4OT1A

Structural basis for the recognition of human cytomegalovirus glycoprotein b by the neutralizing human antibody sm5-1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
b'EDLDEGIMVVYKRNIAGSGCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCVRDEAAAKLQQIFNTSYNQTYEKYGNVSVFETTGGLVVFWQGIKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein B
publication title Structural basis for the recognition of human cytomegalovirus glycoprotein B by a neutralizing human antibody.
pubmed doi rcsb
source organism Human cytomegalovirus
molecule tags Viral protein/immune system
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17416 Glycoprot_B_PH1 Herpesvirus Glycoprotein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.100 Mainly Beta Roll PH-domain like PH-domain like 4ot1A00
4L1RA 3NW8A 3NWAA 4OSNA 4HSIA 3NWFA 3FVCA 3NWDA 4OT1A 2GUMA
chains in the Genus database with same CATH superfamily
4A6KA 2DHJA 1WG7A 1DROA 1V61A 2COCA 3A98B 2E2XA 1SGHA 5CLQB 1U29A 4GXBA 3PVLA 3HSAA 4EMOA 4NY0A 3FVCA 2J59M 2DX1A 4DBBA 5FI1A 1T77A 2P0DA 5C6RA 1TJ6A 2NZ8B 2IFSA 1XODA 3ZDTA 4DX90 2Z0QA 5JLJB 5FI0A 3AJ4A 3ZVRA 4D0NB 3QWMA 5D27A 2AEHA 3ULBA 1AQCA 3DXCA 2JP2A 3U12A 1X11A 1DYNA 5C79A 1PLSA 1LB1A 2DFKA 1K5GB 4A6FA 2KCJA 3DCXA 1NI2A 1I7AA 5C16A 2ELBA 2N0YA 1Y19B 1V88A 1PMSA 1OQNA 4L1RA 4HDOA 2G35A 4TKNA 2OTXA 1V5MA 1J0WA 1GC7A 4Y94A 3UZTA 4DX8A 2ROVA 2D9ZA 2LOZA 2AL6A 3WYFB 2W2XD 1WVHA 4K17A 3KZ1A 4HB0B 4C0AA 1DBHA 4HB2B 2RSGA 1DDMA 2W2XC 2YT1A 2I5FA 2K2UA 1H4RA 2RNRB 3D8DA 5L81A 3DXEA 2RRFA 1W1DA 4CSQA 1J19A 1FGYA 3D8FA 5HE0A 3KY9A 3TO1A 2Z14A 1OMWA 2ZPYA 2ADZA 1ZSQA 4CHJA 5C5BB 1FAOA 2EJ8A 2L2IA 3ODOA 5DHAB 2M38A 5C5BA 3PVWA 4MK0A 3HW2B 3TCAA 5J3QA 2K2JA 2UVMA 1W1HA 5JP4A 3BJIA 2KGXB 1Y5OA 2J0KA 1QC6A 2COFA 4D6WA 5LOPB 2Z4DA 3CIKA 2I1JA 2YVCA 4GN1A 4HATB 2D9WA 5HE1A 3V5WA 2W2WA 3QBVB 3NWFA 1DDVA 1EVHA 3HQCA 4WSFA 2YSZA 2D11A 2KR0A 2KIGA 2YS5A 4KHOA 2GJYA 2MDXA 2PZ1A 2YRYA 3NW8A 2V76A 4HAYB 2RGNB 1AWEA 4GMVA 4F7HA 2H7EA 5JHGA 4HSIA 3RCPA 4XWXA 