4OS7A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk607 (bicyclic)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os7A01
5H4IB 3RXSA 3O8BA 1DY9A 3QLPH 1O3HA 3NWUA 3SUFA 1WQSA 4ZUHA 1A5GH 1G32B 1W0ZU 1O5EH 2W5EA 5J4QA 5K0HA 1LHGH 4JZIA 1N6XA 1PPBH 1TGBA 3MTYA 4AB8A 1IHTH 2ZDMA 4ABIA 3SO3A 3EGKH 2OC0A 2VVVA 1GJ8B 3VB3A 1TFXA 1HIAA 3EAJA 3OX7U 3CP7A 1GBCA 1EJAA 3SQEE 1LVBA 1JMOH 4ZHLU 5G4BA 2W3KA 3UNQA 1EB1H 1GCTC 2Z9JA 1BRAA 1FI8A 3LGTA 4MNXA 1TQ7B 4ZH8A 1UHBB 1P05A 3M61U 1H9HE 1P3CA 1XUJA 2B7DH 1GJ9B 1GPZA 1VCQA 2VWLA 1OWDA 1QCPA 5EQSA 3SGQE 1K2I1 4U01A 1HB0B 1KXDA 1UCYH 4O3UA 1D3PB 3RXVA 4Q7XA 2HNTE 2BD3A 4JZDH 5DJ7A 3M3SA 2XNIA 3A82A 2FTMA 1UTJA 4BAOB 1QY6A 3P70B 3KQEA 3BTWE 2G5NA 2KAIA 2TGPZ 3P95A 3DHKH 4GHTA 3SUEA 1V2QT 2FOAA 2QN5T 1HJAB 3BEIB 1KDQA 2HRVA 1TMUH 4Y8ZA 1ELGA 2VWOA 4X1PU 3JZ2B 4A7IB 4CR5A 4TYDA 1B0FA 1TBRH 1ZPZA 1FIWA 2BOHB 1XUHA 2GGVB 4E7NA 3Q3YA 3NZIA 3SU0A 3L3TA 3QTOH 1ESTA 3KQDA 3R3GB 1EUFA 2CJIA 2ZG0H 1TNHA 5FPSA 1MKWK 3SZNA 1Y3XA 2J94A 2ZGBH 1MKXH 1VZQH 2ULLA 2A2QH 2J95A 2XW9A 1MTNB 4UDWH 4WH6A 2CN0H 1A1RA 1BTUA 1EOJA 3MNXA 1BTYA 1QBNA 3IG6B 1NFXA 1S85A 3D23A 1Z8RA 2QXGA 1ELCA 3LKWA 3RLYH 4DJZB 3P6ZB 3M7TA 1EASA 1YPKH 1FMGA 3QZQA 2YNBA 1YCPK 1Y5AT 3TH2H 1UTNA 4WXVA 1HYLA 3TK9A 3VEQB 2UUJB 3A8AA 1G36A 1ZGVA 4D8NA 4B76A 1ETRH 2ZP0H 2XBXA 2GMTC 3U8RH 2F91A 4ZKNU 2ZFTA 5L2YH 2ZTXA 1MTVA 7KMEH 3RXJA 4ABAA 1ZR0A 2LPRA 1NC6A 4CRFA 4XOJA 3KEEA 3TIUA 1H8DH 1VITH 3AVZA 1BTWA 1C1PA 4I33A 5FCRA 3D65E 2VIPA 2Q6FA 3RXKA 1LHEH 1SB1H 1RTKA 2G51A 3JZ1B 4KKDA 3VB6A 2FZZA 1C2IA 1W8BH 3A88A 5E2OA 1O2UA 5BRRE 1T8NA 1SGFA 1Q2WA 4Q7ZA 3DFLA 2P59A 1DITH 1AUJA 1GCDA 1O5DH 3RM2H 2ZDKA 1O2MA 1LVYA 3VXFH 4BAMB 1ZTKA 1B5GH 1XUFA 5TJXA 2GCHG 4ISHH 1K9OE 1DLEA 2OBQA 3S9CA 3BEUA 3LOXA 4B73A 1LCYA 3ZVEA 2Y5GA 3UIRA 1WTHD 2ZHEH 3ENSB 4MPVA 2CGAA 2XC5A 1KLIH 1D6WA 1JRSA 3NUMA 2J9NA 3DD2H 2RA3A 2AYWA 3H5CB 2Q1JA 1BT7A 1GDUA 2VH6A 1TGTA 1P3EA 2ZKSA 2BLVA 1NTPA 4DT7B 1F5RA 3LT3A 1O3LA 2PHBA 2ZECA 4MQAA 3A7YA 1SGRE 4CR9A 2Z3CA 3ZYEA 2RG3A 1ELTA 1HAVA 5EXNA 1C5YB 1AZ8A 4IMQA 1TNIA 4DVAU 2ZHQH 3F1SB 3KQBA 1ZHRA 4ABEA 4RKOB 1P11E 1WSSH 2FYRA 1H9LB 1SFIA 1TALA 1QFKH 4RSPA 2H9EH 1HLTH 3AAUA 1G37A 3UWJH 2HGTH 3GY3A 1ZHPA 1FJSA 2PKSB 2ZCKP 3PO1B 1QRWA 5EODA 3V13A 3TNSA 1BUIA 5FX5A 4HI3A 3MH7A 3UFAA 4MNVA 1ANCA 5HYOA 2A31A 1GHBG 1FY3A 1GVLA 3A80A 2M5TA 2AMQA 2ANYA 3E8LA 1BZXE 1K1IA 3RXBA 1HAIH 4OS5A 3BEFB 3DUXH 3NK8A 5EPNA 4GHQA 5FXLA 3U8OH 1IQJA 1LMWB 1W7XH 2BHGA 1GJ6A 2ZWLH 2BOKA 5C2ZA 3MHWU 3QDZB 1E36B 1GMHF 5A8ZA 2VGCB 8GCHF 1C5NH 3T25A 1BMNH 1SVPA 2XTTB 4O9VA 4D7GA 3E16B 1P04A 3S7KB 3P8NA 3EA8A 1CHOF 3Q3XA 1QB6A 1D3DB 3ZZ4A 1O3EA 3RXRA 2QIQA 2ZPRA 4YTAA 5F03A 2V6NA 4K2YA 2Y7XA 4WF8A 4AFQA 5A8XA 1QNJA 5EW2H 1TRNA 1KXEA 1TPSA 1WYKA 1QB1A 2ANWA 3SNBA 1AB9C 3KHVA 2P3TB 4KGAA 2FOBA 3N7OA 5HMAA 1YPLH 1C2EA 1NFWA 1FY5A 1BRBE 1GJDB 1G2LA 2WPJS 5JBCS 1SGNE 2BLQA 1YPMH 1GWAA 8KME2 2WPHS 1UVPA 1W7GH 2B8OH 4IW4E 4U2WA 3S69A 1CVWH 3STIA 1RXPA 1IAUA 3SJKA 1O3NA 4WXIA 4TWWA 1C5PA 1P02A 2ZHFH 2OINA 5GJ4B 2BD7A 2G4TA 2O8UA 3Q76A 3ZZ6A 3SHCH 1RIWC 1LKAA 1O2KA 1YYY1 1SMFE 1L2EA 1NRRH 1BDAA 1O38A 1EZUC 3PWCA 1HFDA 3SV7A 3F9GA 2FP7B 2VJ1A 3OTJE 1Y5UT 1RTLA 1OP0A 1YC0A 2AMPA 2FI3E 1TRYA 3HKJB 2UUFB 3UPEA 3BV9B 3MI4A 2EEKA 1J15A 1ELAA 1HJAC 1FUJA 1T8LA 3A86A 4M7GA 3TK5A 4CBOA 1P2KA 2FXRA 1UTOA 5GDSH 5FAHA 5F8ZA 1P2JA 2B9LA 3A7WA 1AGJA 1K1OA 2P3FH 2FDAA 1T7CA 1SI5H 5JB8S 3ZVGA 1TGCA 2D2DA 3RXFA 4BAHB 3LH1A 4NA7A 2BLOA 1O3PB 1P2IA 3M7UA 4X8UH 2VH0A 1XUKA 1TE0A 2BY9X 4WY3A 1DUEA 1DM4B 1ANEA 2OC8A 3IITA 1BTHH 4I8LA 5EG4A 7GCHF 4B2CA 2ZHWH 1GG6C 1ZPCA 4B2BA 3RC5A 3T62A 4ABDA 2JH5D 3S0NA 5T6FA 2NU1E 4INHA 3RC4A 1HAHH 3QTVH 1ZPBA 3W95A 2ZGJA 2STAE 2VB0A 3MWIU 3KL6A 2R0LA 4OS1A 1E0FD 4BXSA 1BBRE 5EPYA 1O2VA 4JCNA 2PV9B 2EI8A 1TX8A 1SGEE 3VB7A 2GZ8A 1O5BB 2GMTB 4WMDA 1T8OA 4R8TB 1KSNA 1F2SE 2QGRA 5DGJA 2PSYA 5HM2A 4Z0KA 1BJVA 3MO3A 2ZFFH 1A2CH 1O2YA 3HATH 5EXLA 3U1JB 1F0RA 2AS9A 1A61H 1XUGA 1DPOA 4Q80A 1WAYB 3AW1A 2ALPA 2A32A 3SOSA 1PQ8A 3URCA 4XBBA 1DXWA 4JYUH 3VB5A 4A6LA 3LJOA 1EXFA 1OWEA 1ETSH 1SBWA 1Q31A 1GBAA 1GI9B 5AHGH 2FMJA 3SU2A 5E0GA 2WYJA 4K1SA 1HAOH 2C8YB 2QXHA 3DA9B 2BVRH 2PSXA 5ABWA 3MH6A 3AW0A 2HPQH 3QGNB 1PFXC 1O3MA 3PLBA 1QQUA 1THRH 2FS9A 2H9TH 1NPMA 3QK1A 1P2OA 2BB4A 4NCYA 1KY9A 4ESTE 1OXGA 2PGBB 1MZDA 4J1YA 5F8TA 4ZKSU 3SHAH 4HGCA 1QBOA 1EB2A 2FWWA 4MNYA 1O2SA 2ANKH 3D62A 3PWBA 1O3DA 1VITG 1IQIA 2V35A 3SUGA 3UUZA 1CT0E 1ZMNA 1BA8B 2BXUH 1BTXA 6ESTA 4Y8YA 1UK3A 2NWNA 2BX4A 2AGGX 4X6OA 3PROA 1FONA 1DSTA 3ZZ3A 5L30H 1O2IA 4XDEA 5FBIA 4ZXXH 1NN6A 2J92A 1GMHG 3KQCA 3SGAE 1OWKA 1W14U 2GCHF 1O2LA 2P16A 2P8OB 4GLYA 1GI2A 2ASUB 4DIIH 3LONA 3M7QA 4X0WU 1O5GH 2BY7X 4Y8XA 2FEQH 4DURA 1AE8H 2VWMA 3A7ZA 4X2XA 3UOUA 1WOFA 3GDUA 5T3HA 5FX6A 1TMTH 1K1PA 3HK3B 2Z3DA 3RC6A 1C2DA 1GHAG 2RCEA 2SGDE 5B6OA 1TAWA 1ETTH 3EE0B 1YF4A 3TGJE 1YPGH 1GBKA 1MMJN 5C1XA 5JPMH 4DGJA 4O3TA 2VIDA 1MCTA 4JZFH 1UCYK 3QUMP 3MO9A 1S83A 1G9IE 