4OTEA

Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
238
structure length
238
Chain Sequence
DKKIVVGATLVPGGELLEELKPLIKEKGYTLEVKNFDDYILPNEALNNGEIDANLFQHEPYLKEAVKAKGYKIMAGKKLYVCPAILYSYKIKSVDEFKKGDTIAISNNPSSCSKNLRYLESIGLLTLPKGDGLVSPKDIIENPKGIQFKELDIAQIPSSLPDVTAAFIDTTYAVPAGLDAKKNGIYTAPINDEYANLLAFRTEDKDSEKIKVLQDVLTSDKARSLIEEKYKGIVIPTFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative lipoprotein (CD630_1653) from Clostridium difficile 630 at 2.20 A resolution
rcsb
source organism Clostridium difficile
molecule tags Protein transport
molecule keywords Lipoprotein
total genus 74
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03180 Lipoprotein_9 NLPA lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oteA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oteA02
3HHGA 1XC1A 4U1OA 4OHNA 1WDNA 1DPEA 2XXRA 4HS7A 4X1BA 5A5XB 3IO6A 4PP0A 3MWBA 4PFTA 3U94A 4OENA 1QJMA 4F3PA 3UA8A 1PDAA 5LOMA 1A40A 3DP8A 3G3HA 4GL0A 4KYEA 4RYAA 1UTHA 4C0RA 1NNPA 3BKIB 4R74A 3FZVA 1YCJA 2B3BA 2RKMA 3KEIA 4XKNA 3UGWA 3VDFA 1LFHA 2XXUA 4ELRA 1N0TA 2I6EA 3Q28A 1NFTA 3EQ1A 4GQOA 1M5CA 1N7WA 1SW5A 3A3CA 3CI8A 1JVYA 1LB8A 3K6VA 3OOAA 3PPRA 2DWHA 4N6PA 1JEUA 4WEDA 3PGFA 3SESA 3MP1A 5TPAA 2OWTA 4F3GA 4ELPA 2H99A 3K6WA 4RPOA 3PV0E 2GFEA 2O51A 2V84A 3RLFE 3PUWE 1FQAA 4JXIA 5H8QB 1LAHE 1EH3A 2PT2A 4PETA 2XXHA 2F36A 3U92A 4Q8RA 4Z7EA 5BWJA 3S4UA 3D4GA 3R7XA 3K1NA 2QL3A 2DVZA 2UVGA 1PBPA 3IJXB 4PE5B 3RT6B 1MH3A 3PPQA 2I4BA 5DEXB 5FHMA 3VVEA 4FEBA 3T9XB 3F11A 5H8SA 2QS2A 1FCKA 1JW5A 1OVTA 2GRVA 5H8FA 4IO2A 5TU0A 5AA4B 2QPQA 1HSJA 4H5FA 3GBAA 1Y3QA 2NOOA 4NWDA 1ZJLA 4AQ4A 2KLFA 4GF8A 1URGA 1SVXB 3FV2A 3LSWA 4KQPA 1LCFA 3LSXA 3HN0A 4QSCA 3TQWA 4BDOA 3CRBA 4F39A 3QK6A 4I8CA 2F8DA 3CFLA 2V3QA 4UACA 3IOVA 1OMPA 3O29A 4JWYA 1IITA 4U4XA 1P1UA 4F31B 2NUVA 3U93A 3FASA 1EZPA 4P0GA 2HQ0A 3C35A 3O2AA 5I2KA 5I56B 4EQ7A 1B0LA 3JV9A 4KPTA 4QF9A 1MQIA 1P1OA 2CMOA 5JK4A 2V3UA 3G3KA 3T93B 4F1UA 1B5IA 2PMSA 1QUIA 4OXVA 4F22A 4EF1A 4WKMA 5FTIA 1UTBA 3LSLA 4K3FA 3T22A 3TCGA 3DM0A 1P1WA 4DXCA 3ZS6A 4YMAA 5AA3A 5B70A 4THIA 4XKRA 4YB6A 3G3IA 1FTMA 3GXAA 5F7VA 1B0HA 1MY0A 1ZKBA 3KN3A 1I6BA 3M8UA 3ODBA 4AB6A 1GV8A 1MXVA 1J1NA 1QW0A 2QS3A 5I59B 4RK2A 4H8IA 1SI0A 5ISUA 1B3HA 1D4NA 1SQYA 3G3FA 2O69A 5TPAB 3OELA 3FD3A 2UYEA 3QUFA 3VXBA 2Q2CA 3CSBA 4I9DA 4LQ5A 1MPCA 1FQCA 2X26A 3U1OA 1M5FA 4N07A 5CI5A 1KWHA 4ONYA 4ZEFA 1EZOA 4O3BA 2HCAA 1USYH 3C34A 4GLIA 3JZJA 2ANJA 5J1DA 1SW1A 2ZMBA 1MRPA 1IXGA 3HCQA 4YKIA 4ZDMA 3V83A 2NWJA 3W15C 3TPAA 5BUUA 3FGSA 1IUDA 4LUBA 1QUKA 3RTFB 4DIGA 2BJJX 1RYOA 4Q30B 3G7WA 2Y84A 3GBBA 2DS9A 4X48A 3IAZA 4LVQA 3TODA 1GVCA 4OERA 2O84X 4EDPA 1BLFA 1LAFE 1LAXA 1MQDA 1AH5A 1JW4A 1PB7A 3Q29A 5EHMA 4BDMA 4F2OA 3MP6A 2OBGA 3UP9A 2Y7RA 1H44A 1LCTA 2PVUA 3PMXA 4TOZA 1VFDA 1OLCA 2M8CA 3MZ9A 2Q8JA 1ATGA 1B1XA 4MH5A 3KN7A 