4OSOA

The crystal structure of landomycin c-6 ketoreductase lanv with bound nadp and rabelomycin
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
GNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFTVKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAVNAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGSRRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWITGAFIDASGGTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based engineering of angucyclinone 6-ketoreductases.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Oxidoreductase/antibiotic
molecule keywords Reductase homolog
total genus 90
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4osoA00
1XYGA 2EV9A 4LK3A 3VOSA 1ISIA 2VZ0A 1NX6A 5DT9A 2X5KO 2X23A 5JDCC 4BNKA 3WTCA 3SXPA 1P33A 2NVUB 1ZIDA 3O9ZA 3D7LA 4EYEA 1W6UA 4A27A 1EBFA 4Y9DA 3F6YA 3KTDA 2GDZA 1DOHA 2YHUA 1MX3A 5HM8A 4KQWA 2AE1A 2EJVA 2UUOA 2GZ3A 2X4GA 4AJHA 5A9SA 1Q7CA 4E32A 3KBOA 4IJWA 3I6IA 4Z9XA 4R69A 4CLOA 1KVRA 5A9SB 4I8XA 4J1TA 3LVFO 3C1OA 2NU7A 4J0EA 4K28A 2VT3A 4EGFA 3BTOA 3JQBC 4CMIB 1AXEA 2JD2A 1R4MB 2O3TA 3WJ7A 2BFPA 2F00A 5H82A 4K9DA 4OAQA 4R51A 3S2GA 2V6MA 5KVVA 3BXXA 1K2WA 3AY3A 1QP8A 3DQPA 2UV8A 4DMLA 4ROSA 5A5EA 3FTNA 3JQBA 4CR6A 3JD1A 1X1EA 2A94A 3CZRA 4B4VA 2OO5A 3IKVA 1LDEA 3IJPA 1OOEA 1LNQA 1HSOA 1KS9A 1D1SA 1PJBA 4Q3DA 4Z9FA 5KJ1A 4WEOA 1DFHA 2AXQA 4QX6A 4IJKA 4TVBA 4I9NA 1MA0A 4JIGA 3OICA 2WJPA 5TNXA 3E5RA 3H7AA 4KOAA 4AJPA 1R37A 4AJKA 4FB5A 4QO7A 4R3NA 1C0LA 5AXDA 4D44A 3RKUA 1NWHA 2YFQA 3CPSA 2AQHA 3PWKA 1I24A 4NHEA 1NQOA 2VWHA 1CETA 2C59A 2QYTA 5HS6A 3H5NA 4FN4A 1ISMA 1QYVA 2OBNA 3GZNB 1Y9EA 4WJZA 4OXKA 4PLZA 3WMXA 1P44A 1U7HA 5GZ1A 1P0CA 4HNHA 4RO0A 2ZCUA 3KYDA 2IZ0A 3JV7A 2DC1A 4CQMD 5JCJD 3ASUA 3U9LA 4AVYA 4ILKA 4RV9A 4HY3A 4L4SA 2DUUA 2VHVA 1SO8A 4TROA 5JMPA 1ZMOA 3A28A 3COSA 3CXRA 4YDRA 1U3WA 3LYLA 1CQJA 5TC4A 1NR7A 1JU9A 1HDRA 2D8AA 2QRLA 2EKLA 1OZAA 3JYOA 3PPIA 5AXCA 2IDZA 4NU5A 1BW9B 5F5NA 3Q9UA 4NJMA 5FWNA 1GUZA 4FFOA 3WWYA 3F5QA 5EQFA 3CSDA 3GK3A 1UUFA 4GWGA 3UH1A 2YHIB 2D5AA 3AUAA 3LLSA 5EERA 3FN4A 1R4NA 3JQAA 3TQHA 5TLSA 1S7CA 2DTDA 3PWSA 2I6TA 2HKIA 5K6AA 4IINA 1E1MA 3UXYA 2DLDA 3ASVA 2ZB4A 3DMTC 1C1XA 1LTHR 3GNTA 2B37A 1BRMA 1SC6A 3QY9A 4Q39A 1D4FA 3OJ0A 2JHFA 1E5LA 4JP3A 3FBGA 1L7EA 1E6UA 1ONOA 4WE3A 1SMKA 1PSDA 3DZJA 3ITDA 4XD2A 2FN7A 3TWOA 2QIOA 3Q11A 1RWBA 4DPLA 1A71A 1YQGA 5FI3A 3UF0A 3ZWOA 5EINA 1U8FO 3GC6A 3D5QA 2PZKA 3GAFA 3HWRA 4MVJG 3IL2A 5FFFA 4YT8A 4FS3A 1DB3A 3A1NA 4Z3DA 2JJYA 3AOEA 4EDFA 3PGXA 1P45A 1G0NA 2HLPA 2CFCA 5GMOA 1DAOA 1PJTA 1LLQA 1T2CA 4H7PA 1XQ1A 4CQMB 4RCVA 1Z82A 2X9NA 3C8MA 4OXNA 4XYEA 2O3RA 4WNCA 3EVNA 4DPKA 1BHSA 2GN4A 3C1AA 4XZ3A 1CYDA 3KUXA 1RPNA 1UDBA 2D59A 5DULA 1BXKA 1YL7A 1KVSA 1ZMTA 2C2YA 2XOXA 1B0AA 3TFQA 4E2XA 1KETA 4MVJP 4CM8A 3EC7A 3RIHA 2C20A 2AEJA 5A06A 3ZNQA 1GCUA 1GR0A 2C2XA 3TOXA 3FHLA 4B3IA 5G0VA 1E77A 4YQZA 1U8XX 3L4BC 2D5CA 1IY8A 3WGQA 1PWZA 2GLXA 1EK5A 2NU6A 4CM4A 2BHLA 1VJ1A 2Q2WA 2WSBA 5IDWA 5IAAA 1GPDG 4OO3A 2BGLA 2PK3A 2WWRA 3EVTA 3JQAD 5GZ6A 1MC4A 5COQA 1GD1O 5ITVA 1YOVB 1T4BA 1G6KA 1IOLA 4O5OA 3NX4A 2EWMA 2PZJA 4UUOA 5DP1A 2Q2VA 3VVBA 1PZEA 3ICPA 3D0OA 5T5QA 3GOHA 4HP8A 2WM3A 3H9JA 1JW9B 5ER9A 2NLOA 3FNGA 1PS9A 1V8BA 1KVTA 3BMOA 4GVLA 1C1XB 4ZICA 2HK8A 1E92A 3DDNA 4Y67A 3FCOA 2O4CA 4FGWA 3RUDA 2X9GA 1I36A 2GN9A 4QTZA 2QRKA 2DTEA 2X7HA 4BGIA 4XR9A 3QQPA 3WNVA 2CF6A 5ES3A 4ZRNA 2Q50A 1A7AA 1U28A 2DBZA 1EVZA 4DGSA 1BW9A 4LW8A 3UCXA 3DB2A 3B20A 3RC7A 3KETA 1H6CA 4IY1A 1ZZEA 4Q9NA 3FNHA 4DLLA 1KIFA 4WLUA 4FSHA 3ULKA 1XDWA 4JP2A 1IZ9A 4YJFB 2C54A 2VUUA 1SB8A 4HFJA 3WGHA 1M6WA 1B2LA 1JKJA 1K3TA 2X6TA 1QYDA 1PJLA 4JK3A 3CH6A 3P5SA 2YZ7A 3FRJA 4CUJA 3NGXA 1PX0A 5I9MA 4IQ8A 3FSRA 1LU9A 4IQ0A 4KTTE 4OIMA 3PDUA 5C37A 2GF2A 4PIVA 1SPXA 4BNXA 2IODA 3ON5A 3K8ZA 4INAA 3BMCB 3GHYA 1GYQA 3DFZA 5A02A 4YAEA 2AW5A 3EYWA 4UVGA 4JROA 3G49A 3HQ4O 2R00A 4Z0TA 3BTUA 2BLLA 4Q3BA 2PGJA 1T2EA 2EKPA 1KC3A 3DBRA 4RORA 3ZNOA 4BQRA 4BQPA 1HDOA 5KJ6A 4IDEA 2ZYAA 2Z1MA 1KVUA 1NM5A 3RQSA 3TZHA 4NFSA 4E30A 1WPQA 4W7HA 3JQDA 4MVJI 4D46A 1DC4A 3GVPA 4YYZA 3GEGA 4ND5A 1JWAB 4FFNA 3WTBA 3PYXA 5BT9A 3GEMA 1OBFO 2GYYA 4BNUA 4JGBA 3CUKA 3OA0A 4R3WA 3E9MA 5BSEA 1F17A 3JQ9A 2OMEA 4M8SA 3S1LA 2JFFA 3ZU4A 3HN7A 1U3UA 1OI7A 1FMCA 1ISFA 5TJ9A 5COBA 4J6FA 3LK7A 3WX0A 3H65A 2D4AA 3KOUA 1IYZA 4C7JA 4F6LA 4ALIA 3SJUA 2JAHA 4DWVA 3HJAA 4FW8A 4Z0PA 3DOCA 3HFSA 4IZHA 4RPLA 2ZTVA 4WPGA 1YXMA 1SOWA 1O89A 4LRTB 4PG5A 2H63A 2HMVA 1HLPA 1YGYA 2VZ9A 2DFDA 3E9NA 2J5KA 3OQ6A 1M67A 5I8WA 5G0UA 2UAGA 2DVMA 2EP7A 2HO5A 3AOEC 2JFGA 2JL1A 1GEGA 3H5RA 4NNJA 5TQVA 2EHDA 3VZQA 4D79A 3QVOA 4Q3CA 3AY7A 3O8QA 3LT1A 1ZO8A 4NPCA 1DPGA 2BFOA 4QO8A 3H3JA 2HMUA 3QVXA 2RCYA 4G5HA 4U8GA 4D42A 1Z75A 3VVCA 1VRWA 3V1YA 1XEAA 3GQVA 2RH8A 3UCFA 4R16A 5G4KB 2OXIA 1GQQA 3JYLA 4J49A 4HADA 2WDZA 1PGJA 2XPCA 4ND2A 2Q46A 5JDIA 4OXYA 3WMWA 4J1SA 3WLEA 2P91A 3DOJA 3INTA 3OIFA 4CMJA 4UEKA 4N5NA 4R9RA 1P1HA 2X0NA 2XAAA 3GRPA 3AJRA 2OHXA 4B3JA 2WD7B 2I5PO 3Q0EA 4K6FA 1RM0A 1I2ZA 4G2NA 4XYMA 3OQ1A 2FR1A 