1DDWA 4WJ7A 2R0DA 2DYQA 3SYXA 3FM8C 3HIEA 4TYZA 5KCVA 1H10A 2DA0A 2COAA 4K2PA 1X05A 1MK7B 4EJNA 2I5CA 2IYBA 5D3YA 2DTCA 1V89A 5EFXA 3F0WA 3SNHA 1U2BA 4OT1A 1FHOA 3O96A 2J0MA 2EC1A 1TQZA 1WJMA 1U5DA 1GC6A 3OHMB 1NU2A 1V5UA 3ULCA 4HAWB 4Z2NA 2D10A 2R09A 4HAXB 2CRFA 4HB3B 2KUQA 2VKIA 5KQ1A 1FHXA 4KHAA 1Q67A 1UNQA 2GUMA 2QKMA 4ZRJA 1BTNA 2XQNM 4K81A 3WA0A 2RLOA 3A58A 2FJLA 1WI1A 4OSNA 4GZUA 1ZYIA 5CLLB 3N7CA 1UPQA 2Q13A 3CXBB 2LOXA 2I1KA 2YS1A 3PG7A 2DKQA 4K2OA 3VIAA 3D8EA 1ZM0A 4IFSA 1XCGA 1NTVA 1FHWA 2KUPA 2H7DA 4HB4B 2DHKA 1UNPA 2RVBB 2MFQA 3NSUA 1FB8A 3QIJA 1EAZA 1FGZA 2CY5A 2P0HA 2DN6A 1UEFA 3VOQA 2KIEA 5J3YA 1SHCA 4IOYX 5DI9B 4PQ0A 2Y7BA 3ML4A 3X23A 1LW3A 1P3RA 3GYPA 1QQGA 2HE7A 4L6EA 3TW1A 3SO6A 4ZRIA 4A6HA 3PEGA 3BINA 1UNRA 3T06A 4DIXA 4ZRKA 3U8ZA 1ZVRA 2K49A 2DKPA 4HAUB 2HTHB 3PZDA 1M7EA 5DHFB 4DXAB 4HDQA 2ELAA 2EMTA 3B77A 4IAPA 1ISNA 3G9WA 2K8EA 1P5TA 4HAZB 4F7GA 1MI1A 5KQ4A 2RUKB 3KSYA 2L1CA 1K5DB 3ODXA 2DX5A 4QXAB 1XR0B 4Z2MB 2MKRA 4B6HA 3P6AA 4QJ3B 4MY6A 2P0FA 4QJ5B 1XKEA 4F7UP 2NBVA 1RRPB 2ROZB 1V5PA 2LG1A 3A8PA 4CYEA 1XD4A 4GMXB 2DLWA 2EMSA 3FEHA 3GYOA 2J0JA 3DXDA 3AU5A 2P8VA 5D3WA 1BTKA 2K00A 3IVFA 2CODA 3ODWA 2Y8GA 2GCLA 5HE2A 3MDBC 1KZGA 4MT7A 4YONA 1ZC3B 4KVGB 4KHBB 3HK0A 2LKOA 5D3XA 4CHMA 1PFJA 2GS0A 4KHBA 2VRWB 4A6FB 1GG3A 2D2QA 1Z87A 2BCJA 2M14A 1BAKA 1I2HA 1WGUA 3TFMA 1IRSA 1U27A 1X86A 3MPXA 1XX0A 2MWNB 4NSWA 3NWDA 2CY4A 1U5EA 3SV1A 2GCJA 1TXDA 3A8QA 5HE3A 5J3TA 3OANA 2DYNA 1W1GA 3KRWA 2Y8FA 4H8SA 5D3VA 1MIXA 2FJUB 2OQBA 2YF0A 3P7ZA 2Z0PA 1WJ1A 1M7RA 4QJ4B 2YT2A 1MIZB 1EF1A 2YS3A 2UZSA 3KRXA 3AU4A 2Z13A 4HHVA 4WVFB 1KZ7A 2X18A 1EGXA 1FOEA 4P7IA 1MK9B 2D9VA 5GOWB 2DHIA 3SUZA 4KAXB 2QKLA 4BBKA 1NTYA 3PP2A 4YL8A 5DH9B 1MKEA 1RJ2A 3LJUX 3NWAA 4HAVB 1WGQA 5JHHA 3U7DA 2R2YA 1ZC4B 2YT0A 4GNKB 2Z59A 5LONB 5I2MA 1KI1B 2D4QA 3FSSA 1BWNA 5DIFB 2UZRA 4PNKA 4EKUA 1U5GA 1X1FA 3PVUA 5IRSA 2VSZA 3PSCA 4GOUA 2LYDA 2N23A 2D9XA 2LULA 4A5KA 3M1IB 1UPRA 1B55A 1U5FA 5LG4B 2CAYA 3TVVA 2NMBA 1X1GA 1MAIA 1N3HA 5I2SA 2ZKMX 1P6SA 1OY2A 2Z0OA 3F5RA 1MPHA 5M4YB 2D9YA 4GPTB 1E5WA
