4OTEA

Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
238
structure length
238
Chain Sequence
DKKIVVGATLVPGGELLEELKPLIKEKGYTLEVKNFDDYILPNEALNNGEIDANLFQHEPYLKEAVKAKGYKIMAGKKLYVCPAILYSYKIKSVDEFKKGDTIAISNNPSSCSKNLRYLESIGLLTLPKGDGLVSPKDIIENPKGIQFKELDIAQIPSSLPDVTAAFIDTTYAVPAGLDAKKNGIYTAPINDEYANLLAFRTEDKDSEKIKVLQDVLTSDKARSLIEEKYKGIVIPTFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein
publication title Crystal structure of a putative lipoprotein (CD630_1653) from Clostridium difficile 630 at 2.20 A resolution
rcsb
source organism Clostridium difficile
molecule tags Protein transport
total genus 74
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03180 Lipoprotein_9 NLPA lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oteA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oteA02
1B2HA 5DT6A 3MVWA 3TEPA 4IB2A 4Q0CA 3EHUA 1NL5A 2H98A 3VLVA 3ONMA 3IOUA 1B5IA 1FQCA 1H44A 3THIA 4QFOA 3SEYA 1NNFA 4BDMA 1FQFA 3MUQA 1LBCA 3OENA 4ZECA 4P0GA 1HSJA 1B1XA 4F31B 4IY5A 2FYIA 3L6HA 2PX1A 2DSFA 3TAJA 2H9BA 2F5XA 1N76A 2F36A 2D5WA 1GTKA 4Z0IA 1MQHA 3S9NC 1GV8A 4YKIA 3MW0A 1QVSA 2HZKA 3C34A 1H45A 1FTKA 4E0XA 2G29A 4EF2A 2THIA 3OELA 1CB6A 2I4CA 2QS2A 5F1QA 4M4GA 4Q30B 1NNPA 5H8QA 5FTIA 4XKNA 4EF1A 1SW1A 1JVXA 1FW0A 1IITA 4YB5A 5I57B 4O3AA 2Q88A 3PV0E 1ZU0A 5ITOA 4R74A 2UYFA 3H3GA 4GWOA 1QW0A 5I58B 4F29A 5H8SA 1LB8A 1IQ7A 3JV9A 1OQHA 4OEVA 4F2OA 1P1NA 3N6TA 1JEUA 1QUJA 1M5BA 1BKAA 3N94A 1FCKA 1XC1A 2ZXTA 1TFDA 4G4PA 1D3KA 4KCDA 4NF4A 2E1SA 3F11A 3KOSA 5L9MA 4DDDA 3S9EA 3SEXA 1VFEA 1A40A 4NEDA 3B6TA 5CMBA 4I1DA 4BDQA 2PBWA 1LB9A 1M5DA 4FORA 3EQ1A 1LCTA 1B0LA 1ANFA 2I58A 1B40A 3O6HA 1B6HA 2OZZA 3RTFB 4LZ5A 4EXKA 4QSEA 1MPBA 4G77A 1MY0A 3FGSA 1CE2A 4F1VA 5DEXA 1I6BA 2Q9TA 3OD7A 5HM4B 4JXIA 4BLAA 4GXSB 5I2NB 1MM6A 3CSGA 1P99A 2E0SA 1LAGE 2O1MA 1B5HA 3UGWA 3MWBA 4YB6A 1QUKA 3I5OA 1JETA 4U22A 4IO2A 1OQGA 2NUVA 2CZLA 3TYHA 5JEIA 3UN6A 3QK6A 3UIFA 5BUUA 3SKPA 4DLDA 1ZKBA 3M3FA 3PPPA 1FQDA 1SI1A 2AYSA 2ZNSA 1IXGA 4KCCA 3O9PA 1A8FA 1OLAA 4UACA 1YAEA 2XXTA 3RT6B 3CG3A 1MXZA 4QSDA 3QSLA 3O97A 1WODA 1A54A 4U1ZA 1BP5A 4FEDA 4DCYA 4H67A 4Q5TA 3PUYE 4F22A 3FD3A 2H5YA 4OQOA 3MVXA 1OVBA 2XX8A 4JSDA 1B7UA 1B52A 5ITPA 3H6VA 1FTMA 5CI5A 3QXMA 3LSFB 4KYEA 3KN7A 3QUFA 4BDNA 3OXNA 1ZBMA 4RK9A 3PD8A 4TOZA 3ZKLA 2XXHA 2DS9A 1BIYA 2W7YA 5CMKA 4XXUA 4OHNA 3H03A 3B6WA 2XD3A 3OMBA 1S7YA 5L8DA 4JDFA 4U2RA 1VR5A 4HTGA 4PETA 5KDTB 1UTBB 3D4CA 1BLFA 1TT1A 1B58A 1J1NA 5H8NA 1FTJA 1US5A 2VP1A 1I69A 1MY2A 1VE4A 4RY1A 3USDA 2RINA 3CFZA 3DP6A 5A5XB 4GIZA 4UA8A 3H06B 4H5FA 2O6AA 3TFLA 3RN8A 3MP6A 3PPQA 4C0RA 1M5FA 3K6UA 2QMXA 3G3JA 5IKBA 2CMOA 1P1WA 1PC3A 3MZBA 3CG1A 3FZVA 1OLCA 3V89B 3IJOB 4GL0A 1B0HA 2HEUA 4RPOA 5H8HB 3V8XB 1A55A 2HFBA 3BKIB 2X7QA 4NF6B 5KCJA 1Y20A 3KGCA 1DSNA 4KD5A 5CM6A 4BDRA 4QRZA 3H6TA 4POWA 4GD5A 4NF5A 1GGGA 1PBQA 3V5AA 3LUYA 2F7CA 3VLWA 4F3BA 4OYVA 4Z7EA 2GFEA 4C1UA 3MJNA 1Z7NE 1Z7ME 1RKMA 1EZ9A 3G3HA 3ODBA 1IIWA 1LAXA 1PB7A 3LSXA 2REJA 5H8NB 1SD3A 2ANJA 4PFUA 2UVIA 3MZ9A 4XKQA 3C35A 3RT8A 4DZ1A 4I8CA 1O64A 3UK4A 1YTVA 3U8QA 4KPTA 4IO4A 3BBRA 2A5TB 3CVGA 1B4ZA 1QJMA 1R1NA 3TQWA 3G7WA 4PFYA 1A7LA 1JQFA 4ZZAA 1MPCA 4G8HA 3K6WA 1XVYA 1OMPA 4F2QA 5JTYA 3C4MA 3FJ7A 2P1SA 3QYTA 1R6ZA 3DP8A 2I3WA 3W9WA 3ZS6A 3HCQA 2O51A 3IX1A 5EHMA 2O1LA 2Z22A 4FECA 1L5TA 4EQ9A 4E0WA 3WAFA 3KEIA 2ONRA 4OVJA 1HSEA 2DQVA 1B05A 1NH7A 4GVOA 3RUMA 1NMUA 4LONB 5I56B 2QS1A 5CC2A 1R9LA 1B1HA 5KCJB 3MZ1A 3OO6A 1GVCA 4TLLB 3MP1A 4H65A 4O3CA 2VOZA 4FEBA 4BDOA 2D21A 5L9OA 3VXBA 4WKMA 3DP4A 5EHSA 3SDFA 1MXYA 1SW2A 1D9VA 4R6HA 3UP9A 1FQAA 3TCHA 2RCAA 1YCJA 1IEJA 3H6UA 1A8EA 5F7VA 2XHDA 4DXUA 4IGTA 3N6UA 4R6YA 2XXXA 4M1VA 3E9XA 2I49A 3A3UA 3ZKKA 3KSJA 1H3DA 2HZLA 4H0WA 4DXCA 2ZNTA 1USYE 4RYAA 1JNFA 4LZ8A 4YAHX 4G68C 3S4UA 1MS7A 4FE8A 4EQBA 3IB0A 4WEDA 3TTMA 5ICQA 1Y3PA 4OFJA 1MQIA 1P1UA 3FXRA 2DOJA 2V93A 4IO3A 1LFHA 3KBRA 4G8MA 3IB1A 5JTYB 1T0KA 1LAHE 2YJPA 4U4SA 1IUDA 3AXFA 3CRBA 2OCUA 3PD9A 4OMBA 3QIMA 1TXFA 2QS3A 3H4ZA 4H5GA 4IO6A 1Q35A 2Z8DA 3IR1A 2O7IA 4XTCQ 1B3GA 4KI0E 3HO7A 4IO5A 2DVCA 1H76A 4MBPA 2F7AA 5TP9A 4NWCA 1LBBA 3E4RA 2Y7IA 3H7MA 3JYRA 1LSTA 3PUZE 4ZS9A 5TPAA 4ISUA 4JBZA 2HAVA 1EZOA 2GHBA 2P2AA 3H6WA 1UTHA 1NFTA 2DWIA 1O7TA 2H99A 5JK4A 2LAOA 4U21A 4F3GA 3LSLA 4YMBA 4F1UA 4G68A 3K1PA 3IB2A 2DWJA 1Y4CA 2FA7A 3O2AA 5AA2A 3N26A 2DVZA 1ZIUA 3IK6B 5CRYA 2ZYKA 2PVUA 2H4IA 5H8QB 4YKKA 4ONYA 3MVZA 4RXLA 3KG2A 4FJPA 2OBGA 4LA9A 2NVUB 3KN8A 1NNTA 1H43A 4LZ7A 1N7XA 3FVKA 1R9QA 2YLNA 1FTOA 4L17A 1B9JA 4QFKA 3QUJA 3TODA 3FVNA 3PUVE 1AMFA 3MQ9A 3Q28A 3FVGA 2OLBA 3PPOA 3TCFA 2B3FA 4N13A 5FHNA 3IOWA 5HPQA 4KR5A 3MPLA 4OFLA 2AL5A 1GR2A 4NE4A 3SESA 2PT1A 1B7HA 3EF7A 4MH5A 3IORA 4DCXA 1TFAA 4XKPA 1Y1MA 5H8FA 2DE4A 3CIJA 1Y4TA 3TTRA 1FQBA 3CR9A 1SBPA 1TWYA 2F78A 3C33A 4RK2A 1P1QA 5I59A 5TPAB 4NF4B 2DP8A 3KJ7A 4F18A 2ESNA 1MH3A 1UTHB 1UIUA 2P0SA 3M3LA 4X48A 3GZGA 3ILUB 4R6KA 5DYHA 1IZ1A 4KFQA 3K2DA 2F7BA 4G68B 2YPNA 4N07A 1DMBA 3PMXA 5DEXB 2F6GA 4EUOA 4LP2B 2HQ0A 4ZZEA 2QSXA 3K1NA 4GL8A 2QJEA 3K0VA 1EZPA 1MM7A 3TPAA 2DWAA 3VVFA 4RJZA 2NXOA 1DTZA 4I62A 3LR1A 3PPNA 3R6UA 5CMCA 3OO8A 3FV1A 1URSA 3DLNA 5EYFA 4ELPA 4Q8RA 3Q27A 2Z8FA 3B7DA 4JWYA 1O63A 4RNSA 1URGA 2Q89A 2V3UA 3K02A 1D9YA 1RYOA 3G3GA 4F3PA 1LFGA 1N7WA 1B51A 2PMSA 3KN3A 3OOAA 4YU0A 2BJJX 3N5LA 5I2KA 1USYH 2AL4A 2Y7KA 2Y84A 3T93B 2H25A 4HCYA 2X7PA 3MAMA 4LQ2A 3C31A 3O6IA 5KZTA 2VHAA 4ND9A 1XVXA 2XXUA 3V83A 1DPEA 4JSOA 3S2VA 3FIRA 1FQEA 1B3EA 3EPEA 2DWHA 4R2BA 4DXBA 1LCFA 2AIXA 2DXYA 1N3WA 4XIGQ 1SYIA 5AE4A 1SDXA 4YKJA 4H1XA 5AA4A 3K1MA 3U1OA 1IXCA 1IXHA 1SQYA 1D4NA 1MH4A 4N6PA 4ESXA 1IXIA 1MY1A 1ZTYA 4F3SA 3HV1A 1I6QA 4JB7A 4PE5B 1MDP1 3R7XA 3LBSA 3CSBA 3IJXB 1DOTA 2XXWA 5ELVA 4GQOA 4C1TA 2V84A 2V3TA 1HSLA 2R71A 2QL3A 3PGFA 3HN0A 2XXPA 1Y1ZA 4ZEDA 4OERA 1QUIA 2XXVA 4PFWA 2OK2A 4X1BA 4MLVA 1Y3QA 3VV5A 1PEBA 1B7ZA 1M5CA 1N0TA 2I48A 1P1OA 5IAIA 2R6GE 1SYHA 3E13X 4OXVA 4U4XA 4IO7A 3M8UA 4K3FA 1SVXB 3UORA 2I0CA 4OWDA 3U92A 1JVYA 2O7UA 4LQ5A 2FNCA 3KJTA 3C9HA 3Q29A 2D3IA 1US4A 4WXJA 4YICA 3Q26A 2XXRA 3TZAA 2UVGA 4LVQA 5I57A 2ONKE 3TELA 3T96B 2REGA 4OESA 5DTBA 2ZNUA 4RA1A 3E3KA 5AA4B 2GHAA 5I58A 2QMWA 3IO4A 4OFOA 2XX7A 2RKMA 3LSWA 1SW5A 4GRKA 4FAJA 3HHFA 2X26A 3RLFE 3VFJA 4LATA 4NF5B 4NF8A 3FXUA 1B32A 3Q25A 1AH5A 3U72A 1ZJLA 3T22A 3IAZA 3EN3A 4ECFA 1PB8A 3S9MC 3CFLA 2XD2A 3TUSA 2Z23A 3VVDA 3CI8A 3SEWA 1POY1 3CFXA 3U93A 2KLFA 4HCWA 3U94A 4OZ9A 3RQTA 4ELOA 3OEKA 1URDA 3KFMA 5TU0A 3EHTA 4GOTA 3SETA 2XXYA 3BFTA 4G8NA 4O3BA 3ILTB 3SEUA 3IL1B 4AB6A 1ZLQA 4MLQA 4RPNA 1B3HA 1MY3A 1VSOA 1QKBA 5I2NA 3G3FA 2UXAA 1ATGA 3I3VA 2QRYA 1DTGA 4U23A 2DYXA 2VD3A 4OETA 1DPPA 4ELRA 3KOTA 4PFTA 3FATA 2IEEA 1B46A 1PB9A 3IOTA 3S9LC 5DVJA 3O28A 3TTNA 3JZJA 4DE8A 2XXIA 2RC7A 4H6DA 4YMAA 3TCGA 2F6PA 3DM0A 3VDFA 1MXXA 2XXQA 4NWDA 4R9FA 4H8JA 3VXCA 4XKRA 4QFLA 4AB5A 3RTWB 3TDJA 4NMYA 4I9DA 4GXAA 2Y7RA 4YZZA 1N04A 1ZMGA 2O69A 2RC9A 4NF8B 2ONSA 3MPKA 5L9SA 3P7IA 2DE2A 3SERA 3HSTA 1SI0A 2VD2A 5K2XA 4TLMB 1MXWA 2UYEA 1NNKA 3D4GA 4P0IA 1B4HA 4ZEIA 4GFRA 3OEMA 1ELJA 1MXUA 1MG1A 2B3BA 2XX9A 1A99A 1MY4A 3BFUA 2Q8JA 3WAEA 4IY6A 4ZE8A 2ZYOA 1MQJA 1MRPA 4F1YA 3VLUA 2UVHA 1QKAA 1SW4A 2RC8A 4HW8A 3RNNA 4EXLA 3MP8A 3O66A 5FTHA 4FATA 2IA4A 1JW1A 2Z8EA 1MQDA 3GLBA 3FJGA 4X1DA 2NOOA 3MC2A 2DXRA 3RGYA 2O68A 3GXAA 1UTBA 5KDTA 1MPDA 5AA3A 4F39A 5FHOA 4R73A 2NWJA 2B65A 4PQJA 3G3IA 1LFIA 4ZE9A 3KZGA 1MDQA 3O6GA 4AQ4A 4ELQA 3GBBA 2PYYA 2Q2CA 3PUXE 4X9TA 2ALUA 3FXQA 3OO9A 1F9BA 2Y7WA 4KHZE 5DVFA 5TP9B 3W9VA 3A3CA 5A5XA 2DE3A 4JWXA 2I3VA 2V25A 3FUZA 1Q1KA 1Y9UA 2F35A 3KSXA 2PT2A 3FJMA 4P11A 3K00A 3T9UA 2HAUA 1WVJA 3MBPA 4ZDMA 3TTKA 2O84X 3MVYA 3SEVA 2R9JA 2A5SA 2VGQA 3LC8A 4LUBA 5H8HA 3T9XB 1JW5A 4OENA 3PU5A 5DVIA 5AA2D 4TQUQ 1POTA 3L6GA 4NF6A 1M5EA 2HCAA 5I84A 1FTLA 4KYSA 3EHSA 2ZYMA 5AA2B 2F97A 5M2VA 1EH3A 2UVJA 3DELB 1AOVA 4MF3A 5ISUA 3RY3A 2RF1A 1MQGA 1S50A 4ZEFA 4F19A 3K6VA 1QULA 3PMVA 1NKXA 3PPRA 5ICTA 1PDAA 3A09A 3VE1B 4QFNA 3OSRA 3K01A 2WKYA 4G2ZA 2M8CA 3K4UA 3OSQA 3FVOA 4QF9A 1XT8A 1EU8A 3C36A 3IO6A 4ZEKA 2F8DA 4R2FA 3M3KA 1OVTA 1Y3NA 1S9TA 1KWHA 3HPIA 3T9VA 5LOMA 5J1DA 1B3LA 2A5TA 4HS7A 1LGBC 5H8FB 3OO7A 5B7DA 3B6QA 3TTLA 4H8IA 1WDNA 1N84A 2OWTA 2OWSA 2GH9A 5I59B 4U1OA 1MXVA 2G93A 3O29A 3PMWA 4GF8A 3ZSFA 4YB7A 4OEUA 3K6XA 3UA8A 1XOCA 4KYDA 4ZEBA 3IOVA 1UQWA 1RYXA 4R75A 5HBCA 4QSCA 2ABHA 3I6VA 1XS5A 3ECRA 1N3XA 2I6EA 4EQ7A 3HHGA 1YPNA 1UIVA 1AL3A 3FASA 5I56A 2RCBA 4GLIA 1XHYA 2Y7PA 3TMGA 4R9GA 5CMMA 3TKDA 3PUWE 4QHQA 1JEVA 4PP0A 1B5JA 5CBRA 5AA1A 3T9HB 4THIA 4WEPA 2Q2AA 2I4BA 1VFDA 4QFPA 2V3QA 2I0BA 4POXA 4MFIA 3T66A 5B70A 2F34A 3QAXA 1NH8A 2HXWA 3W15C 1BTJA 1OIBA 3VVEA 4JWOA 5I2KB 1II5A 3GBAA 3G3KA 3R26A 3RPWA 5FHMA 2ZMBA 2OJTA 5K2YA 4NTLA 4DIGA 1PBPA 1JW4A 2QS4A 5CBSA 1B3FA 3C32A 4OTEA 2GRVA 4KQPA 4YKPA 1LLSA 2ZYNA 2QPQA 3TQLA 4IGRA 4FIMA 4EDPA 4BDLA 5BWJA 1I6AA 1AIVA 4R72A 1LAFE 3FV2A 4ESWA
