 4HGCA 3A81A 1UK4A 3RLYH 1ZPZA 3GY6A 4CR5A 2STBE 3W95A 2BQWB 2XBYA 1GMCF 3TGKE 1ESAA 1AZ8A 5TJXA 1T7CA 1FNIA 4MNXA 4UONA 3O8CA 1TE0A 1NRQH 5J4QA 1O3KA 3VXEH 4Y7AA 3E1XB 5FX5A 4A1VA 1YPHE 1LVMA 1ZMNA 4OS6A 4CRGA 1GMHF 1V2TT 3ATKA 1H9LB 2JETB 1N6YA 5A0BA 1A7SA 3RXEA 1O3JA 3LJJA 2PUQH 4D76A 3HGNA 3ZZCA 1TX8A 3RDZA 8KME2 1K1NA 3DFLA 3SJIA 2R9PA 2PLXA 2Z3EA 3LGTA 6CHAB 2OTVA 4D8NA 1YCPM 2V3HH 4ZKSU 3RXFA 1P10A 3P70B 2CGAA 1KLIH 1CVWH 4FXGH 2J38A 1C5MD 2D1JA 2R3YA 1F5KU 1IQLA 1NO9H 5DPAA 5JYIA 4GUXA 4Q7YA 3AVZA 1FMGA 4ABIA 3KN2A 5E2OA 1OWDA 4FUJA 1BMAA 1QFKH 1C5OH 4KTCA 3UWJH 1AWHB 5EXMA 1PYTC 2W3IA 2BDAA 1NESE 1HGTH 4ZKRU 1FLEE 3SV7A 4CREA 1W10U 1O37A 2FMJA 3URDA 1Y5AT 3ZZ8A 2R0LA 4ABEA 1D4PB 2BLQA 3LPRA 2FESH 4IBLH 1GHZA 2ODQA 1G30B 3KQEA 3ESTA 1O5EH 1CT4E 1VR1H 3BEIB 4IMZA 1S83A 5EW2H 4Q7XA 3KF2A 3PLPA 5JBBS 2ZDMA 4O97A 3MU5A 2UWPA 4XSKU 3S9CA 1QL8A 1UO6A 2A7JA 3GYLB 2R2MB 4CBOA 4X2YA 4BAQB 3SNCA 4NFFA 4LXBH 4HTCH 5ETXA 1C5RA 3TU7H 1BJVA 1TOCB 1EZXC 1RJXB 1AQ7A 3UIRA 5DO4H 2PTCE 1O31A 2ZFTA 2BYAX 2Z9IA 1EJAA 3SHAH 1BRCE 1TPPA 4WF8A 2PGBB 3DUXH 3P6ZB 3SJOA 4D9RA 3SU6A 1C1NA 2ULLA 1DICA 5EOKA 4DT7B 2EI7A 4SGAE 1D3QB 1QRWA 2GP9B 3BTDE 1YGCH 1C4V2 5AHGH 2NU3E 1GI1A 2J34A 4Y0ZE 1G32B 3C1KA 3P95A 2W3KA 2O8UA 3LDXH 2G00A 1Z6EA 3I29A 1O2KA 1OP2A 3MU0A 1PJPA 1F5LA 5GIBA 4E7RG 2OP9A 2QCYA 3ATWA 5EQRA 5GPIB 3K6YA 5E2PA 1C2DA 1AMHA 1O3LA 2ZI2H 3E3TA 3RMMH 3UR6A 3SW2B 1YBWA 2PUXB 3KQBA 2XC4A 5JPMH 4ZKOU 4ISHH 1GGDB 3PTBA 3TGIE 3RXLA 4H6TA 3QWCH 4OGYA 4ABGA 1BTHH 1UTJA 3TNSA 2UWOA 1UTMA 1GHVH 4BOHA 1ZRKA 3EA9A 1QQ4A 1SLXB 1AU8A 1ELCA 1V2UT 2A45B 3QN7A 1GL0E 1HDTH 4IGDA 5A8ZA 1THPB 5LPEA 