chains in the Genus database with same CATH topology
3GYOA 4KHAA 4IFSA 4KHOA 2KIGA 3TW1A 4D6WA 3NW8A 3NWAA 4QJ4B 2Z4DA 2YT2A 4GOUA 3U12A 5LG4B 3TVVA 4OT1A 2GUMA 4DIXA 4QXAB 4Z2MB 4HSIA 2GCLA 2K49A 2R2YA 2Z13A 3FVCA 3NWDA 3OHMB 3A58A 2Z59A 4GNKB 2GCJA 4QJ3B 5I2MA 5I2SA 2ZKMX 2KIEA 3HIEA 4OSNA 4Z2NA 1ZYIA 3NWFA 4KHBB 3FSSA 4QJ5B 2RRFA 3GYPA 2NBVA 4IOYX 4PQ0A 4CSQA 4L1RA 5M4YB 2FJUB 2KUQA 4KHBA 5IRSA 2K8EA 3TO1A 2KR0A 2Z14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L1R A;  3NW8 A;  3NWA A;  4OSN A;  4HSI A;  3NWF A;  3FVC A;  3NWD A;  4OT1 A;  2GUM A; 
#chains in the Genus database with same CATH topology
 4A6K A;  2DHJ A;  1WG7 A;  1DRO A;  1V61 A;  2COC A;  3A98 B;  2E2X A;  1SGH A;  5CLQ B;  1U29 A;  4GXB A;  3PVL A;  3HSA A;  4EMO A;  4NY0 A;  3FVC A;  2J59 M;  2DX1 A;  4DBB A;  5FI1 A;  1T77 A;  2P0D A;  5C6R A;  1TJ6 A;  2NZ8 B;  2IFS A;  1XOD A;  3ZDT A;  4DX9 0;  2Z0Q A;  5JLJ B;  5FI0 A;  3AJ4 A;  3ZVR A;  4D0N B;  3QWM A;  5D27 A;  2AEH A;  3ULB A;  1AQC A;  3DXC A;  2JP2 A;  3U12 A;  1X11 A;  1DYN A;  5C79 A;  1PLS A;  1LB1 A;  2DFK A;  1K5G B;  4A6F A;  2KCJ A;  3DCX A;  1NI2 A;  1I7A A;  5C16 A;  2ELB A;  2N0Y A;  1Y19 B;  1V88 A;  1PMS A;  1OQN A;  4L1R A;  4HDO A;  2G35 A;  4TKN A;  2OTX A;  1V5M A;  1J0W A;  1GC7 A;  4Y94 A;  3UZT A;  4DX8 A;  2ROV A;  2D9Z A;  2LOZ A;  2AL6 A;  3WYF B;  2W2X D;  1WVH A;  4K17 A;  3KZ1 A;  4HB0 B;  4C0A A;  1DBH A;  4HB2 B;  2RSG A;  1DDM A;  2W2X C;  2YT1 A;  2I5F A;  2K2U A;  1H4R A;  2RNR B;  3D8D A;  5L81 A;  3DXE A;  2RRF A;  1W1D A;  4CSQ A;  1J19 A;  1FGY A;  3D8F A;  5HE0 A;  3KY9 A;  3TO1 A;  2Z14 A;  1OMW A;  2ZPY A;  2ADZ A;  1ZSQ A;  4CHJ A;  5C5B B;  1FAO A;  2EJ8 A;  2L2I A;  3ODO A;  5DHA B;  2M38 A;  5C5B A;  3PVW A;  4MK0 A;  3HW2 B;  3TCA A;  5J3Q A;  2K2J A;  2UVM A;  1W1H A;  5JP4 A;  3BJI A;  2KGX B;  1Y5O A;  2J0K A;  1QC6 A;  2COF A;  4D6W A;  5LOP B;  2Z4D A;  3CIK A;  2I1J A;  2YVC A;  4GN1 A;  4HAT B;  2D9W A;  5HE1 A;  