4OT1A

Structural basis for the recognition of human cytomegalovirus glycoprotein b by the neutralizing human antibody sm5-1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
EDLDEGIMVVYKRNIAGSGCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAAAKLQQIFNTSYNQTYEKYGNVSVFETTGGLVVFWQGIKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of human cytomegalovirus glycoprotein B by a neutralizing human antibody.
pubmed doi rcsb
source organism Human cytomegalovirus
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein B
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 4ot1A00
3FVCA 3NWFA 4L1RA 3NWAA 4HSIA 3NW8A 3NWDA 4OSNA 2GUMA 4OT1A
chains in the Genus database with same CATH superfamily
3NWFA 2Z0OA 3ULBA 1MI1A 2KCJA 1P3RA 1MIXA 2J0MA 1E5WA 3U12A 4OT1A 1U5EA 4A6KA 4DX8A 1J0WA 1J19A 3WYFB 2RSGA 1DBHA 3NWAA 5JHGA 2DYQA 3M1IB 1FGYA 2DHJA 2UVMA 1ISNA 3TVVA 2VKIA 2BCJA 2Y8GA 2W2XC 2M14A 1V5MA 3AU4A 1DROA 4KHAA 2Z0PA 1UNRA 4EMOA 2Z4DA 1UNQA 4HB2B 4QJ4B 2D2QA 2RLOA 4HB3B 5I2MA 2DN6A 2KGXB 3FVCA 2D9XA 4TKNA 1Y5OA 1P5TA 1PMSA 2M38A 1V5PA 2P8VA 1TXDA 2MWNB 4Z2MB 2KUPA 2EMTA 1DDVA 3HSAA 4HHVA 3X23A 1WGUA 3D8FA 3PZDA 5D27A 4KVGB 4MY6A 1ZM0A 1FHWA 4GXBA 1RRPB 2FJUB 3GYOA 3NSUA 2YT2A 3PP2A 4A6HA 2H7EA 2DYNA 1BWNA 4B6HA 3V5WA 5I2SA 2FJLA 2QKLA 1FGZA 2DX1A 1KZ7A 3PSCA 1MKEA 1PFJA 1W1HA 2CODA 1LW3A 4NSWA 2EMSA 3HIEA 1U29A 2COCA 2OTXA 3SYXA 5C16A 1MK7B 3AJ4A 3CXBB 4K17A 3PEGA 3ZVRA 4QJ5B 2HE7A 3CIKA 1XCGA 1MPHA 2H7DA 2UZSA 3MPXA 3F0WA 1Y19B 2CRFA 4DX90 2DHIA 3F5RA 3A8PA 2I1JA 1ZSQA 3GYPA 2KIGA 3LJUX 2MKRA 5J3YA 2X18A 5JHHA 3RCPA 3PVUA 5GOWB 4C0AA 3BJIA 3NWDA 4KAXB 2Z14A 2KUQA 5JLJB 5CLQB 5HE3A 1W1DA 5C6RA 2K2UA 1LB1A 2D9YA 1B55A 2YT0A 4HAVB 4H8SA 2Z59A 1GC6A 2LYDA 3FM8C 1SHCA 3ML4A 4HAYB 1AQCA 3B77A 1WJ1A 2RNRB 4DIXA 1NTYA 1SGHA 1UEFA 2E2XA 2ZKMX 2AL6A 4WSFA 5C5BA 1EF1A 2DX5A 4MT7A 1I2HA 3U8ZA 1PLSA 2IYBA 4HATB 1TJ6A 3UZTA 4WJ7A 2L2IA 5D3WA 4K2OA 4DXAB 1U5DA 3PVWA 2N0YA 4F7HA 1IRSA 2RRFA 5D3XA 1X11A 