chains in the Genus database with same CATH superfamily
1B2HA 1FPIA 4NQ8A 5DT6A 3MVWA 4OANA 4HE2A 3TEPA 4IB2A 4Q0CA 3EHUA 1NL5A 5ET6A 2H98A 3VLVA 3ONMA 3IOUA 1B5IA 1FQCA 1H44A 1FBDA 3THIA 4QFOA 3SEYA 1NNFA 4BDMA 2BJIA 5I7IA 1FQFA 3MUQA 1LBCA 3OENA 4ZECA 4P0GA 1HSJA 1B1XA 4F31B 2GQ1A 4IY5A 2FYIA 3L6HA 2PX1A 2XA5A 2DSFA 4MJOA 3TAJA 1FRPA 2H9BA 4O7MA 2F5XA 1N76A 2F36A 2D5WA 1GTKA 4Z0IA 1MQHA 1YZ0A 3S9NC 1GV8A 4YKIA 3MW0A 1QVSA 2HZKA 1FPFA 4NGUA 3C34A 5LTCA 1H45A 1FTKA 4E0XA 2G29A 4MX6A 4EF2A 2PFZA 2THIA 3OELA 1CB6A 2I4CA 2QS2A 5F1QA 3EKIA 4M4GA 4Q30B 1NNPA 5H8QA 2FVZA 5FTIA 4XKNA 1FPLA 4EF1A 1SW1A 1JVXA 1FW0A 1IITA 4YB5A 4MEVA 5I57B 4O3AA 1LBYA 1XI6A 2Q88A 3FBPA 3PV0E 1ZU0A 5ITOA 4R74A 2UYFA 2VPNA 3H3GA 1NUXA 4PC9A 4H46A 4GWOA 1QW0A 5I58B 4F29A 5H8SA 1LB8A 1IQ7A 3JV9A 1OQHA 4OEVA 4F2OA 1P1NA 4MNIA 3N6TA 1JEUA 1QUJA 4HXVA 1M5BA 1BKAA 3N94A 1FCKA 4GX3A 4QBAA 1XC1A 2ZXTA 1TFDA 4G4PA 1D3KA 4KCDA 4NF4A 2F3BA 2E1SA 1FPEA 3F11A 3KOSA 5L9MA 4DDDA 3S9EA 3SEXA 1VFEA 1A40A 4NEDA 4PAKA 3B6TA 1IMCA 5CMBA 4N6KA 4I1DA 4BDQA 2PBWA 1LB9A 1M5DA 4FORA 3EQ1A 1LCTA 1B0LA 1ANFA 2I58A 1B40A 3O6HA 1B6HA 4XFEA 2HPGA 2OZZA 3RTFB 4LZ5A 4EXKA 4QSEA 1MPBA 4G77A 1MY0A 3FGSA 1CE2A 4XEQA 4F1VA 5DEXA 1I6BA 2Q9TA 3OD7A 1FJ9A 5HM4B 4JXIA 4BLAA 4GXSB 5I2NB 1MM6A 3CSGA 1P99A 2E0SA 1LAGE 2O1MA 1B5HA 5I5PA 3UGWA 3D1RA 3MWBA 4YB6A 1QUKA 3I5OA 1JETA 4U22A 4P1LA 2R8TA 4IO2A 1OQGA 5IZ3B 2NUVA 2CZLA 3TYHA 5JEIA 3UN6A 3QK6A 3UIFA 5BUUA 3SKPA 4DLDA 1ZKBA 3M3FA 3PPPA 1FQDA 1SI1A 2AYSA 2ZNSA 1IXGA 1KA1A 4KCCA 3O9PA 1A8FA 1OLAA 4UACA 1YAEA 2XXTA 3RT6B 3CG3A 1MXZA 4QSDA 4IR8A 3QSLA 3O97A 1WODA 1A54A 4U1ZA 1BP5A 4FEDA 4DCYA 4GWXA 4H67A 2CZIA 4Q5TA 3PUYE 4NN3A 4F22A 3FD3A 2H5YA 4OQOA 4N81A 4OVSA 3MVXA 1OVBA 2XX8A 4JSDA 3T0JA 5J16A 1B7UA 1B52A 5ITPA 3H6VA 3ISPA 1FTMA 5CI5A 3QXMA 2B4MA 3LSFB 4KYEA 3KN7A 3QUFA 4BDNA 3OXNA 1ZBMA 4RK9A 3PD8A 4PDHA 4TOZA 3ZKLA 2XXHA 1INPA 2DS9A 1BIYA 2W7YA 5CMKA 4XXUA 4OHNA 3H03A 3B6WA 2XD3A 3OMBA 1S7YA 5L8DA 4JDFA 4U2RA 4PTKA 1VR5A 4HTGA 4PETA 5KDTB 1UTBB 3D4CA 1BLFA 1TT1A 1B58A 2FBPA 3SZPA 1J1NA 5H8NA 1FSAA 1FTJA 4PF6A 4MNCA 1US5A 2VP1A 1I69A 2KQZA 1MY2A 1VE4A 4G61A 5EQAA 4RY1A 3USDA 2RINA 3CFZA 3DP6A 5A5XB 4GIZA 4UA8A 3H06B 4H5FA 2O6AA 3TFLA 3RN8A 1RDZA 3MP6A 3PPQA 1NV4A 4C0RA 1M5FA 3K6UA 2QMXA 3G3JA 5IKBA 2CMOA 2WEFA 4DI3D 1P1WA 1PC3A 3MZBA 3CG1A 2WYKA 3FZVA 1OLCA 3V89B 3IJOB 4GL0A 5A5LA 4GX6A 4PFRA 1B0HA 2HEUA 5IGAA 4RPOA 5H8HB 3V8XB 1A55A 2HFBA 3BKIB 2CZHA 2X7QA 4PFIA 4NF6B 5KCJA 1FPKA 1Y20A 3KGCA 1DSNA 1NUYA 4KD5A 5CM6A 4MNPA 4BDRA 4QRZA 3H6TA 4POWA 4GD5A 4NF5A 1GGGA 1PBQA 3V5AA 3LUYA 2F7CA 3VLWA 2PCRA 4F3BA 4OYVA 4Z7EA 2GFEA 4C1UA 3MJNA 1Z7NE 1Z7ME 1RKMA 1EZ9A 3G3HA 3ODBA 1IIWA 1LAXA 1PB7A 3LSXA 2REJA 5H8NB 1IMDA 1RDXA 1SD3A 2ANJA 4PFUA 4GWSA 2UVIA 3MZ9A 4XKQA 3C35A 3RT8A 4DZ1A 4I8CA 1O64A 3UK4A 1YTVA 3U8QA 4KPTA 4IO4A 3BBRA 2A5TB 3CVGA 1B4ZA 2P3VA 4NX1A 4FBPA 1QJMA 1R1NA 3TQWA 3G7WA 4PFYA 1A7LA 1JQFA 4ZZAA 1MPCA 4G8HA 3K6WA 1XVYA 1OMPA 4F2QA 5JTYA 3C4MA 4NHBA 3FJ7A 2P1SA 3QYTA 1R6ZA 3DP8A 2I3WA 3W9WA 3ZS6A 3HCQA 2O51A 3LV0A 3IX1A 5EHMA 2O1LA 2Z22A 4FECA 1L5TA 4EQ9A 4E0WA 3WAFA 3KEIA 4QXDA 2ONRA 4OVJA 1HSEA 2DQVA 1B05A 1NH7A 4GVOA 3RUMA 1NMUA 4LONB 5I56B 2QS1A 5CC2A 1R9LA 1B1HA 5KCJB 3MZ1A 4DI4B 3OO6A 2VT5A 1GVCA 4TLLB 3MP1A 4H65A 4O3CA 2VOZA 4FEBA 4BDOA 2D21A 5L9OA 3VXBA 4GWUA 4GWYA 3QMFA 4WKMA 1FPGA 3DP4A 5EHSA 3SDFA 2ZZXA 1MXYA 1SW2A 1D9VA 4R6HA 3UP9A 1FQAA 3TCHA 2RCAA 1YCJA 1IEJA 1DK4A 3H6UA 1A8EA 5F7VA 2XHDA 4DXUA 4I3EA 4IGTA 3N6UA 4R6YA 2XXXA 4M1VA 4HE0A 2FIXA 3E9XA 2I49A 3A3UA 3ZKKA 3KSJA 4X04A 1H3DA 2VPOA 2HZLA 4H0WA 4DXCA 1QGXA 2ZNTA 1USYE 4RYAA 1JNFA 4LZ8A 4YAHX 2L5VA 4G68C 3S4UA 4NG7A 1MS7A 4FE8A 4PBHA 4PE3A 4EQBA 3IB0A 4WEDA 3TTMA 3PTYA 5ICQA 1Y3PA 4OFJA 1MQIA 1P1UA 3FXRA 2DOJA 2V93A 4IO3A 1LFHA 3KBRA 4G8MA 3IB1A 4PCDA 5JTYB 1T0KA 1LAHE 2YJPA 4U4SA 1IUDA 3AXFA 3NOHA 3CRBA 4OA4A 3E78A 4OVRA 2OCUA 3PD9A 1IMEA 4OMBA 3QIMA 1TXFA 2QS3A 3BIHA 3H4ZA 4H5GA 4IO6A 1Q35A 2Z8DA 3IR1A 2O7IA 4XTCQ 1B3GA 4KI0E 3HO7A 4IO5A 4JVIA 2DVCA 1H76A 4PBQA 1YXIA 4MBPA 2XWKA 2F7AA 5TP9A 4NWCA 1LBBA 3E4RA 2Y7IA 3H7MA 3JYRA 4P56A 1LSTA 1LEVA 3PUZE 4N8YA 4ZS9A 5TPAA 4ISUA 4JBZA 2HAVA 1EZOA 2GHBA 2P2AA 3H6WA 4PAIA 1UTHA 1NFTA 1JP4A 2DWIA 2ZZVA 1O7TA 2QVVA 2H99A 5JK4A 2LAOA 4U21A 4F3GA 3LSLA 1FPJA 3MYUA 4YMBA 4F1UA 4G68A 2JJKA 3K1PA 3IB2A 2DWJA 4X8RA 1Y4CA 2FA7A 3O2AA 5AA2A 3N26A 2DVZA 5EQ8A 1ZIUA 2XXKA 3IK6B 5CRYA 2ZYKA 1FBCA 2PVUA 2H4IA 5H8QB 4O8MA 4YKKA 4ONYA 3MVZA 2KR0A 4RXLA 3KG2A 4FJPA 1YYZA 2OBGA 4LA9A 2NVUB 3KN8A 1NNTA 5I3SA 1H43A 4LZ7A 4HE1A 1N7XA 3FVKA 1R9QA 2YLNA 1FTOA 4L17A 2P3NA 1B9JA 4O94A 1FBGA 5FBPA 4QFKA 3QUJA 3TODA 3FVNA 3PUVE 1AMFA 3MQ9A 3Q28A 3FVGA 2OLBA 3PPOA 3TCFA 2B3FA 4N13A 5FHNA 3IOWA 5HPQA 4KR5A 3MPLA 4OFLA 5IZ1A 2AL5A 1GR2A 4NE4A 3SESA 4H45A 2PT1A 1B7HA 3EF7A 4MH5A 3IORA 1NV2A 4DCXA 1TFAA 4N4UA 4XKPA 1Y1MA 1FBFA 5H8FA 2DE4A 3CIJA 1Y4TA 3TTRA 1FQBA 3CR9A 1SBPA 1TWYA 2F78A 3C33A 4RK2A 1P1QA 5I59A 5TPAB 4NF4B 4GX4A 2DP8A 3KJ7A 4F18A 2ESNA 1MH3A 1UTHB 1UIUA 2P0SA 2XWVA 3M3LA 4X48A 3GZGA 2OX3A 4GWZA 3ILUB 4R6KA 5DYHA 1IZ1A 4KFQA 3K2DA 2F7BA 4G68B 2YPNA 4N07A 4JVDA 1DMBA 4GBVA 3PMXA 5DEXB 2F6GA 4EUOA 4LP2B 2HQ0A 1FTAA 1KZ8A 5DW8A 4ZZEA 2QSXA 3K1NA 4GL8A 2QJEA 3K0VA 1EZPA 1MM7A 3TPAA 2DWAA 3KBZA 1FBHA 3VVFA 4RJZA 2NXOA 1DTZA 4I62A 3LR1A 3PPNA 3R6UA 5CMCA 3OO8A 3FV1A 1URSA 3DLNA 5EYFA 1NV5A 4ELPA 4Q8RA 3Q27A 2Z8FA 3B7DA 4JWYA 1O63A 4RNSA 1URGA 5ET8A 1AWBA 2Q89A 2V3UA 3K02A 1D9YA 1RYOA 3G3GA 4F3PA 1LFGA 1N7WA 1B51A 4P1EA 2PMSA 3KN3A 3OOAA 4MIJA 4YU0A 2BJJX 3N5LA 5I2KA 4MCOA 2OWZA 1USYH 2AL4A 2Y7KA 2Y84A 3BIGA 2WBDA 3KC1A 3T93B 2H25A 4HCYA 4PDDA 2X7PA 3CHGA 3MAMA 4LQ2A 1K9ZA 3C31A 3O6IA 4AS5A 5KZTA 2VHAA 4ND9A 4P9KA 1XVXA 2XXUA 3V83A 1DPEA 4JSOA 3S2VA 3FIRA 1FQEA 2CEYA 1B3EA 3EPEA 2DWHA 4R2BA 1LCFA 2AIXA 4DXBA 2DXYA 1N3WA 4XIGQ 1SYIA 5AE4A 1SDXA 4YKJA 4H1XA 5AA4A 4OVQA 3K1MA 3U1OA 1IXCA 1IXHA 4P8BA 1VDWA 1SQYA 1DBZA 1D4NA 1MH4A 4N6PA 4ESXA 1IXIA 1MY1A 1ZTYA 4F3SA 3HV1A 1I6QA 4JB7A 1EYKA 4PE5B 1BK4A 1MDP1 3R7XA 3LBSA 4AS4A 3CSBA 3IJXB 1DOTA 2XXWA 4MAGA 5ELVA 4GQOA 4C1TA 2V84A 1G0IA 2V3TA 1HSLA 2R71A 1IMFA 2QL3A 3PGFA 3HN0A 2QVUA 2XXPA 4N8GA 1Y1ZA 4ZEDA 4OERA 1QUIA 2XXVA 4PFWA 2OK2A 4X1BA 4MLVA 1Y3QA 3VV5A 1PEBA 1B7ZA 1M5CA 3FXBA 1N0TA 2CZKA 2I48A 1P1OA 5IAIA 4P3LA 2R6GE 1SYHA 3E13X 4OXVA 4U4XA 4IO7A 2V4CA 3M8UA 4K3FA 1SVXB 4N6DA 3UORA 2I0CA 4OWDA 4P47A 3U92A 3LUZA 1NV6A 5ET5A 1JVYA 2HHMA 2O7UA 4LQ5A 2FNCA 3KJTA 3C9HA 3Q29A 2D3IA 4GBWA 1US4A 4WXJA 4YICA 3Q26A 2XXRA 2CEXA 3TZAA 2UVGA 4LVQA 5I57A 2ONKE 3TELA 3T96B 2REGA 4OESA 1RDYA 5DTBA 2ZNUA 4RA1A 3B50A 3E3KA 5AA4B 1NV7A 2GHAA 5I58A 2QMWA 3IO4A 4OFOA 2XX7A 2RKMA 3LSWA 1SW5A 4LN5A 4GRKA 4FAJA 3HHFA 2X26A 1SPIA 3RLFE 3VFJA 4LATA 4NF5B 4NF8A 3FXUA 1B32A 3Q25A 1AH5A 3U72A 1KA0A 1ZJLA 2HXRA 3T22A 3IAZA 3EN3A 4ECFA 1PB8A 3S9MC 3CFLA 2XD2A 3TUSA 3HFUA 2Z23A 3VVDA 3CI8A 3SEWA 1POY1 2Y5KA 3CFXA 3U93A 2KLFA 4HCWA 3U94A 4OZ9A 3RQTA 4ELOA 2WBBA 3OEKA 1URDA 3KFMA 2FIEA 5TU0A 2PFYA 3EHTA 4GOTA 3SETA 2XXYA 3BFTA 4G8NA 4O3BA 3ILTB 3SEUA 3IL1B 4AB6A 1ZLQA 4MLQA 4RPNA 1B3HA 1MY3A 2Y5LA 1VSOA 1QKBA 5I2NA 3G3FA 2UXAA 1ATGA 1LBZA 3I3VA 2QRYA 1FBEA 4PAFA 1DTGA 4U23A 2DYXA 2VD3A 4OETA 3GYYA 1DPPA 4ELRA 3KOTA 4PFTA 3FATA 2IEEA 1B46A 1PB9A 3IOTA 3S9LC 2B4LA 5DVJA 3O28A 3TTNA 3JZJA 5IZ3A 4DE8A 2XXIA 2RC7A 4H6DA 4YMAA 3TCGA 2F6PA 3DM0A 3VDFA 5EQ9A 1MXXA 1FPDA 2XXQA 4NWDA 4PF8A 4I3YA 4R9FA 4H8JA 3VXCA 4XKRA 4QFLA 4AB5A 3RTWB 4NF0A 5EYHA 3TDJA 4NMYA 4O7IA 3RPLA 4N15A 4I9DA 4GXAA 2Y7RA 4YZZA 1N04A 1ZMGA 2O69A 2RC9A 4NF8B 2ONSA 3IFCA 3MPKA 3IFAA 5L9SA 3P7IA 1FPBA 2DE2A 3SERA 3HSTA 1SI0A 2VD2A 2ZZWA 5K2XA 