5FHOA 3G3JA 5H8FB 2UVIA 3ONMA 3RNNA 4G4PA 4H1XA 4TLLB 4EF2A 3TEPA 4HTGA 3FVNA 1Y4CA 3O66A 5I2NA 1S50A 4IO7A 2XXXA 4U2RA 3O6IA 2QS4A 3V5AA 5CBSA 2RF1A 5CBRA 2ZYKA 3M3LA 5H8QA 3VXCA 2H5YA 1USYE 3TCHA 5ITPA 3TUSA 2RC9A 3O97A 2XXIA 1BP5A 1Q1KA 1SW4A 1LFGA 4NMYA 5TP9B 1XOCA 3H03A 3LUYA 4R75A 1N04A 3K02A 3E4RA 3KJTA 3FJMA 2HZKA 3OSRA 2Y7PA 4MBPA 3B6TA 3KN8A 1L5TA 1URSA 3IB0A 3K00A 3TTRA 5A5XA 4EQ9A 4ZZEA 5H8NB 1H45A 2YJPA 2ZNTA 3K6XA 3LR1A 4ZECA 3LSFB 3MW0A 5CMKA 1DMBA 3C36A 1FTLA 4KCCA 4QFKA 4YAHX 4DCYA 3TTKA 2QMXA 4OMBA 1SBPA 3H6TA 4Q5TA 4BLAA 2F78A 1B9JA 2F7CA 3CG1A 3TAJA 2FYIA 4O3CA 1B52A 1Y4TA 2HZLA 4MLQA 3MPKA 4NWCA 5DTBA 3A3UA 3OEKA 1B6HA 1N84A 2I48A 4M1VA 3VLVA 1R6ZA 1Y20A 2F6PA 4G8MA 4G8NA 4C1TA 1UTHB 5B7DA 2THIA 3T9VA 2Q88A 3Q25A 4RA1A 2GH9A 2QMWA 2RCBA 4LATA 5ICTA 5K2XA 1OIBA 2O68A 2OJTA 1MY1A 2P0SA 4FATA 1LBBA 1MH4A 3TYHA 3K1PA 2GHAA 4FJPA 4DZ1A 1AMFA 3KSJA 4NF6A 1O7TA 3S9EA 4KHZE 1QUJA 4NEDA 1TWYA 4IO4A 3CVGA 3SKPA 2VD2A 5FTHA 3ZKKA 2DYXA 4H0WA 2W7YA 3ILTB 3GLBA 1QKBA 5K2YA 1FQBA 3U8QA 1R9LA 5L8DA 1SYIA 2HEUA 3PUVE 5AA2B 1CE2A 5CC2A 3CR9A 2OWSA 3MP8A 4JDFA 2AYSA 5I59A 3S9LC 3MPLA 4ZEBA 1M5BA 4PQJA 4YKPA 1NNKA 1DSNA 1IQ7A 1MPDA 3FXRA 5CM6A 3PMVA 3TDJA 2DP8A 2I0CA 4OTEA 2GHBA 4F19A 2VP1A 3VVDA 5L9SA 4RY1A 2XXQA 3FJGA 3PUZE 3N26A 4H8JA 2WKYA 2QJEA 4X9TA 3S9NC 4OQOA 3CFZA 2O7UA 3P7IA 3K1MA 1H76A 1GTKA 4KD5A 4KFQA 3SEYA 1AOVA 4QFPA 3DP6A 4XKPA 4F3BA 4IGTA 4KI0E 3PMWA 4GFRA 4NTLA 5CMCA 3OO6A 5DT6A 5AE4A 3L6HA 2AL4A 4ZS9A 3LBSA 2A5TA 4F1VA 3MQ9A 4R6KA 4GOTA 4F2QA 1LAGE 3EHTA 3PUYE 5DYHA 3TZAA 1DOTA 4EXKA 5KCJB 1A8FA 1XVYA 1YPNA 1NH7A 1Y3PA 1IXHA 3DP4A 1TT1A 5I2NB 3W9WA 1OQGA 2ZYNA 1EU8A 1OVBA 1URDA 3RGYA 1FQDA 2ONSA 4NF6B 3ZSFA 1MQHA 2Z8FA 1SW2A 2ESNA 4DXUA 3HHFA 1SDXA 1MG1A 2E0SA 2D3IA 3QIMA 2XXPA 5I84A 1NMUA 1Z7ME 1D9VA 4PFUA 3TTLA 3K6UA 2F7BA 4G68B 1BKAA 1FTKA 1MQJA 2E1SA 4JWXA 3KJ7A 1MY3A 2OCUA 2DQVA 3MAMA 3W9VA 1US5A 4BDRA 1B7ZA 3DELB 1PB8A 2F97A 3MZ1A 2VGQA 3IL1B 1A99A 4IO3A 4F18A 5IAIA 1B4HA 1JEVA 1MXZA 1TFDA 2PYYA 1SYHA 2QRYA 1NNTA 2ZYOA 3PD8A 1NNFA 4IGRA 4POXA 4U4SA 4KYDA 1I6QA 3RY3A 4FAJA 3FIRA 3FVKA 4ESXA 1Z7NE 3H06B 1DPPA 1MDQA 3SEXA 2H98A 2X7QA 3DLNA 4NF5B 3N94A 3PPOA 4G68A 4OESA 5F1QA 3KZGA 3HPIA 4M4GA 4R2FA 3AXFA 3RN8A 3SEVA 1IIWA 4IO5A 3PU5A 4NE4A 2P1SA 3ECRA 4U23A 5H8HB 3SEWA 1UIVA 3RTWB 1B3FA 3KBRA 2Q89A 3KFMA 2DVCA 4P0IA 1NL5A 2XX8A 2Y7IA 3CG3A 3EN3A 1P1QA 2AIXA 2DSFA 1IXIA 3KOTA 4QFNA 1UQWA 4R2BA 1MDP1 3QUJA 2I49A 3RQTA 3TELA 3MZBA 1GR2A 2FNCA 4QFLA 1B32A 1LLSA 4H67A 1POY1 1EZ9A 1FQEA 3N6TA 3C9HA 2YPNA 2F35A 2UVHA 4IB2A 4LZ5A 4DXBA 5KCJA 2A5TB 1B2HA 1XHYA 2B3FA 2X7PA 3L6GA 2H4IA 5EHSA 2Q2AA 1A54A 3I3VA 4GWOA 4F3SA 3GZGA 1D9YA 5ITOA 1OQHA 3UN6A 2PBWA 2DOJA 3IOTA 4FE8A 1ANFA 1ZBMA 3EF7A 3H7MA 3MBPA 4LZ8A 4OFJA 1MS7A 3O28A 4LA9A 4YZZA 4YICA 3T66A 3T9UA 4E0XA 1FTJA 1UIUA 