4OT1A

Structural basis for the recognition of human cytomegalovirus glycoprotein b by the neutralizing human antibody sm5-1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
EDLDEGIMVVYKRNIAGSGCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAAAKLQQIFNTSYNQTYEKYGNVSVFETTGGLVVFWQGIKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of human cytomegalovirus glycoprotein B by a neutralizing human antibody.
pubmed doi rcsb
source organism Human cytomegalovirus
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein B
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 4ot1A00
4L1RA 4OT1A 3FVCA 4OSNA 3NWAA 4HSIA 3NW8A 3NWFA 3NWDA 2GUMA
chains in the Genus database with same CATH superfamily
1Z87A 4YONA 1WI1A 1WVHA 4YL8A 2MDXA 2L2IA 4KVGB 2RVBB 2XQNM 4L1RA 2Y7BA 1EAZA 2Z13A 2MWNB 4TKNA 1N3HA 3U7DA 2OTXA 3DXDA 4HAYB 2RLOA 2D9VA 2Q13A 4H8SA 4MY6A 1BTKA 2GJYA 2N0YA 1NI2A 2COAA 2K49A 4K81A 2I1KA 1KZ7A 2P0HA 2YF0A 2DKQA 1OQNA 1ISNA 3D8FA 2GCJA 4NY0A 4HB2B 4HDQA 2D9YA 2OQBA 3A58A 4GN1A 1WGUA 1U29A 2COFA 5LG4B 4Z2MB 4C0AA 2COCA 2UZRA 3PVLA 3KRWA 5KQ1A 1W1HA 1RRPB 2CY4A 3QBVB 3V5WA 4QJ5B 3ULCA 4PNKA 2J59M 1J19A 1U5GA 4K17A 4P7IA 4WSFA 2GS0A 1X1FA 1ZC3B 2VKIA 1WG7A 3NWFA 5CLQB 2EJ8A 3HIEA 2EC1A 4NSWA 5FI0A 2R09A 1XODA 1P5TA 2K2JA 3PP2A 2RGNB 4CHMA 5C5BA 1DDWA 2KGXB 2KR0A 3U12A 2Z59A 3HK0A 5HE3A 5GOWB 5DIFB 5JHHA 3G9WA 1U5FA 4OSNA 3DCXA 5D3VA 2JP2A 5FI1A 2DYNA 3F0WA 1QQGA 3TO1A 3M1IB 1M7EA 3U8ZA 1DBHA 1UNQA 2DYQA 1BWNA 1LB1A 1DROA 5J3YA 2NBVA 1X1GA 1X86A 2D9ZA 2D9WA 3UZTA 4HB3B 4KHOA 1MIXA 3PSCA 2PZ1A 4GXBA 3SYXA 3FSSA 1OMWA 1TQZA 3CIKA 2ELAA 2K2UA 2ROZB 1AQCA 3HW2B 1DYNA 3ODXA 4DIXA 1EGXA 1U5EA 2HTHB 1WJMA 1DDVA 2YRYA 2Z14A 2P0DA 1V5UA 3A98B 1UPQA 2D11A 5KQ4A 2DFKA 1BTNA 2X18A 2NZ8B 3MDBC 3TCAA 2VSZA 1KI1B 3BINA 4HAVB 2CODA 4GMVA 2DX5A 1OY2A 1P3RA 3HSAA 2CRFA 2KIGA 2W2XD 4F7GA 2AL6A 3PVWA 3NW8A 1EF1A 4IOYX 2YT2A 1XKEA 2L1CA 1FGYA 3PVUA 1X11A 4OT1A 1WJ1A 3QIJA 2P8VA 2EMTA 5J3QA 2DLWA 2YSZA 3WA0A 