4TLMB 2XWOA 1MXWA 2UYEA 1NNKA 3D4GA 4PGNA 1NUZA 3U65A 3RYDA 4P0IA 1B4HA 4ZEIA 4GFRA 3OEMA 1ELJA 1MXUA 1MG1A 2B3BA 2XX9A 1IMBA 1A99A 1EYJA 1MY4A 3BFUA 2Q8JA 3WAEA 4IY6A 4ZE8A 4UABA 2ZYOA 1MQJA 1MRPA 4F1YA 3VLUA 2UVHA 1QKAA 1SW4A 2RC8A 4HW8A 3RNNA 4EXLA 3MP8A 3O66A 5FTHA 4FATA 2IA4A 1JW1A 2Z8EA 2MKZA 1MQDA 3GLBA 3FJGA 4X1DA 2NOOA 3MC2A 2DXRA 3RGYA 2O68A 3GXAA 1UTBA 5KDTA 1MPDA 5AA3A 4F39A 5FHOA 4R73A 2NWJA 1FBPA 2B65A 3A29A 4PQJA 1IMAA 3G3IA 1LFIA 4ZE9A 3KZGA 1MDQA 3O6GA 4AQ4A 4ELQA 4PFBA 3GBBA 2PYYA 2Q2CA 3MSTA 3PUXE 4X9TA 2QVRA 4MMPA 1NI9A 2ALUA 3FXQA 3OO9A 1F9BA 2Y7WA 4KHZE 5DVFA 5TP9B 3W9VA 3A3CA 5A5XA 2DE3A 4JWXA 3RPLB 2I3VA 2V25A 3FUZA 1Q1KA 1Y9UA 2F35A 3KSXA 2PT2A 3FJMA 4P11A 3T1BA 5T3JA 5ESYA 3B8BA 3K00A 3T9UA 2HAUA 1WVJA 3MBPA 4ZDMA 3TTKA 2F3DA 2O84X 3MVYA 3SEVA 5ET7A 2R9JA 2A5SA 2WX9A 2VGQA 3LC8A 4LUBA 5H8HA 3T9XB 1JW5A 4OENA 2FHYA 3PU5A 5DVIA 5AA2D 4TQUQ 1POTA 3L6GA 4NF6A 2DDKA 1M5EA 2HCAA 5I84A 1FTLA 4KYSA 3EHSA 2ZYMA 5AA2B 2F97A 4GWWA 5F24A 5M2VA 1EH3A 2UVJA 3DELB 1AOVA 4MF3A 5ISUA 1FJ6A 3RY3A 2RF1A 1MQGA 1S50A 4PGPA 4ZEFA 4F19A 5LDZA 3K6VA 1QULA 3PMVA 1NKXA 1Q9DA 1DCUA 3PPRA 1K9YA 5ICTA 1PDAA 3A09A 3VE1B 4QFNA 3OSRA 3K01A 2WKYA 4G2ZA 2M8CA 3K4UA 1NV3A 3OSQA 3FVOA 1NV0A 4QF9A 1XT8A 1EU8A 3C36A 4NAPA 3IO6A 2XWIA 1LBVA 1EYIA 4ZEKA 2F8DA 4R2FA 3M3KA 1OVTA 1Y3NA 1S9TA 1KWHA 3HPIA 3T9VA 5LOMA 5J1DA 1B3LA 2A5TA 4HS7A 1LGBC 5H8FB 3OO7A 5IZZA 3ROJA 5B7DA 3B6QA 3TTLA 4H8IA 1WDNA 1N84A 2OWTA 3KC0A 2OWSA 1LBXA 2GH9A 4N91A 5I59B 4U1OA 1MXVA 2G93A 3O29A 3PMWA 4GF8A 3ZSFA 4YB7A 4OEUA 3K6XA 3UA8A 1XOCA 5EYGA 4KYDA 2WYPA 4ZEBA 3IOVA 1UQWA 1RYXA 4R75A 5HBCA 1CNQA 4QSCA 2ABHA 3I6VA 1XS5A 3ECRA 1N3XA 2I6EA 4EQ7A 3HHGA 1YPNA 4JVCA 1UIVA 1AL3A 3FASA 1NV1A 5I56A 2RCBA 4GLIA 1XHYA 2Y7PA 3TMGA 4R9GA 5CMMA 3TKDA 3PUWE 4QHQA 1JEVA 4PP0A 1B5JA 5CBRA 5AA1A 3T9HB 4I40A 4OVTA 4THIA 4WEPA 2Q2AA 1G0HA 2I4BA 4MHFA 1VFDA 4QFPA 2V3QA 5IM2A 2I0BA 4POXA 4MFIA 3T66A 5B70A 2F34A 3QAXA 1NUWA 4XF5A 4OVPA 1NH8A 2HXWA 3W15C 1BTJA 1OIBA 3VVEA 4JWOA 5I2KB 1II5A 3E79A 3GBAA 5EQ7A 3G3KA 3R26A 3RPWA 5FHMA 2ZMBA 2OJTA 5K2YA 4NTLA 4KXPA 4DIGA 1PBPA 1JW4A 2QS4A 5CBSA 1B3FA 2QFLA 3C32A 1D9QA 4OTEA 2GRVA 4KQPA 4YKPA 1LLSA 2Q74A 2Q8MA 2ZYNA 2QPQA 3TQLA 4IGRA 4FIMA 1LBWA 4EDPA 4BDLA 5BWJA 1I6AA 1AIVA 4R72A 1LAFE 3FV2A 4N17A 4ESWA
chains in the Genus database with same CATH topology
1B2HA 5DT6A 3MVWA 3TEPA 4IB2A 4Q0CA 3EHUA 1NL5A 2H98A 3VLVA 3ONMA 3IOUA 1B5IA 1FQCA 1H44A 3THIA 4QFOA 3SEYA 1NNFA 4BDMA 1FQFA 3MUQA 1LBCA 3OENA 4ZECA 4P0GA 1HSJA 1B1XA 4F31B 4IY5A 2FYIA 3L6HA 2PX1A 2DSFA 3TAJA 2H9BA 2F5XA 1N76A 2F36A 2D5WA 1GTKA 4Z0IA 1MQHA 3S9NC 1GV8A 4YKIA 3MW0A 1QVSA 2HZKA 3C34A 1H45A 1FTKA 4E0XA 2G29A 4EF2A 2THIA 3OELA 1CB6A 2I4CA 2QS2A 5F1QA 4M4GA 4Q30B 1NNPA 5H8QA 5FTIA 4XKNA 4EF1A 1SW1A 1JVXA 1FW0A 1IITA 4YB5A 5I57B 4O3AA 2Q88A 3PV0E 1ZU0A 5ITOA 4R74A 2UYFA 3H3GA 4GWOA 1QW0A 5I58B 4F29A 5H8SA 1LB8A 1IQ7A 3JV9A 1OQHA 4OEVA 4F2OA 1P1NA 3N6TA 1JEUA 1QUJA 1M5BA 1BKAA 3N94A 1FCKA 1XC1A 2ZXTA 1TFDA 4G4PA 1D3KA 4KCDA 4NF4A 2E1SA 3F11A 3KOSA 5L9MA 4DDDA 3S9EA 3SEXA 1VFEA 1A40A 4NEDA 3B6TA 5CMBA 4I1DA 4BDQA 2PBWA 1LB9A 1M5DA 4FORA 3EQ1A 1LCTA 1B0LA 1ANFA 2I58A 1B40A 3O6HA 1B6HA 2OZZA 3RTFB 4LZ5A 4EXKA 4QSEA 1MPBA 4G77A 1MY0A 3FGSA 1CE2A 4F1VA 5DEXA 1I6BA 2Q9TA 3OD7A 5HM4B 4JXIA 4BLAA 4GXSB 5I2NB 1MM6A 3CSGA 1P99A 2E0SA 1LAGE 2O1MA 1B5HA 3UGWA 3MWBA 4YB6A 1QUKA 3I5OA 1JETA 4U22A 4IO2A 1OQGA 2NUVA 2CZLA 3TYHA 5JEIA 3UN6A 3QK6A 3UIFA 5BUUA 3SKPA 4DLDA 1ZKBA 3M3FA 3PPPA 1FQDA 1SI1A 2AYSA 2ZNSA 1IXGA 4KCCA 3O9PA 1A8FA 1OLAA 4UACA 1YAEA 2XXTA 3RT6B 3CG3A 1MXZA 4QSDA 3QSLA 3O97A 1WODA 1A54A 4U1ZA 1BP5A 4FEDA 4DCYA 4H67A 4Q5TA 3PUYE 4F22A 3FD3A 2H5YA 4OQOA 3MVXA 1OVBA 2XX8A 4JSDA 1B7UA 1B52A 5ITPA 3H6VA 1FTMA 5CI5A 3QXMA 3LSFB 4KYEA 3KN7A 3QUFA 4BDNA 3OXNA 1ZBMA 4RK9A 3PD8A 4TOZA 3ZKLA 2XXHA 2DS9A 1BIYA 2W7YA 5CMKA 4XXUA 4OHNA 3H03A 3B6WA 2XD3A 3OMBA 1S7YA 5L8DA 4JDFA 4U2RA 1VR5A 4HTGA 4PETA 5KDTB 1UTBB 3D4CA 1BLFA 1TT1A 1B58A 1J1NA 5H8NA 1FTJA 1US5A 2VP1A 1I69A 1MY2A 1VE4A 4RY1A 3USDA 2RINA 3CFZA 3DP6A 5A5XB 4GIZA 4UA8A 3H06B 4H5FA 2O6AA 3TFLA 3RN8A 3MP6A 3PPQA 4C0RA 1M5FA 3K6UA 2QMXA 3G3JA 5IKBA 2CMOA 1P1WA 1PC3A 3MZBA 3CG1A 3FZVA 1OLCA 3V89B 3IJOB 4GL0A 1B0HA 2HEUA 4RPOA 5H8HB 3V8XB 1A55A 2HFBA 3BKIB 2X7QA 4NF6B 5KCJA 1Y20A 3KGCA 1DSNA 4KD5A 5CM6A 4BDRA 4QRZA 3H6TA 4POWA 4GD5A 4NF5A 1GGGA 1PBQA 3V5AA 3LUYA 2F7CA 3VLWA 4F3BA 4OYVA 4Z7EA 2GFEA 4C1UA 3MJNA 1Z7NE 1Z7ME 1RKMA 1EZ9A 3G3HA 3ODBA 1IIWA 1LAXA 1PB7A 3LSXA 2REJA 5H8NB 1SD3A 2ANJA 4PFUA 2UVIA 3MZ9A 4XKQA 3C35A 3RT8A 4DZ1A 4I8CA 1O64A 3UK4A 1YTVA 3U8QA 4KPTA 4IO4A 3BBRA 2A5TB 3CVGA 1B4ZA 1QJMA 1R1NA 3TQWA 3G7WA 4PFYA 1A7LA 1JQFA 4ZZAA 1MPCA 4G8HA 3K6WA 1XVYA 1OMPA 4F2QA 5JTYA 3C4MA 3FJ7A 2P1SA 3QYTA 1R6ZA 3DP8A 2I3WA 3W9WA 3ZS6A 3HCQA 2O51A 3IX1A 5EHMA 2O1LA 2Z22A 4FECA 1L5TA 4EQ9A 4E0WA 3WAFA 3KEIA 2ONRA 4OVJA 1HSEA 2DQVA 1B05A 1NH7A 4GVOA 3RUMA 1NMUA 4LONB 5I56B 2QS1A 5CC2A 1R9LA 1B1HA 5KCJB 3MZ1A 3OO6A 1GVCA 4TLLB 3MP1A 4H65A 4O3CA 2VOZA 4FEBA 4BDOA 2D21A 5L9OA 3VXBA 4WKMA 3DP4A 5EHSA 3SDFA 1MXYA 1SW2A 1D9VA 4R6HA 3UP9A 1FQAA 3TCHA 2RCAA 1YCJA 1IEJA 3H6UA 1A8EA 5F7VA 2XHDA 4DXUA 4IGTA 3N6UA 4R6YA 2XXXA 4M1VA 3E9XA 2I49A 3A3UA 3ZKKA 3KSJA 1H3DA 2HZLA 4H0WA 4DXCA 2ZNTA 1USYE 4RYAA 1JNFA 4LZ8A 4YAHX 4G68C 3S4UA 1MS7A 4FE8A 4EQBA 3IB0A 4WEDA 3TTMA 5ICQA 1Y3PA 4OFJA 1MQIA 1P1UA 3FXRA 2DOJA 2V93A 4IO3A 1LFHA 3KBRA 4G8MA 3IB1A 5JTYB 1T0KA 1LAHE 2YJPA 4U4SA 1IUDA 3AXFA 3CRBA 2OCUA 3PD9A 4OMBA 3QIMA 1TXFA 2QS3A 3H4ZA 4H5GA 4IO6A 1Q35A 2Z8DA 3IR1A 2O7IA 4XTCQ 1B3GA 4KI0E 3HO7A 4IO5A 2DVCA 1H76A 4MBPA 2F7AA 5TP9A 4NWCA 1LBBA 3E4RA 2Y7IA 3H7MA 3JYRA 1LSTA 3PUZE 4ZS9A 5TPAA 4ISUA 4JBZA 2HAVA 1EZOA 2GHBA 2P2AA 3H6WA 1UTHA 1NFTA 2DWIA 1O7TA 2H99A 5JK4A 2LAOA 4U21A 4F3GA 3LSLA 4YMBA 4F1UA 4G68A 3K1PA 3IB2A 2DWJA 1Y4CA 2FA7A 3O2AA 5AA2A 3N26A 2DVZA 1ZIUA 3IK6B 5CRYA 2ZYKA 2PVUA 2H4IA 5H8QB 4YKKA 4ONYA 3MVZA 4RXLA 3KG2A 4FJPA 2OBGA 4LA9A 2NVUB 3KN8A 1NNTA 1H43A 4LZ7A 1N7XA 3FVKA 1R9QA 2YLNA 1FTOA 4L17A 1B9JA 4QFKA 3QUJA 3TODA 3FVNA 3PUVE 1AMFA 3MQ9A 3Q28A 3FVGA 2OLBA 3PPOA 3TCFA 2B3FA 4N13A 5FHNA 3IOWA 5HPQA 4KR5A 3MPLA 4OFLA 2AL5A 1GR2A 4NE4A 3SESA 2PT1A 1B7HA 3EF7A 4MH5A 3IORA 4DCXA 1TFAA 4XKPA 1Y1MA 5H8FA 2DE4A 3CIJA 1Y4TA 3TTRA 1FQBA 3CR9A 1SBPA 1TWYA 2F78A 3C33A 4RK2A 1P1QA 5I59A 5TPAB 4NF4B 2DP8A 3KJ7A 4F18A 2ESNA 1MH3A 1UTHB 1UIUA 2P0SA 3M3LA 4X48A 3GZGA 3ILUB 4R6KA 5DYHA 1IZ1A 4KFQA 3K2DA 2F7BA 4G68B 2YPNA 4N07A 1DMBA 3PMXA 5DEXB 2F6GA 4EUOA 4LP2B 2HQ0A 4ZZEA 2QSXA 3K1NA 4GL8A 2QJEA 3K0VA 1EZPA 1MM7A 3TPAA 2DWAA 3VVFA 4RJZA 2NXOA 1DTZA 4I62A 3LR1A 3PPNA 3R6UA 5CMCA 3OO8A 3FV1A 1URSA 3DLNA 5EYFA 4ELPA 4Q8RA 3Q27A 2Z8FA 3B7DA 4JWYA 1O63A 4RNSA 1URGA 2Q89A 2V3UA 3K02A 1D9YA 1RYOA 3G3GA 4F3PA 1LFGA 1N7WA 1B51A 2PMSA 3KN3A 3OOAA 4YU0A 2BJJX 3N5LA 5I2KA 1USYH 2AL4A 2Y7KA 2Y84A 3T93B 2H25A 4HCYA 2X7PA 3MAMA 4LQ2A 3C31A 3O6IA 5KZTA 2VHAA 4ND9A 1XVXA 2XXUA 3V83A 1DPEA 4JSOA 3S2VA 3FIRA 1FQEA 1B3EA 3EPEA 2DWHA 4R2BA 4DXBA 1LCFA 2AIXA 2DXYA 1N3WA 4XIGQ 1SYIA 5AE4A 1SDXA 4YKJA 4H1XA 5AA4A 3K1MA 3U1OA 1IXCA 1IXHA 1SQYA 1D4NA 1MH4A 4N6PA 4ESXA 1IXIA 1MY1A 1ZTYA 4F3SA 3HV1A 1I6QA 4JB7A 4PE5B 1MDP1 3R7XA 3LBSA 3CSBA 3IJXB 1DOTA 2XXWA 5ELVA 4GQOA 4C1TA 2V84A 2V3TA 1HSLA 2R71A 2QL3A 3PGFA 3HN0A 2XXPA 1Y1ZA 4ZEDA 4OERA 1QUIA 2XXVA 4PFWA 2OK2A 4X1BA 4MLVA 1Y3QA 3VV5A 1PEBA 1B7ZA 1M5CA 1N0TA 2I48A 1P1OA 5IAIA 2R6GE 1SYHA 3E13X 4OXVA 4U4XA 4IO7A 3M8UA 4K3FA 1SVXB 3UORA 2I0CA 4OWDA 3U92A 1JVYA 2O7UA 4LQ5A 2FNCA 3KJTA 3C9HA 3Q29A 2D3IA 1US4A 4WXJA 4YICA 3Q26A 2XXRA 3TZAA 2UVGA 4LVQA 5I57A 2ONKE 3TELA 3T96B 2REGA 4OESA 5DTBA 2ZNUA 4RA1A 3E3KA 5AA4B 2GHAA 5I58A 2QMWA 3IO4A 4OFOA 2XX7A 2RKMA 3LSWA 1SW5A 4GRKA 4FAJA 3HHFA 2X26A 3RLFE 3VFJA 4LATA 4NF5B 4NF8A 3FXUA 1B32A 3Q25A 1AH5A 3U72A 1ZJLA 3T22A 3IAZA 3EN3A 4ECFA 1PB8A 3S9MC 3CFLA 2XD2A 3TUSA 2Z23A 3VVDA 3CI8A 3SEWA 1POY1 3CFXA 3U93A 2KLFA 4HCWA 3U94A 4OZ9A 3RQTA 4ELOA 3OEKA 1URDA 3KFMA 5TU0A 3EHTA 4GOTA 3SETA 2XXYA 3BFTA 4G8NA 4O3BA 3ILTB 3SEUA 3IL1B 4AB6A 1ZLQA 4MLQA 4RPNA 1B3HA 1MY3A 1VSOA 1QKBA 5I2NA 3G3FA 2UXAA 1ATGA 3I3VA 2QRYA 1DTGA 4U23A 2DYXA 2VD3A 4OETA 1DPPA 4ELRA 3KOTA 4PFTA 3FATA 2IEEA 1B46A 1PB9A 3IOTA 3S9LC 5DVJA 3O28A 3TTNA 3JZJA 4DE8A 