2ONKE 3TFLA 2LAOA 4DDDA 2DXRA 5ELVA 3T9HB 3TTNA 4HCWA 1P99A 1PBQA 3FV1A 3H3GA 4DCXA 1JW1A 3MVYA 1B46A 3TKDA 2Z23A 1LFIA 5HPQA 3N5LA 1QULA 2I0BA 4LQ2A 1H43A 3VVFA 5I58A 4C1UA 5HBCA 4N13A 1XVXA 4I62A 1R9QA 3BBRA 4PFWA 3B6WA 5DVFA 2OZZA 1LSTA 3IO4A 3EPEA 3Q27A 2RC8A 1O64A 4OZ9A 2YLNA 4BDLA 1O63A 5AA2A 1I6AA 1N76A 3PPNA 4GXAA 2DE4A 2F6GA 5L9OA 4U21A 3USDA 1HSLA 1UTBB 1PEBA 1ELJA 4OETA 4G2ZA 3S2VA 2VOZA 5I58B 5KDTA 2I3WA 2REJA 3TQLA 4KCDA 3MJNA 4IY5A 3WAEA 4DE8A 4E0WA 1AL3A 2OK2A 1TFAA 4XIGQ 3FATA 5FHNA 4JBZA 1WVJA 2I4CA 4BDQA 1MXXA 4QHQA 4GD5A 3C4MA 3A09A 1VFEA 2UXAA 2QS1A 1BIYA 2FA7A 3IB2A 3MC2A 3OEMA 3OMBA 2XXWA 4RPNA 4DLDA 2G93A 5AA4A 4RK9A 4OVJA 2D21A 4GVOA 3U72A 1XT8A 5L9MA 2XHDA 1N7XA 5KDTB 3VLWA 1XS5A 4R9GA 1ZLQA 4F1YA 1OLAA 2DWAA 1Y1ZA 3H6VA 4GIZA 4QFOA 1M5EA 1NH8A 3IK6B 3M3KA 2OLBA 4G68C 4LP2B 4XKQA 5H8HA 1HSEA 2HAVA 4NF8B 4ZZAA 1QVSA 3H4ZA 1SI1A 1B3LA 5TP9A 2HFBA 4ELOA 3I5OA 2AL5A 3O9PA 4EXLA 3OO9A 2H25A 2XXTA 5DEXA 5EYFA 3RUMA 4JSOA 1B1HA 3C32A 4MF3A 3IOWA 1P1NA 4U22A 2VD3A 2RINA 2REGA 5I57A 3SEUA 4BDNA 2ZYMA 2RC7A 4QSEA 1IEJA 4L17A 1ZMGA 2QSXA 2XD2A 4QRZA 2DWJA 1A7LA 2O6AA 3IORA 1POTA 3G3GA 1JNFA 1TXFA 3FJ7A 1BTJA 3R6UA 2DE2A 1QKAA 2DE3A 3N6UA 3C33A 3E9XA 4OEUA 4OYVA 4XTCQ 3TCFA 1F9BA 1R1NA 2ZNSA 3PD9A 1LBCA 2D5WA 3ZKLA 1MY4A 2F5XA 1JQFA 1WODA 3O6GA 1S7YA 2IEEA 1LGBC 1ZIUA 2Q9TA 1A55A 2V93A 1NKXA 2XXVA 3D4CA 3FXQA 3QAXA 4ZE9A 4YKKA 4R9FA 1VR5A 1VE4A 3UK4A 4F29A 4EUOA 5AA2D 1SD3A 5H8NA 1B7HA 1DTZA 4R6YA 2V25A 4JB7A 5CMMA 3IJOB 3RPWA 5I57B 5JEIA 3MUQA 2ZNUA 3KSXA 2PT1A 3K0VA 3VLUA 1VSOA 5JTYB 3B6QA 3EHSA 3K2DA 4G8HA 4ISUA 1II5A 3QXMA 4Z0IA 4WEPA 3R26A 3BFTA 1ZTYA 1H3DA 4XXUA 1B51A 4ZE8A 4TLMB 5CRYA 3UIFA 4P11A 4Q0CA 1ZU0A 3TTMA 1DTGA 3SETA 2O7IA 3K4UA 4YB5A 4ELQA 4NF4B 2UYFA 2ABHA 4JWOA 1B05A 4OWDA 1MPBA 4RJZA 4HW8A 4OFOA 1B5JA 2B65A 4ND9A 3QYTA 4NF8A 1MXWA 3E3KA 3IR1A 3V8XB 5I56A 3H6UA 2HXWA 4RNSA 1I69A 4MFIA 4EQBA 4ESWA 2ALUA 4LONB 2XX7A 3EHUA 4KYSA 2PX1A 2G29A 2HAUA 3FXUA 3HV1A 4YKJA 1N3WA 5M2VA 2V3TA 3KG2A 3OD7A 5DVJA 3CSGA 3MVZA 3OXNA 2NVUB 3VFJA 1AIVA 4IO6A 1MY2A 2Z22A 4MLVA 1GGGA 1D3KA 3BFUA 4FEDA 4UA8A 3K01A 4ZEKA 2F7AA 2UVJA 2NXOA 4FIMA 4GXSB 1MXYA 2F34A 1MM6A 1B3GA 4JSDA 2R71A 1T0KA 4H65A 3V89B 1FW0A 4I1DA 5CMBA 3VE1B 2R9JA 2Z8EA 3S9MC 2ZXTA 2A5SA 3KOSA 3OENA 4KR5A 1B3EA 3H6WA 1Y9UA 4NF4A 5HM4B 4PFYA 1A8EA 4FECA 4H5GA 1M5DA 1RKMA 2DXYA 3JYRA 3RT8A 4YU0A 1Y3NA 2XXYA 3HO7A 3OO8A 3SERA 3WAFA 1B40A 2XD3A 2H9BA 3MVWA 5AA1A 1Q35A 1YAEA 1JETA 2CZLA 3OSQA 4IY6A 4FORA 3T96B 4YB7A 3THIA 2ONRA 5I2KB 3M3FA 4ECFA 3LC8A 4OEVA 3FUZA 5ICQA 3CFXA 3HSTA 3FVGA 4QSDA 4R6HA 4ZEIA 2I3VA 4R73A 5JTYA 1IZ1A 2RCAA 1JVXA 1RYXA 4AB5A 2DWIA 4WXJA 2O1MA 3B7DA 3C31A 3MVXA 3VV5A 1PB9A 3IX1A 5IKBA 3IOUA 1IXCA 4ZEDA 4NF5A 3O6HA 4POWA 2R6GE 2P2AA 1B7UA 4HCYA 3E13X 2IA4A 3SDFA 1YTVA 3KGCA 3PPPA 4R72A 3TMGA 3PUXE 1PC3A 1MXUA 1S9TA 4OFLA 1B5HA 3IB1A 4H6DA 1US4A 4GL8A 1MQGA 2O1LA 4TQUQ 5DVIA 5KZTA 1MM7A 3UORA 4U1ZA 1LB9A 4GRKA 2Z8DA 3CIJA 1FTOA 3QSLA 4YMBA 4X1DA 4G77A 2Y7KA 4O3AA 1B58A 1Y1MA 3ILUB 4LZ7A 1FQFA 1CB6A 3I6VA 1B4ZA 1N3XA 2Y7WA 2XX9A 3Q26A 4RXLA 3OO7A 3FVOA 2VHAA 2I58A