5JBTA 4CRBA 1FN6A 1HUTH 2ZFPH 3Q77A 4D9QA 2V0BA 2J2UA 1A46H 1VJAU 5PTPA 4MLFB 1OKXA 4ZXYH 4DY7B 1ZGIA 1F5LA 2ALVA 3M5OA 1AFEH 1BCUH 3TJNA 5GIBA 3FP7E 2PGQB 1C5XB 2PTNA 3KIDU 1J16A 4NSVA 1UHBA 1V2MT 5EW1H 5C1YA 2VIQA 3AAVA 2QC2A 4FUGA 1GHBF 4DOQA 5A0BA 1CT4E 3ZZCA 5DP6A 4R0IA 2H2ZA 2WV5A 4AYVB 4IMZA 1AB9B 1RS0A 1TGNA 5DP4A 2OXSA 2BZAA 5DP3A 3TJOA 3QWCH 2H6MA 4KTUA 1AQ7A 2GT8A 1DICA 1YPEH 2ZFSA 1MAXA 2RA0A 1DWBH 2ILNA 5E0JA 1O2GH 3ZV8A 1NRSH 2Y80A 2TBSA 1ZOMA 4MPUA 4GCHF 1DLKB 1P8VC 1V2NT 2FI4E 4H42U 4D9RA 1RIWB 2BQ6B 2BDAA 3U69H 2QF3A 1SGQE 2GKVE 2HNTC 1YLCA 7GCHG 2UWLA 1P0SH 2ODYB 3W94A 4NSYA 4ISOA 4WWYA 1ACBE 2BMGB 1JIMA 3F68H 3V12A 1TABE 1F0UA 2FOCA 2SGPE 2C4FH 1PQ5A 2W7UA 3EA9A 2EC9H 1C5QA 5CMXH 1KXAA 1QL9A 5TCAA 2W26A 1PPFE 4NFFA 1A7SA 2FI5E 3LGWA 3TITA 1GHVH 4FUEA 5JYIA 1RD3B 2TIOA 3M5NA 1HRTH 4FU7A 1P2MA 2FOGA 4B71A 3ZZAA 1OWJA 3M5MA 4WH8A 4B1TA 1A3EH 1QJ7B 3V3MA 2QAAA 2F9VA 4K1EA 1BBRH 2FO9A 3SI3H 4OGYA 4Y11E 1GVKB 1DSUA 4U32A 1FXYA 1GG6B 1NZQH 1C1QA 1O3IA 1J8AA 1D6RA 2BD8A 3UWIA 1LVOA 2SGFE 2BM2A 1TGSZ 4UFEH 1C5UA 4RN6A 1Z1JA 1S0RA 2AEIH 2H9HA 3GISB 5F8XA 1GI8B 5FCKA 2WPMS 1P2NA 1MTUA 1QL7A 1VGCC 4K8YA 1HAGE 2ZC9H 4WVPE 1GMDG 1MU6B 4IBLH 1N6YA 1AVXA 1M9UA 3NPSA 3LGUA 3SJ9A 1WCZA 2B0FA 1SGIB 5JBAS 1ZLRA 2F83A 1FV9A 1KDQB 2STBE 3RLWH 4NZLA 3BTKE 1GHXH 2VIWA 1C5RA 1CO7E 5AFZH 2QF0A 1YM0A 1W0YH 1S0QA 2ZU2A 1TYNA 3EDXB 1AFQC 1TPOA 4IGDA 1V2PT 1B0EA 1BHXB 4NA9H 1LQEA 3PMAB 2IOTA 1GBEA 4F49A 1C1OA 2ZA5A 2W7SA 2F9NA 2FS8A 1GJCB 3M3VA 1A5IA 2CHAC 4NIXA 3VGCC 3M5LA 2FLRH 1GBMA 2F9PA 1ARCA 1GJ4H 2BY8X 4MPWA 2OC1A 2A4OA 2NU0E 3GY2A 4Y6DA 1MAYA 2F3CE 3MYWA 2ZDAH 4ABJA 1DT2A 1O35A 2DUCA 1C5TA 1QA7A 2BQ7B 3RDZA 1PPHE 1EP5A 2GZ7A 2HPPH 1C4V2 4AX9H 4MVNA 5EQQA 1XKAC 1LDTT 1BB0B 1QJ6B 2R9PA 1GDNA 1L1GA 4FU9A 1V2KT 3LGIA 1ORFA 3KCGH 1O2RA 2BLWA 3A84A 4OS6A 4FUHA 4UD9H 2GCTC 1IQHA 1N1LA 2DE9A 4O03A 3B23B 1SPJA 4Y79A 2AMDA 3LC3A 5IDKA 2Y5FA 1GHZA 1MBMA 2G81E 1AHTH 2FTLE 1YKTA 4THNH 3RUOA 1NFYA 5EQRA 2Q6GA 1GBTA 1HJ9A 4QT8C 4Z6AH 3UR6A 2WYGA 1OS8A 1ANDA 4E06H 2P8OC 1Z6EA 2Z7FE 5LH8A 1C2HA 1NO9H 2FESH 3A8BA 1SFQB 3B9FH 2FYQA 1E35B 3ESTA 3A85A 3SJ8A 4Y0ZE 3ELAH 3C27B 4MTBA 2QV1A 1PYTC 1TA2A 1DWEH 1FY8E 2ZZUH 5E8EH 2XXLA 1O0DH 1MQ6A 1VITF 5BPEA 2JH0D 1F92A 2GX4A 2A5KA 1JBUH 1O37A 1DFPA 4Y71A 2CV3A 4DIHH 4X2VA 3GY4A 3SV8A 3ATIA 2WPLS 2P94A 1Y3UA 4X1RU 1S84A 2HWLB 1DANH 1HAVB 2PKAA 4FUCA 1OP2A 4GCHG 1A5HA 1IHSH 4IN2A 2TGTA 1UTMA 1A0LA 4FXGH 1XM1A 1W11U 5DKMA 4XBDA 2BDHA 4NFEA 1C2GA 4X1SU 4CRCA 3BIUH 1TIOA 2PWXA 2OCVB 1K21H 1Z8IB 3ZZDA 1C1TA 2PW8H 1D3TB 4AG2A 5LPFA 3RXGA 1C2JA 1GHAF 1D3QB 1Z6JH 2WPIS 3HGNA 3HGPA 5FBEA 4CHAC 2VVUA 1TOMH 2BVSH 3E6PH 3ODFA 4K60A 1C5ZB 1EPTC 2WPKS 1F5KU 3BIVH 4NIVA 3GCHC 2FX6A 4Y76A 1ELVA 1YBWA 1V2OT 2O8MA 2J38A 1ELEE 3C1KA 2IN2A 2EA3A 3E90B 2SFAA 2H1UA 2IPHA 2A2XH 1ZYOA 2XCFA 3BF6H 3QO6A 1TMBH 1TWXB 4DG4A 1C2FA 1X7AC 1QL8A 4YOIA 1ZJDA 3QGJA 2OD3B 1O3CA 4X6NA 4ZHMU 2ZFRH 1SHHB 3URDA 2W3IA 1G2MA 1A3BH 2V3OH 3ZVDA 3ZZBA 1FAXA 2WUBA 6LPRA 5DP8A 4BNRA 1NM6A 1WBGB 2XYAA 4LOYH 4NIWA 2A7JA 2PTCE 1QJ1B 3HKIB 3O8DA 1Y59T 5C1UA 1RJXB 3K6ZA 3TLOA 5SGAE 3T5FH 1CU1A 3ATMA 2ZIQH 2ZFQH 3FP8E 1EAWA 1EKBB 2A7HA 3U98H 1LTOA 4YLQH 3RXQA 1TBZH 1HDTH 1QB9A 1Z8GA 2A4RA 2LNCA 5TCCA 3SI4H 3TPIZ 1PYTD 5CE1A 4B74A 3TJVA 4U30A 2BYAX 1ABJH 3L6PA 1HAXB 4FUFA 4XSKU 5EXMA 1ELFA 4YLUA 1BOQA 5C67A 2DE8A 2BTCE 3BN9A 2Z9LA 4GPGA 1FY1A 3UQOA 1HPGA 2XC4A 3A7TA 3RMNH 3G01A 1C5OH 1C1UH 1K1JA 2O8TA 1V2TT 1UVOA 1UCYE 4VGCB 5T6GA 1PPCE 1QHRB 1C1WH 1OWHA 3A7VA 4MNWA 4BTIB 3MU5A 3TGIE 1A0HB 1JRTA 1O2PA 2R2MB 1TNLA 2ZDNA 3M36A 2PLXA 3TK6A 2G00A 1XMNB 1ZSKA 1C9PA 1BMLA 1MTWA 1DX5M 2ODPA 5C5NA 1UTQA 1FNIA 5GXPA 1S5SA 1VGCB 1WU1A 2UUKB 2QCYA 1P2QA 1T31A 1C2KA 1AY6H 4HTCH 2GP9B 2OC7A 3FANA 1GBDA 1AE5A 1MBQA 3EYDA 5LPRA 1YLDA 1GBHA 1TBQH 2ZEBA 4X1QU 2FM2A 2HNTF 4X8TH 2OP9A 4DW2U 1THSH 4E7RG 6GCHG 1L1NA 2C93B 4X1NU 3GDSA 2FODA 4NZQA 2IJOB 1H1BA 3M3TA 1CE5A 4XE4A 4LXBH 1JOUB 1EAUA 1SC8U 1UVUH 2AIQA 1T32A 1AFQB 1V2LT 4BTTB 3F6UH 3MMGA 2XC0A 1ZHMA 1O3FA 1AN1E 2WV4A 3E0NB 1IQNA 3VB4A 1F0TA 2ZGHA 4UFGH 1OYTH 1TONA 4ABHA 4BXWA 4D7FA 1RTFB 1GVZA 4UEHH 2CHAB 3VGCB 4K5ZA 3MU4A 1HV7A 2XWBI 1Q3XA 3P17H 4ISLA 4I7YH 1C1NA 2BZ6H 1GMDF 4I32A 2YOLA 4X2YA 3ZZ7A 1C5LH 1P03A 1GI6A 1BJUA 2GDDA 5HXFA 5DO4H 3PYHA 1E37B 4H4FA 1PPEE 2THFB 1HBTH 3ATKA 2AGEX 1AKSB 1TQ0B 4HFPB 1C1SA 2ZCLP 4MG3A 5A0AE 1UK2A 5CHAC 3SORA 2GCTB 3GY5A 4ZKOU 2Z3EA 1CBWC 5DK1A 3EA7A 1ELDE 1Z1IA 2ZI2H 2A4GA 1GGDC 4BTUB 5ETXA 1C2MA 3Q3KA 3ITIA 4Y10E 1FPCH 3RU4E 1O3AA 1LHDH 2FLBH 4WMFA 5EU8A 1ESBA 3ZVCA 1SGYE 3TNTA 3UTUH 1C5VA 1CA0C 4ZAEA 4WJG2 1ZJKA 1SSXA 1GI5A 1SGCA 2Y7ZA 2FOMB 3SU4A 3RXLA 1FN8A 1UTLM 1IOEA 4JZEH 1GJ7B 1V6DA 1Y8TA 4TY6A 1KXBA 4FU8A 1GDQA 5E2PA 1DY8A 1KXFA 1NS3A 2C3SA 2UUYA 1EZXC 1C1MA 3KF2A 5A2MH 1O2WA 1O3BA 3F9HA 1BRUP 2A4QA 1GMCF 1C5MD 5AVDA 3PM3A 3UNSA 2A5AA 3SV6A 1BRCE 1EAXA 1DWCH 1MH0A 2C8XB 4NWLA 3KNXA 1SGFG 2CMYA 4XFQA 3GY8A 3RXOA 2Y6TA 1VCPA 4IC5A 