3ZGYA 4YAGA 5ADHA 1YQXA 4IM7A 1N1EA 1VE9A 3GG9A 4KUEA 4DTIA 1J4AA 3PQDA 1IL0A 4IBOA 4M49A 3LC7O 3W4JA 1FDUA 1ZW1A 2AA3A 1XQ6A 2AMFA 1TI7A 5C7OO 1RM3A 5FEUA 1QLJA 5C3MA 3VZSA 5EPOA 1B8UA 2LDXA 4D0SA 5BSGA 2BI7A 3ROMA 1P74A 2J8ZA 3GR6A 5HA5A 3M6IA 4EW6A 5EN4A 2YV1A 1ENPA 1KOLA 4DPMA 1GU7A 4HKTA 2VTEA 1LDNA 2CD9A 3PZBA 1MUUA 3RUIA 3ANLA 1LC0A 2CZCA 1RYDA 2GD1O 2VYVA 4RJTA 1A5ZA 1SZJG 1C3VA 1NNUA 4FFPA 1WLYA 1LDBA 6LDHA 2J5QA 4NJMB 4NZ9A 1W8DA 2VN8A 4TQGA 4BMSA 5ILOA 1FK8A 3FNFA 4PRKA 3HUDA 3OHSX 4B8ZA 3RBXA 4IS3A 4RVFA 5T67A 3ZWBA 5T8KC 3P19A 1IUKA 4DBZA 3SC6A 3TL2A 1ZSYA 5L7WA 3JQCA 1HXHA 1I10A 3PIDA 1EE2A 1D7OA 4WASA 1YB1A 2YW9A 1YH3A 1UP7A 3SLGA 4BNNA 5A05A 3WBBA 1I5RA 1VJ0A 4OYRA 2ZK7A 3L6EA 3BHIA 2Y67A 3IUSA 1UZNA 1IHYA 3DEYX 5A9RA 4TZTA 3U0BA 4WECA 1N9GB 1RM4A 2D0IA 1Q7GA 3PP8A 1PJ2A 4B8WA 2VOEA 4URFA 2ZKLA 3ROPA 3O8QB 2R6JA 4D3SA 2UUPA 4M55A 1HL3A 4ND3A 1X7HA 1PZGA 1WXDA 4MVJM 1E3IA 4M54A 4YCAA 1V3UA 1C14A 2XXBA 4FQ8A 4W99A 5IXSA 1BG6A 4QFCA 1T1RA 3WB9A 4PVCA 3RKRA 1TB4A 2Q2QA 1C1DB 4JJGA 4R5HA 3BA1A 4HFRA 3OIGA 3H6KA 2A92A 4EEZA 1NYTA 2EGGA 4MOWA 4A7PA 2B83A 4XQ9A 2VYNA 1LSOA 3W8FA 4YB8A 3MJEA 5EL0A 1ZJZA 4FJ2A 2J5RA 4CUKA 4LISA 1M2WA 1NR1A 2I65A 3DZKA 1Y9AA 1E7YA 2QHXA 4QT0A 5F1OA 3MJSA 2BI8A 4H15A 2NQ8A 5JO9A 2RHRA 5JYEA 1SEPA 2ZJ1A 3BMOB 4BB6A 3S2FA 1TT5A 3RUAA 1BSVA 1E0DA 2OBYA 1YJ8A 1RM5A 3MJCA 2X0IA 3IUPA 1P9LA 4BO8A 1ADCA 1M66A 2DTXA 3JYQA 4ZD6A 3IJRA 4P4NA 1N9GA 1XELA 3JCZA 5I7SA 2UYYA 2NTJA 3DMYA 2RH4A 3WS7A 4AFNA 1T2FA 4DQVA 1U2DA 2BGMA 4AL4A 4XA8A 1S6YA 2HK7A 3PQFA 5L3ZA 4AICA 5CG2A 3GHHA 2G17A 3UW3A 1DXYA 1ZJYA 2O3SA 2C82A 4PGFA 3RUHA 1T24A 1DRVA 4FR5A 3JD2A 3UKOA 4CM4B 4DREA 3QIVA 1P1JA 3W8EA 4UEOA 2IZZA 4FDAA 2VHXA 4NH4A 4E33A 3V2GA 1ZEJA 5JAMA 3MWDB 5A1TA 1EBUA 4YT2A 4J2OA 1A72A 4D7AA 3KO8A 2HMTA 2Q4EA 4ZVVA 4DIOA 3U4IA 3BMQB 1R15A 5H81A 4GKVA 2UDPA 4II2A 3VTFA 1HWYA 3KM0A 2G76A 3EZYA 3DZGA 3RFTA 3SEFA 2W2LA 2O48X 1E3SA 3VC7A 2B5WA 3KVOA 4UEJA 1I3MA 1P31A 2W2KA 4WGGA 4BOYA 4R41A 1E7RA 1VKOA 3CE6A 1R0SA 2BGKA 4CPDA 3PIIA 3AUTA 2BD0A 4YJGB 1C0IA 1ID1A 3V8BA 3WG9A 5L4SA 4EITA 1UZLA 4YTEA 2ZIZA 5KJFA 1XG5A 3OEYA 1HF3A 5F3RA 3WSVA 3ZHYA 1FJHA 1J49A 3DBVO 4ZQHA 5CDTA 9LDBA 3JD3A 2GRAA 1JKIA 2IYPA 3GZ4A 4B4WA 2Q3EA 1WWKA 3JSAA 2HMSA 4YJDA 3I9LA 1LDMA 1H2HA 5KIAA 1KYQA 4E0BA 3R3SA 4IJVA 4P4GA 2QYSA 3LDHA 1ULSA 2NUAA 3VKVA 3Q3CA 4AG3A 3NGLA 3PWZA 3I4FA 4XR4A 3T4XA 4RPHA 4J1QA 2YV3A 2BFMA 4GLLA 1I33A 1LQUA 2QZZA 4JLWA 3VZRA 3I4CA 3W4KA 4BGUA 2Y05A 5HBRA 3C24A 4D45A 3D5TA 4I08A 3H2ZA 2I76A 3KYDB 1HDCA 2A9FA 4CMKA 4PLHA 4BL5A 4AJ2A 4PG7A 1CRWG 5ICMA 1HTBA 3GPIA 2Y66A 3PEFA 4DVJA 3VH1A 4EEXA 2CVQA 3QSGA 4MDHA 4GSLA 2C07A 4GPD1 3AM4A 5CHEA 4YRAA 3ANNA 3ONFA 1V0JA 3UGKA 4R1TA 4NG5A 4NK5A 1ONNA 2IEDA 5DDIP 1HLDA 3WYBA 5L95A 1DC3A 2PY6A 1XU7A 3WYCA 3DXFA 2FP4A 1QYCA 1I01A 3BTSA 3QW2A 4UVDA 1EZ4A 4TVOA 3DWFA 3O38A 1ZSVA 1HDYA 2FPGA 3HDHA 1AUPA 1NHGA 3N74A 3R0IA 1CERA 3D3WB 2E4AA 2B35A 2AQ8A 3DONA 4J4BA 4RVUA 4RF4A 1DFGA 1F0YA 4GX1A 2DBRA 1XIVA 3CINA 3PTZA 4BVAA 2BKAA 3B1JA 3BHJA 3ENNA 5KWEA 4RZHA 2FHSA 1B3RA 1EVIA 1PJ3A 3HB5X 3ZV4A 3MTJA 2TMGA 2JD0A 1QV7A 3RWBA 3JQEA 1VI2A 3S55A 1G1AA 4RQUA 5TGDA 3TDKA 2O2SA 5DBIA 1RKXA 2HU2A 1QV6A 1UZMA 3H9EO 1MFZA 2VHZA 5JCJA 3WOHA 3BMCA 3GNQA 4MIOA 5IFLA 3ANMA 3HDQA 4JJIA 1LSJA 4JNKA 3ADPA 4GX5A 4WCFC 2OGUA 1FXSA 3C1TA 4EJ6A 4OQZA 4GWKA 1BXGA 1JDJA 2EEZA 3KV3O 4E5NA 5T57A 2CNBA 4RL6A 3MTGA 2PD6A 2YQ4A 3A06A 2PZLA 3I9OA 4BNMA 1U4SA 4NI5A 3IS3A 4YVFA 5DCWA 3STHA 4FJ0A 4CV2A 3H4VA 3NKLA 2P5YA 2RIRA 3WGZA 2J3KA 3DR3A 4IXWA 4WK6A 1I3NA 5KVQA 3CIFA 5THQA 4LRSB 2CVZA 5DBFA 4W4TA 1H6AA 1NFFA 3NDIA 3KSUA 1NASA 3UICA 4FJ1A 3GN1A 4IGFA 2WD8A 5KTKA 4GVXA 1H94A 4ZQEA 3DHYA 5G4LA 1E7SA 1MLDA 4UULA 3RFVA 3GT0A 3D4NA 2PA3A 3C7AA 1V3TA 4IJUA 3M2TA 4YPOA 7MDHA 4H3VA 1JAYA 1MG5A 4LSWA 1OFGA 3DAGA 4N18A 4AJLA 3JD0A 2PD3A 4LMRA 3GGPA 3HZZA 4PLWA 1BVRA 3V1UA 4E4YA 3CEAA 1HRDA 1EDZA 3EHEA 3W6ZA 1V35A 3U09A 3RASA 1PU2A 1Y6JA 3QVTA 3PYLA 1WAMA 1UAYA 4BB5A 3TN7A 1MG0A 3AI2A 2OUIA 5KKCA 1VSVA 3NTRA 1JA9A 1P1RA 2WEKA 2JFHA 3ZWPA 1R0KA 5TS3A 1Z7EA 4Y6PA 3F4LA 1PJCA 2ZQZA 1HE3A 4IDAA 4MIEA 4E31A 2NQTA 2Z5LA 2CVOA 3H3FA 2YHIA 2W2LD 4TRJA 3ZWCA 3FR8A 5JCXA 4YJHB 3H5AA 2VUTA 3K6JA 1L7DA 3JD4A 1PGPA 1E6EA 1WDKA 3EGOA 1LLCA 1VJTA 3TZKA 5B4UA 3EDMA 1ZK3A 1C0KA 1HE4A 1A9ZA 3G79A 3AFNA 3I52A 1DIAA 4DLBA 3KYBA 2C0CA 3BMNA 2PKQO 3VTZA 4RLHA 1ML3A 1Y81A 3GZNA 3NV9A 1D1TA 4FFMA 1YB5A 1EQ2A 3NRCA 5DCUA 4FC7A 4I5DA 1I0ZA 4N5MA 2EXXA 3D64A 4CMEA 3M2PA 4P22A 4R1NA 4J16A 2FSSA 2Y1CA 4L0QA 3U62A 1EVYA 3LZ6A 4R9SA 2NU9A 2X9VA 5T64A 1CWUA 3IMFA 3ROKA 3ZV5A 3HG7A 5L4LA 2HRZA 4OOFA 4NK4A 3M1LA 1J6UA 3PJEA 2VCYA 2Y0DA 5ENDA 4CMHA 1LI4A 3MJVA 5KKAA 3VAZA 2Y1FA 3GPDG 4PLGA 2H5LA 4OKNA 2D2IA 1XU9A 3U5TA 2WMDA 4BNHA 3DO5A 4I5GA 4CQLB 5A9TA 2OP1A 1R16A 3QLJA 1HKUA 4DQUA 3AWDA 2F1KA 1Z74A 3GGGA 2NSDA 1IB6A 2EP5A 2Q99A 2DBQA 2P4HX 2W8ZA 5JDIC 1YL5A 3OQBA 3OBBA 3GFBA 1ZXBA 1YB4A 1ZVMA 1PQPA 4FFLA 2PZMA 1F8GA 4AJ1A 5I9LA 1WMAA 3K2BA 4GQAA 5KVSA 2JCXA 3ONEA 3ZI0A 3KRTA 