2XXIA 2RC7A 4H6DA 4YMAA 3TCGA 2F6PA 3DM0A 3VDFA 1MXXA 2XXQA 4NWDA 4R9FA 4H8JA 3VXCA 4XKRA 4QFLA 4AB5A 3RTWB 3TDJA 4NMYA 4I9DA 4GXAA 2Y7RA 4YZZA 1N04A 1ZMGA 2O69A 2RC9A 4NF8B 2ONSA 3MPKA 5L9SA 3P7IA 2DE2A 3SERA 3HSTA 1SI0A 2VD2A 5K2XA 4TLMB 1MXWA 2UYEA 1NNKA 3D4GA 4P0IA 1B4HA 4ZEIA 4GFRA 3OEMA 1ELJA 1MXUA 1MG1A 2B3BA 2XX9A 1A99A 1MY4A 3BFUA 2Q8JA 3WAEA 4IY6A 4ZE8A 2ZYOA 1MQJA 1MRPA 4F1YA 3VLUA 2UVHA 1QKAA 1SW4A 2RC8A 4HW8A 3RNNA 4EXLA 3MP8A 3O66A 5FTHA 4FATA 2IA4A 1JW1A 2Z8EA 1MQDA 3GLBA 3FJGA 4X1DA 2NOOA 3MC2A 2DXRA 3RGYA 2O68A 3GXAA 1UTBA 5KDTA 1MPDA 5AA3A 4F39A 5FHOA 4R73A 2NWJA 2B65A 4PQJA 3G3IA 1LFIA 4ZE9A 3KZGA 1MDQA 3O6GA 4AQ4A 4ELQA 3GBBA 2PYYA 2Q2CA 3PUXE 4X9TA 2ALUA 3FXQA 3OO9A 1F9BA 2Y7WA 4KHZE 5DVFA 5TP9B 3W9VA 3A3CA 5A5XA 2DE3A 4JWXA 2I3VA 2V25A 3FUZA 1Q1KA 1Y9UA 2F35A 3KSXA 2PT2A 3FJMA 4P11A 3K00A 3T9UA 2HAUA 1WVJA 3MBPA 4ZDMA 3TTKA 2O84X 3MVYA 3SEVA 2R9JA 2A5SA 2VGQA 3LC8A 4LUBA 5H8HA 3T9XB 1JW5A 4OENA 3PU5A 5DVIA 5AA2D 4TQUQ 1POTA 3L6GA 4NF6A 1M5EA 2HCAA 5I84A 1FTLA 4KYSA 3EHSA 2ZYMA 5AA2B 2F97A 5M2VA 1EH3A 2UVJA 3DELB 1AOVA 4MF3A 5ISUA 3RY3A 2RF1A 1MQGA 1S50A 4ZEFA 4F19A 3K6VA 1QULA 3PMVA 1NKXA 3PPRA 5ICTA 1PDAA 3A09A 3VE1B 4QFNA 3OSRA 3K01A 2WKYA 4G2ZA 2M8CA 3K4UA 3OSQA 3FVOA 4QF9A 1XT8A 1EU8A 3C36A 3IO6A 4ZEKA 2F8DA 4R2FA 3M3KA 1OVTA 1Y3NA 1S9TA 1KWHA 3HPIA 3T9VA 5LOMA 5J1DA 1B3LA 2A5TA 4HS7A 1LGBC 5H8FB 3OO7A 5B7DA 3B6QA 3TTLA 4H8IA 1WDNA 1N84A 2OWTA 2OWSA 2GH9A 5I59B 4U1OA 1MXVA 2G93A 3O29A 3PMWA 4GF8A 3ZSFA 4YB7A 4OEUA 3K6XA 3UA8A 1XOCA 4KYDA 4ZEBA 3IOVA 1UQWA 1RYXA 4R75A 5HBCA 4QSCA 2ABHA 3I6VA 1XS5A 3ECRA 1N3XA 2I6EA 4EQ7A 3HHGA 1YPNA 1UIVA 1AL3A 3FASA 5I56A 2RCBA 4GLIA 1XHYA 2Y7PA 3TMGA 4R9GA 5CMMA 3TKDA 3PUWE 4QHQA 1JEVA 4PP0A 1B5JA 5CBRA 5AA1A 3T9HB 4THIA 4WEPA 2Q2AA 2I4BA 1VFDA 4QFPA 2V3QA 2I0BA 4POXA 4MFIA 3T66A 5B70A 2F34A 3QAXA 1NH8A 2HXWA 3W15C 1BTJA 1OIBA 3VVEA 4JWOA 5I2KB 1II5A 3GBAA 3G3KA 3R26A 3RPWA 5FHMA 2ZMBA 2OJTA 5K2YA 4NTLA 4DIGA 1PBPA 1JW4A 2QS4A 5CBSA 1B3FA 3C32A 4OTEA 2GRVA 4KQPA 4YKPA 1LLSA 2ZYNA 2QPQA 3TQLA 4IGRA 4FIMA 4EDPA 4BDLA 5BWJA 1I6AA 1AIVA 4R72A 1LAFE 3FV2A 4ESWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2H A;  5DT6 A;  3MVW A;  3TEP A;  4IB2 A;  4Q0C A;  3EHU A;  1NL5 A;  2H98 A;  3VLV A;  3ONM A;  3IOU A;  1B5I A;  1FQC A;  1H44 A;  3THI A;  4QFO A;  3SEY A;  1NNF A;  4BDM A;  1FQF A;  3MUQ A;  1LBC A;  3OEN A;  4ZEC A;  4P0G A;  1HSJ A;  1B1X A;  4F31 B;  4IY5 A;  2FYI A;  3L6H A;  2PX1 A;  2DSF A;  3TAJ A;  2H9B A;  2F5X A;  1N76 A;  2F36 A;  2D5W A;  1GTK A;  4Z0I A;  1MQH A;  3S9N C;  1GV8 A;  4YKI A;  3MW0 A;  1QVS A;  2HZK A;  3C34 A;  1H45 A;  1FTK A;  4E0X A;  2G29 A;  4EF2 A;  2THI A;  3OEL A;  1CB6 A;  2I4C A;  2QS2 A;  5F1Q A;  4M4G A;  4Q30 B;  1NNP A;  5H8Q A;  5FTI A;  4XKN A;  4EF1 A;  1SW1 A;  1JVX A;  1FW0 A;  1IIT A;  4YB5 A;  5I57 B;  4O3A A;  2Q88 A;  3PV0 E;  1ZU0 A;  5ITO A;  4R74 A;  2UYF A;  3H3G A;  4GWO A;  1QW0 A;  5I58 B;  4F29 A;  5H8S A;  1LB8 A;  1IQ7 A;  3JV9 A;  1OQH A;  4OEV A;  4F2O A;  1P1N A;  3N6T A;  1JEU A;  1QUJ A;  1M5B A;  1BKA A;  3N94 A;  1FCK A;  1XC1 A;  2ZXT A;  1TFD A;  4G4P A;  1D3K A;  4KCD A;  4NF4 A;  2E1S A;  3F11 A;  3KOS A;  5L9M A;  4DDD A;  3S9E A;  3SEX A;  1VFE A;  1A40 A;  4NED A;  3B6T A;  5CMB A;  4I1D A;  4BDQ A;  2PBW A;  1LB9 A;  1M5D A;  4FOR A;  3EQ1 A;  1LCT A;  1B0L A;  1ANF A;  2I58 A;  1B40 A;  3O6H A;  1B6H A;  2OZZ A;  3RTF B;  4LZ5 A;  4EXK A;  4QSE A;  1MPB A;  4G77 A;  1MY0 A;  3FGS A;  1CE2 A;  4F1V A;  5DEX A;  1I6B A;  2Q9T A;  3OD7 A;  5HM4 B;  4JXI A;  4BLA A;  4GXS B;  5I2N B;  1MM6 A;  3CSG A;  1P99 A;  2E0S A;  1LAG E;  2O1M A;  1B5H A;  3UGW A;  3MWB A;  4YB6 A;  1QUK A;  3I5O A;  1JET A;  4U22 A;  4IO2 A;  1OQG A;  2NUV A;  2CZL A;  3TYH A;  5JEI A;  3UN6 A;  3QK6 A;  3UIF A;  5BUU A;  3SKP A;  4DLD A;  1ZKB A;  3M3F A;  3PPP A;  1FQD A;  1SI1 A;  2AYS A;  2ZNS A;  1IXG A;  4KCC A;  3O9P A;  1A8F A;  1OLA A;  4UAC A;  1YAE A;  2XXT A;  3RT6 B;  3CG3 A;  1MXZ A;  4QSD A;  3QSL A;  3O97 A;  1WOD A;  1A54 A;  4U1Z A;  1BP5 A;  4FED A;  4DCY A;  4H67 A;  4Q5T A;  3PUY E;  4F22 A;  3FD3 A;  2H5Y A;  4OQO A;  3MVX A;  1OVB A;  2XX8 A;  4JSD A;  1B7U A;  1B52 A;  5ITP A;  3H6V A;  1FTM A;  5CI5 A;  3QXM A;  3LSF B;  4KYE A;  3KN7 A;  3QUF A;  4BDN A;  3OXN A;  1ZBM A;  4RK9 A;  3PD8 A;  4TOZ A;  3ZKL A;  2XXH A;  2DS9 A;  1BIY A;  2W7Y A;  5CMK A;  4XXU A;  4OHN A;  3H03 A;  3B6W A;  2XD3 A;  3OMB A;  1S7Y A;  5L8D A;  4JDF A;  4U2R A;  1VR5 A;  4HTG A;  4PET A;  5KDT B;  1UTB B;  3D4C A;  1BLF A;  1TT1 A;  1B58 A;  1J1N A;  5H8N A;  1FTJ A;  1US5 A;  2VP1 A;  1I69 A;  1MY2 A;  1VE4 A;  4RY1 A;  3USD A;  2RIN A;  3CFZ A;  3DP6 A;  5A5X B;  4GIZ A;  4UA8 A;  3H06 B;  4H5F A;  2O6A A;  3TFL A;  3RN8 A;  3MP6 A;  3PPQ A;  4C0R A;  1M5F A;  3K6U A;  2QMX A;  3G3J A;  5IKB A;  2CMO A;  1P1W A;  1PC3 A;  3MZB A;  3CG1 A;  3FZV A;  1OLC A;  3V89 B;  3IJO B;  4GL0 A;  1B0H A;  2HEU A;  4RPO A;  5H8H B;  3V8X B;  1A55 A;  2HFB A;  3BKI B;  2X7Q A;  4NF6 B;  5KCJ A;  1Y20 A;  3KGC A;  1DSN A;  4KD5 A;  5CM6 A;  4BDR A;  4QRZ A;  3H6T A;  4POW A;  4GD5 A;  4NF5 A;  1GGG A;  1PBQ A;  3V5A A;  3LUY A;  2F7C A;  3VLW A;  4F3B A;  4OYV A;  4Z7E A;  2GFE A;  4C1U A;  3MJN A;  1Z7N E;  1Z7M E;  1RKM A;  1EZ9 A;  3G3H A;  3ODB A;  1IIW A;  1LAX A;  1PB7 A;  3LSX A;  2REJ A;  5H8N B;  1SD3 A;  2ANJ A;  4PFU A;  2UVI A;  3MZ9 A;  4XKQ A;  3C35 A;  3RT8 A;  4DZ1 A;  4I8C A;  1O64 A;  3UK4 A;  1YTV A;  3U8Q A;  4KPT A;  4IO4 A;  3BBR A;  2A5T B;  3CVG A;  1B4Z A;  1QJM A;  1R1N A;  3TQW A;  3G7W A;  4PFY A;  1A7L A;  1JQF A;  4ZZA A;  1MPC A;  4G8H A;  3K6W A;  1XVY A;  1OMP A;  4F2Q A;  5JTY A;  3C4M A;  3FJ7 A;  2P1S A;  3QYT A;  1R6Z A;  3DP8 A;  2I3W A;  3W9W A;  3ZS6 A;  3HCQ A;  2O51 A;  3IX1 A;  5EHM A;  2O1L A;  2Z22 A;  4FEC A;  1L5T A;  4EQ9 A;  4E0W A;  3WAF A;  3KEI A;  2ONR A;  4OVJ A;  1HSE A;  2DQV A;  1B05 A;  1NH7 A;  4GVO A;  3RUM A;  1NMU A;  4LON B;  5I56 B;  2QS1 A;  5CC2 A;  1R9L A;  1B1H A;  5KCJ B;  3MZ1 A;  3OO6 A;  1GVC A;  4TLL B;  3MP1 A;  4H65 A;  4O3C A;  2VOZ A;  4FEB A;  4BDO A;  2D21 A;  5L9O A;  3VXB A;  4WKM A;  3DP4 A;  5EHS A;  3SDF A;  1MXY A;  1SW2 A;  1D9V A;  4R6H A;  3UP9 A;  1FQA A;  3TCH A;  2RCA A;  1YCJ A;  1IEJ A;  3H6U A;  1A8E A;  5F7V A;  2XHD A;  4DXU A;  4IGT A;  3N6U A;  4R6Y A;  2XXX A;  4M1V A;  3E9X A;  2I49 A;  3A3U A;  3ZKK A;  3KSJ A;  1H3D A;  2HZL A;  4H0W A;  4DXC A;  2ZNT A;  1USY E;  4RYA A;  1JNF A;  4LZ8 A;  4YAH X;  4G68 C;  3S4U A;  1MS7 A;  4FE8 A;  4EQB A;  3IB0 A;  4WED A;  3TTM A;  5ICQ A;  1Y3P A;  4OFJ A;  1MQI A;  1P1U A;  3FXR A;  2DOJ A;  2V93 A;  4IO3 A;  1LFH A;  3KBR A;  4G8M A;  3IB1 A;  5JTY B;  1T0K A;  1LAH E;  2YJP A;  4U4S A;  1IUD A;  3AXF A;  3CRB A;  2OCU A;  3PD9 A;  4OMB A;  3QIM A;  1TXF A;  2QS3 A;  3H4Z A;  4H5G A;  4IO6 A;  1Q35 A;  2Z8D A;  3IR1 A;  2O7I A;  4XTC Q;  1B3G A;  4KI0 E;  3HO7 A;  4IO5 A;  2DVC A;  1H76 A;  4MBP A;  2F7A A;  5TP9 A;  4NWC A;  1LBB A;  3E4R A;  2Y7I A;  3H7M A;  3JYR A;  1LST A;  3PUZ E;  4ZS9 A;  5TPA A;  4ISU A;  4JBZ A;  2HAV A;  1EZO A;  2GHB A;  2P2A A;  3H6W A;  1UTH A;  1NFT A;  2DWI A;  1O7T A;  2H99 A;  5JK4 A;  2LAO A;  4U21 A;  4F3G A;  3LSL A;  4YMB A;  4F1U A;  4G68 A;  3K1P A;  3IB2 A;  2DWJ A;  1Y4C A;  2FA7 A;  3O2A A;  5AA2 A;  3N26 A;  2DVZ A;  1ZIU A;  3IK6 B;  5CRY A;  2ZYK A;  2PVU A;  2H4I A;  5H8Q B;  4YKK A;  4ONY A;  3MVZ A;  4RXL A;  3KG2 A;  4FJP A;  2OBG A;  4LA9 A;  2NVU B;  3KN8 A;  1NNT A;  1H43 A;  4LZ7 A;  1N7X A;  3FVK A;  1R9Q A;  2YLN A;  1FTO A;  4L17 A;  1B9J A;  4QFK A;  3QUJ A;  3TOD A;  3FVN A;  3PUV E;  1AMF A;  3MQ9 A;  3Q28 A;  3FVG A;  2OLB A;  3PPO A;  3TCF A;  2B3F A;  4N13 A;  5FHN A;  3IOW A;  5HPQ A;  4KR5 A;  3MPL A;  4OFL A;  2AL5 A;  1GR2 A;  4NE4 A;  3SES A;  2PT1 A;  1B7H A;  3EF7 A;  4MH5 A;  3IOR A;  4DCX A;  1TFA A;  4XKP A;  1Y1M A;  5H8F A;  2DE4 A;  3CIJ A;  1Y4T A;  3TTR A;  1FQB A;  3CR9 A;  1SBP A;  1TWY A;  2F78 A;  3C33 A;  4RK2 A;  1P1Q A;  5I59 A;  5TPA B;  4NF4 B;  2DP8 A;  3KJ7 A;  4F18 A;  2ESN A;  1MH3 A;  1UTH B;  1UIU A;  2P0S A;  3M3L A;  4X48 A;  3GZG