4YESB 4AOQA 4GUXA 1VJ9U 2G52A 1NFUA 4FUBA 2O8LA 1J17T 1FAKH 3GY6A 3F9EA 3M35A 1OX1A 1O5AB 2BD2A 3S9AA 3PLKA 3SQHE 5ESBA 1UMAH 1S82A 3MU0A 1G3DA 4NG9H 1XUIA 2F9BH 3P8FA 3LIWA 1XX9A 3CS7A 4AFUA 5LGOA 1UTPA 3L33A 4X2WA 4ABBA 3VXEH 2SGEE 2C8ZB 3A89A 5JB9S 2A0QB 1U6QA 2Y82A 4A5TS 1EZSC 2TPIZ 2PUQH 2GV7A 1O33A 4CHAB 3UREA 3OU0A 1DXPA 1GBJA 7LPRA 1KIGH 1EPTB 1QBVH 4GVUA 4YOJA 1TOCB 4ZKRU 1BBRK 1ZMJA 4NGAH 2BDIA 2VWNA 3GCHB 1MKXK 2JETC 3MFJA 1P06A 2NU3E 3ZVFA 1O3KA 1ABIH 4JMYA 5A8YA 3ZYDA 5GCHF 1AVGH 1C2LA 4AORA 2CF8H 5FPTA 1IQKA 3BG4C 4FVDA 4IS5A 1OWIA 4AG1A 1QURH 4AN7A 1GBLA 3TGKE 3RXUA 2PFEA 1C9TA 3E1XB 2A7CA 4F4OC 3RU4D 4YT7H 1O3OA 3SU1A 1E34B 5EOKA 1AMHA 1DS2E 4BANB 3SV9A 1LPGB 1FY4A 3GYLB 1Z8JB 3NCLA 3DFJA 3MU8A 5A0CA 1W13U 2O8WA 5ESTE 1FIZA 2ZGCA 3SNEA 3WY8A 1IQMA 3GCNA 4AGKA 1SR5C 1O2TA 3RXMA 1GBFA 2R2WU 1L4ZA 1KTTB 3RMMH 1TNJA 1EZQA 2TGDA 1AI8H 1SQAA 2C8WB 3KN2A 3F9FA 3H7TA 1JXPA 4JYVH 3ZZ5A 1VR1H 5DP9A 4KTCA 1DE7H 4Q2KA 3A8DA 5HM9A 1SOZA 1MD8A 1HIAB 1SGPE 3ZVBA 1CA8B 5DG6A 1O36A 4CH2B 4NIYA 1EX3A 1QQ4A 1O3GA 1T4UH 1FZZA 1MQ5A 4VGCC 3TH3H 3UOPA 3RP2A 1Y3WA 1QA0A 3LDXH 3RXPA 4LZ4B 2ODQA 1LQDB 1QIXB 3BTTE 4FUIA 4ISNA 1PQAA 4YOGA 5C3NA 3A7XA 3SV2H 1O32A 2ZU5A 3GYMA 5L2ZH 3FFGA 3A81A 1V2ST 2G4UA 3S7HB 3MNSA 2KAIB 2UWPA 2FX4A 3QZRA 1ZMLA 3Q00A 1O2QA 1OPHB 1O2NA 3RXTA 4AFZA 1CQQA 5K7RA 3UY9A 1H8IH 5GWZA 1ZTJA 1MCVA 1UO6A 3A83A 3MNCA 3PLPA 2F9OA 1TPAE 1LKBA 1O30A 1RFNA 2JKHA 1A4WH 4ZROA 5HGGA 3SJOA 3PTNA 1DOJA 4I8KA 4AB9A 3SN8A 4GSOA 1BIOA 2R0KA 5DPAA 5T6DA 9ESTA 1AWFH 3TJUA 4BOHA 1W3CA 5A09A 2XRCA 2TGAA 1ESAA 3FVFB 2HVXA 1TNKA 2UWOA 2PR3A 4X8VH 1O34A 3VPKA 3QN7A 5L6NH 4KTSA 1AO5A 2FOHA 4K3JA 2VVCA 4CBNA 2CXVA 2VIVA 1CGIE 1BTZA 2A1DB 6GCHF 4INKA 1YP9A 2P95A 1AU8A 2FOFA 1WV7H 2P93A 2ZGXH 3GICB 3VFEA 3KGPA 5CHAB 4DCDA 1LPZB 1EATA 3GCTG 3TU7H 3SGBE 2ZF0H 1INCA 3MOCA 1SL3A 1QRXA 4ABGA 1MKWH 1UJ1A 2EI6A 1CBWB 1GMCG 4TPYA 5JBBS 3M37A 1GGDB 2BY5X 1UVTH 1AIXH 1HAPH 1S6FA 1RRKA 2BDGA 1V2RT 4Y0YE 2ZTZA 6CHAC 3LC5A 9LPRA 4K8BA 2SNVA 3RU4T 1MD7A 2FIRH 1YCPH 1CA0B 5I25A 1GI1A 1C5SA 5DP7A 2Z9IA 1AUTC 4KELA 1UK4A 4H6TA 3PB1E 4X6MA 1MTSA 2NU4E 1O2JA 1ZSLA 1QTFA 3LU9B 5IYTA 5C20A 2CF9H 1NESE 1TLDA 4O97A 1T8MA 3GOVB 1LHFH 2ZDVH 1PQ7A 1BMAA 3I29A 4JK5A 3BTGE 4KP0A 2BDCA 2FOEA 1BHXF 2V3HH 1S81A 5AF9H 1LPKB 1SGDE 3GDVA 3K9XB 1G30B 4OS4A 3CENA 1H4WA 4Q7YA 2YNAA 2OLGA 2Z9KA 4Y7AA 3T28A 4A1VA 3O8CA 1SQOA 3ATLA 1H9IE 1GJAB 3FAOA 1SLUB 4YO9A 1GL0E 1TRMA 1SOTA 2Y5HA 1BMMH 5GCHG 5AFYH 1S6HA 2WINI 2SGAA 2ZNKH 1P9SA 2QXIA 4HZHA 4K69A 1NY22 1SG8B 2QYIA 3BG8A 4TPIZ 3ZZ8A 4D76A 1K28D 2ZU4A 1C1VH 1JWTA 2J4IA 1EOLA 1L4DA 1V3XA 2ZU1A 3T2NA 5JDUB 1O5CB 3FP6E 1G3CA 2F9UA 1EQ9A 1GHWH 3K65B 3BTHE 3I78A 4FUDA 4H6SB 4YZUA 1SHYA 1RGQA 2C90B 3U8TH 1QRZA 2I6SA 4A1TA 1FDPA 2XBVA 2ZQ2A 1T4VH 2BDYA 2ZPSA 3MU1A 1F7ZA 3MH4A 2JETB 2QY0B 5FHTA 3SNDA 4A1XA 4ABFA 3LH3A 1O2ZA 4WMEA 3RM0H 3SJIA 1N8OC 4SGBE 1BTPA 1TX6A 1ZZZA 2OUAA 3SU3A 4AZ2B 2PUXB 3BG4B 1TB6H 1AD8H 1MUEB 3RMOH 1HAYB 1O31A 2SGQE 2Z94A 4XBCA 1GI3A 4I31A 3SW2B 1EP6A 2ZTYA 2XBWA 4CREA 1TX7A 1HCGA 2PKAB 1CT2E 1MU8B 2D26C 3PMBB 3P8OA 1Y3YA 2R3YA 2ZHDA 1NU7B 1QGFA 1XVOA 1GCTB 4JYTA 3RXCA 3BTFE 1ZSJA 4MPXA 1GBIA 1DVAH 1LHCH 1GHYH 1Y3VA 1OP8A 2RDLA 3BSQA 2VINA 1NROH 3PMHB 2BD9A 2ZO3H 3E91A 4NA8A 3FZDA 2AIPA 3MO6A 3U1IB 1P10A 4I8HA 1YCPM 2O9QA 4BAQB 3UNRA 1OYQA 1OSSA 1KLTA 4CRDA 1CGJE 3RMLH 3E0PB 1J14A 3GY7A 4TWYA 2A5IA 1UTKA 7ESTE 1YPJH 1K1MA 2BXTH 1QR3E 3BTME 5E0HA 2A45B 4YT6H 3GCOA 1CGHA 2NU2E 3K6YA 3ODDA 1UVSH 3T29A 3RXAA 1GJ5H 1OOKB 3LGVA 3S9BA 1IQGA 3UQVA 2GT7A 4LZ1H 1Z71A 2XCNA 3P8GA 2GD4B 4B2AA 1TPPA 4FVBA 1A0JA 3SNAA 1XXDA 3RXHA 3RXIA 2VU8E 3PV4A 2J34A 8LPRA 1C4U2 3O8RA 4GAWA 4IN1A 1TA6A 1KYNA 1P09A 2G5VA 4BAKB 1P12E 1MTNC 1HNEE 2OBOA 1PPZA 1ID5H 1KLJH 3FZZA 1W12U 3LJJA 3LPRA 3RXEA 1O5FH 1W2KH 1SLVB 1V2VT 4AGJA 2JH6D 1V2UT 2K1QA 3T26A 1G3BA 4UFFH 4CRAA 1C4Y2 4I8JA 2OQ5A 1O3JA 1WUNH 1AKSA 3D49H 3ZV9A 3TH4H 1EJNA 1W10U 2XWAA 1O2OA 1ARBA 5J4SA 1O2XA 1NRNH 2BY6X 3BTEE 5I46H 2GTBA 1FLEE 1ZTLA 2B5TB 3NKKA 3OY6U 1F0SA 3V0XA 2HOBA 3A8CA 1ZRBA 3T27A 4UFDH 1IQLA 2BX3A 5EGMA 4CRGA 2GVFA 3E3TA 1YPHC 4ZHAA 4FUJA 2ZPQA 2AFQB 2D1JA 1HJ8A 2D8WA 4IC6A 1HGTH 1SLWB 2VNTA 1E38B 2BDBA 2SNWA 2Y81A 1YPHE 4OGXA 4UE7H 1GJBB 5GPIB 3V7TA 1HXFH 4X6PA 2H5CA 4K1TA 2ZU3A 1GI4A 1NU9A 3OSYA 1LVMA 3R0FA 2BQWB 4OS2A 2Z9GA 3SU6A 4E05H 1V2JT 2ZCHP 1B7XB 3STJA 2QA9E 2I6QA 5FPYA 4SGAE 1WTGH 3SBKA 1NRPH 5DP5A 4INLA 1HAZB 1KXCA 1WQVH 2AERH 6CHAB 2XBYA 1Z7KA 4PROA 3HPTB 2AGIX 4ISIH 2QXJA 1NRQH 1HXEH 1DUAA 3K2UA 1DDJA 1EAIA 1MZAA 3MNBA 1P01A 3TVJB 1YGCH 1D4PB 3EQ0H 3I77A 1O39A 2BVXH 1EJMA 2TRMA 4OS7A 3RXDA 2HALA 4TY7A 4AFSA 2GZ9A 1Y5BT 3P92A 3ZZ9A 2EI7A 1L1JA 1CHGA 1XKBC 3ATWA 3CS0A 1IQEA 8ESTE 4CH8B 1ZRKA 4A92A 2P3UB 1PJPA 3GCTF 8GCHG 1AVWA 3PMJA 3BTDE 2WUCA 1XVMA 4JK6A 1DWDH 4LK4A 3OYPA 4JZ1A 1CHOG 1NT1A 2ZDLA 2PKSC 3PO1C 1GBBA 3A87A 2OTVA 3LGYA 5LPEA 2GDEH 2ANMH 1XXFA 3B8JA 1AZZA 1GI7B 3H7OA 4NWKA 2H5DA 3AASA 3IWMA 1ANBA 1SLXB 2GV6A 1BQYA 1EPTA 3BTQE 4RKJB 1LO6A 1D9IA 3DT0H 3SU5A 4ASHA 2Q6DA 1BITA 1L0ZA 2G55A 1TNGA 3ZVAA 4UONA 3PTBA 3SUDA 1C1RA 5C5OA 4J2YB 1C5WB 4YM9A 4B75A 1KTSB 1GI0A 1K1LA 1VCWA 3UR9A 2HLCA 5F6MA 1THPB 1PPGE 1P57B 1SQTA 3MH5A 1AWHB 2ZQ1A 1SGTA 1FPHH 1O2HA 4ZMAH 2Z6BD 2AH4X 3NXPA 2G8TA 1JIRA 1K1NA 1P9UA 2VGCC 2R3UA 4Y7BA 1CSOE 1J9CH 3OY5U 2BD5A 1ELBA 4AYYB 3QX5H 4I8GA 1G3EA 4MDSA 1IQFA 3U9AH 2OQUA 3SNCA 2VIOA 3HK6B 1V2WT 2FPZA 1K22H 2ESTE 4X8SH 1GL1A 2BD4A 1N8OB 1FQ3A