2H1SA 2JKVA 4CMIA 3G1UA 5AQ1A 5GZ3A 3QJ5A 1Z6ZA 1EUDA 4U7WA 1GUYA 4ALKA 1UP6A 3WFJA 3CMCO 1VC2A 1NFQA 4BNIA 1ENYA 5KOIA 3Q6IA 1AHIA 1ONPA 3PHHA 3DTTA 3BYZA 4DQXA 1MFPA 4TMFA 2GSDA 2O3UA 1XA0A 3IIEA 2OFPA 1ZXLA 3JQ7A 3QHAA 2DQ4A 1X7DA 3BAZA 4HBGA 2Z95A 3JQ9C 4Y8VA 3C7CB 3GDOA 4XWYA 4UREA 4PLVA 3VPGA 2Q49A 3AM5A 3G17A 2VWQA 5JY6A 1LUAA 1I8TA 3IP3A 4DLAA 3VDRA 4CLOB 1E3WB 2HK9A 4AJEA 2GGSA 3WGTA 4OMUA 2AQKA 1LLUA 1IE3A 4XGNA 3LF1A 3E48A 1VLLA 1FF9A 1F06A 3VH4A 5CAEA 3NJ4A 4J7UA 2VHWA 2WYWA 4LCJA 1EE9A 4PN3A 3DAPA 2AHRA 4HUJA 4CLRB 3E1KA 1YE3A 4XJTA 4MKZA 4KZPA 1DLJA 4OJNA 3RUFA 1YBVA 4XGIA 4Z9YA 4KMSA 3ETGA 1GYRA 4NIMA 1PL8A 4XRGA 1DJQA 1DIGA 1NVMB 1JVBA 1UXJA 4AJOA 1I3KA 2WE8A 2NM0A 1ENZA 4YJGA 2YY7A 3WSWA 3F1KA 1F12A 1TLTA 4HFNA 3IAHA 4Q3AA 1NQ5A 1WNTA 1X14A 4MVJD 1AN9A 2VYVD 2Y1EA 3O26A 2YYYA 2HJSA 2VZ8A 1CEQA 1PS8A 3ICCA 3NYWA 3ZV3A 4CLXA 2W4QA 4UUPA 2FZEA 1XSEA 1GAEO 3RROA 5THKA 2GO1A 4E2ZA 3RUEA 2QG4A 4LGVA 1W4ZA 3Q1LA 4CV1A 4CM9A 3Q9NA 3ZH2A 4D41A 3D3EA 1NQTA 1H5QA 5JMWA 2EIHA 1ZCJA 4BGVA 1P77A 1B16A 1CIVA 4G65A 3B1KA 5CDYA 4O6VA 3ZWYA 3OJEA 5TIIA 5EIOA 5TT1A 2BH9A 3ETEA 4JCOA 2ZQYA 4GX2A 1WDLA 3E03A 3KLPX 2OOSA 4BO3A 5JFOA 1ZSNA 2B5VA 3RC2A 4ND4A 4OQYA 3ZCXA 4J4HA 1C0PA 1DDOA 1K5HA 4Q3NA 3DFUA 3DBHA 5DF1A 1EUCA 1NPTO 4EZBA 2RAFA 1DEHA 4RF2A 4G81A 4XEHA 3PJGA 4AJIA 3ZNPA 3OP4A 4J9VA 4DUPA 4S1VA 4ZA2A 2O3JA 1Y5RA 1ZEMA 1EEHA 1B14A 1QYWA 1O9BA 2B4RO 1TEHA 2NACA 4BNWA 1XWFA 3GF4A 4J2HA 3GEDA 3WQQA 2IEBA 4NMHA 1PR3A 1N92A 2XF8A 5TJHA 3JQ8A 3RBVA 4R4JA 3B6ZA 4U0KA 4BNFA 1W0CA 2Y1DA 1PL6A 3RD5A 1O5IA 5C7LO 3I6QA 4BO0A 4QSMA 3ZHBA 3NJ8A 1NP3A 2E37A 2HJRA 3I9NA 3UOGA 4PRLA 2W2KB 4BNGA 4CL3A 1YWGO 5B4TA 3CTMA 1NTOA 3OJOA 1K6XA 2ZYGA 1X1TA 3C85A 1J0XO 3A9WA 2IYOA 1KEVA 3WXBA 1KBZA 5JO0A 2PH5A 3RVDA 1HZZA 2H6EA 5LCXA 2DUWA 4RVGA 1C1DA 1NWCA 1DC5A 3QVSA 4E2WA 3NT4A 3DL2A 4MJLA 4WLNA 7ADHA 5I7FA 5LC1A 3WICA 5DOVA 4ALMA 1NAIA 1VKNA 3F5SA 3ZHZA 3H2SA 2PH3A 4CM5A 2WD7A 1X7GA 3DBHB 4BNLA 5DOZA 1NVGA 3VPHA 5BQFA 4JBGA 1KVQA 4ALLA 3TSCA 4DMMA 4M86A 1AGNA 1QXSA 5BNTA 2O50A 3KYCA 4MO2A 2GNAA 1XKQA 4EUHA 3ZWNA 2FPPA 3I9MA 3MOIA 3P2OA 4P8RA 1IZ0A 2NTVA 3JTMA 5DZSA 4WCDA 3DTYA 1PWXA 1YKFA 2BELA 3VH3A 1JN0A 3K2EA 3WLFA 5L51A 1I30A 5JAQA 2NWQA 3FBTA 2AEMA 4U6QA 1H0KA 1LQTA 5AOVA 4EUFA 3DOOA 4RLSA 4CUZA 1MP0A 2V7PA 2O23A 3GG2A 3NDRA 4KTVE 2DAPA 5MGBA 3HSKA 4GBJA 4AJNA 3OFSA 4FBGA 1O0SA 2AG5A 3F4BA 4FGSA 3EAGA 4O59O 4MP8A 3L9WA 5IZCA 3KZVA 3SBOA 1KEWA 1QR6A 3DBLB 4OL9A 3WJAA 4QQRA 1KY5A 2I66A 3LF2A 4R1SA 5T6BA 1N7HA 4GL4A 4LN1A 2V6BA 1GZ4A 3AY6A 4E5KA 5F21A 4CM1A 1LRKA 2C5EA 1R66A 5MDHA 2C5AA 3PLNA 4D43A 2ZATA 3PHLA 4B4OA 1T2AA 3AU9A 3QWIA 2VRCA 4IS2A 4MP6A 4ZN6A 5I9NA 2DKNA 5TF4A 4FC6A 4RPKA 3SX2A 3X2FA 4E21A 1GYPA 1Z45A 4CM3A 4UVEA 5DBGA 4W9NA 3WIDA 1YBMA 4CODB 4FFRA 1GZ6A 1P1KA 2WE7A 3T7EA 5HRUA 3NT2A 2Q1UA 3HNPA 4YAKA 4FCCA 5A5FA 1KEUA 2HQ1A 3HN2A 1RJWA 1E3LA 3ZWMA 1YL6A 1SNYA 5L45A 3B70A 3X2EA 1PQUA 1UDAA 3K9QO 4J43A 1GDHA 5JBIA 1SCUA 5BNFA 4DBVO 1PJQA 1WZEA 4CMGA 4CV3A 1DRUA 4A5OA 5AXAA 3NTQA 4II3A 3VKUA 2YJZA 4GLOA 1NFRA 2Q1TA 2VWGA 5DN9A 1GPJA 1E5QA 1ZFNA 2Y0CA 4PLFA 5DCYA 4PG8A 5JC8A 5G0WA 2WYUA 3RUCA 4KDEA 2LDBA 5JXWA 4K1LA 3VDQA 3MCVA 2Y99A 3V2HA 1U7TA 4IPTA 3IP1A 4I5FA 4DL9A 4BGEA 4KQXA 4S3MA 5L40A 2YDYA 3KHUA 3GGOA 3PHJA 2VNSA 3WGYA 5B37A 3U3XA 4BHTA 5JNLA 5FF9A 5KVCA 1E7QA 2VTDA 1OAAA 1LA2A 1OC2A 3T7CA 1GUFA 1E7WA 3OIDA 4FOSA 4XDZA 1P0FA 3E8XA 5TRTA 4D3DA 4EJ0A 1H2BA 1M6HA 1SBYA 1UJMA 3RCBA 1FDWA 3B1FA 1UXIA 4F45A 1PGNA 1IULA 2QZ9A 1BTOA 3LC2O 4A0SA 4OGWA 2EKQA 4YRDA 4B7XA 4E13A 1DC6A 4OKIA 3QWBA 4BNZA 5KJEA 2CMDA 4ZJUA 8ADHA 2B4QA 3NAQA 3E5MA 1R12A 2FSVA 4UUNA 3A14A 1ADBA 2PV7A 1JTVA 3LT0A 2ZTLA 2XXJA 2BRUA 4BKOA 5B12A 3IDSA 4R5MA 3D3WA 4YQYA 4J1NA 1PL7A 4YXFA 4CQLA 3MOGA 2HSDA 5CFZA 2YQ5A 3WIEA 3V5NA 4BO5A 3ZNNA 5JY1A 1LXCA 4XIYA 3GH3A 3MJTA 3DBRB 3VPXA 4BKUA 3ZHXA 1QLHA 1Z7BA 3PJFA 4D0RA 3WGIA 1AE1A 3RJ5A 4Z6KA 4WCFA 4ZQFA 3VHRA 4XIJA 3EK2A 3TL3A 2AG8A 2B0JA 1V9LA 1A4IA 3FPLA 1DHRA 4MINA 1VPDA 2VT2A 1HYEA 1B26A 3R3JA 2J3HA 4L76A 2X0RA 3ZN2A 4OH1A 3IQDB 2WTBA 3HDYA 1Y7TA 2Y93A 1H9BA 3OSUA 4MVJH 3ZWWA 4KDFA 4J3FA 4ID9A 4NJOA 2TMDA 3K96A 4N7RA 1EFLA 4I9HA 4IUYA 4HWKA 4BO9A 4CM6A 1NAHA 5IXYA 5IZCC 1KY4A 2OP0A 4F3YA 4CR8A 1E3JA 4E12A 4PLCA 1CDOA 1R0LA 1PR9A 2CY0A 2P9EA 1X13A 3QV1A 1Y8RA 2I99A 2DBVO 2FRDA 1ORRA 2B69A 3GMDA 5A4DA 3BHMA 1WP4A 2IZ1A 3WGGA 2D3TA 4N54A 5AXBA 4YR9A 4F6CA 2EF1A 5ER6A 2QW8A 3FTPA 4UVIA 3PVZA 1VSUA 1GFSA 1KERA 3OH8A 3WFIA 1UXHA 4HV4A 3E6AA 4BNYA 4MPDA 2ET6A 5HTOA 1UH5A 3F47A 3GN2A 2ZJ0A 3JQGB 3PHGA 2X5JO 1B7GO 1K89A 1HYHA 3QP9A 2ZB7A 1NHWA 3AM3A 3HE3A 1B3BA 2E82A 2FPIA 4W82A 4WNIA 3GVIA 1X0VA 1DBVO 2EERA 1BMDA 1E3EA 4ZRMA 1Q2XA 4XGKA 4GMGA 5ICSA 2ILTA 3W8DA 5J23A 4CLRA 3D1LA 1PTJA 4GMFA 4KUGA 3W6UA 1GCOA 4KP7A 4XJSA 3TF5A 4M89A 3ZU5A 2C29D 2Q1SA 2VHYA 3MWEB 1VM6A 5TT0A 4CL8A 3WQSB 3H8VA 4BV8A 2P4QA 2CDCA 2NADA 2A4KA 4PZCA 3QE3A 1MB4A 1D3AA 1ISGA 4CM8B 1OMOA 2HCTA 4D3FA 2GERA 3UCEA 1LDYA 4HNGA 1WVGA 2IXBA 4GGOA 1HDGO 2AEFA 4KWIA 3UAGA 