A;  3ILU B;  4R6K A;  5DYH A;  1IZ1 A;  4KFQ A;  3K2D A;  2F7B A;  4G68 B;  2YPN A;  4N07 A;  1DMB A;  3PMX A;  5DEX B;  2F6G A;  4EUO A;  4LP2 B;  2HQ0 A;  4ZZE A;  2QSX A;  3K1N A;  4GL8 A;  2QJE A;  3K0V A;  1EZP A;  1MM7 A;  3TPA A;  2DWA A;  3VVF A;  4RJZ A;  2NXO A;  1DTZ A;  4I62 A;  3LR1 A;  3PPN A;  3R6U A;  5CMC A;  3OO8 A;  3FV1 A;  1URS A;  3DLN A;  5EYF A;  4ELP A;  4Q8R A;  3Q27 A;  2Z8F A;  3B7D A;  4JWY A;  1O63 A;  4RNS A;  1URG A;  2Q89 A;  2V3U A;  3K02 A;  1D9Y A;  1RYO A;  3G3G A;  4F3P A;  1LFG A;  1N7W A;  1B51 A;  2PMS A;  3KN3 A;  3OOA A;  4YU0 A;  2BJJ X;  3N5L A;  5I2K A;  1USY H;  2AL4 A;  2Y7K A;  2Y84 A;  3T93 B;  2H25 A;  4HCY A;  2X7P A;  3MAM A;  4LQ2 A;  3C31 A;  3O6I A;  5KZT A;  2VHA A;  4ND9 A;  1XVX A;  2XXU A;  3V83 A;  1DPE A;  4JSO A;  3S2V A;  3FIR A;  1FQE A;  1B3E A;  3EPE A;  2DWH A;  4R2B A;  4DXB A;  1LCF A;  2AIX A;  2DXY A;  1N3W A;  4XIG Q;  1SYI A;  5AE4 A;  1SDX A;  4YKJ A;  4H1X A;  5AA4 A;  3K1M A;  3U1O A;  1IXC A;  1IXH A;  1SQY A;  1D4N A;  1MH4 A;  4N6P A;  4ESX A;  1IXI A;  1MY1 A;  1ZTY A;  4F3S A;  3HV1 A;  1I6Q A;  4JB7 A;  4PE5 B;  1MDP 1;  3R7X A;  3LBS A;  3CSB A;  3IJX B;  1DOT A;  2XXW A;  5ELV A;  4GQO A;  4C1T A;  2V84 A;  2V3T A;  1HSL A;  2R71 A;  2QL3 A;  3PGF A;  3HN0 A;  2XXP A;  1Y1Z A;  4ZED A;  4OER A;  1QUI A;  2XXV A;  4PFW A;  2OK2 A;  4X1B A;  4MLV A;  1Y3Q A;  3VV5 A;  1PEB A;  1B7Z A;  1M5C A;  1N0T A;  2I48 A;  1P1O A;  5IAI A;  2R6G E;  1SYH A;  3E13 X;  4OXV A;  4U4X A;  4IO7 A;  3M8U A;  4K3F A;  1SVX B;  3UOR A;  2I0C A;  4OWD A;  3U92 A;  1JVY A;  2O7U A;  4LQ5 A;  2FNC A;  3KJT A;  3C9H A;  3Q29 A;  2D3I A;  1US4 A;  4WXJ A;  4YIC A;  3Q26 A;  2XXR A;  3TZA A;  2UVG A;  4LVQ A;  5I57 A;  2ONK E;  3TEL A;  3T96 B;  2REG A;  4OES A;  5DTB A;  2ZNU A;  4RA1 A;  3E3K A;  5AA4 B;  2GHA A;  5I58 A;  2QMW A;  3IO4 A;  4OFO A;  2XX7 A;  2RKM A;  3LSW A;  1SW5 A;  4GRK A;  4FAJ A;  3HHF A;  2X26 A;  3RLF E;  3VFJ A;  4LAT A;  4NF5 B;  4NF8 A;  3FXU A;  1B32 A;  3Q25 A;  1AH5 A;  3U72 A;  1ZJL A;  3T22 A;  3IAZ A;  3EN3 A;  4ECF A;  1PB8 A;  3S9M C;  3CFL A;  2XD2 A;  3TUS A;  2Z23 A;  3VVD A;  3CI8 A;  3SEW A;  1POY 1;  3CFX A;  3U93 A;  2KLF A;  4HCW A;  3U94 A;  4OZ9 A;  3RQT A;  4ELO A;  3OEK A;  1URD A;  3KFM A;  5TU0 A;  3EHT A;  4GOT A;  3SET A;  2XXY A;  3BFT A;  4G8N A;  4O3B A;  3ILT B;  3SEU A;  3IL1 B;  4AB6 A;  1ZLQ A;  4MLQ A;  4RPN A;  1B3H A;  1MY3 A;  1VSO A;  1QKB A;  5I2N A;  3G3F A;  2UXA A;  1ATG A;  3I3V A;  2QRY A;  1DTG A;  4U23 A;  2DYX A;  2VD3 A;  4OET A;  1DPP A;  4ELR A;  3KOT A;  4PFT A;  3FAT A;  2IEE A;  1B46 A;  1PB9 A;  3IOT A;  3S9L C;  5DVJ A;  3O28 A;  3TTN A;  3JZJ A;  4DE8 A;  2XXI A;  2RC7 A;  4H6D A;  4YMA A;  3TCG A;  2F6P A;  3DM0 A;  3VDF A;  1MXX A;  2XXQ A;  4NWD A;  4R9F A;  4H8J A;  3VXC A;  4XKR A;  4QFL A;  4AB5 A;  3RTW B;  3TDJ A;  4NMY A;  4I9D A;  4GXA A;  2Y7R A;  4YZZ A;  1N04 A;  1ZMG A;  2O69 A;  2RC9 A;  4NF8 B;  2ONS A;  3MPK A;  5L9S A;  3P7I A;  2DE2 A;  3SER A;  3HST A;  1SI0 A;  2VD2 A;  5K2X A;  4TLM B;  1MXW A;  2UYE A;  1NNK A;  3D4G A;  4P0I A;  1B4H A;  4ZEI A;  4GFR A;  3OEM A;  1ELJ A;  1MXU A;  1MG1 A;  2B3B A;  2XX9 A;  1A99 A;  1MY4 A;  3BFU A;  2Q8J A;  3WAE A;  4IY6 A;  4ZE8 A;  2ZYO A;  1MQJ A;  1MRP A;  4F1Y A;  3VLU A;  2UVH A;  1QKA A;  1SW4 A;  2RC8 A;  4HW8 A;  3RNN A;  4EXL A;  3MP8 A;  3O66 A;  5FTH A;  4FAT A;  2IA4 A;  1JW1 A;  2Z8E A;  1MQD A;  3GLB A;  3FJG A;  4X1D A;  2NOO A;  3MC2 A;  2DXR A;  3RGY A;  2O68 A;  3GXA A;  1UTB A;  5KDT A;  1MPD A;  5AA3 A;  4F39 A;  5FHO A;  4R73 A;  2NWJ A;  2B65 A;  4PQJ A;  3G3I A;  1LFI A;  4ZE9 A;  3KZG A;  1MDQ A;  3O6G A;  4AQ4 A;  4ELQ A;  3GBB A;  2PYY A;  2Q2C A;  3PUX E;  4X9T A;  2ALU A;  3FXQ A;  3OO9 A;  1F9B A;  2Y7W A;  4KHZ E;  5DVF A;  5TP9 B;  3W9V A;  3A3C A;  5A5X A;  2DE3 A;  4JWX A;  2I3V A;  2V25 A;  3FUZ A;  1Q1K A;  1Y9U A;  2F35 A;  3KSX A;  2PT2 A;  3FJM A;  4P11 A;  3K00 A;  3T9U A;  2HAU A;  1WVJ A;  3MBP A;  4ZDM A;  3TTK A;  2O84 X;  3MVY A;  3SEV A;  2R9J A;  2A5S A;  2VGQ A;  3LC8 A;  4LUB A;  5H8H A;  3T9X B;  1JW5 A;  4OEN A;  3PU5 A;  5DVI A;  5AA2 D;  4TQU Q;  1POT A;  3L6G A;  4NF6 A;  1M5E A;  2HCA A;  5I84 A;  1FTL A;  4KYS A;  3EHS A;  2ZYM A;  5AA2 B;  2F97 A;  5M2V A;  1EH3 A;  2UVJ A;  3DEL B;  1AOV A;  4MF3 A;  5ISU A;  3RY3 A;  2RF1 A;  1MQG A;  1S50 A;  4ZEF A;  4F19 A;  3K6V A;  1QUL A;  3PMV A;  1NKX A;  3PPR A;  5ICT A;  1PDA A;  3A09 A;  3VE1 B;  4QFN A;  3OSR A;  3K01 A;  2WKY A;  4G2Z A;  2M8C A;  3K4U A;  3OSQ A;  3FVO A;  4QF9 A;  1XT8 A;  1EU8 A;  3C36 A;  3IO6 A;  4ZEK A;  2F8D A;  4R2F A;  3M3K A;  1OVT A;  1Y3N A;  1S9T A;  1KWH A;  3HPI A;  3T9V A;  5LOM A;  5J1D A;  1B3L A;  2A5T A;  4HS7 A;  1LGB C;  5H8F B;  3OO7 A;  5B7D A;  3B6Q A;  3TTL A;  4H8I A;  1WDN A;  1N84 A;  2OWT A;  2OWS A;  2GH9 A;  5I59 B;  4U1O A;  1MXV A;  2G93 A;  3O29 A;  3PMW A;  4GF8 A;  3ZSF A;  4YB7 A;  4OEU A;  3K6X A;  3UA8 A;  1XOC A;  4KYD A;  4ZEB A;  3IOV A;  1UQW A;  1RYX A;  4R75 A;  5HBC A;  4QSC A;  2ABH A;  3I6V A;  1XS5 A;  3ECR A;  1N3X A;  2I6E A;  4EQ7 A;  3HHG A;  1YPN A;  1UIV A;  1AL3 A;  3FAS A;  5I56 A;  2RCB A;  4GLI A;  1XHY A;  2Y7P A;  3TMG A;  4R9G A;  5CMM A;  3TKD A;  3PUW E;  4QHQ A;  1JEV A;  4PP0 A;  1B5J A;  5CBR A;  5AA1 A;  3T9H B;  4THI A;  4WEP A;  2Q2A A;  2I4B A;  1VFD A;  4QFP A;  2V3Q A;  2I0B A;  4POX A;  4MFI A;  3T66 A;  5B70 A;  2F34 A;  3QAX A;  1NH8 A;  2HXW A;  3W15 C;  1BTJ A;  1OIB A;  3VVE A;  4JWO A;  5I2K B;  1II5 A;  3GBA A;  3G3K A;  3R26 A;  3RPW A;  5FHM A;  2ZMB A;  2OJT A;  5K2Y A;  4NTL A;  4DIG A;  1PBP A;  1JW4 A;  2QS4 A;  5CBS A;  1B3F A;  3C32 A;  4OTE A;  2GRV A;  4KQP A;  4YKP A;  1LLS A;  2ZYN A;  2QPQ A;  3TQL A;  4IGR A;  4FIM A;  4EDP A;  4BDL A;  5BWJ A;  1I6A A;  1AIV A;  4R72 A;  1LAF E;  3FV2 A;  4ESW A; 
#chains in the Genus database with same CATH topology
 1B2H A;  1FPI A;  4NQ8 A;  5DT6 A;  3MVW A;  4OAN A;  4HE2 A;  3TEP A;  4IB2 A;  4Q0C A;  3EHU A;  1NL5 A;  5ET6 A;  2H98 A;  3VLV A;  3ONM A;  3IOU A;  1B5I A;  1FQC A;  1H44 A;  1FBD A;  3THI A;  4QFO A;  3SEY A;  1NNF A;  4BDM A;  2BJI A;  5I7I A;  1FQF A;  3MUQ A;  1LBC A;  3OEN A;  4ZEC A;  4P0G A;  1HSJ A;  1B1X A;  4F31 B;  2GQ1 A;  4IY5 A;  2FYI A;  3L6H A;  2PX1 A;  2XA5 A;  2DSF A;  4MJO A;  3TAJ A;  1FRP A;  2H9B A;  4O7M A;  2F5X A;  1N76 A;  2F36 A;  2D5W A;  1GTK A;  4Z0I A;  1MQH A;  1YZ0 A;  3S9N C;  1GV8 A;  4YKI A;  3MW0 A;  1QVS A;  2HZK A;  1FPF A;  4NGU A;  3C34 A;  5LTC A;  1H45 A;  1FTK A;  4E0X A;  2G29 A;  4MX6 A;  4EF2 A;  2PFZ A;  2THI A;  3OEL A;  1CB6 A;  2I4C A;  2QS2 A;  5F1Q A;  3EKI A;  4M4G A;  4Q30 B;  1NNP A;  5H8Q A;  2FVZ A;  5FTI A;  4XKN A;  1FPL A;  4EF1 A;  1SW1 A;  1JVX A;  1FW0 A;  1IIT A;  4YB5 A;  4MEV A;  5I57 B;  4O3A A;  1LBY A;  1XI6 A;  2Q88 A;  3FBP A;  3PV0 E;  1ZU0 A;  5ITO A;  4R74 A;  2UYF A;  2VPN A;  3H3G A;  1NUX A;  4PC9 A;  4H46 A;  4GWO A;  1QW0 A;  5I58 B;  4F29 A;  5H8S A;  1LB8 A;  1IQ7 A;  3JV9 A;  1OQH A;  4OEV A;  4F2O A;  1P1N A;  4MNI A;  3N6T A;  1JEU A;  1QUJ A;  4HXV A;  1M5B A;  1BKA A;  3N94 A;  1FCK A;  4GX3 A;  4QBA A;  1XC1 A;  2ZXT A;  1TFD A;  4G4P A;  1D3K A;  4KCD A;  4NF4 A;  2F3B A;  2E1S A;  1FPE A;  3F11 A;  3KOS A;  5L9M A;  4DDD A;  3S9E A;  3SEX A;  1VFE A;  1A40 A;  4NED A;  4PAK A;  3B6T A;  1IMC A;  5CMB A;  4N6K A;  4I1D A;  4BDQ A;  2PBW A;  1LB9 A;  1M5D A;  4FOR A;  3EQ1 A;  1LCT A;  1B0L A;  1ANF A;  2I58 A;  1B40 A;  3O6H A;  1B6H A;  4XFE A;  2HPG A;  2OZZ A;  3RTF B;  4LZ5 A;  4EXK A;  4QSE A;  1MPB A;  4G77 A;  1MY0 A;  3FGS A;  1CE2 A;  4XEQ A;  4F1V A;  5DEX A;  1I6B A;  2Q9T A;  3OD7 A;  1FJ9 A;  5HM4 B;  4JXI A;  4BLA A;  4GXS B;  5I2N B;  1MM6 A;  3CSG A;  1P99 A;  2E0S A;  1LAG E;  2O1M A;  1B5H A;  5I5P A;  3UGW A;  3D1R A;  3MWB A;  4YB6 A;  1QUK A;  3I5O A;  1JET A;  4U22 A;  4P1L A;  2R8T A;  4IO2 A;  1OQG A;  5IZ3 B;  2NUV A;  2CZL A;  3TYH A;  5JEI A;  3UN6 A;  3QK6 A;  3UIF A;  5BUU A;  3SKP A;  4DLD A;  1ZKB A;  3M3F A;  3PPP A;  1FQD A;  1SI1 A;  2AYS A;  2ZNS A;  1IXG A;  1KA1 A;  4KCC A;  3O9P