4KHBB 2KR0A 3QWMA 2Z13A 3ULCA 3O96A 2COFA 1I7AA 2K8EA 5D3YA 2GS0A 5HE1A 2CY4A 5FI1A 4ZRJA 2NZ8B 4XWXA 4HAWB 1XX0A 2D9ZA 4IOYX 4PQ0A 1V5UA 2V76A 5DI9B 3N7CA 3WA0A 1NTVA 2YT1A 1OMWA 2YS5A 2PZ1A 1ZC3B 4KHOA 3QBVB 5EFXA 1QQGA 3TO1A 3AU5A 5J3TA 1EGXA 1U5FA 2JP2A 1BTKA 3SV1A 4PNKA 4HB4B 2AEHA 2D9VA 4WVFB 4DBBA 1Q67A 4A6FA 3DXEA 3KRXA 3DXCA 5DIFB 2P0HA 2EC1A 1FAOA 2NBVA 1X05A 3OANA 4HSIA 2YS3A 2LULA 2ELAA 2J59M 1V88A 5HE2A 4BBKA 1N3HA 4Z2NA 3OHMB 4IAPA 4EJNA 1K5DB 2YF0A 1X1FA 4GMXB 2QKMA 3P6AA 2J0JA 3A8QA 2DFKA 3DXDA 3PG7A 1MK9B 4GPTB 1WGQA 2W2XD 2DA0A 1DDWA 3ZDTA 1NU2A 4L6EA 3BINA 3G9WA 1H10A 1WVHA 2DKQA 2KIEA 4MK0A 1FHOA 2P0FA 3ODXA 2LOXA 2K2JA 1ZC4B 3D8DA 1WG7A 1BAKA 3MDBC 3SUZA 2Y8FA 4KHBA 2YRYA 2W2WA 3FEHA 3PVLA 2GJYA 2LG1A 1X1GA 1FOEA 5L81A 4EKUA 2I5CA 1W1GA 2CY5A 4F7GA 5KQ4A 3KY9A 5D3VA 4GN1A 4QXAB 2R2YA 4Y94A 5LONB 1NI2A 2NMBA 3KRWA 1KI1B 4GOUA 2XQNM 2Z0QA 1UPQA 4A6FB 2N23A 3A98B 1XR0B 3FSSA 1U27A 2RVBB 4P7IA 1FB8A 4GMVA 4OSNA 3VOQA 5IRSA 3KSYA 1ZYIA 2I1KA 4ZRIA 3TFMA 2COAA 2D11A 4L1RA 4A5KA 1K5GB 3NW8A 2J0KA 2R0DA 2ZPYA 3IVFA 2EJ8A 2GCJA 4YL8A 3VIAA 2DHKA 3P7ZA 1TQZA 1WI1A 4IFSA 3SNHA 1P6SA 1UPRA 1U5GA 2UZRA 1BTNA 4HB0B 3TCAA 1RJ2A 2ADZA 3QIJA 1M7RA 4NY0A 2YS1A 1DDMA 4D0NB 5KCVA 1GC7A 2L1CA 5HE0A 2VRWB 2OQBA 1XD4A 1EAZA 4CHMA 2RGNB 3U7DA 2ELBA 2GCLA 1QC6A 2DKPA 2P0DA 5C79A 5DHFB 4CHJA 2HTHB 2D10A 4HAXB 5DHAB 3T06A 3ODWA 1WJMA 2IFSA 3HK0A 3DCXA 5LG4B 1X86A 4HDOA 2MFQA 1FHXA 2DTCA 2K49A 4K81A 3A58A 4HAZB 5LOPB 1T77A 1ZVRA 4QJ3B 1KZGA 1UNPA 3ODOA 2YVCA 1DYNA 5J3QA 3SO6A 5CLLB 4CSQA 4F7UP 1Z87A 1H4RA 2VSZA 2ROVA 1XODA 2CAYA 3D8EA 1MAIA 2I5FA 2LOZA 2YSZA 5FI0A 3TW1A 1AWEA 4HDQA 1OY2A 1M7EA 1V61A 4CYEA 5M4YB 4YONA 4ZRKA 4GNKB 2RUKB 1XKEA 2D9WA 5DH9B 1V89A 3HW2B 4D6WA 2DLWA 2K00A 1U2BA 5KQ1A 4GZUA 2GUMA 1GG3A 2LKOA 4TYZA 4HAUB 5C5BB 3HQCA 3KZ1A 1OQNA 1MIZB 2MDXA 2D4QA 5JP4A 2R09A 2G35A 2ROZB 2Y7BA 4K2PA 2Q13A 1EVHA
chains in the Genus database with same CATH topology