2KCJA 5EFXA 1QC6A 4HSIA 2DHKA 5CLLB 1I7AA 2IFSA 3TVVA 2YS3A 1UNRA 3ODOA 2Y8GA 1UNPA 3QWMA 2RUKB 4KHBA 4ZRKA 3P6AA 5D3YA 1GC7A 2I1JA 1MK7B 2UZSA 1GG3A 3WYFB 4WJ7A 5HE0A 2DA0A 2M14A 5LONB 3A8QA 4GPTB 2FJLA 2LOXA 3IVFA 4ZRIA 3FEHA 2UVMA 1B55A 1ZC4B 2KUQA 2Y8FA 1FHOA 1XCGA 3RCPA 2RSGA 4Z2NA 1J0WA 4IFSA 4B6HA 3NSUA 1U27A 3OANA 4WVFB 4CHJA 2YT1A 4DBBA 1EVHA 2RRFA 4CYEA 4ZRJA 4EMOA 5D3XA 5L81A 3KSYA 3NWAA 2LKOA 2GUMA 2W2WA 2BCJA 2H7EA 3ULBA 1FHXA 4QJ4B 3GYOA 4CSQA 1ZVRA 5J3TA 4HB0B 4A6FA 2DHIA 2YS1A 1P6SA 5KCVA 4F7UP 1PMSA 1U2BA 1PLSA 2H7DA 3VIAA 2HE7A 3A8PA 2ZKMX 3SNHA 4MK0A 2R2YA 3HQCA 3D8EA 4GMXB 1MPHA 4BBKA 2ZPYA 3FM8C 3T06A 1V88A 2LG1A 4A6FB 3PEGA 1NU2A 3TW1A 2Z4DA 1IRSA 1MAIA 4HATB 1NTYA 1H4RA 1SGHA 3O96A 4PQ0A 2EMSA 1KZGA 2Z0QA 1MKEA 2ELBA 2QKLA 1M7RA 2DTCA 1W1GA 3LJUX 3DXEA 1Q67A 3B77A 1T77A 2YS5A 1I2HA 1TJ6A 5C5BB 1MI1A 4DX8A 2R0DA 1UPRA 3P7ZA 1BAKA 5LOPB 4DXAB 5HE1A 4GZUA 5JLJB 1UEFA 3D8DA 1U5DA 2D9XA 4QXAB 5DI9B 3ZVRA 1V61A 2D4QA 3N7CA 4HAXB 5DHFB 2KUPA 2RNRB 4L6EA 4A6HA 1MK9B 4TYZA 1TXDA 5C79A 1W1DA 3ML4A 1ZSQA 3ODWA 3MPXA 3TFMA 4A5KA 5JHGA 3OHMB 4D0NB 2MKRA 4KAXB 1V89A 4HHVA 4K2OA 2LYDA 2K8EA 3DXCA 3SO6A 5DH9B 1Y19B 5C16A 2LOZA 5I2SA 1XR0B 1FGZA 4EKUA 3F5RA 3PG7A 4HAZB 2DHJA 2AEHA 1WGQA 1ZM0A 1MIZB 1ZYIA 2LULA 4F7HA 5D3WA 2Z0PA 5IRSA 4A6KA 4HAUB 2E2XA 3AU4A 2K00A 2D2QA 3ZDTA 3KRXA 5M4YB 3VOQA 2FJUB 5HE2A 1H10A 4EJNA 1PFJA 2CY5A 4XWXA 2ROVA 5DHAB 1V5MA 2VRWB 3AJ4A 2W2XC 4HB4B 2J0KA 3X23A 4KHBB 1FB8A 2QKMA 3FVCA 1K5DB 2CAYA 1X05A 2J0JA 2IYBA 3SV1A 2N23A 1NTVA 1XD4A 1LW3A 1RJ2A 2YT0A 3CXBB 4Y94A 3NWDA 2V76A 2KIEA 1FOEA 3BJIA 4QJ3B 1V5PA 2MFQA 4GOUA 5C6RA 2J0MA 1Y5OA 3KZ1A 1DDMA 4HAWB 2M38A 4HDOA 5JP4A 2DX1A 2D10A 4KHAA 2I5CA 1E5WA 2YVCA 3KY9A 2G35A 1FHWA 1FAOA 2P0FA 1K5GB 4GNKB 4D6WA 2DKPA 3AU5A 3SUZA 2I5FA 4MT7A 4IAPA 5D27A 1GC6A 3GYPA 1XX0A 2GCLA 2DN6A 2NMBA 2Z0OA 2ADZA 4DX90 4K2PA 1AWEA 1SHCA 3PZDA 5I2MA
chains in the Genus database with same CATH topology