chains in the Genus database with same CATH superfamily
3HHGA 2WBDA 4PP0A 3DP8A 4GL0A 4KXPA 1YCJA 4XKNA 2XXUA 3Q28A 1NFTA 4LN5A 2KR0A 2V84A 3RLFE 2QFLA 4Z7EA 2F36A 3U92A 3K1NA 2ZZVA 1DCUA 3F11A 1FCKA 1OVTA 4IO2A 2QPQA 2NOOA 4AQ4A 4NF0A 4BDOA 3CRBA 3CFLA 4UACA 3IOVA 4JWYA 1NV5A 5I56B 2FVZA 4KPTA 4QF9A 3RPLA 2V3UA 4F1UA 4OXVA 4EF1A 4WKMA 1UTBA 1EYKA 3G3IA 3GXAA 1B0HA 3ODBA 3M8UA 4NAPA 4AB6A 5I56A 1J1NA 1QW0A 1SI0A 1B3HA 4GX3A 3G3FA 2O69A 2UYEA 1DK4A 3QUFA 2Q2CA 1M5FA 4N07A 3JZJA 1MRPA 3HCQA 4LUBA 4GWUA 3RTFB 4X48A 4EDPA 1BLFA 1LAXA 1MQDA 4F2OA 1CNQA 5EHMA 4HE1A 3UP9A 1LCTA 3PMXA 4TOZA 1OLCA 1ATGA 3RNNA 3ONMA 3O66A 3O6IA 5CBRA 3VXCA 3TUSA 5ITPA 1SW4A 1LFGA 4PDHA 3H03A 3FJMA 4ZZEA 3K6XA 4ZECA 1FTLA 4QFKA 1FBEA 3TTKA 4OMBA 1SBPA 2F78A 1B9JA 3CG1A 2V4CA 5DTBA 3OEKA 1LEVA 1R6ZA 1Y20A 4G8NA 2Q88A 2RCBA 4FATA 2P0SA 4AS5A 1QUJA 4IO4A 3CVGA 2VD2A 1FPDA 2DYXA 4H0WA 2W7YA 4N8GA 5K2YA 5CC2A 2AYSA 1M5BA 4PQJA 4YKPA 1DSNA 3T0JA 5CM6A 2HPGA 2DP8A 1RDXA 3FJGA 3PUZE 2WKYA 4OVQA 2QJEA 4X9TA 5EQ9A 2O7UA 3P7IA 4PGPA 1INPA 4KFQA 4OVTA 4HXVA 1K9ZA 4XKPA 4F3BA 3PMWA 4NTLA 4UABA 4ZS9A 3LBSA 2A5TA 3MQ9A 1NV3A 1LAGE 1DOTA 1A8FA 1XVYA 4PGNA 1YPNA 1EYIA 5DW8A 1URDA 1FQDA 1SW2A 1AWBA 4PFUA 2QVUA 1BKAA 3W9VA 2DQVA 2XWOA 3MAMA 1US5A 3MZ1A 2VGQA 3IL1B 1A99A 4F18A 4MHFA 4OVPA 5IAIA 1JEVA 1TFDA 4POXA 4FAJA 1Z7NE 1DPPA 3N94A 5F1QA 3KZGA 2CZHA 4M4GA 4P1LA 2WX9A 2Y5LA 5H8HB 4GWSA 3EN3A 1P1QA 3KOTA 3RQTA 3TELA 3MZBA 2FNCA 4PF6A 4MX6A 2A5TB 1B2HA 2H4IA 4F3SA 4N6DA 3IOTA 4OFJA 1ANFA 1ZBMA 4LZ8A 3T66A 4LA9A 4E0XA 2ONKE 1B46A 1NV1A 4LQ2A 5DVFA 3IO4A 3EPEA 3PPNA 4P3LA 2DE4A 4PTKA 1ELJA 5I58B 4KCDA 4DE8A 1AL3A 1TFAA 1VFEA 3IB2A 1BIYA 4RPNA 2G93A 2VPNA 5AA4A 3U72A 1N7XA 4R9GA 1OLAA 2DWAA 3H6VA 4QFOA 1NH8A 4HE0A 4XKQA 2OLBA 2HAVA 4ELOA 4MF3A 3C32A 1P1NA 4U22A 5I57A 2REGA 3SEUA 2RC7A 1IEJA 3MSTA 2QSXA 4QRZA 1DBZA 2O6AA 2DE3A 2ZNSA 2D5WA 1MY4A 1IMAA 1JQFA 3O6GA 2XXVA 3EKIA 4YKKA 5AA2D 1B7HA 2V25A 5JEIA 2VPOA 3KSXA 3K0VA 3EHSA 1II5A 2F3BA 1ZTYA 1H3DA 4XXUA 1B51A 4ZE8A 4Q0CA 1DTGA 5I7IA 4OWDA 4HW8A 4OFOA 4ND9A 3H6UA 4N91A 5EQAA 4MFIA 2ALUA 4OA4A 2VT5A 1FPFA 2G29A 5M2VA 2V3TA 3KG2A 4FIMA 1FPEA 1B3GA 4I3YA 3H6WA 4P8BA 4FECA 4H5GA 1RKMA 2DXYA 3JYRA 3SERA 1Y3NA 3WAFA 4PE3A 3UN6A 3MVWA 2CZLA 3THIA 4IY6A 4YB7A 1NI9A 3M3FA 3FUZA 4R73A 1JVXA 1RYXA 4AB5A 4G61A 1PB9A 4MNPA 3IOUA 1IXCA 3E13X 2IA4A 1YTVA 3PPPA 1FPIA 1S9TA 1B5HA 1FBDA 5KZTA 4U1ZA 2Z8DA 4X1DA 1B58A 4H45A 4X1BA 3U94A 3MWBA 4PFTA 4OENA 3UA8A 5LOMA 4GWWA 4C0RA 1UTHA 4R74A 2B3BA 1YYZA 4HE2A 4EXKA 4WEDA 4ELPA 3PV0E 