4BNJA 3FWZA 3JQFC 2X5OA 4U6SA 3V1TC 2JHGA 3E9QA 4U0JA 1NBOA 1ISHA 4A26A 1Y8RB 2POQX 4IDFA 3GVHA 2P9GA 1JAXA 1J5PA 4XRRA 3R6DA 1JKFA 5JAZA 1I2CA 1X0XA 3F3SA 4YT5A 4MKRA 4ALJA 3WYEA 3ORFA 3GLQA 2NVBA 4WLEA 1SAYA 1U4OA 3PYMA 3EY4A 4NBVA 1GZ3A 4YEDA 4E6PA 1Q0QA 2FZWA 1EVJA 4IIUA 3RU9A 1QKIA 4XX0A 4FIZA 2CUKA 3AUUA 3FNEA 4EBFA 4BO2A 4ALNA 1U9JA 3OEWA 1T1SA 2R00C 3IOYA 2B36A 3GA0A 1QMGA 4TRNA 1ZKMA 3QA9A 3H9QA 3VPFA 3TJRA 3ZWVA 1ADGA 4LSMA 1YDEA 1TT5B 3CMMA 1PEDA 1O94A 4RF5A 4WCFB 4YRBA 1K6IA 3RU7A 4ZHSA 1Z73A 3DAFA 5CPFA 4E5PA 3KLMX 3L6DA 1FDVA 2P68A 1LJ8A 3TOZA 1U3TA 2AQIA 1EDOA 3U49A 4YBZA 4TRRA 3K73O 3PHIA 4MIYA 1ZUD1 1PJSA 4I1IA 5IF3A 2VWPA 1T26A 2HRBA 1LSUA 4CMCA 2E49A 1TVEA 1UDCA 2EJWA 1BWSA 1WDMA 3DHEA 3NDJA 4TKLA 2FWMX 4TWRA 5KJCA 3K31A 1SEVA 3W1VA 3LLVA 1ARZA 4WOJA 3U4DA 2GCGA 3AW9A 1U5AA 4IQGA 1E6WA 5A3JA 3SC4A 3LC1O 5CDUA 4XCVA 1JQBA 4J7XA 1XR3A 4PG4A 2DM6A 2YUTA 3TNLA 1K0UA 5CG1A 2UVDA 1EQUA 4UUMA 3TZQA 5C7IO 4P4LA 4JN6B 1NPYA 3BMNB 2AE2A 1BXZA 3QRWA 3FWNA 4GKBA 1LBEA 1YVEI 5IZ4A 3KEOA 4RVDA 4EI2A 2QX7A 5LDGA 1Q7BA 4WLOA 4Z0HO 3DZFA 4XYBA 4JJFA 3ZW9A 1I2BA 1Q0LA 2JCYA 4EJMA 5G2OA 5U9CA 2WYVA 3ETDA 4OSPA 3O03A 2RHCA 5AYVA 1MC5A 1DLIA 3VPSA 4BO6A 2IE0A 1LSSA 4DIFA 1RYEA 2VRBA 3LT4A 3O4RA 5AVOA 2RBEA 1K6JA 3KB6A 1LRJA 1UP4A 2O2YA 3D4OA 3JQ6A 4TZKA 1YQDA 1UR5A 3G3EA 1O6ZA 2P2SA 2G1UA 3ITKA 5U1PA 3ROQA 2EG9A 4FD3A 4L9RA 4NFYA 4PVDA 3WWZA 2JD1A 3JQGA 4J9UE 3ZWXA 1F8FA 3RSHA 3S2EA 4ZQBA 3U4HA 4RPJA 4F46A 2ZYDA 1H93A 4BIIA 1LX6A 1YBAA 3AFMA 4NBTA 3HDJA 3ZV6A 4IDCA 3A4VA 3EMKA 9LDTA 4IIVA 2GUGA 4BNVA 4NR0A 2Y1GA 1HSZA 4O0LA 5I7VA 4BKQA 4PZDA 1QG6A 4IMRA 5GY7A 4J91A 2OZPA 1M76A 3V2UA 1GY8A 3KSDO 4W7IA 2GZ1A 2PNFA 4XYLA 2JCVA 1HETA 2BF7A 5IDXA 4TKMA 2YDXA 5G0TA 2VNAA 4HFMA 3L77A 3WQRA 3BMQA 4DC0A 3KEQA 5BNIA 5JSFA 3RI3A 1PGOA 2G5CA 1E3WA 2JAPA 2Q45A 2C7GA 5H83A 3N58A 3TZ6A 4BUCA 3RFXA 1EFKA 4K26A 3I5MA 4R01A 4WOKA 4A2CA 1ISJA 1FDSA 3I83A 4AJ4A 4C7KA 3E82A 5G0SA 1A7KA 2NV6A 3AUSA 1NXQA 5T8KA 4FPXA 4WLFA 1GADO 4UVHA 5K9ZA 3RAJA 3DC2A 4XYGA 2NU8A 1MGOA 5KCZA 4W9NC 3ZW8A 5K6AC 2V65A 3PJDA 1DFIA 2X1HA 4B7CA 3GMSA 4PG6A 3F46A 2GPTA 1GEEA 3KSZO 5EESA 1VL0A 2GASA 2YV2A 1ENOA 3L6OO 3MJ4A 4NBUA 5G4KA 4C4OA 1N7GA 4J0FA 3WR5A 5FYDA 5L7YA 4KWHA 5CEFA 2DPHA 4MVJE 5ITWA 5ILGA 2DT5A 3ENKA 3PLRA 4O1MA 1HZJA 4CQMA 4K6CA 3C3XA 1F14A 1T4DA 3K30A 3TRIA 2FY8A 4CJXA 4A73A 3R1IA 4GI2A 4W6ZA 5L9AA 2BMAA 3EZLA 4BV9A 4CMEC 2I3AA 1N2SA 4M1QA 3ONDA 1DIRA 4LCEA 3E18A 4R68A 4ND1A 5IDYA 5CDSA 4NU6A 3VH2A 4BKRA 2A35A 1P1IA 4Z3KA 3H9UA 2PGDA 5TX7A 1D8AA 4CM7A 2O7SA 3HHPA 1R4NB 3JQAB 5IN4A 4DYVA 1R6DA 2PKQP 1ZK2A 4Q3EA 2Q1WA 1V6AA 3L4SO 1GV1A 2J3JA 2ZTUA 3FR7A 4WKGA 3JQ8B 3DBLA 3CKYA 5JS6A 4CLEA 4XQCA 3CZMA 2EGHA 4JQCA 5IN5A 1ZBQA 1UAGA 3ABIA 1ZNQO 2GR9A 3GRKA 4JBIA 4PLYA 2O3QA 3L0DA 3AI3A 5A03A 1CF2O 1GTMA 1IPFA 2PR2A 1ULUA 1DAPA 5IJZA 5CDGA 1HEUA 3JYNA 4L75A 5BSHA 3H9GA 4OOEA 4AJJA 1DO8A 3GDFA 3GAZA 2FR0A 4R1UA 3TPCA 3P2YA 3SJ7A 4MVJF 4ITUA 4B7UA 3ZWAA 1YDWA 2D1YA 5I8ZA 5L53A 1EUZA 1EMDA 4OHUA 4CMAA 2PTGA 4DYDA 2VYND 4R54A 3OA2A 2CDBA 1DIHA 2PFGA 2FOIA 4XQEA 4NQZA 4B4UA 4RPGA 5L4NA 4M87A 2G0TA 4Y6RA 4YJHA 4E3ZA 5EMHA 4MP3A 3L07A 4IXTA 3IKTA 1IHXA 2PKRA 2DFVA 4JBHA 5COAA 5IG2A 1DSSG 2CDAA 3PQEA 5I7EA 4GX0A 2H9IA 8LDHA 3OF2A 5KNLA 2GN8A 5JE8A 4TRMA 5A04A 2W98A 4YJFA 5EQDA 1I3LA 3RJ9A 3GUYA 2J6IA 4NBWA 4I9UA 4ONEA 1UXKA 2ZTMA 1U5CA 1XGKA 2QRJA 4BO1A 1HE2A 4QEDA 2B4TO 3G1TA 4L8VA 4NDNE 4NBRA 3PGJA 3WDSA 5EJ2A 3NUGA 1P3DA 4CMBA 3JYPA 1PS0A 5F5LA 5C5IA 1IPEA 4PFJA 4JX8A 1BGVA 1H6BA 4NFHA 4WLVA 3DZHA 3Q2KA 3VZPA 1GQ2A 1YRLA 1AXGA 2GZ2A 2PGLA 2VRCD 3PDJA 2I67A 4IZIA 4OSOA 3UVEA 4I5EA 3SVTA 1XCBA 1O95A 4IDGA 3QWHA 5U4QA 5JDCA 3UFXA 4YACA 4BKPA 3PFWO 3PI7A 4XB2A 1A9YA 3BTVA 3MZ0A 2V6GA 4XKJA 5HWSA 5CP8A 3ZU3A 4WUVA 3GFGA 1PGQA 2OORA 3C7DB 3OECA 2SCUA 4HXYA 3UUWA 2OL4A 3N7UA 3Q2IA 1E7MA 1JWBB 4L4RA 4H16A 5IDQA 1EK6A 3U4CA 4E2YA 2W90A 4BO7A 1CQIA 4TSKA 1SB9A 3DZBA 3GVXA 3IC5A 4UAGA 1AHHA 3RC9A 3ZDFA 4A03A 4IMPA 1R4MA 2HAEA 5F1KA 4DIBA 3KYCB 3K92A 5B4VA 2G82A 1HYGA 1BXGB 5FI5A 1QYXA 1DJNA 4IDDA 1MV8A 1MXFA 1B8PA 1HDXA 2YFHA 2NVUA 3F9IA 4LVCA 4N5LA 3S8MA 5JAIA 1E1LA 5L7TA 1MXHA 4B3HA 4YT4A 1HDZA 1VL8A 1A4UA 1P1FA 1V3VA 2X0JA 4E5MA 2R2GA 1NVTA 6ADHA 4RQTA 4LMPA 1E1NA 4QUKA 4CM9D 5CEJA 2X58A 2I3GA 1PZHA 4RVSA 4J4TA 5ENVA 3F1LA 3LSYA 4HX5A 3WNQA 4QFDA 2X86A 4FOOA 4QECA 3ST7A 4YAJA 2O7QA 3NT5A 4L74A 3T4EA 1YS4A 2CSUA 3PK0A 4YWJA 4RGBA 2I9PA 1OC4A 3GDGA 1CJCA 3OM9A 4OM8A 1BDBA 3NEPX 4ZQGA 3NTOA 3FF4A 3ZU2A 4MVJA 1JVSA 4KUHA 1Y8QA 1M75A 5HS4A 4CLHA 1U2GA 3I9KA 1H6DA 4IDBA 2PWZA 2EW8A 3OJFA 3L9XA 1PZFA 3MEQA 3INGA 4EUEA 5JW6A 3FD8A 1PIWA 4Y6SA 3I9JA 5BSFA 2HMWA 3QWFA 4ZGWA 1LDGA 5LDHA 5A3VA 3M1AA 3HADA 4RVHA 1TT7A 1ZK0A 4PLTA 4ESOA 4CLDA 3SLKA 3JQFA 3OETA 1KEPA 1E1KA 1KC1A 1WW8A 2E6UX 1W73A 4DXHA 1DHTA 1T2DA 3HFGA 1DIBA 2IRWA 1GV0A 2V6FA 3BIOA 3GVCA 2NTNA 2DU8A 3QVWA 4B79A 1NPDA 1TA4A 2X8LA 1QRRA 1N8KA 1Q1NA 1U1IA 3AU8A 3LT2A 2NVWA 3L4BA 2P9CA 3TZCA 2BFAA 3AK4A 1ZH8A 3PXXA 1N1GA 1WZIA 3UN1A 4O63O 1PJ4A 