2Z4DA 2RRFA 3FVCA 2GCJA 1ZYIA 4KHAA 3A58A 2Z14A 3TVVA 3NW8A 3NWFA 3OHMB 3HIEA 4L1RA 4IOYX 4QXAB 2Z13A 4PQ0A 2YT2A 4Z2MB 5LG4B 5IRSA 2KUQA 2ZKMX 4GNKB 2K8EA 4KHBA 3NWAA 4D6WA 2NBVA 2GUMA 3NWDA 2KIEA 5M4YB 2R2YA 3TO1A 4KHOA 2KR0A 4OT1A 4QJ3B 3U12A 2FJUB 5I2SA 4GOUA 3GYPA 2Z59A 4Z2NA 4QJ4B 3GYOA 2GCLA 4IFSA 4CSQA 2K49A 3FSSA 4QJ5B 4OSNA 4DIXA 4HSIA 5I2MA 4KHBB 2KIGA 3TW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L1R A;  4OT1 A;  3FVC A;  4OSN A;  3NWA A;  4HSI A;  3NW8 A;  3NWF A;  3NWD A;  2GUM A; 
#chains in the Genus database with same CATH topology
 1Z87 A;  4YON A;  1WI1 A;  1WVH A;  4YL8 A;  2MDX A;  2L2I A;  4KVG B;  2RVB B;  2XQN M;  4L1R A;  2Y7B A;  1EAZ A;  2Z13 A;  2MWN B;  4TKN A;  1N3H A;  3U7D A;  2OTX A;  3DXD A;  4HAY B;  2RLO A;  2D9V A;  2Q13 A;  4H8S A;  4MY6 A;  1BTK A;  2GJY A;  2N0Y A;  1NI2 A;  2COA A;  2K49 A;  4K81 A;  2I1K A;  1KZ7 A;  2P0H A;  2YF0 A;  2DKQ A;  1OQN A;  1ISN A;  3D8F A;  2GCJ A;  4NY0 A;  4HB2 B;  4HDQ A;  2D9Y A;  2OQB A;  3A58 A;  4GN1 A;  1WGU A;  1U29 A;  2COF A;  5LG4 B;  4Z2M B;  4C0A A;  2COC A;  2UZR A;  3PVL A;  3KRW A;  5KQ1 A;  1W1H A;  1RRP B;  2CY4 A;  3QBV B;  3V5W A;  4QJ5 B;  3ULC A;  4PNK A;  2J59 M;  1J19 A;  1U5G A;  4K17 A;  4P7I A;  4WSF A;  2GS0 A;  1X1F A;  1ZC3 B;  2VKI A;  1WG7 A;  3NWF A;  5CLQ B;  2EJ8 A;  3HIE A;  2EC1 A;  4NSW A;  5FI0 A;  2R09 A;  1XOD A;  1P5T A;  2K2J A;  3PP2 A;  2RGN B;  4CHM A;  5C5B A;  1DDW A;  2KGX B;  2KR0 A;  3U12 A;  2Z59 A;  3HK0 A;  5HE3 A;  5GOW B;  5DIF B;  5JHH A;  3G9W A;  1U5F A;  4OSN A;  3DCX A;  5D3V A;  2JP2 A;  5FI1 A;  2DYN A;  3F0W A;  1QQG A;  3TO1 A;  3M1I B;  1M7E A;  3U8Z A;  1DBH A;  1UNQ A;  2DYQ A;  1BWN A;  1LB1 A;  1DRO A;  5J3Y A;  2NBV A;  1X1G A;  1X86 A;  2D9Z A;  2D9W A;  3UZT A;  4HB3 B;  4KHO A;  1MIX A;  3PSC A;  2PZ1 A;  4GXB A;  3SYX A;  3FSS A;  1OMW A;  1TQZ A;  3CIK A;  2ELA A;  2K2U A;  2ROZ B;  1AQC A;  3HW2 B;  1DYN A;  3ODX A;  4DIX A;  1EGX A;  1U5E A;  2HTH B;  1WJM A;  1DDV A;  