chains in the Genus database with same CATH superfamily
4FOUC 5H4IB 3RXSA 3O8BA 1DY9A 3QLPH 1O3HA 3NWUA 3SUFA 4AC9A 1WQSA 4ZUHA 1A5GH 1G32B 1W0ZU 1O5EH 2W5EA 5J4QA 5K0HA 1LHGH 4JZIA 1N6XA 1PPBH 1TGBA 3MTYA 4AB8A 1IHTH 2ZDMA 4ABIA 3SO3A 3EGKH 2OC0A 2VVVA 1GJ8B 3VB3A 1TFXA 1HIAA 3EAJA 3F2FA 3CP7A 1GBCA 1EJAA 3OX7U 1LVBA 3SQEE 1JMOH 4ZHLU 5G4BA 2W3KA 3UNQA 1EB1H 1GCTC 2Z9JA 1BRAA 1FI8A 3LGTA 3OAAD 4MNXA 1TQ7B 4ZH8A 1UHBB 1P05A 3M61U 1H9HE 3KYFA 1P3CA 1XUJA 2B7DH 1GJ9B 1GPZA 1VCQA 2VWLA 1OWDA 1QCPA 5EQSA 3SGQE 1K2I1 4U01A 1HB0B 1KXDA 1UCYH 4O3UA 1D3PB 5HIYA 3RXVA 2KCOA 3KQ5A 4Q7XA 2HNTE 2BD3A 4JZDH 5DJ7A 5GNDA 3M3SA 2XNIA 3A82A 2FTMA 1UTJA 4BAOB 1QY6A 3P70B 3KQEA 3BTWE 2G5NA 2KAIA 2TGPZ 3P95A 3DHKH 4GHTA 3SUEA 1V2QT 2FOAA 2QN5T 2WV9A 1HJAB 4XD7D 3BEIB 2M2AA 1KDQA 2HRVA 1TMUH 4Y8ZA 1ELGA 2VWOA 4X1PU 3JZ2B 4A7IB 4CR5A 4TYDA 1B0FA 1TBRH 1ZPZA 1FIWA 2BOHB 1XUHA 2GGVB 1YLNA 2LELA 4E7NA 3Q3YA 3NZIA 3SU0A 3L3TA 3QTOH 1ESTA 3KQDA 3R3GB 1EUFA 1WXRA 2CJIA 2ZG0H 1TNHA 5FPSA 1MKWK 3SZNA 1Y3XA 2J94A 2ZGBH 1MKXH 3N99A 1VZQH 2ULLA 2A2QH 2J95A 2XW9A 1MTNB 4UDWH 4WH6A 2CN0H 1A1RA 1BTUA 1EOJA 3MNXA 1BTYA 1QBNA 3IG6B 1NFXA 1S85A 3D23A 1Z8RA 2QXGA 1ELCA 3LKWA 3RLYH 4DJZB 3P6ZB 3M7TA 1EASA 1YPKH 1FMGA 3QZQA 2YNBA 2VBCA 1YCPK 1Y5AT 3TH2H 1UTNA 4WXVA 1HYLA 3TK9A 3VEQB 2UUJB 2PP6A 3A8AA 1G36A 1ZGVA 4D8NA 4B76A 1ETRH 2ZP0H 2XBXA 2GMTC 3U8RH 2F91A 4ZKNU 2ZFTA 5L2YH 2ZTXA 1MTVA 7KMEH 3RXJA 3F2GA 4ABAA 1ZR0A 2LPRA 1NC6A 4CRFA 3MQKC 4XOJA 3KEEA 3TIUA 1H8DH 1VITH 3AVZA 1BTWA 1C1PA 4I33A 5FCRA 4YXWD 3D65E 2VIPA 2Q6FA 3RXKA 1LHEH 1SB1H 1RTKA 2G51A 3FKSD 3JZ1B 4KKDA 2FZZA 3VB6A 1C2IA 1W8BH 3A88A 5E2OA 1O2UA 5BRRE 1T8NA 1SGFA 1Q2WA 4FETA 4Q7ZA 3DFLA 2P59A 1DITH 1AUJA 1GCDA 1O5DH 3RM2H 2ZDKA 1O2MA 1LVYA 3VXFH 3DSPA 4BAMB 1ZTKA 1K0HA 1B5GH 1XUFA 5TJXA 2CK3D 2GCHG 4ISHH 1K9OE 1DLEA 2OBQA 3S9CA 3BEUA 3LOXA 4B73A 1LCYA 3ZVEA 2Y5GA 3UIRA 1WTHD 2ZHEH 3ENSB 4MPVA 2CGAA 2XC5A 1KLIH 1D6WA 1JRSA 3NUMA 2J9NA 3DD2H 2RA3A 2AYWA 3H5CB 2Q1JA 1BT7A 1GDUA 2VH6A 1TGTA 1P3EA 3F0PA 2ZKSA 2BLVA 1NTPA 4DT7B 1F5RA 3LT3A 1O3LA 2PHBA 2ZECA 4MQAA 3A7YA 1SGRE 4CR9A 2Z3CA 3ZYEA 2RG3A 1ELTA 1HAVA 5EXNA 1C5YB 1AZ8A 4IMQA 1TNIA 4DVAU 2W6JD 2ZHQH 3F1SB 3KQBA 1ZHRA 4ABEA 4RKOB 1P11E 1WSSH 2FYRA 1H9LB 1SFIA 1TALA 4XRNA 1QFKH 4RSPA 2H9EH 1HLTH 2WZQA 3AAUA 1G37A 3UWJH 2HGTH 3GY3A 1ZHPA 1FJSA 2PKSB 2ZCKP 3PO1B 1QRWA 5CHBA 5EODA 3V13A 3TNSA 1BUIA 5FX5A 4HI3A 3MH7A 3UFAA 4MNVA 1ANCA 5HYOA 2A31A 1GHBG 1FY3A 1GVLA 3A80A 2M5TA 2AMQA 2ANYA 3E8LA 1BZXE 1K1IA 3RXBA 1HAIH 4OS5A 3BEFB 3DUXH 3NK8A 5EPNA 4GHQA 5FXLA 3U8OH 1IQJA 1LMWB 1W7XH 2BHGA 1GJ6A 2ZWLH 2BOKA 5C2ZA 3MHWU 3QDZB 1E36B 1GMHF 3DSOA 5A8ZA 2VGCB 8GCHF 1C5NH 3T25A 1BMNH 1SVPA 2RFKC 2XTTB 4O9VA 4D7GA 3E16B 1P04A 3S7KB 3P8NA 3EA8A 1CHOF 3Q3XA 1QB6A 1YWUA 1D3DB 3ZZ4A 1O3EA 3RXRA 2QIQA 2ZPRA 4YTAA 5F03A 3UAIC 2V6NA 4K2YA 2Y7XA 4WF8A 4AFQA 5A8XA 1QNJA 5EW2H 1TRNA 1KXEA 1TPSA 1WYKA 1QB1A 2ANWA 3SNBA 1AB9C 3KHVA 2P3TB 4KGAA 2FOBA 3N7OA 5HMAA 1YPLH 1C2EA 1NFWA 1FY5A 1BRBE 1GJDB 1G2LA 2WPJS 5JBCS 1SGNE 2BLQA 1YPMH 1GWAA 8KME2 2WPHS 1UVPA 1W7GH 2B8OH 4IW4E 4U2WA 3S69A 1CVWH 3STIA 1RXPA 1IAUA 3SJKA 1O3NA 4WXIA 1S6LA 4TWWA 1C5PA 1P02A 2ZHFH 2OINA 5GJ4B 5C0UA 2BD7A 2G4TA 2O8UA 3Q76A 3ZZ6A 3SHCH 1RIWC 1LKAA 1O2KA 1YYY1 1SMFE 1L2EA 1NRRH 1BDAA 1O38A 1EZUC 3PWCA 1HFDA 3SV7A 3F9GA 2FP7B 2VJ1A 3OTJE 1Y5UT 1RTLA 1OP0A 1YC0A 2AMPA 2FI3E 2HVYB 1TRYA 3HKJB 2UUFB 3UPEA 3BV9B 3MI4A 2EEKA 1J15A 1ELAA 3WW7A 1HJAC 1FUJA 1T8LA 3A86A 4M7GA 3TK5A 4CBOA 1P2KA 2FXRA 1UTOA 5GDSH 5FAHA 5F8ZA 1P2JA 2B9LA 3A7WA 1AGJA 1K1OA 2P3FH 3F3BA 2FDAA 1T7CA 1SI5H 3WWBA 5JB8S 3ZVGA 1TGCA 2D2DA 3RXFA 4BAHB 3LH1A 4NA7A 2BLOA 1O3PB 1P2IA 3M7UA 4X8UH 2VH0A 1XUKA 1TE0A 2W6ID 4TT3D 2BY9X 4WY3A 1DUEA 1DM4B 1ANEA 2OC8A 3IITA 1BTHH 4I8LA 5EG4A 7GCHF 4B2CA 2ZHWH 1GG6C 1ZPCA 4B2BA 5C17A 3RC5A 3T62A 4ABDA 2JH5D 3S0NA 5T6FA 2NU1E 4INHA 3RC4A 1HAHH 3QTVH 1ZPBA 3W95A 2ZGJA 2STAE 2VB0A 3MWIU 3KL6A 2R0LA 4OS1A 2JJ2D 1E0FD 4BXSA 1BBRE 5EPYA 1O2VA 4JCNA 2PV9B 2EI8A 1TX8A 1SGEE 3VB7A 2GZ8A 1O5BB 2GMTB 4WMDA 5EJZA 1T8OA 4R8TB 1KSNA 1F2SE 2QGRA 5DGJA 2PSYA 5HM2A 4Z0KA 1BJVA 3MO3A 2ZFFH 1A2CH 1O2YA 3HATH 5EXLA 3U1JB 1F0RA 2AS9A 1A61H 1XUGA 1DPOA 4Q80A 1WAYB 3AW1A 2ALPA 2A32A 3SOSA 1PQ8A 5C0TA 3URCA 4XBBA 1DXWA 4JYUH 3VB5A 4A6LA 3LJOA 1EXFA 1OWEA 1ETSH 1SBWA 1Q31A 1GBAA 1GI9B 5AHGH 2FMJA 3SU2A 5E0GA 2WYJA 4K1SA 1HAOH 2C8YB 2QXHA 3DA9B 2BVRH 2PSXA 5ABWA 3MH6A 3AW0A 2HPQH 3QGNB 1PFXC 1O3MA 3PLBA 1QQUA 1THRH 