3V5W A;  2W2W A;  3QBV B;  3NWF A;  1DDV A;  1EVH A;  3HQC A;  4WSF A;  2YSZ A;  2D11 A;  2KR0 A;  2KIG A;  2YS5 A;  4KHO A;  2GJY A;  2MDX A;  2PZ1 A;  2YRY A;  3NW8 A;  2V76 A;  4HAY B;  2RGN B;  1AWE A;  4GMV A;  4F7H A;  2H7E A;  5JHG A;  4HSI A;  3RCP A;  4XWX A;  1DDW A;  4WJ7 A;  2R0D A;  2DYQ A;  3SYX A;  3FM8 C;  3HIE A;  4TYZ A;  5KCV A;  1H10 A;  2DA0 A;  2COA A;  4K2P A;  1X05 A;  1MK7 B;  4EJN A;  2I5C A;  2IYB A;  5D3Y A;  2DTC A;  1V89 A;  5EFX A;  3F0W A;  3SNH A;  1U2B A;  4OT1 A;  1FHO A;  3O96 A;  2J0M A;  2EC1 A;  1TQZ A;  1WJM A;  1U5D A;  1GC6 A;  3OHM B;  1NU2 A;  1V5U A;  3ULC A;  4HAW B;  4Z2N A;  2D10 A;  2R09 A;  4HAX B;  2CRF A;  4HB3 B;  2KUQ A;  2VKI A;  5KQ1 A;  1FHX A;  4KHA A;  1Q67 A;  1UNQ A;  2GUM A;  2QKM A;  4ZRJ A;  1BTN A;  2XQN M;  4K81 A;  3WA0 A;  2RLO A;  3A58 A;  2FJL A;  1WI1 A;  4OSN A;  4GZU A;  1ZYI A;  5CLL B;  3N7C A;  1UPQ A;  2Q13 A;  3CXB B;  2LOX A;  2I1K A;  2YS1 A;  3PG7 A;  2DKQ A;  4K2O A;  3VIA A;  3D8E A;  1ZM0 A;  4IFS A;  1XCG A;  1NTV A;  1FHW A;  2KUP A;  2H7D A;  4HB4 B;  2DHK A;  1UNP A;  2RVB B;  2MFQ A;  3NSU A;  1FB8 A;  3QIJ A;  1EAZ A;  1FGZ A;  2CY5 A;  2P0H A;  2DN6 A;  1UEF A;  3VOQ A;  2KIE A;  5J3Y A;  1SHC A;  4IOY X;  5DI9 B;  4PQ0 A;  2Y7B A;  3ML4 A;  3X23 A;  1LW3 A;  1P3R A;  3GYP A;  1QQG A;  2HE7 A;  4L6E A;  3TW1 A;  3SO6 A;  4ZRI A;  4A6H A;  3PEG A;  3BIN A;  1UNR A;  3T06 A;  4DIX A;  4ZRK A;  3U8Z A;  1ZVR A;  2K49 A;  2DKP A;  4HAU B;  2HTH B;  3PZD A;  1M7E A;  5DHF B;  4DXA B;  4HDQ A;  2ELA A;  2EMT A;  3B77 A;  4IAP A;  1ISN A;  3G9W A;  2K8E A;  1P5T A;  4HAZ B;  4F7G A;  1MI1 A;  5KQ4 A;  2RUK B;  3KSY A;  2L1C A;  1K5D B;  3ODX A;  2DX5 A;  4QXA B;  1XR0 B;  4Z2M B;  2MKR A;  4B6H A;  3P6A A;  4QJ3 B;  4MY6 A;  2P0F A;  4QJ5 B;  1XKE A;  4F7U P;  2NBV A;  1RRP B;  2ROZ B;  1V5P A;  2LG1 A;  3A8P A;  4CYE A;  1XD4 A;  4GMX B;  2DLW A;  2EMS A;  3FEH A;  3GYO A;  2J0J A;  3DXD A;  3AU5 A;  2P8V A;  5D3W A;  1BTK A;  2K00 A;  3IVF A;  2COD A;  