3HB4X 3S2IA 4X54A 3QWAA 5CPBA 4L73A 4Y98A 3EUWA 1Q0HA 1YONA 1BDMA 3INRA 1QSGA 2ZCVA 3I1JA 3PFFA 3AOGA 3ADOA 4ZU3A 1Y1PA 1T25A 1HT0A 3ZZNA 4GH5A 3TFOA 2DPGA 3PRJA 2VUSA 3W4IA 2IXAA 4CV0A 5CEEA 4J7CA 3RBZA 4GAEA 3EW7A 3DHNA 1GL3A 3K5PA 5F1PA 3FI9A 1Y5MA 1L1FA 2HUNA 4BNTA 2O4UX 3JQ7B 5JPIA 5BR7A 1A27A 4A10A 1G0OA 3LU1A 3GY0A 2VOJA 2Z1NA 3UHAA 3DMTA 2E48A 1YO6A 2Y68A 4J90A 2Y1OA 3DZIA 4QXMA 1LLDA 3FPCA 1HE5A 5JYDA 4GGPA 2CF5A 4WEQA 2QQ5A 2C7VA 4RF3A 4YA6A 3I23A 1BVUA 1QORA 3WGOA 5K0ZA 4BS9A 2FMUA 4RDHA 5JLAA 1XLTA 1X15A 1LEHA 1ZK1A 2Y0EA 4MKXA 3AI1A 1JLLA 1GQYA 3LQFA 1H9AA 2HDHA 1PQWA 3OMLA 4CR7A 1SOVA 2ZB3A 2P5UA 3GNSA 3GUCA 2GN6A 4DC1A 1LC3A 3OJLA 4P38A 4GSKA 2EW2A 4JXKA 1XHLA 4PLPA 2J3IA 4DA9A 4RZIA 3P7MA 3PZRA 5DP2A 5B1YA 1LRLA 1ADFA 4IGEA 4U5QA 2Q4BA 4XB1A 2VQ3A 2PD4A 4PZEA 1B15A 2PLAA 5DNAA 1I32A 4DRYA 4LVUA 3I3OA 2X22A 5JC1A 1NQAO 5TSDA 1O8CA 3G0OA 3WBFA 3RC1A 1FDTA 1ZK4A 1N5DA 2ZB8A 1TXGA 3D4PA 1Y8QB 4E5YA 1U3VA 1VL6A 4BO4A 3BZUA 1DRWA 2FR8A 4RDIA 4PCVA 4XQGA 4L4XA 4YAIA 1YOVA 1B8VA 2NNLD 1YJQA 4BMNA 4BMVA 1UXGA 1WMBA 3KXDA 4XDYA
chains in the Genus database with same CATH superfamily
3DNFA 1FMTA 3DDZX 4KHZA 1Y42X 2DBYA 2PMCA 3HO8A 1RC0A 1N5JA 3SX4A 4CCWA 2XCSB 5DT9A 3FB1A 4KAXA 3CB4A 4LQ4A 2GPAA 4NBLA 1P33A 3E15A 3PD0A 1ZH4A 4YRIA 3BD6A 3O9ZA 1YBHA 3WLIA 3JAKA 4BB0A 4CG0A 1I6MA 2FMXA 1FFGA 2PYIA 3UT5A 1Q1EA 1P9WA 3KTDA 3UIEA 1OH7A 4KPYA 2YHUA 2IU4A 4YRKA 1R0BA 1WIWA 3B5IA 4BBAA 2FEOA 5EEGA 2FETA 1N0UA 2GZ3A 4FK8A 2UUBB 4J3JA 5EWMB 4IJWA 1TZBA 1X77A 4Z9XA 1X42A 5ALOA 5J9FA 4EQ6B 5KO2A 1JDNA 1G8HA 1NUHA 3F6BX 2D13A 3DZCA 3H6GA 4ZZ2A 5HUHA 1CYEA 2NU7A 4J0EA 1E2MA 4K28A 4Y2UA 4F12A 5E1MA 4E4RA 4YUXA 1JXOA 1KDRA 3R5KA 4IHJF 4C78A 3WKAA 1AXEA 3A3KA 4HGPA 1NNI1 1R4MB 1TYZA 2O3TA 4QOFA 4RWZA 2A86A 2JKYA 4K9DA 3ENWA 4QBGB 2OCBA 2DZDA 1K2WA 3AY3A 1ZOOA 4QWWA 1QP8A 4G8JA 2O1SA 5EY5B 4K6OA 4TLCA 3ROEA 3AM1A 1PI3A 1DOAA 2D1QA 5IJ0A 2UXBB 3KKNA 2OPBA 2X19A 4QEKA 5C1BA 3A31A 4MI3A 1UZAA 1UT8A 3I4LA 3OKAA 1X1EA 2W37A 4C7XA 2EFGA 1EUDB 1YS1X 4PYRA 4CIWA 5K5EA 4B44A 4MGHA 1WQ4A 2PT9A 1LDEA 3IKVA 2ZVJA 4YP6A 3QLEA 5HFJA 3F97A 1D1SA 4ITVA 1X1AA 1JHAA 2JH8A 5HFNA 3BL8A 2P3LA 4PX9A 4YMVA 4BB9A 2V3CC 2XNSA 4CEHB 2J4CA 3K0BA 4M1KA 2W6ZA 2XYVA 4LXYA 3W2HA 3K2IA 2VT7A 3OFVA 2FP4B 4UASA 4EW3A 4QJIA 4BNDA 3M6UA 1A5BB 1P91A 1Q83A 1MA0A 2H57A 2ZRAA 3QEMB 4JIGA 4DV2B 1YASA 2GZAA 3C3YA 2F1RA 4G0NA 1L7BA 2DWUA 1E2FA 5DBHX 5U4XA 2NUTB 2VBCA 3A6LA 1ULZA 4KOAA 1X7WB 2OHGA 3QU4A 4J1TC 4P4SA 4QO7A 4UTNA 1C0LA 4WZBA 3K70B 3P2JA 3RKUA 4D99A 4L3WA 1Z7YA 1I24A 2ANCA 3CKKA 3DKRA 4D4KA 1U5BA 5KYVA 1DPFA 1RKBA 1XZBA 1CHDA 2Q9AA 3AR3A 3HY4A 1QNFA 4BP3A 4RK6A 4U9IS 4FN4A 1RWNA 2I4RA 5JMTA 5KDOA 3EQ6A 3H99A 3MTDA 2Q3CA 2C8JA 1Y9EA 3DXYA 3P20A 3A6FA 4AZWA 1FRNA 1W9MA 1VRCA 1PYGA 1ZISA 2I03A 2V7TA 2HBYA 4FILA 5EIAA 1RQRA 4QVIA 4JGIA 3KYDA 4TL9A 2PKWA 3NIBA 3PRKE 2OAEA 3PDIB 4Q34A 3JV7A 2DC1A 3ORRA 4F38A 3FPBA 1E58A 2BFEA 1OZ0A 4MWDA 5JCJD 2YJ3A 1AKMA 1TK9A 3BQ9A 4DYHA 3CGWA 4HY3A 1OQAA 1YMVA 5J5VA 2VCHA 5A5VA 1U3WA 3WWCA 4YJ2A 2XA9A 1Y98A 4AQ7A 5F33A 2C42A 1NR7A 1EGMB 3G0IA 1IN8A 2A9RA 1JU9A 3UMFA 1J24A 2FEXA 2WZQA 2DSTA 3C3CA 4L0DA 2OQVA 1JIVA 3C39A 4UCXA 2EKLA 3PPIA 1ETHA 1QTNA 1JDUA 4RKQA 5KNBA 2ID9A 1BW9B 2VAXA 4FCWA 4DV7B 2E4XA 1OKKA 2W11A 1NLYA 2YXDA 2FF5A 3CF2A 2H7YA 5AP9A 1GUZA 3AHGA 3K15A 3WWYA 5EQFA 1RTTA 5A62A 1SUEA 1YOBA 3TI9A 2AN9A 1ZJ5A 3D8RA 4ANFA 3GCDA 1YE8A 4ZOAA 2YHIB 4Z1OA 3LXMA 3FVRA 4IR7A 1QQ5A 4KNYA 1V96A 3DV0B 3ZGVA 4DSAA 5ARBA 3VSAA 3TQHA 5TLSA 1S7CA 1MAAA 3LX4A 4ISBA 3PWSA 2I6TA 4L6IA 5JCZA 1EX9A 1PAUA 4IINA 3COYA 3KT3A 2FYTA 2R8BA 3UWMA 2KW5A 1LTHR 1QC5B 1QDLB 1M2EA 1TUEA 1BRMA 2ZT7A 5FULA 3PFCA 3OJ0A 4UBOA 1QRSA 5K3CA 5HKKD 1ZGZA 3QFSA 3TLKA 1A50B 4YQEA 4B40A 3CE9A 4H6PA 4BP9A 1KZ7B 3P9CA 3EGVA 4X93A 4LXUA 4NENB 2CN1A 4G8CA 3TWOA 1YZFA 3E3OA 1DEAA 2ZWPA 3IVMA 2O07A 3Q11A 4DPLA 2D3WA 1CQWA 5KMGA 2BFWA 5FI3A 1F0NA 5IUJC 1A1VA 2UUAB 3UF0A 4CETA 1J0CA 3GC6A 2NZ2A 3VNBA 2PL5A 2WKQA 3D5QA 3ETHA 2GJKA 3IR5A 1T4MA 3SC2B 5FFFA 4F5YA 3FJ1A 2QR2A 2W2OA 2K5UA 3D8UA 3MCUA 1QO7A 3JARA 5DYYA 3NGMA 1LLFA 3WLHA 1THGA 1EHIA 4KLNA 3ZK7A 3WRXC 1JG3A 2QJOA 5KYUA 3VR1A 4DLRA 4PV7A 4ENUA 3ND7A 5KHLB 3E9ZA 4AQDA 5I7AA 4HN4B 3G5MA 2OHIA 4RCVA 2WHPA 1KH2A 2AFHB 3KQVA 5BW4A 1NF8A 2IW1A 4DNPA 4NWIA 2PYDA 1QWOA 1U7UA 1HZZC 1ZDMA 2RCNA 3OUUA 3PFIA 1NVVR 1ZOSA 2D59A 3U3DA 4CDGA 2V1UA 3NW9A 5DULA 2A9PA 1AKUA 3WHLA 3P9SA 2X0FA 2C2YA 2XOXA 1KETA 4RY8A 2EF0A 5DH9A 1HORA 2VAVA 3LUKA 3NOOA 4OHVA 5B3JC 3RIHA 4LV6A 4CXMA 2FCAA 2GVDC 1GN8A 1A3CA 2Y3IA 4A8HA 1BOFA 2YX1A 4WFKA 1IXRC 1MB3A 3A05A 4GPAA 4LBWA 3AEYA 5BQ5A 1IJKA 3A1WA 2PGNA 3L4BC 3HA5A 4LJSA 4YQZA 5F3WB 1YJXA 5REQA 1PWZA 2DHEA 2Y6VA 3CSUA 2IDKA 1KXJA 4EHNA 4YUYA 4UXHA 1G3UA 2VTBB 1PFVA 3VX3A 2VPWA 1YQUA 2OWDA 1VJ1A 4M21A 3E8SA 2WQ6A 1JJVA 2WSBA 2X8BA 5IAAA 5HXAA 1XALA 3UHPA 2BGLA 2PK3A 2WWRA 2Z2XA 3KDAA 1JEYB 1JH8A 4XX1A 4QM7A 4F92B 4JX9A 3IELA 5K3FA 5BW5A 3M81A 2FW9A 3PFHA 4L5CA 5SY6A 5ITVA 4ZDIA 1TVCA 4DA6A 1YOVB 1Q91A 5HYVA 2WUEA 2RGEA 4O5OA 