A;  1A8F A;  1OLA A;  4UAC A;  1YAE A;  2XXT A;  3RT6 B;  3CG3 A;  1MXZ A;  4QSD A;  4IR8 A;  3QSL A;  3O97 A;  1WOD A;  1A54 A;  4U1Z A;  1BP5 A;  4FED A;  4DCY A;  4GWX A;  4H67 A;  2CZI A;  4Q5T A;  3PUY E;  4NN3 A;  4F22 A;  3FD3 A;  2H5Y A;  4OQO A;  4N81 A;  4OVS A;  3MVX A;  1OVB A;  2XX8 A;  4JSD A;  3T0J A;  5J16 A;  1B7U A;  1B52 A;  5ITP A;  3H6V A;  3ISP A;  1FTM A;  5CI5 A;  3QXM A;  2B4M A;  3LSF B;  4KYE A;  3KN7 A;  3QUF A;  4BDN A;  3OXN A;  1ZBM A;  4RK9 A;  3PD8 A;  4PDH A;  4TOZ A;  3ZKL A;  2XXH A;  1INP A;  2DS9 A;  1BIY A;  2W7Y A;  5CMK A;  4XXU A;  4OHN A;  3H03 A;  3B6W A;  2XD3 A;  3OMB A;  1S7Y A;  5L8D A;  4JDF A;  4U2R A;  4PTK A;  1VR5 A;  4HTG A;  4PET A;  5KDT B;  1UTB B;  3D4C A;  1BLF A;  1TT1 A;  1B58 A;  2FBP A;  3SZP A;  1J1N A;  5H8N A;  1FSA A;  1FTJ A;  4PF6 A;  4MNC A;  1US5 A;  2VP1 A;  1I69 A;  2KQZ A;  1MY2 A;  1VE4 A;  4G61 A;  5EQA A;  4RY1 A;  3USD A;  2RIN A;  3CFZ A;  3DP6 A;  5A5X B;  4GIZ A;  4UA8 A;  3H06 B;  4H5F A;  2O6A A;  3TFL A;  3RN8 A;  1RDZ A;  3MP6 A;  3PPQ A;  1NV4 A;  4C0R A;  1M5F A;  3K6U A;  2QMX A;  3G3J A;  5IKB A;  2CMO A;  2WEF A;  4DI3 D;  1P1W A;  1PC3 A;  3MZB A;  3CG1 A;  2WYK A;  3FZV A;  1OLC A;  3V89 B;  3IJO B;  4GL0 A;  5A5L A;  4GX6 A;  4PFR A;  1B0H A;  2HEU A;  5IGA A;  4RPO A;  5H8H B;  3V8X B;  1A55 A;  2HFB A;  3BKI B;  2CZH A;  2X7Q A;  4PFI A;  4NF6 B;  5KCJ A;  1FPK A;  1Y20 A;  3KGC A;  1DSN A;  1NUY A;  4KD5 A;  5CM6 A;  4MNP A;  4BDR A;  4QRZ A;  3H6T A;  4POW A;  4GD5 A;  4NF5 A;  1GGG A;  1PBQ A;  3V5A A;  3LUY A;  2F7C A;  3VLW A;  2PCR A;  4F3B A;  4OYV A;  4Z7E A;  2GFE A;  4C1U A;  3MJN A;  1Z7N E;  1Z7M E;  1RKM A;  1EZ9 A;  3G3H A;  3ODB A;  1IIW A;  1LAX A;  1PB7 A;  3LSX A;  2REJ A;  5H8N B;  1IMD A;  1RDX A;  1SD3 A;  2ANJ A;  4PFU A;  4GWS A;  2UVI A;  3MZ9 A;  4XKQ A;  3C35 A;  3RT8 A;  4DZ1 A;  4I8C A;  1O64 A;  3UK4 A;  1YTV A;  3U8Q A;  4KPT A;  4IO4 A;  3BBR A;  2A5T B;  3CVG A;  1B4Z A;  2P3V A;  4NX1 A;  4FBP A;  1QJM A;  1R1N A;  3TQW A;  3G7W A;  4PFY A;  1A7L A;  1JQF A;  4ZZA A;  1MPC A;  4G8H A;  3K6W A;  1XVY A;  1OMP A;  4F2Q A;  5JTY A;  3C4M A;  4NHB A;  3FJ7 A;  2P1S A;  3QYT A;  1R6Z A;  3DP8 A;  2I3W A;  3W9W A;  3ZS6 A;  3HCQ A;  2O51 A;  3LV0 A;  3IX1 A;  5EHM A;  2O1L A;  2Z22 A;  4FEC A;  1L5T A;  4EQ9 A;  4E0W A;  3WAF A;  3KEI A;  4QXD A;  2ONR A;  4OVJ A;  1HSE A;  2DQV A;  1B05 A;  1NH7 A;  4GVO A;  3RUM A;  1NMU A;  4LON B;  5I56 B;  2QS1 A;  5CC2 A;  1R9L A;  1B1H A;  5KCJ B;  3MZ1 A;  4DI4 B;  3OO6 A;  2VT5 A;  1GVC A;  4TLL B;  3MP1 A;  4H65 A;  4O3C A;  2VOZ A;  4FEB A;  4BDO A;  2D21 A;  5L9O A;  3VXB A;  4GWU A;  4GWY A;  3QMF A;  4WKM A;  1FPG A;  3DP4 A;  5EHS A;  3SDF A;  2ZZX A;  1MXY A;  1SW2 A;  1D9V A;  4R6H A;  3UP9 A;  1FQA A;  3TCH A;  2RCA A;  1YCJ A;  1IEJ A;  1DK4 A;  3H6U A;  1A8E A;  5F7V A;  2XHD A;  4DXU A;  4I3E A;  4IGT A;  3N6U A;  4R6Y A;  2XXX A;  4M1V A;  4HE0 A;  2FIX A;  3E9X A;  2I49 A;  3A3U A;  3ZKK A;  3KSJ A;  4X04 A;  1H3D A;  2VPO A;  2HZL A;  4H0W A;  4DXC A;  1QGX A;  2ZNT A;  1USY E;  4RYA A;  1JNF A;  4LZ8 A;  4YAH X;  2L5V A;  4G68 C;  3S4U A;  4NG7 A;  1MS7 A;  4FE8 A;  4PBH A;  4PE3 A;  4EQB A;  3IB0 A;  4WED A;  3TTM A;  3PTY A;  5ICQ A;  1Y3P A;  4OFJ A;  1MQI A;  1P1U A;  3FXR A;  2DOJ A;  2V93 A;  4IO3 A;  1LFH A;  3KBR A;  4G8M A;  3IB1 A;  4PCD A;  5JTY B;  1T0K A;  1LAH E;  2YJP A;  4U4S A;  1IUD A;  3AXF A;  3NOH A;  3CRB A;  4OA4 A;  3E78 A;  4OVR A;  2OCU A;  3PD9 A;  1IME A;  4OMB A;  3QIM A;  1TXF A;  2QS3 A;  3BIH A;  3H4Z A;  4H5G A;  4IO6 A;  1Q35 A;  2Z8D A;  3IR1 A;  2O7I A;  4XTC Q;  1B3G A;  4KI0 E;  3HO7 A;  4IO5 A;  4JVI A;  2DVC A;  1H76 A;  4PBQ A;  1YXI A;  4MBP A;  2XWK A;  2F7A A;  5TP9 A;  4NWC A;  1LBB A;  3E4R A;  2Y7I A;  3H7M A;  3JYR A;  4P56 A;  1LST A;  1LEV A;  3PUZ E;  4N8Y A;  4ZS9 A;  5TPA A;  4ISU A;  4JBZ A;  2HAV A;  1EZO A;  2GHB A;  2P2A A;  3H6W A;  4PAI A;  1UTH A;  1NFT A;  1JP4 A;  2DWI A;  2ZZV A;  1O7T A;  2QVV A;  2H99 A;  5JK4 A;  2LAO A;  4U21 A;  4F3G A;  3LSL A;  1FPJ A;  3MYU A;  4YMB A;  4F1U A;  4G68 A;  2JJK A;  3K1P A;  3IB2 A;  2DWJ A;  4X8R A;  1Y4C A;  2FA7 A;  3O2A A;  5AA2 A;  3N26 A;  2DVZ A;  5EQ8 A;  1ZIU A;  2XXK A;  3IK6 B;  5CRY A;  2ZYK A;  1FBC A;  2PVU A;  2H4I A;  5H8Q B;  4O8M A;  4YKK A;  4ONY A;  3MVZ A;  2KR0 A;  4RXL A;  3KG2 A;  4FJP A;  1YYZ A;  2OBG A;  4LA9 A;  2NVU B;  3KN8 A;  1NNT A;  5I3S A;  1H43 A;  4LZ7 A;  4HE1 A;  1N7X A;  3FVK A;  1R9Q A;  2YLN A;  1FTO A;  4L17 A;  2P3N A;  1B9J A;  4O94 A;  1FBG A;  5FBP A;  4QFK A;  3QUJ A;  3TOD A;  3FVN A;  3PUV E;  1AMF A;  3MQ9 A;  3Q28 A;  3FVG A;  2OLB A;  3PPO A;  3TCF A;  2B3F A;  4N13 A;  5FHN A;  3IOW A;  5HPQ A;  4KR5 A;  3MPL A;  4OFL A;  5IZ1 A;  2AL5 A;  1GR2 A;  4NE4 A;  3SES A;  4H45 A;  2PT1 A;  1B7H A;  3EF7 A;  4MH5 A;  3IOR A;  1NV2 A;  4DCX A;  1TFA A;  4N4U A;  4XKP A;  1Y1M A;  1FBF A;  5H8F A;  2DE4 A;  3CIJ A;  1Y4T A;  3TTR A;  1FQB A;  3CR9 A;  1SBP A;  1TWY A;  2F78 A;  3C33 A;  4RK2 A;  1P1Q A;  5I59 A;  5TPA B;  4NF4 B;  4GX4 A;  2DP8 A;  3KJ7 A;  4F18 A;  2ESN A;  1MH3 A;  1UTH B;  1UIU A;  2P0S A;  2XWV A;  3M3L A;  4X48 A;  3GZG A;  2OX3 A;  4GWZ A;  3ILU B;  4R6K A;  5DYH A;  1IZ1 A;  4KFQ A;  3K2D A;  2F7B A;  4G68 B;  2YPN A;  4N07 A;  4JVD A;  1DMB A;  4GBV A;  3PMX A;  5DEX B;  2F6G A;  4EUO A;  4LP2 B;  2HQ0 A;  1FTA A;  1KZ8 A;  5DW8 A;  4ZZE A;  2QSX A;  3K1N A;  4GL8 A;  2QJE A;  3K0V A;  1EZP A;  1MM7 A;  3TPA A;  2DWA A;  3KBZ A;  1FBH A;  3VVF A;  4RJZ A;  2NXO A;  1DTZ A;  4I62 A;  3LR1 A;  3PPN A;  3R6U A;  5CMC A;  3OO8 A;  3FV1 A;  1URS A;  3DLN A;  5EYF A;  1NV5 A;  4ELP A;  4Q8R A;  3Q27 A;  2Z8F A;  3B7D A;  4JWY A;  1O63 A;  4RNS A;  1URG A;  5ET8 A;  1AWB A;  2Q89 A;  2V3U A;  3K02 A;  1D9Y A;  1RYO A;  3G3G A;  4F3P A;  1LFG A;  1N7W A;  1B51 A;  4P1E A;  2PMS A;  3KN3 A;  3OOA A;  4MIJ A;  4YU0 A;  2BJJ X;  3N5L A;  5I2K A;  4MCO A;  2OWZ A;  1USY H;  2AL4 A;  2Y7K A;  2Y84 A;  3BIG A;  2WBD A;  3KC1 A;  3T93 B;  2H25 A;  4HCY A;  4PDD A;  2X7P A;  3CHG A;  3MAM A;  4LQ2 A;  1K9Z A;  3C31 A;  3O6I A;  4AS5 A;  5KZT A;  2VHA A;  4ND9 A;  4P9K A;  1XVX A;  2XXU A;  3V83 A;  1DPE A;  4JSO A;  3S2V A;  3FIR A;  1FQE A;  2CEY A;  1B3E A;  3EPE A;  2DWH A;  4R2B A;  1LCF A;  2AIX A;  4DXB A;  2DXY A;  1N3W A;  4XIG Q;  1SYI A;  5AE4 A;  1SDX A;  4YKJ A;  4H1X A;  5AA4 A;  4OVQ A;  3K1M A;  3U1O A;  1IXC A;  1IXH A;  4P8B A;  1VDW A;  1SQY A;  1DBZ A;  1D4N A;  1MH4 A;  4N6P A;  4ESX A;  1IXI A;  1MY1 A;  1ZTY A;  4F3S A;  3HV1 A;  1I6Q A;  4JB7 A;  1EYK A;  4PE5 B;  1BK4 A;  1MDP 1;  3R7X A;  3LBS A;  4AS4 A;  3CSB A;  3IJX B;  1DOT A;  2XXW A;  4MAG A;  5ELV A;  4GQO A;  4C1T A;  2V84 A;  1G0I A;  2V3T A;  1HSL A;  2R71 A;  1IMF A;  2QL3 A;  3PGF A;  3HN0 A;  2QVU A;  2XXP A;  4N8G A;  1Y1Z A;  4ZED A;  4OER A;  1QUI A;  2XXV A;  4PFW A;  2OK2 A;  4X1B A;  4MLV A;  1Y3Q A;  3VV5 A;  1PEB A;  1B7Z A;  1M5C A;  3FXB A;  1N0T A;  2CZK A;  2I48 A;  1P1O A;  5IAI A;  4P3L A;  2R6G E;  1SYH A;  3E13 X;  4OXV A;  4U4X A;  4IO7 A;  2V4C A;  3M8U A;  4K3F A;  1SVX B;  4N6D A;  3UOR A;  2I0C A;  4OWD A;  4P47 A;  3U92 A;  3LUZ A;  1NV6 A;  5ET5 A;  1JVY A;  2HHM A;  2O7U A;  4LQ5 A;  2FNC A;  3KJT A;  3C9H A;  3Q29 A;  2D3I A;  4GBW A;  1US4 A;  4WXJ A;  4YIC A;  3Q26 A;  2XXR A;  2CEX A;  3TZA A;  2UVG A;  4LVQ A;  5I57 A;  2ONK E;  3TEL A;  3T96 B;  2REG A;  4OES A;  1RDY A;  5DTB A;  2ZNU A;  4RA1 A;  3B50 A;  3E3K A;  5AA4 B;  1NV7 A;  2GHA A;  5I58 A;  2QMW A;  3IO4 A;  4OFO A;  2XX7 A;  2RKM A;  3LSW A;  1SW5 A;  4LN5 A;  4GRK A;  4FAJ A;  3HHF A;  2X26 A;  1SPI A;  3RLF E;  3VFJ A;  4LAT A;  4NF5 B;  4NF8 A;  3FXU A;  1B32 A;  3Q25 A;  1AH5 A;  3U72 A;  1KA0 A;  1ZJL A;  2HXR A;  3T22 A;  3IAZ A;  3EN3 A;  4ECF A;  1PB8 A;  3S9M C;  3CFL A;  2XD2 A;  3TUS A;  3HFU A;  2Z23 A;  3VVD A;  3CI8 A;  3SEW A;  1POY 1;  2Y5K A;  3CFX A;  3U93 A;  2KLF A;  4HCW A;  3U94 A;  4OZ9 A;  3RQT A;  4ELO A;  2WBB A;  3OEK A;  1URD A;  3KFM A;  2FIE A;  5TU0 A;  2PFY A;  3EHT A;  4GOT A;  3SET A;  2XXY A;  3BFT A;  4G8N A;  4O3B A;  3ILT