2O51A 3SDFA 1FQAA 4JXIA 4Q8RA 4AS4A 2XXHA 4JVDA 3S4UA 2QL3A 2DVZA 3IJXB 1PBPA 3RT6B 1MH3A 3VVEA 5H8SA 5TU0A 4H5FA 4NHBA 1Y3QA 4GF8A 1SVXB 3FV2A 3LSXA 4PCDA 4QSCA 3TQWA 2V3QA 5IZ1A 2HQ0A 3LUZA 2XA5A 1P1OA 1IMEA 4YMAA 3T22A 4DXCA 3ZS6A 5B70A 4XKRA 4YB6A 1FTMA 1MY0A 1I6BA 4N8YA 5I59B 2QS3A 2XWVA 4RK2A 4H8IA 1D4NA 5TPAB 3OELA 3CSBA 4I9DA 5CI5A 1KWHA 1USYH 1KZ8A 4GLIA 4JVIA 2ANJA 5J1DA 4PBHA 4ZDMA 2NWJA 3TPAA 1IUDA 1QUKA 2BJJX 3G7WA 4XF5A 2OX3A 2DS9A 2KQZA 1LAFE 4BDMA 1PB7A 3Q29A 2OBGA 2Y7RA 2PVUA 4OANA 5ET7A 2Q8JA 2CEYA 1B1XA 3KN7A 1G0HA 4TLLB 3FVNA 1Y4CA 3A29A 5I2NA 2WYPA 4P47A 2ZYKA 3M3LA 5H8QA 3TCHA 1N04A 3K02A 4EQ9A 3LR1A 3MW0A 4BLAA 3TAJA 5ESYA 4O3CA 4NWCA 1B6HA 2THIA 4MNCA 3T9VA 3Q25A 5ICTA 2QMWA 4LATA 4MAGA 3T1BA 4FJPA 4NF6A 1O7TA 4NEDA 1TWYA 3SKPA 3ZKKA 3BIGA 3ILTB 3GLBA 1SYIA 2CEXA 4JDFA 1FBPA 1NNKA 1IQ7A 3TDJA 2GHBA 4F19A 5L9SA 4RY1A 3N26A 1QGXA 4KD5A 3SEYA 4QFPA 3DP6A 4IGTA 5DT6A 3L6HA 4F1VA 3EHTA 5DYHA 5KCJB 5I2NB 1OQGA 4O8MA 2ONSA 4PFRA 2ESNA 1MG1A 2D3IA 1NMUA 3K6UA 2F7BA 4G68B 4JWXA 4BDRA 3DELB 2F97A 4IO3A 4HS7A 1B4HA 2PYYA 3PD8A 5A5XB 1SYHA 4GWZA 1NNTA 1NNFA 4KYDA 4PF8A 4ESXA 4NF5B 4G68A 4R2FA 3AXFA 3RN8A 4IO5A 4U23A 4NE4A 2PCRA 3ECRA 3SEWA 3RTWB 1B3FA 3KFMA 4P0IA 2DVCA 1NL5A 2XX8A 3CG3A 5EYHA 4R2BA 5EYGA 3BIHA 1POY1 1EZ9A 3N6TA 2YPNA 5KCJA 5LTCA 3L6GA 3I3VA 3U65A 1D9YA 1OQHA 5TP9B 3H7MA 1NUZA 3MBPA 1MS7A 1FTJA 1UIUA 3TFLA 2LAOA 4HCWA 1P99A 1PBQA 3MVYA 5HPQA 1LFIA 3N5LA 1QULA 2XWIA 4C1UA 4N13A 1XVXA 3B6WA 2OZZA 1LSTA 4DI4B 3Q27A 4U21A 3USDA 1PEBA 4OETA 2VOZA 3TQLA 4IY5A 4E0WA 5FHNA 1WVJA 4BDQA 4GD5A 3A09A 4GIZA 3OMBA 4F1YA 4DLDA 4RK9A 4OVJA 4GVOA 4I3EA 1Y1ZA 3IK6B 5H8HA 1QVSA 2HFBA 3O9PA 3OO9A 5EYFA 1B1HA 2VD3A 2CZKA 3IFCA 1A7LA 4PETA 1BTJA 3R6UA 2DE2A 3TCFA 3N6UA 3C33A 4OEUA 1LBZA 1LBCA 3D4CA 4ZE9A 3FXQA 4R9FA 1VR5A 3UK4A 5CMMA 3B6QA 3QXMA 1IMBA 4P11A 1ZU0A 3SETA 2O7IA 4YB5A 4JWOA 1B05A 1FJ6A 1LBVA 1MPBA 1B5JA 2FIEA 1NUYA 3E3KA 3IR1A 3V8XB 2HXWA 4N6KA 4RNSA 3EHUA 1NUWA 3HV1A 4YKJA 3VFJA 4IO6A 2Z22A 1D3KA 2R8TA 4DI3D 2UVJA 4H65A 1FW0A 3VE1B 5CMBA 3S9MC 5EQ7A 3OENA 1B3EA 1Y9UA 1A8EA 3OO8A 2XD3A 2P3VA 4ECFA 4OEVA 5ICQA 3HSTA 4NN3A 3FVGA 4O7MA 4R6HA 1IZ1A 2FHYA 2O1MA 3B7DA 3VV5A 4O94A 4NF5A 3O6HA 4POWA 2R6GE 5J16A 3KGCA 4R72A 1MXUA 1US4A 2O1LA 5DVIA 1MM7A 1LB9A 1FTOA 4YMBA 4O3AA 4BDNA 3ILUB 1FQFA 1CB6A 3Q26A 1B4ZA 2ZZXA 2XX9A 4IR8A 2VHAA 2I58A 1XC1A 4OHNA 1DPEA 2XXRA 4F3PA 1PDAA 4KYEA 1NNPA 3FZVA 3UGWA 1LFHA 2I6EA 4GQOA 3PPRA 1N7WA 3D1RA 1FBCA 3A3CA 3CI8A 3K6VA 3VVFA 1XI6A 5IM2A 3PGFA 1FBFA 5TPAA 2OWTA 2H99A 4RPOA 2GFEA 3PUWE 5H8QB 1LAHE 2PT2A 5BWJA 3D4GA 3R7XA 2UVGA 5DEXB 1NV2A 3T9XB 1KA1A 5AA4B 1FPKA 1ZJLA 2KLFA 1URGA 1LBXA 4F39A 3QK6A 2F8DA 3O29A 4F31B 2NUVA 1Q9DA 5I2KA 2CMOA 3T93B 2PMSA 3PTYA 3LSLA 4K3FA 3TCGA 5AA3A 1YXIA 1ZKBA 5ET5A 2L5VA 1GV8A 1MXVA 1SQYA 4LQ5A 1MPCA 2X26A 