2FS9A 2H9TH 1NPMA 3QK1A 1P2OA 2BB4A 4NCYA 2KM0A 1KY9A 3SYJA 1OXGA 4ESTE 2PGBB 1MZDA 4J1YA 5F8TA 4ZKSU 3SHAH 2J5UA 4TSFD 4HGCA 1QBOA 1EB2A 2FWWA 4MNYA 1O2SA 4Q63A 2ANKH 3D62A 3PWBA 1O3DA 1VITG 1IQIA 2V35A 3SUGA 3UUZA 1CT0E 3OFND 1ZMNA 1BA8B 2BXUH 1BTXA 6ESTA 4Y8YA 1UK3A 2NWNA 2BX4A 2AGGX 4X6OA 3PROA 1FONA 1DSTA 3ZZ3A 5L30H 1O2IA 4XDEA 5FBIA 4ZXXH 1NN6A 2J92A 1GMHG 3KQCA 3SGAE 1OWKA 1W14U 2GCHF 5EIYA 1O2LA 2P16A 2P8OB 3U28C 5B6LA 4GLYA 1YY3A 1GI2A 1MABB 2ASUB 4DIIH 3LONA 3M7QA 4X0WU 1O5GH 2BY7X 4Y8XA 2FEQH 4DURA 1AE8H 2VWMA 3A7ZA 4X2XA 3UOUA 1WOFA 3GDUA 5T3HA 5FX6A 1TMTH 1K1PA 3HK3B 2Z3DA 3RC6A 1C2DA 1QZ8A 1GHAG 2RCEA 2SGDE 5B6OA 1TAWA 2L74A 1ETTH 3EE0B 1YF4A 3TGJE 1YPGH 1GBKA 1MMJN 5C1XA 5JPMH 4DGJA 4O3TA 2VIDA 1MCTA 4JZFH 1UCYK 4ACBA 3QUMP 3MO9A 1S83A 1G9IE 5JBTA 4CRBA 1FN6A 1HUTH 2ZFPH 3Q77A 4D9QA 2V0BA 2J2UA 1A46H 1VJAU 5PTPA 4MLFB 1OKXA 4ZXYH 4DY7B 1ZGIA 1F5LA 2ALVA 3M5OA 1AFEH 1BCUH 3TJNA 5GIBA 3FP7E 2PGQB 4ACAA 1C5XB 2PTNA 3KIDU 1J16A 4NSVA 1UHBA 1V2MT 5EW1H 5C1YA 2VIQA 2K8IA 3AAVA 2QC2A 4FUGA 1GHBF 4DOQA 5A0BA 4I86A 1CT4E 3ZZCA 5DP6A 4R0IA 2H2ZA 2WV5A 4AYVB 4IMZA 5HKKD 1AB9B 1RS0A 1TGNA 5DP4A 2OXSA 2BZAA 5DP3A 2AHME 3TJOA 3QWCH 2H6MA 4KTUA 1AQ7A 2GT8A 1DICA 1YPEH 2ZFSA 1MAXA 2RA0A 1DWBH 2ILNA 5E0JA 1O2GH 3ZV8A 1NRSH 2Y80A 2TBSA 1ZOMA 4MPUA 2KCAA 4GCHF 1DLKB 1P8VC 1V2NT 2FI4E 4H42U 4D9RA 1RIWB 2BQ6B 2BDAA 3U69H 2QF3A 1COWD 1SGQE 5C94A 2GKVE 2HNTC 1YLCA 7GCHG 1EFRD 2UWLA 1P0SH 2ODYB 3W94A 4NSYA 4ISOA 4WWYA 1ACBE 2BMGB 1JIMA 3F68H 3V12A 1TABE 1F0UA 2KZ4A 1SQRA 2FOCA 2SGPE 2C4FH 1PQ5A 2W7UA 3EA9A 1OHHD 1C5QA 2EC9H 5CMXH 1KXAA 1QL9A 5TCAA 2W26A 1PPFE 4NFFA 1A7SA 2FI5E 3LGWA 3TITA 1GHVH 4FUEA 5JYIA 1RD3B 2TIOA 3M5NA 1HRTH 4FU7A 1P2MA 2FOGA 4B71A 3ZZAA 1OWJA 3M5MA 4WH8A 4B1TA 1A3EH 1QJ7B 3V3MA 2QAAA 2F9VA 4K1EA 1BBRH 2FO9A 3SI3H 4OGYA 4Y11E 1GVKB 1DSUA 4U32A 1FXYA 1GG6B 1NZQH 3H09A 1C1QA 1O3IA 1J8AA 1D6RA 2BD8A 3UWIA 1LVOA 2SGFE 2BM2A 1TGSZ 4UFEH 1C5UA 4RN6A 1Z1JA 1S0RA 2AEIH 2H9HA 3GISB 5F8XA 1GI8B 5FCKA 2WPMS 1P2NA 5KGOA 1MTUA 1QL7A 1VGCC 4K8YA 1HAGE 2ZC9H 4WVPE 1GMDG 1MU6B 4IBLH 1N6YA 1AVXA 1M9UA 3NPSA 3NRLA 3LGUA 3SJ9A 3CNRA 1WCZA 2B0FA 3PRDA 1SGIB 5JBAS 1ZLRA 2F83A 1FV9A 1KDQB 2STBE 3RLWH 4NZLA 2QE7D 3BTKE 1GHXH 2VIWA 1W0JD 1C5RA 1CO7E 5AFZH 2QF0A 1YM0A 1W0YH 1S0QA 2ZU2A 1TYNA 3EDXB 1AFQC 1TPOA 4IGDA 1NBME 1V2PT 1B0EA 1BHXB 4NA9H 1LQEA 3PMAB 2IOTA 1GBEA 4F49A 1C1OA 2WHXA 2ZA5A 2W7SA 2F9NA 2FS8A 1GJCB 3M3VA 1A5IA 2CHAC 4NIXA 4Q4LA 3VGCC 3M5LA 2FLRH 1GBMA 2F9PA 1ARCA 1GJ4H 2BY8X 4MPWA 2OC1A 2A4OA 2NU0E 3GY2A 4Y6DA 1MAYA 2HLDD 2F3CE 3MYWA 2ZDAH 4ABJA 5IK2D 1DT2A 1O35A 1WDIA 2DUCA 1C5TA 3N7DA 1QA7A 2BQ7B 3RDZA 1PPHE 1EP5A 2GZ7A 2HPPH 1C4V2 4AX9H 4MVNA 5EQQA 1XKAC 1LDTT 1BB0B 1QJ6B 2R9PA 1GDNA 1L1GA 4FU9A 1V2KT 3LGIA 1ORFA 3KCGH 1O2RA 2BLWA 3A84A 4OS6A 4FUHA 4UD9H 2GCTC 1IQHA 1N1LA 2DE9A 4O03A 3B23B 1SPJA 4Y79A 2AMDA 3LC3A 5IDKA 2Y5FA 1GHZA 1MBMA 2G81E 1AHTH 2FTLE 1YKTA 4THNH 3RUOA 1NFYA 3UB0A 5EQRA 2Q6GA 1GBTA 1HJ9A 4QT8C 4Z6AH 3UR6A 2WYGA 1OS8A 1ANDA 4E06H 2P8OC 1Z6EA 2Z7FE 5LH8A 1C2HA 1NO9H 2KCYA 2FESH 3A8BA 1SFQB 3B9FH 2FYQA 4RT0A 1E35B 3ESTA 3A85A 3SJ8A 4Y0ZE 3ELAH 3C27B 4MTBA 2QV1A 1PYTC 1TA2A 1DWEH 1FY8E 2ZZUH 5E8EH 2XXLA 1O0DH 1MQ6A 1VITF 5BPEA 2JH0D 1F92A 2GX4A 2A5KA 1JBUH 1O37A 2L6OA 1DFPA 4Y71A 2CV3A 4DIHH 4X2VA 3GY4A 3SV8A 3ATIA 2WPLS 2P94A 1Y3UA 4X1RU 1S84A 5EJLA 2HWLB 1DANH 1HAVB 2PKAA 4FUCA 1NBMD 1OP2A 4GCHG 1A5HA 1IHSH 4IN2A 2TGTA 1UTMA 1A0LA 4FXGH 1XM1A 1W11U 5DKMA 4XBDA 2BDHA 2KFWA 4NFEA 1C2GA 4X1SU 4CRCA 3BIUH 1TIOA 2PWXA 2OCVB 1K21H 1Z8IB 3ZZDA 1C1TA 2JJ1D 2PW8H 1D3TB 4AG2A 5LPFA 3RXGA 1C2JA 1GHAF 4ASUD 1D3QB 1Z6JH 2WPIS 3HGNA 3HGPA 5FBEA 4CHAC 2VVUA 1TOMH 2BVSH 3E6PH 3ODFA 4K60A 1C5ZB 1EPTC 2WPKS 1F5KU 3BIVH 4NIVA 3GCHC 2FX6A 4Y76A 1H8HD 1ELVA 1YBWA 1V2OT 2V3MA 2O8MA 2J38A 1ELEE 3DCLA 3C1KA 2IN2A 2EA3A 3E90B 2SFAA 2H1UA 2IPHA 2A2XH 1ZYOA 2XCFA 3BF6H 3QO6A 1TMBH 1TWXB 4DG4A 1C2FA 1X7AC 1QL8A 4YOIA 1ZJDA 3QGJA 2OD3B 1O3CA 4X6NA 4ZHMU 2ZFRH 1SHHB 3URDA 2W3IA 1G2MA 1A3BH 2V3OH 3ZVDA 3ZZBA 1FAXA 2WUBA 4M9FA 5DP8A 6LPRA 4BNRA 1NM6A 1WBGB 2XYAA 4LOYH 4NIWA 2A7JA 2PTCE 1QJ1B 3HKIB 3O8DA 1Y59T 5C1UA 1RJXB 3K6ZA 3TLOA 5SGAE 3T5FH 1CU1A 3ATMA 2ZIQH 2ZFQH 3FP8E 1EAWA 1EKBB 2A7HA 3U98H 1LTOA 4YLQH 3RXQA 1TBZH 1HDTH 1QB9A 1Z8GA 2A4RA 2LNCA 5TCCA 3SI4H 3TPIZ 1PYTD 5CE1A 4B74A 3TJVA 4U30A 2BYAX 1ABJH 3L6PA 1HAXB 2IPQX 4FUFA 4XSKU 5EXMA 1ELFA 2J98A 4YLUA 1BOQA 5C67A 2DE8A 3OTPA 2BTCE 3BN9A 2Z9LA 4GPGA 1FY1A 3UQOA 1HPGA 2XC4A 3A7TA 3RMNH 3G01A 1C5OH 1C1UH 1K1JA 2O8TA 1V2TT 1UVOA 1UCYE 4VGCB 5T6GA 1PPCE 1QHRB 1C1WH 1OWHA 3A7VA 4MNWA 4BTIB 3MU5A 3TGIE 1A0HB 1JRTA 1O2PA 2R2MB 1TNLA 2ZDNA 3M36A 2PLXA 3TK6A 2G00A 1XMNB 1ZSKA 3OEED 1C9PA 1BMLA 1MTWA 1DX5M 2ODPA 5C5NA 1UTQA 1FNIA 5GXPA 1S5SA 4OM9A 1VGCB 1WU1A 4DT4A 2UUKB 2QCYA 1P2QA 4P00A 1T31A 1C2KA 1AY6H 4HTCH 2GP9B 2OC7A 3FANA 1GBDA 1AE5A 1MBQA 3EYDA 5LPRA 1YLDA 1GBHA 1TBQH 2ZEBA 4X1QU 2FM2A 2HNTF 4X8TH 2OP9A 2F43B 1THSH 4DW2U 3F0OA 