4KHAA 3NWFA 4Z2MB 3GYPA 2NBVA 4D6WA 2KIGA 4HSIA 3FSSA 2RRFA 4DIXA 4CSQA 4OSNA 2GUMA 4OT1A 3U12A 4KHOA 2Z4DA 1ZYIA 3HIEA 4KHBB 5IRSA 3TO1A 2KR0A 4QJ4B 2Z13A 2ZKMX 3NWDA 5I2MA 2Z14A 5LG4B 2KUQA 4QXAB 2R2YA 2KIEA 2K8EA 3FVCA 4Z2NA 4L1RA 2FJUB 3NWAA 3GYOA 3NW8A 3TW1A 4QJ5B 2K49A 2YT2A 3OHMB 2GCJA 4GOUA 4IOYX 3A58A 5M4YB 4PQ0A 4KHBA 2GCLA 3TVVA 2Z59A 5I2SA 4GNKB 4QJ3B 4IFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVC A;  3NWF A;  4L1R A;  3NWA A;  4HSI A;  3NW8 A;  3NWD A;  4OSN A;  2GUM A;  4OT1 A; 
#chains in the Genus database with same CATH topology
 3NWF A;  2Z0O A;  3ULB A;  1MI1 A;  2KCJ A;  1P3R A;  1MIX A;  2J0M A;  1E5W A;  3U12 A;  4OT1 A;  1U5E A;  4A6K A;  4DX8 A;  1J0W A;  1J19 A;  3WYF B;  2RSG A;  1DBH A;  3NWA A;  5JHG A;  2DYQ A;  3M1I B;  1FGY A;  2DHJ A;  2UVM A;  1ISN A;  3TVV A;  2VKI A;  2BCJ A;  2Y8G A;  2W2X C;  2M14 A;  1V5M A;  3AU4 A;  1DRO A;  4KHA A;  2Z0P A;  1UNR A;  4EMO A;  2Z4D A;  1UNQ A;  4HB2 B;  4QJ4 B;  2D2Q A;  2RLO A;  4HB3 B;  5I2M A;  2DN6 A;  2KGX B;  3FVC A;  2D9X A;  4TKN A;  1Y5O A;  1P5T A;  1PMS A;  2M38 A;  1V5P A;  2P8V A;  1TXD A;  2MWN B;  4Z2M B;  2KUP A;  2EMT A;  1DDV A;  3HSA A;  4HHV A;  3X23 A;  1WGU A;  3D8F A;  3PZD A;  5D27 A;  4KVG B;  4MY6 A;  1ZM0 A;  1FHW A;  4GXB A;  1RRP B;  2FJU B;  3GYO A;  3NSU A;  2YT2 A;  3PP2 A;  4A6H A;  2H7E A;  2DYN A;  1BWN A;  4B6H A;  3V5W A;  5I2S A;  2FJL A;  2QKL A;  1FGZ A;  2DX1 A;  1KZ7 A;  3PSC A;  1MKE A;  1PFJ A;  1W1H A;  2COD A;  1LW3 A;  4NSW A;  2EMS A;  3HIE A;  1U29 A;  2COC A;  2OTX A;  3SYX A;  5C16 A;  1MK7 B;  3AJ4 A;  3CXB B;  4K17 A;  3PEG A;  3ZVR A;  4QJ5 B;  2HE7 A;  3CIK A;  1XCG A;  1MPH A;  2H7D A;  2UZS A;  3MPX A;  3F0W A;  1Y19 B;  2CRF A;  4DX9 0;  2DHI A;  3F5R A;  3A8P A;  2I1J A;  1ZSQ A;  3GYP A;  2KIG A;  3LJU X;  2MKR A;  5J3Y A;  2X18 A;  5JHH A;  3RCP A;  3PVU A;  5GOW B;  4C0A A;  3BJI A;  3NWD A;  4KAX B;  2Z14 A;  2KUQ A;  5JLJ B;  5CLQ B;  5HE3 A;  1W1D A;  5C6R A;  2K2U A;  1LB1 A;  2D9Y A;  1B55 A;  2YT0 A;  4HAV B;  4H8S A;  2Z59 A;  1GC6 A;  2LYD A;  3FM8 C;  1SHC A;  3ML4 A;  4HAY B;  1AQC A;  3B77 A;  1WJ1 A;  2RNR B;  4DIX A;  1NTY A;  1SGH A;  1UEF A;  2E2X A;  2ZKM X;  2AL6 A;  4WSF A;  5C5B A;  1EF1 A;  2DX5 A;  4MT7 A;  1I2H A;  3U8Z A;  1PLS A;  2IYB A;  4HAT B;  1TJ6 A;  3UZT A;  4WJ7 A;  2L2I A;  5D3W A;  4K2O A;  4DXA B;  1U5D A;  3PVW A;  2N0Y A;  4F7H A;  1IRS A;  2RRF A;  5D3X A;  1X11 A;  4KHB B;  2KR0 A;  3QWM A;  2Z13 A;  3ULC A;  3O96 A;  2COF A;  1I7A A;  2K8E A;  5D3Y A;  2GS0 A;  5HE1 A;  2CY4 A;  5FI1 A;  4ZRJ A;  2NZ8 B;  4XWX A;  4HAW B;  1XX0 A;  2D9Z A;  4IOY X;  4PQ0 A;  1V5U A;  2V76 A;  5DI9 B;  3N7C A;  3WA0 A;  1NTV A;  2YT1 A;  1OMW A;  2YS5 A;  2PZ1 A;  1ZC3 B;  4KHO A;  3QBV B;  5EFX A;  1QQG A;  3TO1 A;  3AU5 A;  5J3T A;  1EGX A;  1U5F A;  2JP2 A;  1BTK A;  3SV1 A;  4PNK A;  4HB4 B;  2AEH A;  2D9V A;  4WVF B;  4DBB A;  1Q67 A;  4A6F A;  3DXE A;  3KRX A;  3DXC A;  5DIF B;  2P0H A;  2EC1 A;  1FAO A;  2NBV A;  1X05 A;  3OAN A;  4HSI A;  2YS3 A;  2LUL A;  2ELA A;  2J59 M;  1V88 A;  5HE2 A;  4BBK A;  1N3H A;  4Z2N A;  3OHM B;  4IAP A;  4EJN A;  1K5D B;  2YF0 A;  1X1F A;  4GMX B;  2QKM A;  3P6A A;  2J0J A;  3A8Q A;  2DFK A;  3DXD A;  3PG7 A;  1MK9 B;  4GPT B;  1WGQ A;  2W2X D;  2DA0 A;  1DDW A;  3ZDT A;  1NU2 A;  4L6E A;  3BIN A;  3G9W A;  1H10 A;  1WVH A;  2DKQ A;  2KIE A;  4MK0 A;  1FHO A;  2P0F A;  3ODX A;  2LOX A;  2K2J A;  1ZC4 B;  3D8D A;  1WG7 A;  1BAK A;  3MDB C;  3SUZ A;  2Y8F A;  4KHB A;  2YRY A;  2W2W A;  3FEH A;  3PVL A;  2GJY A;  2LG1 A;  1X1G A;  1FOE A;  5L81 A;  4EKU A;  2I5C A;  1W1G A;  2CY5 A;  4F7G A;  5KQ4 A;  3KY9 A;  5D3V A;  4GN1 A;  4QXA B;  2R2Y A;  4Y94 A;  5LON B;  1NI2 A;  2NMB A;  3KRW A;  1KI1 B;  4GOU A;  2XQN M;  2Z0Q A;  1UPQ A;  4A6F B;  2N23 A;  3A98 B;  1XR0 B;  3FSS A;  1U27 A;  2RVB B;  4P7I A;  1FB8 A;  4GMV A;  4OSN A;  3VOQ A;  5IRS A;  3KSY A;  1ZYI A;  2I1K A;  4ZRI A;  3TFM A;  2COA A;  2D11 A;  4L1R