4ZEFA 4ONYA 4O3BA 3C34A 2XWKA 2ZMBA 2OWZA 4YKIA 5I5PA 4PC9A 4DIGA 3KC0A 4Q30B 2Y84A 3LV0A 3IAZA 3TODA 4OERA 2O84X 5H8FA 1JW4A 4GBVA 2CZIA 1H44A 1VFDA 2M8CA 4MH5A 5FHOA 3G3JA 2UVIA 4FBPA 4G4PA 3TEPA 1S50A 4IO7A 3V5AA 5CBSA 5IZ3A 3O97A 1BP5A 1Q1KA 1XOCA 3E4RA 3KJTA 1L5TA 3KN8A 3TTRA 1URSA 3IB0A 3K00A 5A5XA 5H8NB 1FBGA 1H45A 3LSFB 3C36A 4YAHX 2QMXA 3H6TA 4Q5TA 1B52A 2HZLA 3MPKA 3A3UA 1N84A 4C1TA 1UTHB 5B7DA 2GH9A 1OIBA 2OJTA 1MY1A 1MH4A 3TYHA 3K1PA 4DZ1A 5IZZA 4KHZE 4PFIA 4O7IA 2F3DA 1R9LA 2HEUA 3ISPA 1CE2A 3S9LC 3PMVA 2I0CA 4OTEA 3VVDA 4H8JA 4NX1A 5F24A 4MEVA 4KI0E 4GFRA 5CMCA 3OO6A 5AE4A 2WEFA 4R6KA 4GOTA 4F2QA 2DDKA 3PUYE 3TZAA 1Y3PA 3CHGA 1TT1A 3RGYA 4NF6B 2Z8FA 5IZ3B 4DXUA 1FPLA 3HHFA 1SDXA 1LBWA 3QIMA 5I84A 1Z7ME 1D9VA 1FTKA 2E1SA 3KJ7A 1B7ZA 2ZYOA 3SESA 3RY3A 1I6QA 3FIRA 3FVKA 3SEXA 2X7QA 3DLNA 4PAIA 3HPIA 3SEVA 1IIWA 3PU5A 4GWYA 2FIXA 3KBRA 2DSFA 3KBZA 1IXIA 1UQWA 1MDP1 3QUJA 4QFLA 3B50A 1FQEA 3C9HA 2F35A 3GZGA 2DOJA 4FE8A 4YZZA 4ZEDA 3O28A 3T9UA 1FSAA 4DDDA 2DXRA 5ELVA 1RDYA 3T9HB 2B4LA 3FV1A 4DCXA 1JW1A 4H46A 3TKDA 2Z23A 2I0BA 5HBCA 1R9QA 3BBRA 4PFWA 4PDDA 1O64A 2YLNA 1I6AA 1N76A 1HSLA 4G2ZA 3S2VA 5KDTA 2I3WA 2REJA 4PFBA 4OVRA 3FATA 2I4CA 1MXXA 4QHQA 3MC2A 3OEMA 2XXWA 2D21A 5L9MA 2XHDA 5KDTB 5ET6A 4GX4A 1ZLQA 1FJ9A 1M5EA 4NF8B 5TP9A 1SI1A 2H25A 2XXTA 4JSOA 3E78A 3IOWA 4QSEA 4L17A 1ZMGA 2PFZA 2XD2A 2DWJA 3IORA 1TXFA 3RUMA 3ZSFA 1QKAA 3GYYA 3E9XA 4OYVA 1F9BA 1R1NA 3U1OA 2IEEA 1YZ0A 1ZIUA 2Q9TA 3QAXA 2BJIA 1VE4A 4F29A 1SD3A 5H8NA 1DTZA 4JB7A 5I57B 3IJOB 3RPWA 4ISUA 3K2DA 4PBQA 4Z0IA 5CRYA 1VDWA 4NGUA 3K4UA 4ELQA 4NF4B 2UYFA 2ABHA 4RJZA 2B65A 4NF8A 2WYKA 2XX7A 4KYSA 2PX1A 2HAUA 1SPIA 4N15A 5DVJA 3MVZA 3OXNA 1AIVA 4UA8A 4MLVA 2XXKA 3K01A 2NXOA 4PAKA 4GXSB 1MXYA 1MM6A 1T0KA 2R71A 2Z8EA 4KR5A 2A5SA 4XFEA 1FTAA 1M5DA 2XXYA 1B40A 5AA1A 4GX6A 1YAEA 4FORA 5I2KB 1IMDA 3LC8A 3CFXA 4QSDA 5JTYA 2RCAA 2DWIA 4WXJA 2WBBA 3PUXE 1PC3A 4OFLA 4H6DA 4GL8A 1MQGA 5EQ8A 3VDFA 3I6VA 1N3XA 4RXLA 4LP2B 4U1OA 1WDNA 3IO6A 1QJMA 1A40A 3G3HA 4RYAA 3BKIB 2RKMA 3KEIA 4ELRA 1N0TA 3EQ1A 1M5CA 1SW5A 4N6PA 1JVYA 1LB8A 3OOAA 2DWHA 1JEUA 3MP1A 4F3GA 3K6WA 1EH3A 3RYDA 5A5LA 4MIJA 4PE5B 3PPQA 2I4BA 5FHMA 4FEBA 2QS2A 4JVCA 1JW5A 2GRVA 1HSJA 3GBAA 4NWDA 2HHMA 3LSWA 4KQPA 1LCFA 3HN0A 4I8CA 1OMPA 1IITA 4U4XA 1P1UA 1EZPA 3U93A 3FASA 4P0GA 3C35A 3O2AA 4OVSA 4EQ7A 1B0LA 3JV9A 1MQIA 5JK4A 1FPGA 3G3KA 2JJKA 1B5IA 1QUIA 4F22A 5FTIA 3DM0A 1P1WA 4THIA 5F7VA 3KN3A 2Y5KA 5ISUA 2Q8MA 1NUXA 4QXDA 3FD3A 1RDZA 3VXBA 1FQCA 3HFUA 1EZOA 2HCAA 1SW1A 3V83A 1IXGA 4MJOA 5BUUA 3FGSA 3ROJA 1RYOA 4GBWA 3GBBA 4LVQA 1GVCA 3E79A 1AH5A 3MP6A 4MNIA 4QBAA 2HXRA 3MZ9A 5H8FB 4EF2A 4H1XA 4HTGA 2XXXA 4U2RA 2QS4A 2RF1A 2H5YA 1USYE 4MCOA 2RC9A 2XXIA 4NMYA 3LUYA 4R75A 2FBPA 4GWXA 4MBPA 2HZKA 3OSRA 2Y7PA 3B6TA 1NV7A 2YJPA 2ZNTA 5CMKA 1DMBA 4KCCA 4N81A 4DCYA 1NV0A 