3ODW A;  2Y8G A;  2GCL A;  5HE2 A;  3MDB C;  1KZG A;  4MT7 A;  4YON A;  1ZC3 B;  4KVG B;  4KHB B;  3HK0 A;  2LKO A;  5D3X A;  4CHM A;  1PFJ A;  2GS0 A;  4KHB A;  2VRW B;  4A6F B;  1GG3 A;  2D2Q A;  1Z87 A;  2BCJ A;  2M14 A;  1BAK A;  1I2H A;  1WGU A;  3TFM A;  1IRS A;  1U27 A;  1X86 A;  3MPX A;  1XX0 A;  2MWN B;  4NSW A;  3NWD A;  2CY4 A;  1U5E A;  3SV1 A;  2GCJ A;  1TXD A;  3A8Q A;  5HE3 A;  5J3T A;  3OAN A;  2DYN A;  1W1G A;  3KRW A;  2Y8F A;  4H8S A;  5D3V A;  1MIX A;  2FJU B;  2OQB A;  2YF0 A;  3P7Z A;  2Z0P A;  1WJ1 A;  1M7R A;  4QJ4 B;  2YT2 A;  1MIZ B;  1EF1 A;  2YS3 A;  2UZS A;  3KRX A;  3AU4 A;  2Z13 A;  4HHV A;  4WVF B;  1KZ7 A;  2X18 A;  1EGX A;  1FOE A;  4P7I A;  1MK9 B;  2D9V A;  5GOW B;  2DHI A;  3SUZ A;  4KAX B;  2QKL A;  4BBK A;  1NTY A;  3PP2 A;  4YL8 A;  5DH9 B;  1MKE A;  1RJ2 A;  3LJU X;  3NWA A;  4HAV B;  1WGQ A;  5JHH A;  3U7D A;  2R2Y A;  1ZC4 B;  2YT0 A;  4GNK B;  2Z59 A;  5LON B;  5I2M A;  1KI1 B;  2D4Q A;  3FSS A;  1BWN A;  5DIF B;  2UZR A;  4PNK A;  4EKU A;  1U5G A;  1X1F A;  3PVU A;  5IRS A;  2VSZ A;  3PSC A;  4GOU A;  2LYD A;  2N23 A;  2D9X A;  2LUL A;  4A5K A;  3M1I B;  1UPR A;  1B55 A;  1U5F A;  5LG4 B;  2CAY A;  3TVV A;  2NMB A;  1X1G A;  1MAI A;  1N3H A;  5I2S A;  2ZKM X;  1P6S A;  1OY2 A;  2Z0O A;  3F5R A;  1MPH A;  5M4Y B;  2D9Y A;  4GPT B;  1E5W A; 
#chains in the Genus database with same CATH homology
 3GYO A;  4KHA A;  4IFS A;  4KHO A;  2KIG A;  3TW1 A;  4D6W A;  3NW8 A;  3NWA A;  4QJ4 B;  2Z4D A;  2YT2 A;  4GOU A;  3U12 A;  5LG4 B;  3TVV A;  4OT1 A;  2GUM A;  4DIX A;  4QXA B;  4Z2M B;  4HSI A;  2GCL A;  2K49 A;  2R2Y A;  2Z13 A;  3FVC A;  3NWD A;  3OHM B;  3A58 A;  2Z59 A;  4GNK B;  2GCJ A;  4QJ3 B;  5I2M A;  5I2S A;  2ZKM X;  2KIE A;  3HIE A;  4OSN A;  4Z2N A;  1ZYI A;  3NWF A;  4KHB B;  3FSS A;  4QJ5 B;  2RRF A;  3GYP A;  2NBV A;  4IOY X;  4PQ0 A;  4CSQ A;  4L1R A;  5M4Y B;  2FJU B;  2KUQ A;  4KHB A;  5IRS A;  2K8E A;  3TO1 A;  2KR0 A;  2Z14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...