1ORFA 2W26A 2GCHG 1WTHD 2WYJA 1SGQE 1PQ7A 1OOKB 2JETC 2STAE 1MCTA 1OYTH 1F0TA 1GBCA 2H9EH 1DWBH 1EOLA 5SGAE 1GJ6A 1Z8RA 3PB1E 1B0FA 1GBMA 1O0DH 1HAPH 4A92A 2TPIZ 1G9IE 1SR5C 2BDGA 2BDCA 2VWOA 3SJ8A 3LKWA 3TVJB 1SGIB 4MNYA 3QDZB 3SU0A 2BDYA 3Q3KA 1JXPA 2Z9GA 5H4IB 4LZ1H 2ZHEH 1HAVB 4FU7A 5FX6A 2F9NA 1AE5A 2F9BH 4B2AA 1BDAA 8GCHG 1NU9A 1P2IA 1RIWB 3TH2H 2QXIA 1GJ7B 5K0HA 3LGYA 2RA3A 2ZU3A 1JOUB 4NA9H 2WV5A 4BAMB 4NZLA 5EXNA 1TFXA 3MWIU 1T8NA 2F3CE 3T5FH 1D6WA 3R3GB 1O2QA 2ZKSA 3SNBA 1VCQA 3RXCA 1QR3E 3BTGE 3FZDA 1YPMH 1F5RA 2ANMH 2GMTC 1AE8H 1BMNH 4IC6A 3IG6B 3LGVA 1W3CA 5ESTE 1NRPH 2HLCA 5AVDA 1BMMH 2A7HA 1C1PA 1FY3A 1UCYE 4MTBA 4BNRA 1W7XH 1LVYA 1FY5A 1RGQA 1GBEA 3MNCA 2PTNA 3Q3XA 3T2NA 2BX4A 1BB0B 3BIVH 2PV9B 3BTTE 2GMTB 1ELDE 3UPEA 1HJAC 2PKSB 5DP7A 3GY7A 2ZZUH 1GBAA 4XFQA 3GOVB 2FOBA 1T4UH 1K1MA 3GY2A 3QZQA 3MH6A 3VB7A 1TGBA 1ZYOA 4MPWA 2XCFA 4Y7BA 1GG6B 1A61H 1O2GH 9LPRA 2J2UA 2H5CA 2J95A 3TJOA 2Y5GA 4JZEH 4AGKA 3ZZ9A 3P8FA 1MBMA 3RXKA 1ELAA 1XKBC 1IAUA 3MU8A 1SGTA 2BQ7B 1JIMA 3GDSA 5C2ZA 2BXUH 2ZFFH 1TAWA 2UUKB 2F91A 2Z9KA 6LPRA 4RKOB 2BM2A 1LKBA 5JDUB 3SQHE 1O5CB 4MG3A 1GBHA 2SGEE 2Z3CA 2FOGA 1O30A 1ANCA 5HM2A 3S9AA 4DGJA 4TY7A 4WJG2 1P05A 1XXFA 3TITA 3SBKA 2ZGCA 5HXFA 4ZHMU 1WYKA 5A0CA 1WV7H 1GHBG 3LH3A 4BXWA 3B23B 2Y5HA 3GCHC 3T28A 4ABDA 4YTAA 1G37A 2QF3A 1L4DA 1Z1JA 2GCTC 1AKSA 4IC5A 4LOYH 2K1QA 1EB2A 1IQIA 1UK2A 1QHRB 2ZNKH 2GZ8A 3G01A 1LQEA 3PMBB 3I78A 1WOFA 4YLQH 4X6PA 2QN5T 3KCGH 2BZ6H 1ELVA 1UVOA 1NFUA 8ESTE 4TYDA 1ZTLA 1WBGB 1RTKA 3F9HA 4OS4A 3BV9B 3MU1A 4JZ1A 1MAXA 1AFEH 3SV6A 1P2JA 2ZECA 1C5QA 4JYUH 3C27B 2BD8A 2ZU1A 3A8BA 3CENA 1GI5A 3PO1C 1O3BA 2BY9X 