B;  3SEU A;  3IL1 B;  4AB6 A;  1ZLQ A;  4MLQ A;  4RPN A;  1B3H A;  1MY3 A;  2Y5L A;  1VSO A;  1QKB A;  5I2N A;  3G3F A;  2UXA A;  1ATG A;  1LBZ A;  3I3V A;  2QRY A;  1FBE A;  4PAF A;  1DTG A;  4U23 A;  2DYX A;  2VD3 A;  4OET A;  3GYY A;  1DPP A;  4ELR A;  3KOT A;  4PFT A;  3FAT A;  2IEE A;  1B46 A;  1PB9 A;  3IOT A;  3S9L C;  2B4L A;  5DVJ A;  3O28 A;  3TTN A;  3JZJ A;  5IZ3 A;  4DE8 A;  2XXI A;  2RC7 A;  4H6D A;  4YMA A;  3TCG A;  2F6P A;  3DM0 A;  3VDF A;  5EQ9 A;  1MXX A;  1FPD A;  2XXQ A;  4NWD A;  4PF8 A;  4I3Y A;  4R9F A;  4H8J A;  3VXC A;  4XKR A;  4QFL A;  4AB5 A;  3RTW B;  4NF0 A;  5EYH A;  3TDJ A;  4NMY A;  4O7I A;  3RPL A;  4N15 A;  4I9D A;  4GXA A;  2Y7R A;  4YZZ A;  1N04 A;  1ZMG A;  2O69 A;  2RC9 A;  4NF8 B;  2ONS A;  3IFC A;  3MPK A;  3IFA A;  5L9S A;  3P7I A;  1FPB A;  2DE2 A;  3SER A;  3HST A;  1SI0 A;  2VD2 A;  2ZZW A;  5K2X A;  4TLM B;  2XWO A;  1MXW A;  2UYE A;  1NNK A;  3D4G A;  4PGN A;  1NUZ A;  3U65 A;  3RYD A;  4P0I A;  1B4H A;  4ZEI A;  4GFR A;  3OEM A;  1ELJ A;  1MXU A;  1MG1 A;  2B3B A;  2XX9 A;  1IMB A;  1A99 A;  1EYJ A;  1MY4 A;  3BFU A;  2Q8J A;  3WAE A;  4IY6 A;  4ZE8 A;  4UAB A;  2ZYO A;  1MQJ A;  1MRP A;  4F1Y A;  3VLU A;  2UVH A;  1QKA A;  1SW4 A;  2RC8 A;  4HW8 A;  3RNN A;  4EXL A;  3MP8 A;  3O66 A;  5FTH A;  4FAT A;  2IA4 A;  1JW1 A;  2Z8E A;  2MKZ A;  1MQD A;  3GLB A;  3FJG A;  4X1D A;  2NOO A;  3MC2 A;  2DXR A;  3RGY A;  2O68 A;  3GXA A;  1UTB A;  5KDT A;  1MPD A;  5AA3 A;  4F39 A;  5FHO A;  4R73 A;  2NWJ A;  1FBP A;  2B65 A;  3A29 A;  4PQJ A;  1IMA A;  3G3I A;  1LFI A;  4ZE9 A;  3KZG A;  1MDQ A;  3O6G A;  4AQ4 A;  4ELQ A;  4PFB A;  3GBB A;  2PYY A;  2Q2C A;  3MST A;  3PUX E;  4X9T A;  2QVR A;  4MMP A;  1NI9 A;  2ALU A;  3FXQ A;  3OO9 A;  1F9B A;  2Y7W A;  4KHZ E;  5DVF A;  5TP9 B;  3W9V A;  3A3C A;  5A5X A;  2DE3 A;  4JWX A;  3RPL B;  2I3V A;  2V25 A;  3FUZ A;  1Q1K A;  1Y9U A;  2F35 A;  3KSX A;  2PT2 A;  3FJM A;  4P11 A;  3T1B A;  5T3J A;  5ESY A;  3B8B A;  3K00 A;  3T9U A;  2HAU A;  1WVJ A;  3MBP A;  4ZDM A;  3TTK A;  2F3D A;  2O84 X;  3MVY A;  3SEV A;  5ET7 A;  2R9J A;  2A5S A;  2WX9 A;  2VGQ A;  3LC8 A;  4LUB A;  5H8H A;  3T9X B;  1JW5 A;  4OEN A;  2FHY A;  3PU5 A;  5DVI A;  5AA2 D;  4TQU Q;  1POT A;  3L6G A;  4NF6 A;  2DDK A;  1M5E A;  2HCA A;  5I84 A;  1FTL A;  4KYS A;  3EHS A;  2ZYM A;  5AA2 B;  2F97 A;  4GWW A;  5F24 A;  5M2V A;  1EH3 A;  2UVJ A;  3DEL B;  1AOV A;  4MF3 A;  5ISU A;  1FJ6 A;  3RY3 A;  2RF1 A;  1MQG A;  1S50 A;  4PGP A;  4ZEF A;  4F19 A;  5LDZ A;  3K6V A;  1QUL A;  3PMV A;  1NKX A;  1Q9D A;  1DCU A;  3PPR A;  1K9Y A;  5ICT A;  1PDA A;  3A09 A;  3VE1 B;  4QFN A;  3OSR A;  3K01 A;  2WKY A;  4G2Z A;  2M8C A;  3K4U A;  1NV3 A;  3OSQ A;  3FVO A;  1NV0 A;  4QF9 A;  1XT8 A;  1EU8 A;  3C36 A;  4NAP A;  3IO6 A;  2XWI A;  1LBV A;  1EYI A;  4ZEK A;  2F8D A;  4R2F A;  3M3K A;  1OVT A;  1Y3N A;  1S9T A;  1KWH A;  3HPI A;  3T9V A;  5LOM A;  5J1D A;  1B3L A;  2A5T A;  4HS7 A;  1LGB C;  5H8F B;  3OO7 A;  5IZZ A;  3ROJ A;  5B7D A;  3B6Q A;  3TTL A;  4H8I A;  1WDN A;  1N84 A;  2OWT A;  3KC0 A;  2OWS A;  1LBX A;  2GH9 A;  4N91 A;  5I59 B;  4U1O A;  1MXV A;  2G93 A;  3O29 A;  3PMW A;  4GF8 A;  3ZSF A;  4YB7 A;  4OEU A;  3K6X A;  3UA8 A;  1XOC A;  5EYG A;  4KYD A;  2WYP A;  4ZEB A;  3IOV A;  1UQW A;  1RYX A;  4R75 A;  5HBC A;  1CNQ A;  4QSC A;  2ABH A;  3I6V A;  1XS5 A;  3ECR A;  1N3X A;  2I6E A;  4EQ7 A;  3HHG A;  1YPN A;  4JVC A;  1UIV A;  1AL3 A;  3FAS A;  1NV1 A;  5I56 A;  2RCB A;  4GLI A;  1XHY A;  2Y7P A;  3TMG A;  4R9G A;  5CMM A;  3TKD A;  3PUW E;  4QHQ A;  1JEV A;  4PP0 A;  1B5J A;  5CBR A;  5AA1 A;  3T9H B;  4I40 A;  4OVT A;  4THI A;  4WEP A;  2Q2A A;  1G0H A;  2I4B A;  4MHF A;  1VFD A;  4QFP A;  2V3Q A;  5IM2 A;  2I0B A;  4POX A;  4MFI A;  3T66 A;  5B70 A;  2F34 A;  3QAX A;  1NUW A;  4XF5 A;  4OVP A;  1NH8 A;  2HXW A;  3W15 C;  1BTJ A;  1OIB A;  3VVE A;  4JWO A;  5I2K B;  1II5 A;  3E79 A;  3GBA A;  5EQ7 A;  3G3K A;  3R26 A;  3RPW A;  5FHM A;  2ZMB A;  2OJT A;  5K2Y A;  4NTL A;  4KXP A;  4DIG A;  1PBP A;  1JW4 A;  2QS4 A;  5CBS A;  1B3F A;  2QFL A;  3C32 A;  1D9Q A;  4OTE A;  2GRV A;  4KQP A;  4YKP A;  1LLS A;  2Q74 A;  2Q8M A;  2ZYN A;  2QPQ A;  3TQL A;  4IGR A;  4FIM A;  1LBW A;  4EDP A;  4BDL A;  5BWJ A;  1I6A A;  1AIV A;  4R72 A;  1LAF E;  3FV2 A;  4N17 A;  4ESW A; 
#chains in the Genus database with same CATH homology
 1B2H A;  5DT6 A;  3MVW A;  3TEP A;  4IB2 A;  4Q0C A;  3EHU A;  1NL5 A;  2H98 A;  3VLV A;  3ONM A;  3IOU A;  1B5I A;  1FQC A;  1H44 A;  3THI A;  4QFO A;  3SEY A;  1NNF A;  4BDM A;  1FQF A;  3MUQ A;  1LBC A;  3OEN A;  4ZEC A;  4P0G A;  1HSJ A;  1B1X A;  4F31 B;  4IY5 A;  2FYI A;  3L6H A;  2PX1 A;  2DSF A;  3TAJ A;  2H9B A;  2F5X A;  1N76 A;  2F36 A;  2D5W A;  1GTK A;  4Z0I A;  1MQH A;  3S9N C;  1GV8 A;  4YKI A;  3MW0 A;  1QVS A;  2HZK A;  3C34 A;  1H45 A;  1FTK A;  4E0X A;  2G29 A;  4EF2 A;  2THI A;  3OEL A;  1CB6 A;  2I4C A;  2QS2 A;  5F1Q A;  4M4G A;  4Q30 B;  1NNP A;  5H8Q A;  5FTI A;  4XKN A;  4EF1 A;  1SW1 A;  1JVX A;  1FW0 A;  1IIT A;  4YB5 A;  5I57 B;  4O3A A;  2Q88 A;  3PV0 E;  1ZU0 A;  5ITO A;  4R74 A;  2UYF A;  3H3G A;  4GWO A;  1QW0 A;  5I58 B;  4F29 A;  5H8S A;  1LB8 A;  1IQ7 A;  3JV9 A;  1OQH A;  4OEV A;  4F2O A;  1P1N A;  3N6T A;  1JEU A;  1QUJ A;  1M5B A;  1BKA A;  3N94 A;  1FCK A;  1XC1 A;  2ZXT A;  1TFD A;  4G4P A;  1D3K A;  4KCD A;  4NF4 A;  2E1S A;  3F11 A;  3KOS A;  5L9M A;  4DDD A;  3S9E A;  3SEX A;  1VFE A;  1A40 A;  4NED A;  3B6T A;  5CMB A;  4I1D A;  4BDQ A;  2PBW A;  1LB9 A;  1M5D A;  4FOR A;  3EQ1 A;  1LCT A;  1B0L A;  1ANF A;  2I58 A;  1B40 A;  3O6H A;  1B6H A;  2OZZ A;  3RTF B;  4LZ5 A;  4EXK A;  4QSE A;  1MPB A;  4G77 A;  1MY0 A;  3FGS A;  1CE2 A;  4F1V A;  5DEX A;  1I6B A;  2Q9T A;  3OD7 A;  5HM4 B;  4JXI A;  4BLA A;  4GXS B;  5I2N B;  1MM6 A;  3CSG A;  1P99 A;  2E0S A;  1LAG E;  2O1M A;  1B5H A;  3UGW A;  3MWB A;  4YB6 A;  1QUK A;  3I5O A;  1JET A;  4U22 A;  4IO2 A;  1OQG A;  2NUV A;  2CZL A;  3TYH A;  5JEI A;  3UN6 A;  3QK6 A;  3UIF A;  5BUU A;  3SKP A;  4DLD A;  1ZKB A;  3M3F A;  3PPP A;  1FQD A;  1SI1 A;  2AYS A;  2ZNS A;  1IXG A;  4KCC A;  3O9P A;  1A8F A;  1OLA A;  4UAC A;  1YAE A;  2XXT A;  3RT6 B;  3CG3 A;  1MXZ A;  4QSD A;  3QSL A;  3O97 A;  1WOD A;  1A54 A;  4U1Z A;  1BP5 A;  4FED A;  4DCY A;  4H67 A;  4Q5T A;  3PUY E;  4F22 A;  3FD3 A;  2H5Y A;  4OQO A;  3MVX A;  1OVB A;  2XX8 A;  4JSD A;  1B7U A;  1B52 A;  5ITP A;  3H6V A;  1FTM A;  5CI5 A;  3QXM A;  3LSF B;  4KYE A;  3KN7 A;  3QUF A;  4BDN A;  3OXN A;  1ZBM A;  4RK9 A;  3PD8 A;  4TOZ A;  3ZKL A;  2XXH A;  2DS9 A;  1BIY A;  2W7Y A;  5CMK A;  4XXU A;  4OHN A;  3H03 A;  3B6W A;  2XD3 A;  3OMB A;  1S7Y A;  5L8D A;  4JDF A;  4U2R A;  1VR5 A;  4HTG A;  4PET A;  5KDT B;  1UTB B;  3D4C A;  1BLF A;  1TT1 A;  1B58 A;  1J1N A;  5H8N A;  1FTJ A;  1US5 A;  2VP1 A;  1I69 A;  1MY2 A;  1VE4 A;  4RY1 A;  3USD A;  2RIN A;  3CFZ A;  3DP6 A;  5A5X B;  4GIZ A;  4UA8 A;  3H06 B;  4H5F A;  2O6A A;  3TFL A;  3RN8 A;  3MP6 A;  3PPQ A;  4C0R A;  1M5F A;  3K6U A;  2QMX A;  3G3J A;  5IKB A;  2CMO A;  1P1W A;  1PC3 A;  3MZB A;  3CG1 A;  3FZV A;  1OLC A;  3V89 B;  3IJO B;  4GL0 A;  1B0H A;  2HEU A;  4RPO A;  5H8H B;  3V8X B;  1A55 A;  2HFB A;  3BKI B;  2X7Q A;  4NF6 B;  5KCJ A;  1Y20 A;  3KGC A;  1DSN A;  4KD5 A;  5CM6 A;  4BDR A;  4QRZ A;  3H6T A;  4POW A;  4GD5 A;  4NF5 A;  1GGG A;  1PBQ A;  3V5A A;  3LUY A;  2F7C A;  3VLW A;  4F3B A;  4OYV A;  4Z7E A;  2GFE A;  4C1U A;  3MJN A;  1Z7N E;  1Z7M E;  1RKM A;  1EZ9 A;  3G3H A;  3ODB A;  1IIW A;  1LAX A;  1PB7 A;  3LSX A;  2REJ A;  5H8N B;  1SD3 A;  2ANJ A;  4PFU A;  2UVI A;  3MZ9 A;  4XKQ A;  3C35 A;  3RT8 A;  4DZ1 A;  4I8C A;  1O64 A;  3UK4 A;  1YTV A;  3U8Q A;  4KPT A;  4IO4 A;  3BBR A;  2A5T B;  3CVG A;  1B4Z A;  1QJM A;  1R1N A;  3TQW A;  3G7W A;  4PFY A;  1A7L A;  1JQF A;  4ZZA A;  1MPC A;  4G8H A;  3K6W A;  1XVY A;  1OMP A;  4F2Q A;  5JTY A;  3C4M A;  3FJ7 A;  2P1S A;  3QYT A;  1R6Z A;  3DP8 A;  2I3W A;  3W9W A;  3ZS6 A;  3HCQ A;  2O51 A;  3IX1 A;  5EHM A;  2O1L A;  2Z22 A;  4FEC A;  1L5T A;  4EQ9 A;  4E0W A;  3WAF A;  3KEI A;  2ONR A;  4OVJ A;  1HSE A;  2DQV A;  1B05 A;  1NH7 A;  4GVO