2YRY A;  2Z14 A;  2P0D A;  1V5U A;  3A98 B;  1UPQ A;  2D11 A;  5KQ4 A;  2DFK A;  1BTN A;  2X18 A;  2NZ8 B;  3MDB C;  3TCA A;  2VSZ A;  1KI1 B;  3BIN A;  4HAV B;  2COD A;  4GMV A;  2DX5 A;  1OY2 A;  1P3R A;  3HSA A;  2CRF A;  2KIG A;  2W2X D;  4F7G A;  2AL6 A;  3PVW A;  3NW8 A;  1EF1 A;  4IOY X;  2YT2 A;  1XKE A;  2L1C A;  1FGY A;  3PVU A;  1X11 A;  4OT1 A;  1WJ1 A;  3QIJ A;  2P8V A;  2EMT A;  5J3Q A;  2DLW A;  2YSZ A;  3WA0 A;  2KCJ A;  5EFX A;  1QC6 A;  4HSI A;  2DHK A;  5CLL B;  1I7A A;  2IFS A;  3TVV A;  2YS3 A;  1UNR A;  3ODO A;  2Y8G A;  1UNP A;  3QWM A;  2RUK B;  4KHB A;  4ZRK A;  3P6A A;  5D3Y A;  1GC7 A;  2I1J A;  1MK7 B;  2UZS A;  1GG3 A;  3WYF B;  4WJ7 A;  5HE0 A;  2DA0 A;  2M14 A;  5LON B;  3A8Q A;  4GPT B;  2FJL A;  2LOX A;  3IVF A;  4ZRI A;  3FEH A;  2UVM A;  1B55 A;  1ZC4 B;  2KUQ A;  2Y8F A;  1FHO A;  1XCG A;  3RCP A;  2RSG A;  4Z2N A;  1J0W A;  4IFS A;  4B6H A;  3NSU A;  1U27 A;  3OAN A;  4WVF B;  4CHJ A;  2YT1 A;  4DBB A;  1EVH A;  2RRF A;  4CYE A;  4ZRJ A;  4EMO A;  5D3X A;  5L81 A;  3KSY A;  3NWA A;  2LKO A;  2GUM A;  2W2W A;  2BCJ A;  2H7E A;  3ULB A;  1FHX A;  4QJ4 B;  3GYO A;  4CSQ A;  1ZVR A;  5J3T A;  4HB0 B;  4A6F A;  2DHI A;  2YS1 A;  1P6S A;  5KCV A;  4F7U P;  1PMS A;  1U2B A;  1PLS A;  2H7D A;  3VIA A;  2HE7 A;  3A8P A;  2ZKM X;  3SNH A;  4MK0 A;  2R2Y A;  3HQC A;  3D8E A;  4GMX B;  1MPH A;  4BBK A;  2ZPY A;  3FM8 C;  3T06 A;  1V88 A;  2LG1 A;  4A6F B;  3PEG A;  1NU2 A;  3TW1 A;  2Z4D A;  1IRS A;  1MAI A;  4HAT B;  1NTY A;  1H4R A;  1SGH A;  3O96 A;  4PQ0 A;  2EMS A;  1KZG A;  2Z0Q A;  1MKE A;  2ELB A;  2QKL A;  1M7R A;  2DTC A;  1W1G A;  3LJU X;  3DXE A;  1Q67 A;  3B77 A;  1T77 A;  2YS5 A;  1I2H A;  1TJ6 A;  5C5B B;  1MI1 A;  4DX8 A;  2R0D A;  1UPR A;  3P7Z A;  1BAK A;  5LOP B;  4DXA B;  5HE1 A;  4GZU A;  5JLJ B;  1UEF A;  3D8D A;  1U5D A;  2D9X A;  4QXA B;  5DI9 B;  3ZVR A;  1V61 A;  2D4Q A;  3N7C A;  4HAX B;  5DHF B;  2KUP A;  2RNR B;  4L6E A;  4A6H A;  1MK9 B;  4TYZ A;  1TXD A;  5C79 A;  1W1D A;  3ML4 A;  1ZSQ A;  3ODW A;  3MPX A;  3TFM A;  4A5K A;  5JHG A;  3OHM B;  4D0N B;  2MKR A;  4KAX B;  1V89 A;  4HHV A;  4K2O A;  2LYD A;  2K8E A;  3DXC A;  3SO6 A;  5DH9 B;  1Y19 B;  5C16 A;  2LOZ A;  5I2S A;  1XR0 B;  1FGZ A;  4EKU A;  3F5R A;  3PG7 A;  4HAZ B;  2DHJ A;  2AEH A;  1WGQ A;  1ZM0 A;  1MIZ B;  1ZYI A;  2LUL A;  4F7H A;  5D3W A;  2Z0P A;  5IRS A;  4A6K A;  4HAU B;  2E2X A;  3AU4 A;  2K00 A;  2D2Q A;  3ZDT A;  3KRX A;  5M4Y B;  3VOQ A;  2FJU B;  5HE2 A;  1H10 A;  4EJN A;  1PFJ A;  2CY5 A;  4XWX A;  2ROV A;  5DHA B;  1V5M A;  2VRW B;  3AJ4 A;  2W2X C;  4HB4 B;  2J0K A;  3X23 A;  4KHB B;  1FB8 A;  2QKM A;  3FVC A;  1K5D B;  2CAY A;  1X05 A;  2J0J A;  2IYB A;  3SV1 A;  2N23 A;  1NTV A;  1XD4 A;  1LW3 A;  1RJ2 A;  2YT0 A;  3CXB B;  4Y94 A;  3NWD A;  2V76 A;  2KIE A;  1FOE A;  3BJI A;  4QJ3 B;  1V5P A;  2MFQ A;  4GOU A;  5C6R A;  2J0M A;  1Y5O A;  3KZ1 A;  1DDM A;  4HAW B;  2M38 A;  4HDO A;  5JP4 A;  2DX1 A;  2D10 A;  4KHA A;  2I5C A;  1E5W A;  2YVC A;  3KY9 A;  2G35 A;  1FHW A;  1FAO A;  2P0F A;  1K5G B;  4GNK B;  4D6W A;  2DKP A;  3AU5 A;  3SUZ A;  2I5F A;  4MT7 A;  4IAP A;  5D27 A;  1GC6 A;  3GYP A;  1XX0 A;  2GCL A;  2DN6 A;  2NMB A;  2Z0O A;  2ADZ A;  4DX9 0;  4K2P A;  1AWE A;  1SHC A;  3PZD A;  5I2M A; 
#chains in the Genus database with same CATH homology
 2Z4D A;  2RRF A;  3FVC A;  2GCJ A;  1ZYI A;  4KHA A;  3A58 A;  2Z14 A;  3TVV A;  3NW8 A;  3NWF A;  3OHM B;  3HIE A;  4L1R A;  4IOY X;  4QXA B;  2Z13 A;  4PQ0 A;  2YT2 A;  4Z2M B;  5LG4 B;  5IRS A;  2KUQ A;  2ZKM X;  4GNK B;  2K8E A;  4KHB A;  3NWA A;  4D6W A;  2NBV A;  2GUM A;  3NWD A;  2KIE A;  5M4Y B;  2R2Y A;  3TO1 A;  4KHO A;  2KR0 A;  4OT1 A;  4QJ3 B;  3U12 A;  2FJU B;  5I2S A;  4GOU A;  3GYP A;  2Z59 A;  4Z2N A;  4QJ4 B;  3GYO A;  2GCL A;  4IFS A;  4CSQ A;  2K49 A;  3FSS A;  4QJ5 B;  4OSN A;  4DIX A;  4HSI A;  5I2M A;  4KHB B;  2KIG A;  3TW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...