1LVBA 3MH4A 1DWDH 3GDVA 5EQQA 1P3EA 3RUOA 1C5PA 3OTJE 3CS0A 3U1JB 4ZHLU 1QURH 3UNSA 1DX5M 2TGTA 1O2LA 1HLTH 2ZQ1A 1VITH 2FI5E 4NZQA 4CR9A 1C5TA 1C5NH 2M5TA 4NA7A 2WPJS 4ABHA 1EX3A 3E16B 2PSXA 1OXGA 2F83A 1SQTA 1UCYK 4F4OC 4AX9H 1C2HA 1P04A 2XRCA 4M7GA 3E90B 1KXCA 5CHAC 1AUTC 3SQEE 4CH2B 1L1GA 4K69A 1IOEA 2ZFRH 1T8MA 4K60A 3SUEA 6GCHF 1V2VT 1HAIH 2VGCB 2QC2A 1EAIA 1SBWA 1NS3A 3D23A 4XDEA 4E7NA 2ZHFH 1B0EA 1BCUH 1GCTC 1S5SA 5FAHA 1VGCC 1ZPCA 4GCHG 1SGRE 3RXTA 2Q6GA 2RCEA 1GI4A 1J9CH 1RS0A 4XBCA 4RN6A 3GCTG 2O8WA 4X8VH 2GVFA 4NCYA 1QIXB 4DG4A 1DOJA 3EQ0H 1CHOG 2FTMA 2BMGB 4DIHH 5A8XA 2Z3DA 2PW8H 1J14A 1TLDA 1TBZH 1C4Y2 2BHGA 3ZVBA 4X1NU 1GVKB 1XMNB 1EZUC 1NN6A 3RMLH 2R2WU 1OWHA 4MLFB 1O34A 3QGJA 5C20A 1O3CA 2G5VA 5A8YA 3PYHA 2OBOA 3GCNA 3B9FH 3E0PB 3TNTA 4OS2A 3B8JA 5C5OA 3S9BA 4WXIA 1Z71A 1HAVA 3DT0H 2Y81A 4YESB 1ZHPA 1QJ6B 3ZZDA 1HAYB 2VWMA 1H1BA 3AAUA 1BRUP 2ZA5A 1L0ZA 1SG8B 1GMDF 1O2WA 2BLOA 3ZVEA 2OCVB 3OY6U 3SN8A 3MH7A 4CHAC 3U9AH 3QK1A 4X6OA 1GJDB 5T6GA 1TPSA 3BTQE 2QGRA 1EKBB 1GJ4H 1HPGA 2NU1E 4UDWH 1OWEA 4MPVA 2ODYB 1SOZA 1E34B 5ESBA 2AGIX 3MMGA 2AIPA 4AFSA 1DLKB 2BTCE 1AIXH 1KDQB 2GTBA 2OC0A 4FUBA 1A3EH 5DK1A 4BTUB 3RXDA 2EI6A 2WUBA 1TONA 2GZ7A 2EI8A 1S0RA 1IHTH 3FVFB 2C4FH 3SZNA 2Y5FA 1BTZA 1OWKA 1O3OA 2FS9A 3BTKE 2ZPSA 1MCVA 2P59A 1ZGVA 1GWAA 4UEHH 5TCAA 1O5GH 2G55A 3DFJA 1YPLH 2HALA 1D9IA 4B73A 1GHYH 4XE4A 1MU6B 4O9VA 3NK8A 1ZTJA 2C8WB 1O3IA 3VXFH 2GGVB 1XX9A 1V2MT 4ASHA 1TNJA 1O32A 3P92A 3U98H 1UCYH 5E8EH 1O33A 1ETTH 1MBQA 2UWLA 2XCNA 2ZGXH 2CV3A 1PPEE 3H7OA 4NIYA 3A8CA 1TQ0B 1P06A 1C5XB 1O3HA 2LPRA 3Q77A 3TPIZ 1HIAA 1NM6A 1F92A 1TQ7B 1VGCB 2OBQA 3P8GA 1Y3YA 1LCYA 