1XMQB 4LJKA 3FMPB 4MQMA 2EWMA 1N1MA 1DQRA 2PZJA 2ZIUB 3GT4A 5DP1A 3CVYA 5LYJB 3NTLA 3EC1A 3ICPA 8GPBA 2WU4A 2OBBA 1L4KA 4M0KA 1C30A 3DKKA 1Z4OA 1N34B 3H9JA 4C7BA 5TMBA 3OQOA 4X60A 3OEEA 3G7UA 1REQA 3FNGA 3K0EA 3QBDA 1NU6A 5C31A 1XTSA 4UNIA 4NCHA 1E2EA 4WSOA 3KSAC 3MIIA 1FFYA 2QJFA 3AR8A 3IEKA 3FCOA 4QHSA 5B7GA 2JAOA 4MQFA 1TAQA 2GN9A 1OWNA 4JI3B 1V2HE 5TF0A 4WAUA 2DTEA 2X7HA 4BGIA 4XR9A 5A7FA 2IEGA 3F7MA 3WNVA 2C8KA 5HBRA 1JYSA 1MAWA 2JF0A 2Q50A 1T3ZA 3OQPA 1A7AA 4KPFC 5LZ7A 1CZKA 1EVZA 3TDNA 2A7XA 3VHXB 3AVQA 2BT4A 3H1FA 4G1VA 1CHNA 1J09A 2C0PA 1G8YA 2OCXA 1RD4A 4HDKB 3B20A 4J0DA 4NABA 3SVZA 2ATCA 2BTEA 1H1TA 4Q9NA 3KETA 2I3DA 1KIFA 4WLUA 3ULKA 3SJCA 1SB8A 3N8HA 5AW4A 5K45A 5C81A 1M6WA 3WWDA 2A88A 5JQGB 1JKJA 3CU5A 4J0CA 3VC2A 3RBAA 5DRYA 5DEIA 1PJLA 1HM5A 1T8WA 2RGNA 3L0SA 5E6RB 1CUAA 2P8SA 3FRJA 4O02B 3T7DA 3UC9A 3UJPA 3GFSA 3UMVA 4CUJA 4ZIRA 1VCHA 3I01M 4IQ8A 1F4VA 3TLEA 3FSRA 1LU9A 4IQ0A 4OIMA 4A91A 3FVWA 3DAHA 3L0ZA 2GF2A 3PDUA 5C37A 3PDIA 3ON5A 3K8ZA 2JIZD 4INAA 2QUBA 4LECA 4YAEA 3F73A 2AW5A 2PRZA 3P9PA 3H2KA 3LCCA 3WK8A 4JROA 3UAYA 4Z0TA 3O9MA 2C3PA 3JWEA 4G85A 5JNUA 4U7JA 2BH2A 3SCZA 3DBRA 1N5LA 1Z5WA 2W6MA 3IT3A 4AULA 4BQPA 1HDOA 1F20A 2CWDA 5CA1A 3ZDAA 4KRFA 3KQUA 4FLFA 4C07A 2PKCA 4E30A 1RLIA 1Z6XA 4HWTA 3HKCA 1SUDA 5L6LB 1YACA 3L4KA 2RGXA 4D9NA 1UIRA 3JQDA 4MVJI 2NZWA 3SSAA 1KI9A 1CRLA 2CXOA 3GVPA 4P4SB 4YYZA 4ND5A 1RQLA 1E64A 4DMUB 3MWEA 4JDPA 4OD0A 3EB9A 3PYXA 1TM7E 3OTOB 4V39A 1EXDA 2PBZA 3QVJA 3CUKA 1X1BA 2D2FA 2ZYIA 4K9RA 5KI6A 2HCJB 3URKA 5C8XA 4TZ0A 3JQ9A 2OMEA 2Q28A 3S1LA 1QP0A 3ZU4A 1FXWF 1OU0A 4YRZA 1G7CA 4PBTA 3KTOA 2BN4A 1GN9A 1U3UA 5BWBA 1FMCA 1ISFA 1GG9A 2OZLB 4IGKA 3LK7A 2QTHA 4N3CA 4GOOD 1C3XA 3H65A 3WX0A 3KOUA 1IYZA 1E2UA 2LIVA 3HCAA 1II9A 4Y1EA 2CFSA 3I58A 4GP9A 5DASA 4Z0PA 3VJLA 4BWVA 4IYRA 4RPLA 4QUGA 2ZTVA 1DMRA 2AR0A 1VKHA 2QQGA 2GM5A 2Z5GA 3X3HA 1Z6YA 3KC2A 4RW0A 1G17A 2H63A 1HLPA 4FSDA 4I66A 2B7LA 3VYVA 5DTJA 3E9NA 3WGJA 1D4OA 4C87A 1N33B 4PANA 1M67A 1QBGA 4X8OA 4ABYA 2ATIA 2QAGB 3V8RA 4CTMA 2WIBA 2R5FA 3W0LB 2JFGA 4XCQA 2IX9A 3VO8A 2X77A 3CRVA 3QVOA 4LDNA 1FU4A 4FEAA 1ZMRA 2FQWA 4BAZA 4QZVA 1Z8FA 2XB6A 4ZO6A 4LPSA 3VV3A 3BXOA 1GRNA 3H3JA 1YHYA 2NXJA 4TTRA 1DV1A 2PL9A 4V0OA 1N8TA 3MBKA 3C45A 3VVCA 1QE3A 1DAFA 1VRWA 5HZGA 3V1YA 2P6NA 2RH8A 4BBJA 4KJZA 4XJXA 5HMLA 4YP7A 5G4KB 2WTXA 2OXIA 2A30A 1GQQA 2ZAOA 4G0MA 3E3MA 3FTQA 2D62A 3BCHA 4HADA 4RMIA 4ZT4A 1TAGA 3S1AA 4H31A 2RI6A 3AY0A 4JU9A 2XPCA 4F4UA 3R9XB 2NO1A 1CDEA 2CLEB 3IDAA 2Y2VA 1KK2A 4WXYB 4J1SA 1I1NA 3JVIA 1N0VC 1CQPA 1V9SA 4P53A 5DW3A 3DCJA 1GJRA 5BUQA 3CCBA 2F1HA 1CB0A 1WUJS 1Q15A 3GCWA 2FMHA 3GRPA 3L02A 5FNVF 5I7UA 3QVGA 1QH8B 2VNKA 2WD7B 5IH3A 1HURA 2O14A 3Q0EA 3SICE 3DSRA 4DJ5X 1KR5A 3T5BA 4MROA 2WHYA 4MSUA 1RI2A 1YQXA 3WRWA 3CNHA 4DTIA 3OPYI 5JRJA 4M49A 2EQ5A 3MT0A 2PR7A 1EM6A 2HK6A 4ODIA 4YQFA 3E9RA 3HYLA 5JU6A 2AA3A 2AMFA 3BB3A 4GYYA 1TI7A 2WMNB 3VU0A 1PO7A 4KQMA 4Q9IA 2BJVA 1XT6A 1BXRA 3FTDA 3GZTB 4F21A 3WIVA 5P21A 3ZUPA 4R2MA 2PO7A 4EB8A 4D8VA 5CLHA 1PLKA 1DS6A 2JI8A 4HPWA 4PZUA 4W9RA 3QVLA 3GGDA 1P74A 1L6IA 2EYQA 2J8ZA 4WNYA 5HA5A 4KBYA 2CHVA 4DPMA 5CT5A 1GU7A 4JMLA 3G6KA 1H65A 2VDWA 2VTEA 2GZRA 4DC9A 2HA2A 2QVZX 1E1DA 4LJ8A 1LC0A 2CZCA 4RJTA 1A5ZA 1SZJG 1C3VA 3CNQS 1NNUA 2ACWA 1ZH2A 4FFPA 1RJEA 3DE2X 3NCTA 1TC1A 2W6OA 2H5JA 1D1PA 2HSEA 5CA0F 1N9ZA 2VN8A 5DN6A 5K8TA 3MMSA 1U2RA 2WMOB 4HYTA 3FNFA 3S2ZA 2C9BA 3SOPA 1QH8A 3PUIA 4B8ZA 1NVDA 5F52A 4C06A 5D00A 1C9EA 1OLXA 2XYGA 4UNNA 3FFTA 2OYRA 1W9HA 2XITA 4QTUB 4WKPA 3R8CA 1N6PA 1F3OA 1L4FA 1PW7A 5CBPA 5HSGA 3WKCA 3AJDA 2HX1A 5ETJA 1GPLA 1ZSYA 2GA8A 4JQZA 5D1HA 3SC6A 3V4ZA 2IXTA 4HI0E 4PONA 1AK1A 3DMNA 3PIDA 4C3OB 4LNUB 4CU5A 3QNUA 2XCLA 2YW9A 5AM4A 4X64B 4PN7A 4UDXX 2QBYA 1S2DA 1DO0A 2FSVC 5A71A 2WKPA 4JT8A 2N75A 5A05A 5LXTA 1B2RA 2W8BA 4ZMBA 1W36D 3E53A 1I6WA 3HCDA 1OYWA 2HY7A 5CNKA 5LMNB 3ZEIA 3BHIA 1EGQA 2Y9MB 3IUSA 4KXWA 3X0DA 4D97A 3HCWA 3KUDA 3T3HA 4L8GA 5IEBA 3USZA 4JUFA 3MW8A 2OESA 1RM4A 5I4CA 3O8OA 4PC7A 3PP8A 1J2EA 4QPNA 1PJ2A 1KO5A 4WN3A 3G9UA 4QDKA 4URFA 3ROPA 3BSYA 2UUPA 4P7FA 4DLVA 2YJ4A 1V4BA 1QH1A 1WXDA 4NCNA 3RTGA 4FZJA 4M4SA 5FBKA 3GLTA 3A58B 3WDMA 2R6DA 1C14A 1BA3A 5IXSA 3DTVA 1PEAA 4EHBA 5JLJA 1S5PA 3HRKA 3IODA 2WSYB 5CLGA 4YFVA 3WFZA 4C6RA 3GV0A 2JLSA 4M38A 1Q44A 4GXNA 4U7FA 4JJGA 1P7WA 2Z98A 2GB4A 4JR0A 1U65A 2QRHA 3V42A 4YFYA 3OIGA 1WB5A 1ZKDA 2PS9A 3H6KA 4PYQA 2Q3BA 4BQOA 1TECE 4YMTA 3TQCA 1IEVA 2UKDA 4TQUS 1N7IA 2EGGA 1TPZA 4GE3A 4MOWA 4H27A 4KXVA 4XQ9A 1LSOA 1WHSA 1E89A 4URZR 4DT1A 1VBNA 1VSQA 4G6ZA 4A6EA 3M4JA 4FJ2A 2J5RA 2V7EA 2VPZA 4DSOA 4JYMA 1L7NA 4QOGA 3S2UA 2XNKA 3JZDA 5M2QA 1NR1A 1MF7A 2I65A 2WR8A 3B6MA 4N41A 3OZEA 1X1SA 5JAHA 1JFRA 3Q8MA 1RYNA 2GCNA 3CJRA 3MJSA 2BI8A 2O8EA 2NQ8A 3P0IA 4ED9A 2R87A 3OLCX 2DRIA 1NVXQ 1TT5A 1G6OA 1ZIOA 1CIJA 1LVUA 2EVWX 1Z4JA 3IMCA 1N2CE 3MAJA 4LHVA 1WCIA 5EJMA 3SN6A 2RJOA 2Z83A 1CY4A 3L8DA 3ZGZA 4MYDA 3GL9A 1M66A 2DTXA 2E4VA 3IOBA 3B60A 4HMOA 4P4NA 3MMZA 3LVBA 3T3OA 4FMPA 3SZ3A 4PYJA 5JSQA 4AL4A 1J8DA 3A1EA 4U6NA 4MVWA 4RK7A 5G1OA 