4E7RG 6GCHG 1L1NA 2C93B 4X1NU 3GDSA 2FODA 4NZQA 2IJOB 1H1BA 3M3TA 1CE5A 4XE4A 4LXBH 1JOUB 1EAUA 1SC8U 1UVUH 2AIQA 1T32A 1AFQB 1V2LT 4BTTB 3F6UH 3MMGA 2XC0A 1ZHMA 1O3FA 1AN1E 2WV4A 3E0NB 1IQNA 2XOKD 3VB4A 1F0TA 2ZGHA 4UFGH 1OYTH 1TONA 1H8ED 4ABHA 4BXWA 4D7FA 1RTFB 1GVZA 4UEHH 5T1VA 3FO8D 2CHAB 3VGCB 4K5ZA 3MU4A 1HV7A 2XWBI 1Q3XA 3P17H 4ISLA 4I7YH 1C1NA 2BZ6H 1GMDF 5DN6D 4I32A 2YOLA 4X2YA 3ZZ7A 1C5LH 1P03A 1GI6A 1BJUA 2GDDA 5HXFA 5DO4H 3PYHA 1E37B 4H4FA 1PPEE 2THFB 1HBTH 3ATKA 2AGEX 1AKSB 1TQ0B 4HFPB 1C1SA 2ZCLP 4MG3A 5A0AE 1UK2A 5CHAC 3SORA 2GCTB 3GY5A 2OK5A 4ZKOU 2Z3EA 1CBWC 5DK1A 3EA7A 1ELDE 1Z1IA 3W1EA 2ZI2H 2A4GA 1GGDC 4BTUB 5ETXA 1C2MA 3Q3KA 3ITIA 4Y10E 1FPCH 3RU4E 1O3AA 1LHDH 2FLBH 4WMFA 5EU8A 1ESBA 3ZVCA 1SGYE 3TNTA 3UTUH 3OE7D 1C5VA 1CA0C 4ZAEA 4WJG2 2GJGA 1ZJKA 1SSXA 1GI5A 1SGCA 2Y7ZA 2FOMB 3SU4A 5HIZA 3RXLA 1FN8A 1UTLM 1IOEA 4JZEH 1GJ7B 1V6DA 1Y8TA 4TY6A 1KXBA 4FU8A 1GDQA 5E2PA 1DY8A 1KXFA 1NS3A 2C3SA 2UUYA 1EZXC 4RI0A 1C1MA 3KF2A 5A2MH 1O2WA 1O3BA 3F9HA 1BRUP 2A4QA 1GMCF 1C5MD 5AVDA 3PM3A 3UNSA 2A5AA 3SV6A 1BRCE 1EAXA 1DWCH 1MH0A 2C8XB 4NWLA 3KNXA 1SGFG 2CMYA 4XFQA 3GY8A 3RXOA 2Y6TA 1VCPA 4IC5A 4YESB 4AOQA 4GUXA 1VJ9U 2G52A 1NFUA 4FUBA 2O8LA 1J17T 1FAKH 3GY6A 3F9EA 3M35A 1OX1A 1O5AB 2BD2A 3S9AA 3PLKA 1E1RD 3SQHE 4Z1MD 5ESBA 1UMAH 1S82A 3MU0A 5F53A 1G3DA 4NG9H 1XUIA 2F9BH 3P8FA 3LIWA 1XX9A 3CS7A 4AFUA 5LGOA 1UTPA 5KEDA 3L33A 4X2WA 3FOAA 4ABBA 3VXEH 2SGEE 2C8ZB 2LP6A 3A89A 5JB9S 2A0QB 1U6QA 2Y82A 4B6FA 4A5TS 1EZSC 1FX0B 2PUQH 2TPIZ 2GV7A 1O33A 4CHAB 3UREA 3OU0A 1DXPA 1GBJA 7LPRA 1KIGH 1EPTB 3VG8A 1E1QD 1QBVH 4GVUA 4YOJA 1TOCB 4ZKRU 1BBRK 1ZMJA 4NGAH 2BDIA 2VWNA 3GCHB 1MKXK 2JETC 3MFJA 1P06A 2NU3E 3ZVFA 1O3KA 1ABIH 4JMYA 5A8YA 3ZYDA 5GCHF 1AVGH 1C2LA 4AORA 2CF8H 5FPTA 1IQKA 3BG4C 4FVDA 4IS5A 1OWIA 4AG1A 1QURH 4AN7A 1GBLA 3TGKE 3RXUA 2PFEA 1C9TA 3E1XB 2A7CA 4F4OC 3RU4D 4YT7H 1O3OA 3SU1A 1E34B 5EOKA 1AMHA 1DS2E 4BANB 3SV9A 1LPGB 1FY4A 3GYLB 1Z8JB 3NCLA 3DFJA 3MU8A 5A0CA 1W13U 2O8WA 5ESTE 1FIZA 2ZGCA 3SNEA 3WY8A 1IQMA 1SKYE 3GCNA 4AGKA 1SR5C 1O2TA 3RXMA 1GBFA 2R2WU 1L4ZA 1KTTB 3RMMH 1TNJA 1EZQA 2TGDA 1AI8H 1SQAA 2C8WB 3KN2A 3F9FA 3H7TA 1JXPA 3FN8A 4JYVH 3ZZ5A 1VR1H 5DP9A 4KTCA 1DE7H 4Q2KA 3A8DA 5HM9A 1SOZA 1MD8A 1HIAB 1SGPE 3ZVBA 1CA8B 5DG6A 1O36A 4CH2B 4NIYA 1EX3A 1QQ4A 1O3GA 1T4UH 1FZZA 1MQ5A 3KYGA 4VGCC 3TH3H 3UOPA 3RP2A 1Y3WA 1QA0A 3LDXH 3RXPA 4LZ4B 2ODQA 1LQDB 1QIXB 3BTTE 4FUIA 4ISNA 1PQAA 4YOGA 5C3NA 3A7XA 3SV2H 1O32A 2ZU5A 3GYMA 5L2ZH 3FFGA 3A81A 1V2ST 3GS9A 2G4UA 5EJ1A 3S7HB 2YMSC 3MNSA 2KAIB 2UWPA 2FX4A 3QZRA 1ZMLA 3Q00A 1O2QA 1OPHB 1O2NA 3RXTA 4AFZA 1CQQA 5K7RA 3UY9A 1H8IH 5GWZA 2RDEA 1ZTJA 3ZIAD 1MCVA 1UO6A 3A83A 3MNCA 3PLPA 2F9OA 1TPAE 1LKBA 1O30A 1RFNA 2JKHA 1A4WH 4ZROA 5HGGA 3SJOA 3PTNA 1DOJA 4I8KA 4AB9A 3SN8A 4GSOA 1BIOA 2R0KA 5DPAA 5T6DA 9ESTA 1AWFH 3TJUA 2QF4A 4BOHA 4P02A 1W3CA 5A09A 2XRCA 2TGAA 1ESAA 3FVFB 2HVXA 1BMFD 1TNKA 2UWOA 2PR3A 4X8VH 1O34A 3VPKA 3QN7A 5L6NH 4KTSA 1AO5A 2FOHA 4K3JA 2QF5A 2VVCA 2CXVA 4CBNA 2VIVA 1CGIE 1BTZA 2A1DB 6GCHF 4INKA 1YP9A 2P95A 1AU8A 2FOFA 1WV7H 2P93A 2ZGXH 3GICB 3VFEA 3KGPA 5CHAB 4DCDA 1LPZB 1EATA 3GCTG 3TU7H 3SGBE 2ZF0H 1INCA 3MOCA 1SL3A 1QRXA 4ABGA 1MKWH 1UJ1A 2EI6A 1CBWB 1GMCG 2EY4C 4TPYA 5JBBS 3M37A 1GGDB 2BY5X 1UVTH 1AIXH 1HAPH 1S6FA 2WSSD 1RRKA 2BDGA 1V2RT 4Y0YE 2ZTZA 6CHAC 3LC5A 9LPRA 4K8BA 2SNVA 3RU4T 1MD7A 2XNDD 2FIRH 2F4LA 1YCPH 1CA0B 5I25A 1GI1A 1C5SA 5DP7A 2Z9IA 1AUTC 4KELA 1UK4A 4H6TA 3PB1E 4X6MA 1MTSA 2NU4E 1O2JA 1ZSLA 1QTFA 3LU9B 5IYTA 5C20A 2CF9H 1NESE 1TLDA 4O97A 1T8MA 3GOVB 2K0QA 1LHFH 2ZDVH 1PQ7A 1BMAA 3I29A 4JK5A 3BTGE 4KP0A 2BDCA 2WPDD 2FOEA 1BHXF 2V3HH 1S81A 4HG6A 5AF9H 1LPKB 1SGDE 3GDVA 3K9XB 1G30B 4OS4A 3CENA 1H4WA 4Q7YA 2YMSD 2JIZD 2YNAA 3WWFA 2OLGA 2Z9KA 4Y7AA 4F48B 3T28A 4A1VA 3O8CA 1SQOA 3ATLA 1H9IE 1GJAB 3FAOA 1SLUB 4YO9A 1GL0E 1TRMA 1SOTA 2Y5HA 1BMMH 5GCHG 5AFYH 1S6HA 2WINI 2SGAA 2ZNKH 1P9SA 2QXIA 4HZHA 4K69A 1NY22 1SG8B 2QYIA 3BG8A 4TPIZ 3ZZ8A 4D76A 1K28D 2ZU4A 1C1VH 1JWTA 2J4IA 1EOLA 1L4DA 1V3XA 2ZU1A 3T2NA 5JDUB 1O5CB 3FP6E 1G3CA 2F9UA 1EQ9A 3OEHD 1GHWH 3K65B 3BTHE 3I78A 4FUDA 4H6SB 4YZUA 1SHYA 1RGQA 2C90B 3U8TH 1QRZA 2I6SA 4A1TA 1FDPA 2XBVA 2ZQ2A 1VKYA 1T4VH 2BDYA 2ZPSA 3MU1A 1F7ZA 3MH4A 2JETB 2QY0B 5FHTA 3SNDA 4A1XA 4ABFA 5FL7D 3LH3A 1O2ZA 4WMEA 3RM0H 3SJIA 1N8OC 4SGBE 1BTPA 1TX6A 1ZZZA 2OUAA 3SU3A 4AZ2B 2PUXB 3BG4B 1TB6H 1AD8H 1MUEB 3RMOH 1HAYB 1O31A 1UW7A 2SGQE 2Z94A 4XBCA 1GI3A 4I31A 3SW2B 1EP6A 2ZTYA 2XBWA 4CREA 1TX7A 1HCGA 2PKAB 1CT2E 1MU8B 2D26C 3PMBB 3P8OA 1Y3YA 2R3YA 2ZHDA 1NU7B 1QGFA 1XVOA 5CDFE 1GCTB 4JYTA 3RXCA 3BTFE 1ZSJA 4MPXA 1GBIA 1DVAH 1LHCH 1GHYH 1Y3VA 3PV2A 1OP8A 2RDLA 3BSQA 2VINA 1NROH 3PMHB 2BD9A 2ZO3H 3E91A 4NA8A 3FZDA 2AIPA 3MO6A 5KECA 3U1IB 1P10A 4I8HA 1YCPM 2O9QA 4BAQB 3UNRA 1OYQA 1OSSA 1KLTA 4CRDA 1CGJE 3RMLH 2JDID 3E0PB 1J14A 3GY7A 4TWYA 2A5IA 1UTKA 7ESTE 1YPJH 1K1MA 2BXTH 1QR3E 3BTME 5E0HA 2A45B 4YT6H 3GCOA 1CGHA 2NU2E 3K6YA 4F55A 3ODDA 1UVSH 2KX4A 3T29A 3RXAA 1GJ5H 