1AO5A 2QAAA 1C9PA 5G4BA 3AW0A 2ZTZA 4OGXA 1VJAU 2F9PA 1MD8A 2WINI 1VCWA 3W94A 4GHTA 1ELBA 1SLUB 1N8OC 4IN2A 1GMHG 1LHGH 4K1SA 1QQUA 1GBLA 1EOJA 1QJ7B 4WH8A 4X8UH 3SU5A 4BAOB 1FONA 4AYYB 1V2ST 1S84A 1S0QA 3M37A 3SJKA 3PMHB 2ALPA 3ZZ5A 1BTPA 1RXPA 3BEFB 1SGNE 2EA3A 4NWKA 2FX6A 3KNXA 3QTOH 1MTUA 1HAZB 3RXJA 1QNJA 1AVGH 1CA0C 4DURA 1DE7H 4AB8A 1SSXA 1YPJH 5JBCS 1O2OA 1MAYA 2OXSA 1CGJE 2DE8A 4K8BA 1NFXA 1T8LA 8GCHF 1K28D 3E8LA 2I6SA 1LDTT 2TRMA 1XXDA 4FUCA 3A82A 1P2QA 1LVOA 6ESTA 1BQYA 1YPEH 4X6NA 1W7GH 4BAHB 3KQCA 2BLWA 1BTXA 1QB6A 1AFQB 2XXLA 5DG6A 2A4GA 1WQVH 3FP7E 4OS7A 1P8VC 1CU1A 4X1PU 1UVPA 3SUGA 1SL3A 1G3EA 4ZUHA 4IW4E 1XKAC 4X2WA 2GCTB 1Y8TA 2HPQH 1ELGA 4MVNA 3STIA 1O2JA 2D26C 1ELTA 1F0UA 1FAXA 2ZU4A 3E6PH 3GCOA 4NSVA 1K2I1 2GDDA 2WYGA 2RA0A 4AORA 3E0NB 1D3TB 3U1IB 1AB9C 3V7TA 1KYNA 2VIVA 1CBWC 1O2TA 2TBSA 2BX3A 3A7WA 5F8XA 1ZHRA 1SHHB 1KXEA 2BD5A 3QX5H 5C5NA 3SV9A 3BTFE 1GGDC 3F6UH 2BLVA 1MTSA 3SGAE 1GDUA 2ZGHA 2ALVA 4X2XA 2EC9H 4FUEA 3LT3A 1KXAA 1QL7A 3BTWE 1P2KA 2W7SA 3T62A 1A0HB 1LPGB 3RXOA 3VB4A 2FODA 3NCLA 3HGPA 2FDAA 3PV4A 1SGYE 2VWLA 4XOJA 5HM9A 3BSQA 3L3TA 3UNQA 1AB9B 4Y71A 3BTEE 1F0SA 2P3FH 4GSOA 3S0NA 5HYOA 1CHOF 1DXWA 4NWLA 4I8HA 2Y82A 5CMXH 3Q00A 4I8LA 2P8OC 2ZDVH 4ESTE 2R3UA 2ZU2A 1K1JA 1DY9A 4THNH 1LMWB 1TGNA 5CE1A 2AEIH 2QY0B 2VH6A 4Y79A 5F8TA 1BBRE 2C3SA 2ZWLH 2XBWA 4GCHF 4NGAH 1BUIA 1MQ5A 1WSSH 2VIPA 3RXVA 1AY6H 7ESTE 1S81A 1FN6A 2J94A 2Q6FA 3PM3A 3EAJA 1O2IA 2V0BA 2HNTF 2VIWA 1GJ5H 2GT7A 4DW2U 1GBDA 3SU1A 1IQGA 2AS9A 4YT7H 1GI0A 1V3XA 4BXSA 1ELFA 4OS1A 2BD3A 4DOQA 1GI8B 2TGDA 1BBRH 1GJBB 2QYIA 2G4TA 1GMDG 1ANBA 1MUEB 1SGDE 1INCA 2FYRA 3PROA 2SNVA