2W6NA 4N5IX 5FOXA 1BWRA 2HN9A 2HK7A 3ED1A 4I4LA 3W34A 1JQLB 2GKSA 2HC9A 4KWCA 3RVPA 3R4VA 1ZJYA 2O3SA 3JRWA 1RWPA 1THTA 2QTAA 3FH0A 1ZESA 4RZXA 4FR5A 3U6KA 1QCDA 1M73E 2C1XA 2H1RA 4YDSA 3QIVA 3B3QA 3D0KA 4A0GA 1FYDA 2QG6A 4ND8A 4RENA 5BQXA 5CDHA 1EIWA 1IAQA 5F9FA 1GPBA 1NW3A 1TK3A 1EGAA 1YS6A 2PX0A 4P4UA 3I2FA 3NPMA 3UWSA 2H18A 4NH4A 3D4LA 3V2GA 3X44A 1DE0A 1GA1A 4YT2A 2YYZA 4FOPA 5C5EA 1A72A 3B3FA 5H7XA 3AEQA 3BSSA 3L4EA 4E7OA 1TQHA 4LOJA 1Z22A 4TTTS 2F67A 3BMQB 3SG0A 1KMMA 1VXRA 1R15A 4MB2A 5H81A 4GKVA 2UDPA 3AHIA 5E0KB 3T9DA 4R81A 1W35A 2CFTA 3VTFA 4WFJA 2FF7A 1QHXA 2XMBA 3KM0A 4LJ9A 1W5EA 2G76A 3WL5A 2QAGC 4Q18A 2EX1A 3SEFA 2IHBA 4I50F 3D6UA 2B5WA 4LBYA 4UEJA 1P31A 3T6KA 4BOYA 3THYB 3HKDB 1AUXA 1E7RA 1ZGCA 3EGXB 1H3EA 3W5AA 4RACA 4I14A 2CZQA 1R0SA 2BGKA 4I6EA 1Q7TA 4MULA 5CCBA 2BD0A 2NPIA 4YJGB 4YV2A 2M98A 3WG9A 1J8FA 4N4AA 3PA8A 4RD1A 4D4JA 3SS7X 1BX3A 2COEA 4BECA 4EITA 4RMNA 5E3JA 4JAVC 2F43A 2HPHA 1XG5A 2PJUA 4M0FA 4Z8YA 2GPBA 5AVVA 3ZHYA 2VP3A 5CDTA 2IKQA 3DBVO 3LHKA 1JKIA 3PVCA 5K3FB 1QTIA 3L6UA 1P4GA 2W2VA 5CT8A 1JA0A 4DCSA 2HMSA 4C01A 4YJDA 2R11A 3K9NA 4BFLA 1CS4C 1TYDE 1H2HA 2VZLA 4KRXA 4RABA 4OATA 4RK0A 4RPIA 5K51A 3U26A 4RAOA 4E0BA 2GDJA 1BHO1 4JZKA 1USVA 4IJVA 4P4GA 4L95C 3DLTA 3B9PA 4R2HA 5FR2A 3T41A 3WLRA 3ZG6A 4BMZA 4OYHA 1LKZA 3DE3X 3F6PA 3Q3CA 4K8RB 2TYSB 3CEJA 1RBMA 4L28A 4GL2A 3ZHOA 2YHBA 3EWIA 1DCKA 2AI2A 1P5RA 2YV3A 1FRFS 1XTQA 3GWZA 4PSUA 4RPHA 5D5QA 2QVYX 1SHJA 4CNBA 5C8YB 4QDZA 3S81A 1K7CA 2VKQA 2K2QB 2YC2C 4ZVOA 4JI7B 1ESDA 4MUIA 3VZRA 1ABFA 1JEAA 1R8XA 3Q0TA 3WWOA 1D1QA 3BE4A 3I4CA 3W4KA 2HUPA 3KUKA 1E94E 5BT8A 4D45A 1K5GA 2BFEB 2Z9DA 2VDVE 1FFAA 2VPTA 4DDVA 3H2ZA 2M6RA 2B2NA 1HFEL 2H8GA 1GGHA 2Y76A 3KYDB 1FU8A 3NVMB 4REQB 4EYKA 1M5TA 4AMVA 8ATCA 2G9NA 5B3AA 3IAXA 2RONA 3TD6A 4AJ2A 1VP3A 2GM4A 1KI8A 4I1YA 5ICMA 4IMIB 1HTBA 3EDCA 5AJVB 1H8HD 3FAZA 1NBEA 1G59A 1UFQA 2IOYA 1J56A 4HAUA 2CVQA 5MFZA 4Q9DA 1NI4B 3B5EA 3QSGA 2ACVA 1OCEA 1Z07A 1U02A 3NP7A 2GM9A 3Q98A 2C07A 4GPD1 4MDHA 5EPEA 1GHTA 4BMPB 4OLAA 3ONFA 1JHUA 2OKCA 2BMVA 5LKAA 2A0XA 2QVBA 4M99A 4YAOA 1Z18A 1IZ7A 2ASEA 3WYBA 2DQYA 1G8MA 4OU4A 3ZGXA 3GUUA 1DC3A 3FKSA 1XU7A 1ORHA 1WETA 4F1WA 2RD2A 1QRTA 3BTSA 1F9EA 1M2VA 2QW1A 3QW2A 1AMNA 1CEEA 1EZ4A 1II8B 1G291 2YWGA 4LG1A 1ZSVA 2FPGA 3GJ6A 4B84A 3HDHA 2REBA 3OT5A 1KYWA 1AUPA 4Q4AB 4B6JA 2G63A 3IQEA 3N74A 1QGED 3UKJA 1AN0A 1JIIA 2V98A 4BUCA 1CERA 3R9WA 2DPLA 2JJQA 3UUFA 5EOVA 4J4BA 3OURA 3SJZA 5L3SB 4KIGA 1NVFA 5EGNA 1T6ZA 1F0YA 4RCZA 3DD5A 1ZGBA 1BH2A 1AUQA 2XWPA 3FWKA 4XOIA 2CYBA 3ZV4A 1W0KA 2AK2A 5LBUA 3ABSB 2TMGA 2XE7A 1QV7A 3OHMA 1CNEA 3MVEA 1RZRA 2A0FA 1VI2A 3S55A 3Q7IA 3IUNA 2A5FA 5CX1B 1UK9A 1ZD2P 4DM4A 4P93A 1U8EA 2ZUEA 4RQUA 4I4TA 2EBUA 1XHFA 5JH7F 4O4LA 2AD1A 1KJQA 4JB8A 3P71T 4B48A 4DUGA 4B1FA 2XECA 3RO7A 3AEXA 3LX8A 1YZUA 4P9NA 4PZ0A 2RJ3A 3GNQA 4RETA 3VYSB 2QQFA 5JATA 4JEMA 1CQJB 2QTFA 4JNKA 3QM1A 3Q40A 1C7ZA 4H6VA 4EI9A 3ADPA 4WCFC 3CVWA 3U3OA 2FUEA 4YRQA 1WBDA 2QRVA 1OXUA 3I76A 4EJ6A 3ISJA 5E3IA 1JDJA 1HLGA 2RAVA 1QVAA 2AFHA 2PN1A 5T57A 4A23A 2NAFA 2CNBA 4LYGA 3JAKB 2IE8A 2J30A 1WSBA 2C31A 2YWBA 2PD6A 3QE0A 4RL6A 3MCTA 4KFTA 3A06A 4MO9A 3I9OA 4A82A 3N0WA 4BNMA 1U4SA 4MPPA 3A2NA 4CV2A 3G2QA 3H4VA 2G5PA 1HFKA 1QCZA 2ZDGA 3D3NA 1ETUA 1YRYE 2EFYA 4KRYA 3JSXA 4IXWA 3AF0A 1I3NA 4PPGA 2ZIAA 4HGNA 4LS3A 1IXKA 3M6AA 3KXPA 1KQNA 1IN4A 3FPKA 4X65B 3K9GA 4EGAA 4MS1B 1P9RA 3KSUA 1NASA 3UICA 5EQJB 4LF7B 4PYLA 3NR2A 5E4YA 2NUTA 2OG2A 2WD8A 4TS1A 1W46A 2QROA 4O4JF 3IBGA 4P5PA 3M6MD 1NXTA 1UJ6A 2AXPA 2F17A 1MLDA 3NC1C 4S0ZA 4AKHA 1MO3A 1VOTA 4YCBA 1E2IA 2HPAA 2O2EA 2X5NA 4GWLA 3DF9A 3HCNA 4CKCB 2FMFA 4H3VA 5L3SA 1JAYA 3QLVC 1WBBA 1J07A 3C43A 4XWKA 3KT8A 3MUOA 4LSWA 4PTYA 3EIFA 2JFQA 3DAGA 1ILEA 1V11B 5I3CA 1O3YA 5GJWC 1D0SA 3ANXA 3Q7EA 3V1UA 1BVRA 2J07A 5HKAA 3CEAA 3GRAA 1R1DA 2O7NA 3FMIA 2VXCA 1KI7A 2HA5A 4IRMA 1J97A 1JSZA 5EA2A 4CWAA 1RXVA 4EMBA 4BKMA 4OG2A 4QBHA 4OA5A 1GTL1 1YKGA 3CLKA 4JLDA 4KIUA 3Q4GA 1PNTA 1Z5GA 5FUYA 4BB5A 1FDOA 3QUQA 3PKJA 2PMKA 4LJRA 1VSVA 3NTRA 3AR4A 2ILVA 4KE8A 5T41A 2NUPA 3O8DA 4G37A 4Z2YA 3UXMA 4GQIA 4PZPA 3OC0A 4IDAA 4E31A 2YXLA 2ZRPA 3R5TA 2ZSUA 4Q4HA 1XZEA 1W5SA 3MFQA 3WYNA 2QRVB 1E6LA 2ANBA 1DQSA 1VPWA 3AZOA 1GNVA 2QZPA 5JCXA 1FS4A 2OZKA 4LHEA 4I55F 3K6JA 2VUTA 2Q7OE 1ULAA 4J8PA 1P39A 2Q9CA 2XGOA 1E6EA 3R2JA 2WT9A 1T6NA 3EGOA 3EIXA 3LHSA 5TQ0A 4Y7CA 4BMXA 4DKXA 3T0GA 2XD4A 4D1YA 3GGJA 3EDMA 1ZK3A 1C0KA 1MQAA 1NIJA 1GXSA 2ZG6A 3A25A 4Q82A 5D7BA 1EINA 1TM2A 4B4KA 4DLBA 3QU7A 2XT0A 3AR7A 4FD2A 4D92A 2PKQO 3VTZA 1TM5E 3AR9A 2FA9A 1G42A 1Y8CA 4EJSC 2HSWA 3PC4A 3C6BA 1YB5A 3QKSB 2N1MA 1TU4A 3VR5A 1EFAA 4RA6B 4WBNF 3ZX5A 2QTVB 4RGYA 5AVJA 4YRPA 1O6GA 3T5PA 1L9XA 2IHTA 1XOIA 5BXQC 3UMYA 1EFTA 4X97A 1RLJA 4WBSA 1CQXA 3DF7A 4YJ3F 1X8KA 4C4ZA 3UJNA 4L0QA 4BIMA 2HCBA 3U62A 3B48A 2A3RA 3AVYA 3LZ6A 4R9SA 2GYWA 2X9VA 1D03A 1CWUA 1FVXA 3KJIA 2HRZA 2IXEA 2XNJA 5KSWB 5J2TF 5B1HA 5ENDA 2VYFA 4CMHA 5A4JA 1AMUA 9ABPA 3VAZA 1T4CB 1E9FA 2Y1FA 4GMHA 3GPDG 2H5LA 2D2IA 1CE8B 2WMDA 3A9VA 4M1WA 2XIQA 4PAMA 3QEKA 