1OOKB 3LGVA 1KMHB 3S9BA 1IQGA 3UQVA 2GT7A 4LZ1H 1Z71A 2XCNA 3P8GA 2GD4B 4B2AA 2V7QD 1TPPA 4FVBA 1A0JA 2J97A 3SNAA 1XXDA 3RXHA 3RXIA 2VU8E 3PV4A 2J34A 8LPRA 1C4U2 3O8RA 4GAWA 4IN1A 1TA6A 1KYNA 1P09A 2YMSB 2G5VA 3AK5A 4BAKB 1P12E 1MTNC 1W0KD 1HNEE 2OBOA 1PPZA 3PRBA 1ID5H 1KLJH 3FZZA 1W12U 3LJJA 3LPRA 3RXEA 1O5FH 1W2KH 1SLVB 1V2VT 4AGJA 2JH6D 1V2UT 2K1QA 4ZCNA 3T26A 1G3BA 4UFFH 4CRAA 1C4Y2 4I8JA 2OQ5A 1O3JA 1WUNH 1AKSA 3D49H 3ZV9A 3TH4H 1EJNA 1W10U 2XWAA 1O2OA 1ARBA 2J98B 5J4SA 1O2XA 1NRNH 2BY6X 3BTEE 5I46H 2GTBA 1FLEE 1ZTLA 2B5TB 3NKKA 3OY6U 1F0SA 3V0XA 2HOBA 3A8CA 1ZRBA 3T27A 4UFDH 1IQLA 2BX3A 5EGMA 4CRGA 2GVFA 3E3TA 1YPHC 4ZHAA 4FUJA 2ZPQA 2AFQB 2D1JA 1HJ8A 2D8WA 4IC6A 1HGTH 1SLWB 2VNTA 1E38B 2BDBA 2SNWA 2Y81A 1YPHE 2IJD1 4OGXA 4UE7H 3N7EA 1GJBB 5GPIB 3V7TA 1HXFH 4X6PA 2H5CA 4K1TA 2ZU3A 1GI4A 1NU9A 3OSYA 1LVMA 3R0FA 2BQWB 4OS2A 2Z9GA 3SU6A 4E05H 1V2JT 2ZCHP 1B7XB 3STJA 2QA9E 2I6QA 5FPYA 4SGAE 1WTGH 3SBKA 1NRPH 5DP5A 2EQNA 4INLA 1HAZB 1KXCA 1WQVH 2AERH 6CHAB 2XBYA 3SZEA 1Z7KA 4PROA 3HPTB 2AGIX 4ISIH 2QXJA 1NRQH 1HXEH 1DUAA 3K2UA 1DDJA 1EAIA 1MZAA 3MNBA 3PV5A 1P01A 3TVJB 1E79D 1YGCH 1D4PB 3EQ0H 3I77A 1O39A 2BVXH 1EJMA 2TRMA 4OS7A 3RXDA 2HALA 4TY7A 4AFSA 2GZ9A 1Y5BT 3P92A 3ZZ9A 2EI7A 1L1JA 1CHGA 1XKBC 3ATWA 3CS0A 2KR7A 1IQEA 8ESTE 4CH8B 1ZRKA 4A92A 2P3UB 1PJPA 3GCTF 8GCHG 1AVWA 3PMJA 3BTDE 2WUCA 1XVMA 4JK6A 1DWDH 3DSGA 4LK4A 3OYPA 4JZ1A 1CHOG 1NT1A 2ZDLA 2PKSC 3PO1C 1GBBA 3A87A 2OTVA 3LGYA 5LPEA 2GDEH 2ANMH 1XXFA 3B8JA 1AZZA 1GI7B 3H7OA 4NWKA 2H5DA 3AASA 3IWMA 1ANBA 1SLXB 2GV6A 1BQYA 1EPTA 3BTQE 4RKJB 1LO6A 3F2HA 1D9IA 3DT0H 3SU5A 4ASHA 2Q6DA 1BITA 1L0ZA 2G55A 1TNGA 3ZVAA 4UONA 3PTBA 3SUDA 1C1RA 5C5OA 4J2YB 1C5WB 4YM9A 2KCPA 4B75A 1KTSB 1GI0A 1K1LA 1VCWA 4RT1A 3UR9A 2HLCA 5F6MA 1THPB 1PPGE 1P57B 1SQTA 3MH5A 1AWHB 2ZQ1A 1SGTA 1FPHH 1O2HA 4ZMAH 2Z6BD 2AH4X 3NXPA 2G8TA 1JIRA 1K1NA 1P9UA 2VGCC 2R3UA 4Y7BA 1CSOE 1J9CH 3OY5U 2BD5A 1ELBA 4AYYB 3QX5H 4I8GA 3EE7A 1G3EA 4MDSA 1IQFA 3U9AH 2OQUA 3SNCA 2VIOA 3HK6B 1V2WT 2FPZA 1K22H 2ESTE 4X8SH 4B6EA 1GL1A 2BD4A 1N8OB 5DSFA 1FQ3A
chains in the Genus database with same CATH topology
5H4IB 3RXSA 3O8BA 1DY9A 3QLPH 1O3HA 3NWUA 3SUFA 1WQSA 4ZUHA 1A5GH 1G32B 1W0ZU 1O5EH 2W5EA 5J4QA 5K0HA 1LHGH 4JZIA 1N6XA 1PPBH 1TGBA 3MTYA 4AB8A 1IHTH 2ZDMA 4ABIA 3SO3A 3EGKH 2OC0A 2VVVA 1GJ8B 3VB3A 1TFXA 1HIAA 3EAJA 3OX7U 3CP7A 1GBCA 1EJAA 3SQEE 1LVBA 1JMOH 4ZHLU 5G4BA 2W3KA 3UNQA 1EB1H 1GCTC 2Z9JA 1BRAA 1FI8A 3LGTA 4MNXA 1TQ7B 4ZH8A 1UHBB 1P05A 3M61U 1H9HE 1P3CA 1XUJA 2B7DH 1GJ9B 1GPZA 1VCQA 2VWLA 1OWDA 1QCPA 5EQSA 3SGQE 1K2I1 4U01A 1HB0B 1KXDA 1UCYH 4O3UA 1D3PB 3RXVA 4Q7XA 2HNTE 2BD3A 4JZDH 5DJ7A 3M3SA 2XNIA 3A82A 2FTMA 1UTJA 4BAOB 1QY6A 3P70B 3KQEA 3BTWE 2G5NA 2KAIA 2TGPZ 3P95A 3DHKH 4GHTA 3SUEA 1V2QT 2FOAA 2QN5T 1HJAB 3BEIB 1KDQA 2HRVA 1TMUH 4Y8ZA 1ELGA 2VWOA 4X1PU 3JZ2B 4A7IB 4CR5A 4TYDA 1B0FA 1TBRH 1ZPZA 1FIWA 2BOHB 1XUHA 2GGVB 4E7NA 3Q3YA 3NZIA 3SU0A 3L3TA 3QTOH 1ESTA 3KQDA 3R3GB 1EUFA 2CJIA 2ZG0H 1TNHA 5FPSA 1MKWK 3SZNA 1Y3XA 2J94A 2ZGBH 1MKXH 1VZQH 2ULLA 2A2QH 2J95A 2XW9A 1MTNB 4UDWH 4WH6A 2CN0H 1A1RA 1BTUA 1EOJA 3MNXA 1BTYA 1QBNA 3IG6B 1NFXA 1S85A 3D23A 1Z8RA 2QXGA 1ELCA 3LKWA 3RLYH 4DJZB 3P6ZB 3M7TA 1EASA 1YPKH 1FMGA 3QZQA 2YNBA 1YCPK 1Y5AT 3TH2H 1UTNA 4WXVA 1HYLA 3TK9A 3VEQB 2UUJB 3A8AA 1G36A 1ZGVA 4D8NA 4B76A 1ETRH 2ZP0H 2XBXA 2GMTC 3U8RH 2F91A 4ZKNU 2ZFTA 5L2YH 2ZTXA 1MTVA 7KMEH 3RXJA 4ABAA 1ZR0A 2LPRA 1NC6A 4CRFA 4XOJA 3KEEA 3TIUA 1H8DH 1VITH 3AVZA 1BTWA 1C1PA 4I33A 5FCRA 3D65E 2VIPA 2Q6FA 3RXKA 1LHEH 1SB1H 1RTKA 2G51A 3JZ1B 4KKDA 3VB6A 2FZZA 1C2IA 1W8BH 3A88A 5E2OA 1O2UA 5BRRE 1T8NA 1SGFA 1Q2WA 4Q7ZA 3DFLA 2P59A 1DITH 1AUJA 1GCDA 1O5DH 3RM2H 2ZDKA 1O2MA 1LVYA 3VXFH 4BAMB 1ZTKA 1B5GH 1XUFA 5TJXA 2GCHG 4ISHH 1K9OE 1DLEA 2OBQA 3S9CA 3BEUA 3LOXA 4B73A 1LCYA 3ZVEA 2Y5GA 3UIRA 1WTHD 2ZHEH 3ENSB 4MPVA 2CGAA 2XC5A 1KLIH 1D6WA 1JRSA 3NUMA 2J9NA 3DD2H 2RA3A 2AYWA 3H5CB 2Q1JA 1BT7A 1GDUA 2VH6A 1TGTA 1P3EA 2ZKSA 2BLVA 1NTPA 4DT7B 1F5RA 3LT3A 1O3LA 2PHBA 2ZECA 4MQAA 3A7YA 1SGRE 4CR9A 2Z3CA 3ZYEA 2RG3A 1ELTA 1HAVA 5EXNA 1C5YB 1AZ8A 4IMQA 1TNIA 4DVAU 2ZHQH 3F1SB 3KQBA 1ZHRA 4ABEA 4RKOB 1P11E 1WSSH 2FYRA 1H9LB 1SFIA 1TALA 1QFKH 4RSPA 2H9EH 1HLTH 3AAUA 1G37A 3UWJH 2HGTH 3GY3A 1ZHPA 1FJSA 2PKSB 2ZCKP 3PO1B 1QRWA 5EODA 3V13A 3TNSA 1BUIA 5FX5A 4HI3A 3MH7A 3UFAA 4MNVA 1ANCA 5HYOA 2A31A 1GHBG 1FY3A 1GVLA 3A80A 2M5TA 2AMQA 2ANYA 3E8LA 1BZXE 1K1IA 3RXBA 1HAIH 4OS5A 3BEFB 3DUXH 3NK8A 5EPNA 4GHQA 5FXLA 3U8OH 1IQJA 1LMWB 1W7XH 2BHGA 1GJ6A 2ZWLH 2BOKA 5C2ZA 3MHWU 3QDZB 1E36B 1GMHF 5A8ZA 2VGCB 8GCHF 1C5NH 3T25A 1BMNH 1SVPA 2XTTB 4O9VA 4D7GA 3E16B 1P04A 3S7KB 3P8NA 3EA8A 1CHOF 3Q3XA 1QB6A 1D3DB 3ZZ4A 1O3EA 3RXRA 2QIQA 2ZPRA 4YTAA 5F03A 2V6NA 4K2YA 2Y7XA 4WF8A 4AFQA 5A8XA 1QNJA 5EW2H 1TRNA 1KXEA 1TPSA 1WYKA 1QB1A 2ANWA 3SNBA 1AB9C 3KHVA 2P3TB 4KGAA 2FOBA 3N7OA 5HMAA 1YPLH 1C2EA 1NFWA 1FY5A 1BRBE 1GJDB 1G2LA 2WPJS 5JBCS 1SGNE 2BLQA 1YPMH 1GWAA 8KME2 2WPHS 1UVPA 1W7GH 2B8OH 4IW4E 4U2WA 