2Q74A 2F7CA 2FYIA 1Y4TA 4MLQA 2I48A 4M1VA 3VLVA 2F6PA 4G8MA 4RA1A 5K2XA 2P3NA 1FRPA 2O68A 1LBBA 5FBPA 2GHAA 1AMFA 3KSJA 3S9EA 4N17A 1K9YA 1QKBA 1FQBA 3U8QA 5L8DA 3PUVE 5AA2B 3CR9A 2OWSA 3MP8A 5I59A 3MPLA 4ZEBA 1EYJA 3FXRA 1MPDA 2VP1A 2XXQA 3S9NC 4OQOA 3CFZA 3K1MA 1H76A 1GTKA 1AOVA 1FBHA 2AL4A 1LBYA 1NH7A 1IXHA 5ET8A 3DP4A 3W9WA 2ZYNA 1EU8A 1OVBA 4X8RA 1MQHA 2E0SA 2QVRA 2XXPA 3TTLA 1MQJA 1IMFA 1MY3A 2OCUA 1PB8A 2MKZA 3FBPA 1MXZA 2QRYA 4IGRA 3W15C 4U4SA 5T3JA 3FXBA 3H06B 1MDQA 2H98A 3PPOA 3SZPA 4OESA 2P1SA 1UIVA 2Q89A 2Y7IA 4QFNA 2AIXA 4BDLA 2I49A 1GR2A 1B32A 1LLSA 4H67A 2UVHA 4IB2A 4LZ5A 4DXBA 1XHYA 2B3FA 2X7PA 5EHSA 2Q2AA 1A54A 4GWOA 1NV6A 5ITOA 2PBWA 3EF7A 4YICA 2ZZWA 3TTNA 3H3GA 1H43A 5I58A 4NG7A 4I62A 1IMCA 1D9QA 4OZ9A 2RC8A 5AA2A 1O63A 4GXAA 2F6GA 5L9OA 1UTBB 3WAEA 3MJNA 4N4UA 2OK2A 4XIGQ 4JBZA 4P56A 3C4MA 3KC1A 2UXAA 1G0IA 2FA7A 2QS1A 3QMFA 1XT8A 1BK4A 1KA0A 3VLWA 1XS5A 2QVVA 3M3KA 4G68C 1HSEA 4ZZAA 5IGAA 3H4ZA 1B3LA 3I5OA 2AL5A 4EXLA 3RPLB 5DEXA 3IFAA 4P1EA 2RINA 2ZYMA 1POTA 3G3GA 1JNFA 5FTHA 3FJ7A 4XTCQ 3PD9A 4X04A 3ZKLA 1JP4A 2F5XA 1WODA 1FPBA 1FPJA 1S7YA 1LGBC 2V93A 1A55A 1NKXA 4EUOA 4R6YA 3MUQA 2ZNUA 2PT1A 3VLUA 1VSOA 5JTYB 4NQ8A 4G8HA 2PFYA 4WEPA 3R26A 3BFTA 4TLMB 3UIFA 3TTMA 2GQ1A 1NV4A 3QYTA 1MXWA 2B4MA 1I69A 4EQBA 4ESWA 4LONB 3FXUA 1N3WA 4I40A 3OD7A 3CSGA 2NVUB 1MY2A 4ZEKA 1GGGA 4FEDA 3BFUA 2F7AA 5LDZA 2F34A 4JSDA 3V89B 4I1DA 2R9JA 2ZXTA 3KOSA 5HM4B 4NF4A 4PFYA 3RT8A 4YU0A 3HO7A 2H9BA 1Q35A 3MYUA 1JETA 3T96B 3OSQA 2ONRA 4ZEIA 2I3VA 3C31A 3MVXA 3IX1A 5IKBA 2P2AA 1B7UA 4HCYA 4P9KA 4MMPA 3TMGA 4TQUQ 3IB1A 4XEQA 3UORA 4GRKA 3CIJA 4PAFA 3B8BA 3QSLA 3NOHA 4G77A 2Y7KA 1Y1MA 4LZ7A 2Y7WA 3OO7A 3FVOA 5I3SA
chains in the Genus database with same CATH topology
3HHGA 1XC1A 4U1OA 4OHNA 1WDNA 1DPEA 2XXRA 4HS7A 4X1BA 5A5XB 3IO6A 4PP0A 3MWBA 4PFTA 3U94A 4OENA 1QJMA 4F3PA 3UA8A 1PDAA 5LOMA 1A40A 3DP8A 3G3HA 4GL0A 4KYEA 4RYAA 1UTHA 4C0RA 1NNPA 3BKIB 4R74A 3FZVA 1YCJA 2B3BA 2RKMA 3KEIA 4XKNA 3UGWA 3VDFA 1LFHA 2XXUA 4ELRA 1N0TA 2I6EA 3Q28A 1NFTA 3EQ1A 4GQOA 1M5CA 1N7WA 1SW5A 3A3CA 3CI8A 1JVYA 1LB8A 3K6VA 3OOAA 3PPRA 2DWHA 4N6PA 1JEUA 4WEDA 3PGFA 3SESA 3MP1A 5TPAA 2OWTA 4F3GA 4ELPA 2H99A 3K6WA 4RPOA 3PV0E 2GFEA 2O51A 2V84A 3RLFE 3PUWE 1FQAA 4JXIA 5H8QB 1LAHE 1EH3A 2PT2A 4PETA 2XXHA 2F36A 3U92A 4Q8RA 4Z7EA 5BWJA 3S4UA 3D4GA 3R7XA 3K1NA 2QL3A 2DVZA 2UVGA 1PBPA 3IJXB 4PE5B 3RT6B 1MH3A 3PPQA 2I4BA 5DEXB 5FHMA 3VVEA 4FEBA 3T9XB 3F11A 5H8SA 2QS2A 1FCKA 1JW5A 1OVTA 2GRVA 5H8FA 4IO2A 5TU0A 5AA4B 2QPQA 1HSJA 4H5FA 3GBAA 1Y3QA 2NOOA 4NWDA 1ZJLA 4AQ4A 2KLFA 4GF8A 1URGA 1SVXB 3FV2A 3LSWA 4KQPA 1LCFA 3LSXA 3HN0A 4QSCA 3TQWA 4BDOA 3CRBA 4F39A 3QK6A 4I8CA 2F8DA 3CFLA 2V3QA 4UACA 3IOVA 1OMPA 3O29A 4JWYA 1IITA 4U4XA 1P1UA 4F31B 2NUVA 3U93A 3FASA 1EZPA 4P0GA 2HQ0A 3C35A 3O2AA 5I2KA 5I56B 4EQ7A 1B0LA 3JV9A 4KPTA 