1YI8A 2C2KA 5BMVA 3RAFC 2X6RA 1IG0A 1NRXA 2ETXA 2OP1A 4PHHA 4S0XA 4HQLA 1X7XB 1CR6A 1N25A 4NBKA 4A0QA 1ZNXA 4E6EA 2P5TB 1ATIA 1DRJA 2EP5A 1KFJB 4P92A 3RR2A 2DBQA 3WOVA 4JVLA 5AQEA 5JDIC 1YL5A 2ZAIA 1E2LA 4FYPA 1E9AA 4QDJA 1GT6A 3QKUA 1NIPA 1NI4A 1YB4A 3A8TA 1T2VA 1ZVMA 3HNOA 3NHZA 4RMHA 1PQPA 3C5HA 4X1KB 4KH1A 4G97A 3U44A 2V5VA 1F8GA 2JGJA 3K2BA 3K0FB 3R0XA 4D8UA 4GQAA 3L7BA 5KVSA 4N49A 1O96B 2VK4A 5H5JA 4FNAA 2ZBFA 3VVLA 3G1UA 1T6XA 3ZQ4A 3QJ5A 4AUNA 4CMIA 1Z6ZA 3AEKA 3ESQA 1GU1A 4YIHA 5JROA 5J47A 3RW9A 1V6CA 5GINE 1ODKA 2XDYA 1UP6A 3EVCA 3O8RA 3CMCO 4ARZB 1RAGA 4ND7A 4ZI5A 1ENYA 3NQ41 1AHIA 1ONPA 3PHHA 4UPDA 2F1JA 3L8CA 2ID7A 3QFCA 3ZJYA 2BDTA 5EWMA 2GSDA 2R7KA 2WMYA 3L3BA 4AY2A 3EDYA 5ERYA 3RIMA 3IKLA 1RVDA 1F8UA 1OWLA 3QHAA 3EUEA 4B2YA 3M6VA 3SKVA 3VOBA 4O0MA 3C7CB 1EP3B 2XWBF 3SWWA 3HZOA 4KQHA 4XWYA 1RLTA 4ON9A 2XQIA 2BSQA 3VPGA 3E3LA 5IKXA 1BOOA 5ESRA 3ELWA 4IFIA 1VHDA 2RB4A 2VWQA 2ZU6A 4AY5A 1NTRA 2ENWA 3TSWA 3IP3A 2BEWA 3HXPA 4DLAA 3LT5A 4TXMA 4CLOB 1RFGE 3K70C 1YR3A 3AO0B 3PPVA 5FA5A 1FTNA 2I7TA 3LO8A 5M7EA 1C1HA 3WMGA 2GGSA 4Z7QB 2FAXA 4BFTA 1KJYA 4KNWA 3DQZA 2HF8A 2ZSKA 2YMLA 5CVTA 1NVVQ 2IIVA 1NI3A 5CAEA 4R40A 1FF9A 1AQYA 3VH4A 4PC3A 4LCJA 4PSKA 2LGJA 1JDTA 3MT7A 4PN3A 1ANKA 4HUJA 4DUGD 3RK0A 4MKZA 2CNWD 1P8AA 4KZPA 1DLJA 2QN2A 3CSSA 4UOQA 3MFYA 1EP2B 3H2YA 4BFWA 1US8A 1U7OA 3DKPA 4P83A 2ERYA 4MI6A 3ERCA 1DBRA 1KYXA 1EVLA 1W5BA 3BAFA 3VPBA 4ER5A 5JRDS 3FCSB 3I12A 4HH4A 4ZCPA 1RYZA 1R74A 1NUSA 1W0KD 4QASA 5ENZA 5CCEA 1ZUNB 3O8NA 2P4UA 4OV6B 4AJOA 3RWMB 5CB4F 4F91B 5FBRB 3QX3A 1JKXA 3AR5A 4NY1A 4QGHA 5DLYA 2QX9A 2CLIB 2YVQA 3KPUA 1JNYA 4BVHA 3EBOA 3AEQB 1F12A 1UBJS 2C7RA 7MHTA 3ZUGA 2VFAA 1ILWA 1NQ5A 1WNTA 4HK4A 3LUHA 1CV2A 3TVYA 5E7QA 1AMOA 1OXTA 2EZUA 3BN3A 2VJKA 4F7DA 3N7AA 5K3OA 3O26A 3TCKA 4BFUA 2P3OA 1VZ3A 1UPBA 2GNPA 3ZV3A 5AKGA 4EL5A 2W4QA 5K3EA 1SULA 1X70A 2GHIA 2ZUCA 2IFTA 2GO1A 4JHXA 3C4QA 5HCIA 3RUEA 3DTVB 1QO0A 1FE8A 3W6OA 4CM9A 3DXXA 1DAEA 5DNCA 1O94C 3QEJA 3RRZA 2Z6UA 1NQTA 3O0DA 2MYPA 2Q5LA 3CUUA 4XWGA 2EIHA 1ZCJA 1R3DA 3O31A 3RC3A 1P77A 1SBCA 3BFXA 4U4AA 4D8WA 9GPBA 2QPLA 2GEJA 2GZHA 2ICAA 3U17A 3GLFB 1KAHA 3B1KA 3OP1A 5HGJA 2AV6A 4K2AA 4JA0A 6ABPA 2AD5A 4NYJR 4NU0A 2YZMA 4KXFB 3OJEA 5K3SA 3Q8KA 4GXQA 2J32A 2D1SA 2TECE 2YHAA 3NYIA 2A59A 1QOPB 1YA4A 1WDLA 1XTZA 1MEOA 3O93A 2YCLA 1ODFA 3KPWA 2DUJA 5CT6A 3RB8A 4YAFA 2QT9A 3CISA 4G9EA 3H17A 4TT8A 1M1NA 3KAQA 1ZMBA 3KQQA 2ZDHA 2VBGA 2HWKA 4P1ZA 4QYXA 4TKVB 3CF4A 2XHZA 4PYMA 2ORED 4XEHA 4XSGA 3PJGA 1I7NA 4AJIA 2AVDA 4PWYA 2O19A 3OP4A 2UXCB 2W48A 4KIFA 1P7CA 4ZA2A 1ZEMA 3CZ4A 3GAAA 5EQTA 1QYWA 4CF5A 2VPPA 1D4AA 1ITZA 4WXEA 1TEHA 1XVVA 3SC3A 3NTUA 1K08A 2C83A 2ZTHA 3GF4A 2P62A 1WSAA 2IEBA 3X1DA 1QKJA 1CNFA 4JJ4A 3H42B 4NMHA 3GJ0A 3JQ8A 5DHUA 1KDPA 3EISA 3JTEA 3RBVA 4DIMA 4BQIA 4LQDA 1PNRA 1C4XA 2PVPA 4U0KA 2XKKA 1YE5A 4BNFA 4AZ0B 1BEZA 3LH5A 1O5IA 5CFNA 3VDMA 2JEZA 1KK3A 2JCBA 3ZHBA 1KY2A 3T0FA 2EARA 4ES6A 4IUBS 2HJRA 3EY9A 1D2EA 3UOGA 3M3DA 4BNGA 2FSFA 3AXTA 4LDZA 1TVMA 1X1TA 3C85A 3A9WA 1XMPA 2IYOA 3PUXA 3L7NA 1TKRA 1CK4A 1UC5B 3NPAA 3LWBA 3Q8LA 2WTNA 3P52A 3G7SA 3QVSA 4DJFC 2DQSA 4RLQA 4TWAA 3ZCRA 1IEQA 3GO4A 1G41A 2EIXA 4UBMA 2QE7A 121PA 3KWFA 3PUVA 3H2SA 2HHAA 1MJFA 4XTCS 1LTQA 4CM5A 2WD7A 2G8NA 3H1BA 4Q93A 3DBHB 1SG9A 1FJ2A 1H2XA 3VDXA 5KYKA 1ODLA 3N5CA 3GP3A 4JBGA 3KHTA 4CN9A 1DTWB 1I51A 2YVAA 3V4OA 2AKEA 1AGNA 3G0DA 1KMQA 2XVXA 4I4IA 2CVPA 4EX6A 2ZPTX 3KEGA 1A4XA 2HM7A 4QWMA 1NZDA 4Z4GA 3ZWNA 3I9MA 1L5HA 2A1UA 1G21A 3OT1A 5DZSA 4N48A 4WCDA 1PWXA 2BELA 3WLFA 4G1EB 1UZUA 1IY9A 4TL7A 2OZVA 1RVV1 1GZ5A 1M54A 1CP2A 1ELOA 3NM6B 1TVKB 2EWVA 3CLTC 3LWZA 1TM3E 4LXIA 3FDZA 3KFXA 4U6QA 1PJAA 1H0KA 5F35A 4F3TA 3ONVA 2JIZA 3HA7A 3SS9X 2QJWA 3V9AA 2ZJ6A 5KNDH 5LFAA 4TV9F 4TUYA 1MP0A 4ENVA 1JF8A 5AOCA 1SUFA 3VSBA 2DAPA 1OXBB 2DWQA 3M8KA 3HSKA 4GBJA 1M0TA 4KQ1A 3NU1A 3U7QA 3OFSA 4FBGA 5KYWB 3CVUA 1OIXA 2BGJA 3M83A 3L9WA 3A1VA 3KZVA 1KNQA 3L6RA 2ZI9A 3IQFA 1QIGA 2B98A 3F3YA 3LF2A 5I9BA 3ASYA 4X7RA 5T6BA 4LN1A 3LUDA 4HAZA 3H8SA 4B74A 4E5KA 1U9IC 5F21A 1L9KA 2R44A 1LRKA 5TS2A 5F76A 1KDYA 3PGLA 5MDHA 2OILA 2P9QA 2Q6TA 5ALHA 4B4OA 1ZYUA 4LIPD 3K53A 3GJ8A 4PBSA 1UOPA 1KJ9A 2N47A 2VRCA 4NV0A 1T2NA 1VJCA 4CKBA 4LE0A 3S70A 5FPYA 4E21A 3DT9A 4C0AC 5AHOA 1NGSA 4UVEA 1AKRA 4W9NA 3WIDA 4MB6A 5F3DA 1YBMA 4AZ0A 4K9SA 2WE7A 4BVBA 4AXBA 2ZEJA 2FW8A 3O95A 1NJ2A 2JK1A 4FCCA 4UM5A 1RJWA 1E3LA 3CFYA 3LKBA 5EMNA 5TPWB 3RFUA 3ZWMA 3EULA 2GRJA 2VKTA 5L45A 1IQPA 3B70A 1TD9A 2AUMA 1PQUA 3LP6A 2P7HA 4KPUA 1YR6A 4OHCA 2IYSA 2H16A 1KJZA 3W3AD 2V4ZA 1WZEA 3C0KA 2E0IA 4HEA1 3I37X 4CMGA 2FMKA 2YTZA 2IA5A 1DRUA 4XGRA 1UC9A 1M8FA 2B8EA 2O57A 2QRPA 2OFXA 5BUZA 1IDOA 4D56A 4ZPXA 3FGOA 3RV4A 4WINA 3S7ZA 2G71A 3AFHA 4WGFA 2VWGA 4F1KA 3O73A 1K8XB 4UNPA 1WPRA 4PLFA 4C4SA 4HPXB 4PG8A 5JC8A 5LMCA 1WTCA 2WYUA 3AB8A 3IP9A 3N8KA 2WAMA 1SBTA 4KDEA 2RGBA 1Y7HA 4RSGA 4YALA 4OQEA 4POAA 5ESDA 4KGXA 5CVVA 3PI6A 4GNKA 4I5FA 1QAMA 2JFPA 5DWQA 5ELMA 5F2EA 2FE4A 1S0UA 1DAMA 1V7PC 2OCAA 1IC6A 3LYUA 3OU2A 3WP0A 1XDBA 2YDYA 3E7PA 3GGOA 2VNSA