A;  4A5K A;  1K5G B;  3NW8 A;  2J0K A;  2R0D A;  2ZPY A;  3IVF A;  2EJ8 A;  2GCJ A;  4YL8 A;  3VIA A;  2DHK A;  3P7Z A;  1TQZ A;  1WI1 A;  4IFS A;  3SNH A;  1P6S A;  1UPR A;  1U5G A;  2UZR A;  1BTN A;  4HB0 B;  3TCA A;  1RJ2 A;  2ADZ A;  3QIJ A;  1M7R A;  4NY0 A;  2YS1 A;  1DDM A;  4D0N B;  5KCV A;  1GC7 A;  2L1C A;  5HE0 A;  2VRW B;  2OQB A;  1XD4 A;  1EAZ A;  4CHM A;  2RGN B;  3U7D A;  2ELB A;  2GCL A;  1QC6 A;  2DKP A;  2P0D A;  5C79 A;  5DHF B;  4CHJ A;  2HTH B;  2D10 A;  4HAX B;  5DHA B;  3T06 A;  3ODW A;  1WJM A;  2IFS A;  3HK0 A;  3DCX A;  5LG4 B;  1X86 A;  4HDO A;  2MFQ A;  1FHX A;  2DTC A;  2K49 A;  4K81 A;  3A58 A;  4HAZ B;  5LOP B;  1T77 A;  1ZVR A;  4QJ3 B;  1KZG A;  1UNP A;  3ODO A;  2YVC A;  1DYN A;  5J3Q A;  3SO6 A;  5CLL B;  4CSQ A;  4F7U P;  1Z87 A;  1H4R A;  2VSZ A;  2ROV A;  1XOD A;  2CAY A;  3D8E A;  1MAI A;  2I5F A;  2LOZ A;  2YSZ A;  5FI0 A;  3TW1 A;  1AWE A;  4HDQ A;  1OY2 A;  1M7E A;  1V61 A;  4CYE A;  5M4Y B;  4YON A;  4ZRK A;  4GNK B;  2RUK B;  1XKE A;  2D9W A;  5DH9 B;  1V89 A;  3HW2 B;  4D6W A;  2DLW A;  2K00 A;  1U2B A;  5KQ1 A;  4GZU A;  2GUM A;  1GG3 A;  2LKO A;  4TYZ A;  4HAU B;  5C5B B;  3HQC A;  3KZ1 A;  1OQN A;  1MIZ B;  2MDX A;  2D4Q A;  5JP4 A;  2R09 A;  2G35 A;  2ROZ B;  2Y7B A;  4K2P A;  2Q13 A;  1EVH A; 
#chains in the Genus database with same CATH homology
 4KHA A;  3NWF A;  4Z2M B;  3GYP A;  2NBV A;  4D6W A;  2KIG A;  4HSI A;  3FSS A;  2RRF A;  4DIX A;  4CSQ A;  4OSN A;  2GUM A;  4OT1 A;  3U12 A;  4KHO A;  2Z4D A;  1ZYI A;  3HIE A;  4KHB B;  5IRS A;  3TO1 A;  2KR0 A;  4QJ4 B;  2Z13 A;  2ZKM X;  3NWD A;  5I2M A;  2Z14 A;  5LG4 B;  2KUQ A;  4QXA B;  2R2Y A;  2KIE A;  2K8E A;  3FVC A;  4Z2N A;  4L1R A;  2FJU B;  3NWA A;  3GYO A;  3NW8 A;  3TW1 A;  4QJ5 B;  2K49 A;  2YT2 A;  3OHM B;  2GCJ A;  4GOU A;  4IOY X;  3A58 A;  5M4Y B;  4PQ0 A;  4KHB A;  2GCL A;  3TVV A;  2Z59 A;  5I2S A;  4GNK B;  4QJ3 B;  4IFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...