A;  3RUM A;  1NMU A;  4LON B;  5I56 B;  2QS1 A;  5CC2 A;  1R9L A;  1B1H A;  5KCJ B;  3MZ1 A;  3OO6 A;  1GVC A;  4TLL B;  3MP1 A;  4H65 A;  4O3C A;  2VOZ A;  4FEB A;  4BDO A;  2D21 A;  5L9O A;  3VXB A;  4WKM A;  3DP4 A;  5EHS A;  3SDF A;  1MXY A;  1SW2 A;  1D9V A;  4R6H A;  3UP9 A;  1FQA A;  3TCH A;  2RCA A;  1YCJ A;  1IEJ A;  3H6U A;  1A8E A;  5F7V A;  2XHD A;  4DXU A;  4IGT A;  3N6U A;  4R6Y A;  2XXX A;  4M1V A;  3E9X A;  2I49 A;  3A3U A;  3ZKK A;  3KSJ A;  1H3D A;  2HZL A;  4H0W A;  4DXC A;  2ZNT A;  1USY E;  4RYA A;  1JNF A;  4LZ8 A;  4YAH X;  4G68 C;  3S4U A;  1MS7 A;  4FE8 A;  4EQB A;  3IB0 A;  4WED A;  3TTM A;  5ICQ A;  1Y3P A;  4OFJ A;  1MQI A;  1P1U A;  3FXR A;  2DOJ A;  2V93 A;  4IO3 A;  1LFH A;  3KBR A;  4G8M A;  3IB1 A;  5JTY B;  1T0K A;  1LAH E;  2YJP A;  4U4S A;  1IUD A;  3AXF A;  3CRB A;  2OCU A;  3PD9 A;  4OMB A;  3QIM A;  1TXF A;  2QS3 A;  3H4Z A;  4H5G A;  4IO6 A;  1Q35 A;  2Z8D A;  3IR1 A;  2O7I A;  4XTC Q;  1B3G A;  4KI0 E;  3HO7 A;  4IO5 A;  2DVC A;  1H76 A;  4MBP A;  2F7A A;  5TP9 A;  4NWC A;  1LBB A;  3E4R A;  2Y7I A;  3H7M A;  3JYR A;  1LST A;  3PUZ E;  4ZS9 A;  5TPA A;  4ISU A;  4JBZ A;  2HAV A;  1EZO A;  2GHB A;  2P2A A;  3H6W A;  1UTH A;  1NFT A;  2DWI A;  1O7T A;  2H99 A;  5JK4 A;  2LAO A;  4U21 A;  4F3G A;  3LSL A;  4YMB A;  4F1U A;  4G68 A;  3K1P A;  3IB2 A;  2DWJ A;  1Y4C A;  2FA7 A;  3O2A A;  5AA2 A;  3N26 A;  2DVZ A;  1ZIU A;  3IK6 B;  5CRY A;  2ZYK A;  2PVU A;  2H4I A;  5H8Q B;  4YKK A;  4ONY A;  3MVZ A;  4RXL A;  3KG2 A;  4FJP A;  2OBG A;  4LA9 A;  2NVU B;  3KN8 A;  1NNT A;  1H43 A;  4LZ7 A;  1N7X A;  3FVK A;  1R9Q A;  2YLN A;  1FTO A;  4L17 A;  1B9J A;  4QFK A;  3QUJ A;  3TOD A;  3FVN A;  3PUV E;  1AMF A;  3MQ9 A;  3Q28 A;  3FVG A;  2OLB A;  3PPO A;  3TCF A;  2B3F A;  4N13 A;  5FHN A;  3IOW A;  5HPQ A;  4KR5 A;  3MPL A;  4OFL A;  2AL5 A;  1GR2 A;  4NE4 A;  3SES A;  2PT1 A;  1B7H A;  3EF7 A;  4MH5 A;  3IOR A;  4DCX A;  1TFA A;  4XKP A;  1Y1M A;  5H8F A;  2DE4 A;  3CIJ A;  1Y4T A;  3TTR A;  1FQB A;  3CR9 A;  1SBP A;  1TWY A;  2F78 A;  3C33 A;  4RK2 A;  1P1Q A;  5I59 A;  5TPA B;  4NF4 B;  2DP8 A;  3KJ7 A;  4F18 A;  2ESN A;  1MH3 A;  1UTH B;  1UIU A;  2P0S A;  3M3L A;  4X48 A;  3GZG A;  3ILU B;  4R6K A;  5DYH A;  1IZ1 A;  4KFQ A;  3K2D A;  2F7B A;  4G68 B;  2YPN A;  4N07 A;  1DMB A;  3PMX A;  5DEX B;  2F6G A;  4EUO A;  4LP2 B;  2HQ0 A;  4ZZE A;  2QSX A;  3K1N A;  4GL8 A;  2QJE A;  3K0V A;  1EZP A;  1MM7 A;  3TPA A;  2DWA A;  3VVF A;  4RJZ A;  2NXO A;  1DTZ A;  4I62 A;  3LR1 A;  3PPN A;  3R6U A;  5CMC A;  3OO8 A;  3FV1 A;  1URS A;  3DLN A;  5EYF A;  4ELP A;  4Q8R A;  3Q27 A;  2Z8F A;  3B7D A;  4JWY A;  1O63 A;  4RNS A;  1URG A;  2Q89 A;  2V3U A;  3K02 A;  1D9Y A;  1RYO A;  3G3G A;  4F3P A;  1LFG A;  1N7W A;  1B51 A;  2PMS A;  3KN3 A;  3OOA A;  4YU0 A;  2BJJ X;  3N5L A;  5I2K A;  1USY H;  2AL4 A;  2Y7K A;  2Y84 A;  3T93 B;  2H25 A;  4HCY A;  2X7P A;  3MAM A;  4LQ2 A;  3C31 A;  3O6I A;  5KZT A;  2VHA A;  4ND9 A;  1XVX A;  2XXU A;  3V83 A;  1DPE A;  4JSO A;  3S2V A;  3FIR A;  1FQE A;  1B3E A;  3EPE A;  2DWH A;  4R2B A;  4DXB A;  1LCF A;  2AIX A;  2DXY A;  1N3W A;  4XIG Q;  1SYI A;  5AE4 A;  1SDX A;  4YKJ A;  4H1X A;  5AA4 A;  3K1M A;  3U1O A;  1IXC A;  1IXH A;  1SQY A;  1D4N A;  1MH4 A;  4N6P A;  4ESX A;  1IXI A;  1MY1 A;  1ZTY A;  4F3S A;  3HV1 A;  1I6Q A;  4JB7 A;  4PE5 B;  1MDP 1;  3R7X A;  3LBS A;  3CSB A;  3IJX B;  1DOT A;  2XXW A;  5ELV A;  4GQO A;  4C1T A;  2V84 A;  2V3T A;  1HSL A;  2R71 A;  2QL3 A;  3PGF A;  3HN0 A;  2XXP A;  1Y1Z A;  4ZED A;  4OER A;  1QUI A;  2XXV A;  4PFW A;  2OK2 A;  4X1B A;  4MLV A;  1Y3Q A;  3VV5 A;  1PEB A;  1B7Z A;  1M5C A;  1N0T A;  2I48 A;  1P1O A;  5IAI A;  2R6G E;  1SYH A;  3E13 X;  4OXV A;  4U4X A;  4IO7 A;  3M8U A;  4K3F A;  1SVX B;  3UOR A;  2I0C A;  4OWD A;  3U92 A;  1JVY A;  2O7U A;  4LQ5 A;  2FNC A;  3KJT A;  3C9H A;  3Q29 A;  2D3I A;  1US4 A;  4WXJ A;  4YIC A;  3Q26 A;  2XXR A;  3TZA A;  2UVG A;  4LVQ A;  5I57 A;  2ONK E;  3TEL A;  3T96 B;  2REG A;  4OES A;  5DTB A;  2ZNU A;  4RA1 A;  3E3K A;  5AA4 B;  2GHA A;  5I58 A;  2QMW A;  3IO4 A;  4OFO A;  2XX7 A;  2RKM A;  3LSW A;  1SW5 A;  4GRK A;  4FAJ A;  3HHF A;  2X26 A;  3RLF E;  3VFJ A;  4LAT A;  4NF5 B;  4NF8 A;  3FXU A;  1B32 A;  3Q25 A;  1AH5 A;  3U72 A;  1ZJL A;  3T22 A;  3IAZ A;  3EN3 A;  4ECF A;  1PB8 A;  3S9M C;  3CFL A;  2XD2 A;  3TUS A;  2Z23 A;  3VVD A;  3CI8 A;  3SEW A;  1POY 1;  3CFX A;  3U93 A;  2KLF A;  4HCW A;  3U94 A;  4OZ9 A;  3RQT A;  4ELO A;  3OEK A;  1URD A;  3KFM A;  5TU0 A;  3EHT A;  4GOT A;  3SET A;  2XXY A;  3BFT A;  4G8N A;  4O3B A;  3ILT B;  3SEU A;  3IL1 B;  4AB6 A;  1ZLQ A;  4MLQ A;  4RPN A;  1B3H A;  1MY3 A;  1VSO A;  1QKB A;  5I2N A;  3G3F A;  2UXA A;  1ATG A;  3I3V A;  2QRY A;  1DTG A;  4U23 A;  2DYX A;  2VD3 A;  4OET A;  1DPP A;  4ELR A;  3KOT A;  4PFT A;  3FAT A;  2IEE A;  1B46 A;  1PB9 A;  3IOT A;  3S9L C;  5DVJ A;  3O28 A;  3TTN A;  3JZJ A;  4DE8 A;  2XXI A;  2RC7 A;  4H6D A;  4YMA A;  3TCG A;  2F6P A;  3DM0 A;  3VDF A;  1MXX A;  2XXQ A;  4NWD A;  4R9F A;  4H8J A;  3VXC A;  4XKR A;  4QFL A;  4AB5 A;  3RTW B;  3TDJ A;  4NMY A;  4I9D A;  4GXA A;  2Y7R A;  4YZZ A;  1N04 A;  1ZMG A;  2O69 A;  2RC9 A;  4NF8 B;  2ONS A;  3MPK A;  5L9S A;  3P7I A;  2DE2 A;  3SER A;  3HST A;  1SI0 A;  2VD2 A;  5K2X A;  4TLM B;  1MXW A;  2UYE A;  1NNK A;  3D4G A;  4P0I A;  1B4H A;  4ZEI A;  4GFR A;  3OEM A;  1ELJ A;  1MXU A;  1MG1 A;  2B3B A;  2XX9 A;  1A99 A;  1MY4 A;  3BFU A;  2Q8J A;  3WAE A;  4IY6 A;  4ZE8 A;  2ZYO A;  1MQJ A;  1MRP A;  4F1Y A;  3VLU A;  2UVH A;  1QKA A;  1SW4 A;  2RC8 A;  4HW8 A;  3RNN A;  4EXL A;  3MP8 A;  3O66 A;  5FTH A;  4FAT A;  2IA4 A;  1JW1 A;  2Z8E A;  1MQD A;  3GLB A;  3FJG A;  4X1D A;  2NOO A;  3MC2 A;  2DXR A;  3RGY A;  2O68 A;  3GXA A;  1UTB A;  5KDT A;  1MPD A;  5AA3 A;  4F39 A;  5FHO A;  4R73 A;  2NWJ A;  2B65 A;  4PQJ A;  3G3I A;  1LFI A;  4ZE9 A;  3KZG A;  1MDQ A;  3O6G A;  4AQ4 A;  4ELQ A;  3GBB A;  2PYY A;  2Q2C A;  3PUX E;  4X9T A;  2ALU A;  3FXQ A;  3OO9 A;  1F9B A;  2Y7W A;  4KHZ E;  5DVF A;  5TP9 B;  3W9V A;  3A3C A;  5A5X A;  2DE3 A;  4JWX A;  2I3V A;  2V25 A;  3FUZ A;  1Q1K A;  1Y9U A;  2F35 A;  3KSX A;  2PT2 A;  3FJM A;  4P11 A;  3K00 A;  3T9U A;  2HAU A;  1WVJ A;  3MBP A;  4ZDM A;  3TTK A;  2O84 X;  3MVY A;  3SEV A;  2R9J A;  2A5S A;  2VGQ A;  3LC8 A;  4LUB A;  5H8H A;  3T9X B;  1JW5 A;  4OEN A;  3PU5 A;  5DVI A;  5AA2 D;  4TQU Q;  1POT A;  3L6G A;  4NF6 A;  1M5E A;  2HCA A;  5I84 A;  1FTL A;  4KYS A;  3EHS A;  2ZYM A;  5AA2 B;  2F97 A;  5M2V A;  1EH3 A;  2UVJ A;  3DEL B;  1AOV A;  4MF3 A;  5ISU A;  3RY3 A;  2RF1 A;  1MQG A;  1S50 A;  4ZEF A;  4F19 A;  3K6V A;  1QUL A;  3PMV A;  1NKX A;  3PPR A;  5ICT A;  1PDA A;  3A09 A;  3VE1 B;  4QFN A;  3OSR A;  3K01 A;  2WKY A;  4G2Z A;  2M8C A;  3K4U A;  3OSQ A;  3FVO A;  4QF9 A;  1XT8 A;  1EU8 A;  3C36 A;  3IO6 A;  4ZEK A;  2F8D A;  4R2F A;  3M3K A;  1OVT A;  1Y3N A;  1S9T A;  1KWH A;  3HPI A;  3T9V A;  5LOM A;  5J1D A;  1B3L A;  2A5T A;  4HS7 A;  1LGB C;  5H8F B;  3OO7 A;  5B7D A;  3B6Q A;  3TTL A;  4H8I A;  1WDN A;  1N84 A;  2OWT A;  2OWS A;  2GH9 A;  5I59 B;  4U1O A;  1MXV A;  2G93 A;  3O29 A;  3PMW A;  4GF8 A;  3ZSF A;  4YB7 A;  4OEU A;  3K6X A;  3UA8 A;  1XOC A;  4KYD A;  4ZEB A;  3IOV A;  1UQW A;  1RYX A;  4R75 A;  5HBC A;  4QSC A;  2ABH A;  3I6V A;  1XS5 A;  3ECR A;  1N3X A;  2I6E A;  4EQ7 A;  3HHG A;  1YPN A;  1UIV A;  1AL3 A;  3FAS A;  5I56 A;  2RCB A;  4GLI A;  1XHY A;  2Y7P A;  3TMG A;  4R9G A;  5CMM A;  3TKD A;  3PUW E;  4QHQ A;  1JEV A;  4PP0 A;  1B5J A;  5CBR A;  5AA1 A;  3T9H B;  4THI A;  4WEP A;  2Q2A A;  2I4B A;  1VFD A;  4QFP A;  2V3Q A;  2I0B A;  4POX A;  4MFI A;  3T66 A;  5B70 A;  2F34 A;  3QAX A;  1NH8 A;  2HXW A;  3W15 C;  1BTJ A;  1OIB A;  3VVE A;  4JWO A;  5I2K B;  1II5 A;  3GBA A;  3G3K A;  3R26 A;  3RPW A;  5FHM A;  2ZMB A;  2OJT A;  5K2Y A;  4NTL A;  4DIG A;  1PBP A;  1JW4 A;  2QS4 A;  5CBS A;  1B3F A;  3C32 A;  4OTE A;  2GRV A;  4KQP A;  4YKP A;  1LLS A;  2ZYN A;  2QPQ A;  3TQL A;  4IGR A;  4FIM A;  4EDP A;  4BDL A;  5BWJ A;  1I6A A;  1AIV A;  4R72 A;  1LAF E;  3FV2 A;  4ESW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...