3S69A 1CVWH 3STIA 1RXPA 1IAUA 3SJKA 1O3NA 4WXIA 4TWWA 1C5PA 1P02A 2ZHFH 2OINA 5GJ4B 2BD7A 2G4TA 2O8UA 3Q76A 3ZZ6A 3SHCH 1RIWC 1LKAA 1O2KA 1YYY1 1SMFE 1L2EA 1NRRH 1BDAA 1O38A 1EZUC 3PWCA 1HFDA 3SV7A 3F9GA 2FP7B 2VJ1A 3OTJE 1Y5UT 1RTLA 1OP0A 1YC0A 2AMPA 2FI3E 1TRYA 3HKJB 2UUFB 3UPEA 3BV9B 3MI4A 2EEKA 1J15A 1ELAA 1HJAC 1FUJA 1T8LA 3A86A 4M7GA 3TK5A 4CBOA 1P2KA 2FXRA 1UTOA 5GDSH 5FAHA 5F8ZA 1P2JA 2B9LA 3A7WA 1AGJA 1K1OA 2P3FH 2FDAA 1T7CA 1SI5H 5JB8S 3ZVGA 1TGCA 2D2DA 3RXFA 4BAHB 3LH1A 4NA7A 2BLOA 1O3PB 1P2IA 3M7UA 4X8UH 2VH0A 1XUKA 1TE0A 2BY9X 4WY3A 1DUEA 1DM4B 1ANEA 2OC8A 3IITA 1BTHH 4I8LA 5EG4A 7GCHF 4B2CA 2ZHWH 1GG6C 1ZPCA 4B2BA 3RC5A 3T62A 4ABDA 2JH5D 3S0NA 5T6FA 2NU1E 4INHA 3RC4A 1HAHH 3QTVH 1ZPBA 3W95A 2ZGJA 2STAE 2VB0A 3MWIU 3KL6A 2R0LA 4OS1A 1E0FD 4BXSA 1BBRE 5EPYA 1O2VA 4JCNA 2PV9B 2EI8A 1TX8A 1SGEE 3VB7A 2GZ8A 1O5BB 2GMTB 4WMDA 1T8OA 4R8TB 1KSNA 1F2SE 2QGRA 5DGJA 2PSYA 5HM2A 4Z0KA 1BJVA 3MO3A 2ZFFH 1A2CH 1O2YA 3HATH 5EXLA 3U1JB 1F0RA 2AS9A 1A61H 1XUGA 1DPOA 4Q80A 1WAYB 3AW1A 2ALPA 2A32A 3SOSA 1PQ8A 3URCA 4XBBA 1DXWA 4JYUH 3VB5A 4A6LA 3LJOA 1EXFA 1OWEA 1ETSH 1SBWA 1Q31A 1GBAA 1GI9B 5AHGH 2FMJA 3SU2A 5E0GA 2WYJA 4K1SA 1HAOH 2C8YB 2QXHA 3DA9B 2BVRH 2PSXA 5ABWA 3MH6A 3AW0A 2HPQH 3QGNB 1PFXC 1O3MA 3PLBA 1QQUA 1THRH 2FS9A 2H9TH 1NPMA 3QK1A 1P2OA 2BB4A 4NCYA 1KY9A 4ESTE 1OXGA 2PGBB 1MZDA 4J1YA 5F8TA 4ZKSU 3SHAH 4HGCA 1QBOA 1EB2A 2FWWA 4MNYA 1O2SA 2ANKH 3D62A 3PWBA 1O3DA 1VITG 1IQIA 2V35A 3SUGA 3UUZA 1CT0E 1ZMNA 1BA8B 2BXUH 1BTXA 6ESTA 4Y8YA 1UK3A 2NWNA 2BX4A 2AGGX 4X6OA 3PROA 1FONA 1DSTA 3ZZ3A 5L30H 1O2IA 4XDEA 5FBIA 4ZXXH 1NN6A 2J92A 1GMHG 3KQCA 3SGAE 1OWKA 1W14U 2GCHF 1O2LA 2P16A 2P8OB 4GLYA 1GI2A 2ASUB 4DIIH 3LONA 3M7QA 4X0WU 1O5GH 2BY7X 4Y8XA 2FEQH 4DURA 1AE8H 2VWMA 3A7ZA 4X2XA 3UOUA 1WOFA 3GDUA 5T3HA 5FX6A 1TMTH 1K1PA 3HK3B 2Z3DA 3RC6A 1C2DA 1GHAG 2RCEA 2SGDE 5B6OA 1TAWA 1ETTH 3EE0B 1YF4A 3TGJE 1YPGH 1GBKA 1MMJN 5C1XA 5JPMH 4DGJA 4O3TA 2VIDA 1MCTA 4JZFH 1UCYK 3QUMP 3MO9A 1S83A 1G9IE 5JBTA 4CRBA 1FN6A 1HUTH 2ZFPH 3Q77A 4D9QA 2V0BA 2J2UA 1A46H 1VJAU 5PTPA 4MLFB 1OKXA 4ZXYH 4DY7B 1ZGIA 1F5LA 2ALVA 3M5OA 1AFEH 1BCUH 3TJNA 5GIBA 3FP7E 2PGQB 1C5XB 2PTNA 3KIDU 1J16A 4NSVA 1UHBA 1V2MT 5EW1H 5C1YA 2VIQA 3AAVA 2QC2A 4FUGA 1GHBF 4DOQA 5A0BA 1CT4E 3ZZCA 5DP6A 4R0IA 2H2ZA 2WV5A 4AYVB 4IMZA 1AB9B 1RS0A 1TGNA 5DP4A 2OXSA 2BZAA 5DP3A 3TJOA 3QWCH 2H6MA 4KTUA 1AQ7A 2GT8A 1DICA 1YPEH 2ZFSA 1MAXA 2RA0A 1DWBH 2ILNA 5E0JA 1O2GH 3ZV8A 1NRSH 2Y80A 2TBSA 1ZOMA 4MPUA 4GCHF 1DLKB 1P8VC 1V2NT 2FI4E 4H42U 4D9RA 1RIWB 2BQ6B 2BDAA 3U69H 2QF3A 1SGQE 2GKVE 2HNTC 1YLCA 7GCHG 2UWLA 1P0SH 2ODYB 3W94A 4NSYA 4ISOA 4WWYA 1ACBE 2BMGB 1JIMA 3F68H 3V12A 1TABE 1F0UA 2FOCA 2SGPE 2C4FH 1PQ5A 2W7UA 3EA9A 2EC9H 1C5QA 5CMXH 1KXAA 1QL9A 5TCAA 2W26A 1PPFE 4NFFA 1A7SA 2FI5E 3LGWA 3TITA 1GHVH 4FUEA 5JYIA 1RD3B 2TIOA 3M5NA 1HRTH 4FU7A 1P2MA 2FOGA 4B71A 3ZZAA 1OWJA 3M5MA 4WH8A 4B1TA 1A3EH 1QJ7B 3V3MA 2QAAA 2F9VA 4K1EA 1BBRH 2FO9A 3SI3H 4OGYA 4Y11E 1GVKB 1DSUA 4U32A 1FXYA 1GG6B 1NZQH 1C1QA 1O3IA 1J8AA 1D6RA 2BD8A 3UWIA 1LVOA 2SGFE 2BM2A 1TGSZ 4UFEH 1C5UA 4RN6A 1Z1JA 1S0RA 2AEIH 2H9HA 3GISB 5F8XA 1GI8B 5FCKA 2WPMS 1P2NA 1MTUA 1QL7A 1VGCC 4K8YA 1HAGE 2ZC9H 4WVPE 1GMDG 1MU6B 4IBLH 1N6YA 1AVXA 1M9UA 3NPSA 3LGUA 3SJ9A 1WCZA 2B0FA 1SGIB 5JBAS 1ZLRA 2F83A 1FV9A 1KDQB 2STBE 3RLWH 4NZLA 3BTKE 1GHXH 2VIWA 1C5RA 1CO7E 5AFZH 2QF0A 1YM0A 1W0YH 1S0QA 2ZU2A 1TYNA 3EDXB 1AFQC 1TPOA 4IGDA 1V2PT 1B0EA 1BHXB 4NA9H 1LQEA 3PMAB 2IOTA 1GBEA 4F49A 1C1OA 2ZA5A 2W7SA 2F9NA 2FS8A 1GJCB 3M3VA 1A5IA 2CHAC 4NIXA 3VGCC 3M5LA 2FLRH 1GBMA 2F9PA 1ARCA 1GJ4H 2BY8X 4MPWA 2OC1A 2A4OA 2NU0E 3GY2A 4Y6DA 1MAYA 2F3CE 3MYWA 2ZDAH 4ABJA 1DT2A 1O35A 2DUCA 1C5TA 1QA7A 2BQ7B 3RDZA 1PPHE 1EP5A 2GZ7A 2HPPH 1C4V2 4AX9H 4MVNA 5EQQA 1XKAC 1LDTT 1BB0B 1QJ6B 2R9PA 1GDNA 1L1GA 4FU9A 1V2KT 3LGIA 1ORFA 3KCGH 1O2RA 2BLWA 3A84A 4OS6A 4FUHA 4UD9H 2GCTC 1IQHA 1N1LA 2DE9A 4O03A 3B23B 1SPJA 4Y79A 2AMDA 3LC3A 5IDKA 2Y5FA 1GHZA 1MBMA 2G81E 1AHTH 2FTLE 1YKTA 4THNH 3RUOA 1NFYA 5EQRA 2Q6GA 1GBTA 1HJ9A 4QT8C 4Z6AH 3UR6A 2WYGA 1OS8A 1ANDA 4E06H 2P8OC 1Z6EA 2Z7FE 5LH8A 1C2HA 1NO9H 2FESH 3A8BA 1SFQB 3B9FH 2FYQA 1E35B 3ESTA 3A85A 3SJ8A 4Y0ZE 3ELAH 3C27B 4MTBA 2QV1A 1PYTC 1TA2A 1DWEH 1FY8E 2ZZUH 5E8EH 2XXLA 1O0DH 1MQ6A 1VITF 5BPEA 2JH0D 1F92A 2GX4A 2A5KA 1JBUH 1O37A 1DFPA 4Y71A 2CV3A 4DIHH 4X2VA 3GY4A 3SV8A 3ATIA 2WPLS 2P94A 1Y3UA 4X1RU 1S84A 2HWLB 1DANH 1HAVB 2PKAA 4FUCA 1OP2A 4GCHG 1A5HA 1IHSH 4IN2A 2TGTA 1UTMA 1A0LA 4FXGH 1XM1A 1W11U 5DKMA 4XBDA 2BDHA 4NFEA 1C2GA 4X1SU 4CRCA 3BIUH 1TIOA 2PWXA 2OCVB 1K21H 1Z8IB 3ZZDA 1C1TA 2PW8H 1D3TB 4AG2A 5LPFA 3RXGA 1C2JA 1GHAF 1D3QB 1Z6JH 2WPIS 3HGNA 3HGPA 5FBEA 4CHAC 2VVUA 1TOMH 2BVSH 3E6PH 3ODFA 4K60A 1C5ZB 1EPTC 2WPKS 1F5KU 3BIVH 4NIVA 3GCHC 2FX6A 4Y76A 1ELVA 1YBWA 1V2OT 2O8MA 2J38A 1ELEE 3C1KA 2IN2A 2EA3A 3E90B 2SFAA 2H1UA 2IPHA 2A2XH 1ZYOA 2XCFA 3BF6H 3QO6A 1TMBH 1TWXB 4DG4A 1C2FA 1X7AC 1QL8A 4YOIA 1ZJDA 3QGJA 2OD3B 1O3CA 4X6NA 4ZHMU 2ZFRH 1SHHB 3URDA 2W3IA