4QF9A 1MQIA 1P1OA 2CMOA 5JK4A 2V3UA 3G3KA 3T93B 4F1UA 1B5IA 2PMSA 1QUIA 4OXVA 4F22A 4EF1A 4WKMA 5FTIA 1UTBA 3LSLA 4K3FA 3T22A 3TCGA 3DM0A 1P1WA 4DXCA 3ZS6A 4YMAA 5AA3A 5B70A 4THIA 4XKRA 4YB6A 3G3IA 1FTMA 3GXAA 5F7VA 1B0HA 1MY0A 1ZKBA 3KN3A 1I6BA 3M8UA 3ODBA 4AB6A 1GV8A 1MXVA 1J1NA 1QW0A 2QS3A 5I59B 4RK2A 4H8IA 1SI0A 5ISUA 1B3HA 1D4NA 1SQYA 3G3FA 2O69A 5TPAB 3OELA 3FD3A 2UYEA 3QUFA 3VXBA 2Q2CA 3CSBA 4I9DA 4LQ5A 1MPCA 1FQCA 2X26A 3U1OA 1M5FA 4N07A 5CI5A 1KWHA 4ONYA 4ZEFA 1EZOA 4O3BA 2HCAA 1USYH 3C34A 4GLIA 3JZJA 2ANJA 5J1DA 1SW1A 2ZMBA 1MRPA 1IXGA 3HCQA 4YKIA 4ZDMA 3V83A 2NWJA 3W15C 3TPAA 5BUUA 3FGSA 1IUDA 4LUBA 1QUKA 3RTFB 4DIGA 2BJJX 1RYOA 4Q30B 3G7WA 2Y84A 3GBBA 2DS9A 4X48A 3IAZA 4LVQA 3TODA 1GVCA 4OERA 2O84X 4EDPA 1BLFA 1LAFE 1LAXA 1MQDA 1AH5A 1JW4A 1PB7A 3Q29A 5EHMA 4BDMA 4F2OA 3MP6A 2OBGA 3UP9A 2Y7RA 1H44A 1LCTA 2PVUA 3PMXA 4TOZA 1VFDA 1OLCA 2M8CA 3MZ9A 2Q8JA 1ATGA 1B1XA 4MH5A 3KN7A 5FHOA 3G3JA 5H8FB 2UVIA 3ONMA 3RNNA 4G4PA 4H1XA 4TLLB 4EF2A 3TEPA 4HTGA 3FVNA 1Y4CA 3O66A 5I2NA 1S50A 4IO7A 2XXXA 4U2RA 3O6IA 2QS4A 3V5AA 5CBSA 2RF1A 5CBRA 2ZYKA 3M3LA 5H8QA 3VXCA 2H5YA 1USYE 3TCHA 5ITPA 3TUSA 2RC9A 3O97A 2XXIA 1BP5A 1Q1KA 1SW4A 1LFGA 4NMYA 5TP9B 1XOCA 3H03A 3LUYA 4R75A 1N04A 3K02A 3E4RA 3KJTA 3FJMA 2HZKA 3OSRA 2Y7PA 4MBPA 3B6TA 3KN8A 1L5TA 1URSA 3IB0A 3K00A 3TTRA 5A5XA 4EQ9A 4ZZEA 5H8NB 1H45A 2YJPA 2ZNTA 3K6XA 3LR1A 4ZECA 3LSFB 3MW0A 5CMKA 1DMBA 3C36A 1FTLA 4KCCA 4QFKA 4YAHX 4DCYA 3TTKA 2QMXA 4OMBA 1SBPA 3H6TA 4Q5TA 4BLAA 2F78A 1B9JA 2F7CA 3CG1A 3TAJA 2FYIA 4O3CA 1B52A 1Y4TA 2HZLA 4MLQA 3MPKA 4NWCA 5DTBA 3A3UA 3OEKA 1B6HA 1N84A 2I48A 4M1VA 3VLVA 1R6ZA 1Y20A 2F6PA 4G8MA 4G8NA 4C1TA 1UTHB 5B7DA 2THIA 3T9VA 2Q88A 3Q25A 4RA1A 2GH9A 2QMWA 2RCBA 4LATA 5ICTA 5K2XA 1OIBA 2O68A 2OJTA 1MY1A 2P0SA 4FATA 1LBBA 1MH4A 3TYHA 3K1PA 2GHAA 4FJPA 4DZ1A 1AMFA 3KSJA 4NF6A 1O7TA 3S9EA 4KHZE 1QUJA 4NEDA 1TWYA 4IO4A 3CVGA 3SKPA 2VD2A 5FTHA 3ZKKA 2DYXA 4H0WA 2W7YA 3ILTB 3GLBA 1QKBA 5K2YA 1FQBA 3U8QA 1R9LA 5L8DA 1SYIA 2HEUA 3PUVE 5AA2B 1CE2A 5CC2A 3CR9A 2OWSA 3MP8A 4JDFA 2AYSA 5I59A 3S9LC 3MPLA 4ZEBA 1M5BA 4PQJA 4YKPA 1NNKA 1DSNA 1IQ7A 1MPDA 3FXRA 5CM6A 3PMVA 3TDJA 2DP8A 2I0CA 4OTEA 2GHBA 4F19A 2VP1A 3VVDA 5L9SA 4RY1A 2XXQA 3FJGA 3PUZE 3N26A 4H8JA 2WKYA 2QJEA 4X9TA 3S9NC 4OQOA 3CFZA 2O7UA 3P7IA 3K1MA 1H76A 1GTKA 4KD5A 4KFQA 3SEYA 1AOVA 4QFPA 3DP6A 4XKPA 4F3BA 4IGTA 4KI0E 3PMWA 4GFRA 4NTLA 5CMCA 3OO6A 5DT6A 5AE4A 3L6HA 2AL4A 4ZS9A 3LBSA 2A5TA 4F1VA 3MQ9A 4R6KA 4GOTA 4F2QA 1LAGE 3EHTA 3PUYE 5DYHA 3TZAA 1DOTA 4EXKA 5KCJB 1A8FA 1XVYA 1YPNA 1NH7A 1Y3PA 1IXHA 3DP4A 1TT1A 5I2NB 3W9WA 1OQGA 2ZYNA 1EU8A 1OVBA 1URDA 3RGYA 1FQDA 2ONSA 4NF6B 3ZSFA 1MQHA 2Z8FA 1SW2A 2ESNA 4DXUA 3HHFA 1SDXA 1MG1A 2E0SA 2D3IA 3QIMA 2XXPA 5I84A 1NMUA 1Z7ME 1D9VA 4PFUA 3TTLA 3K6UA 2F7BA 4G68B 1BKAA 1FTKA 1MQJA 2E1SA 4JWXA 3KJ7A 1MY3A 2OCUA 2DQVA 3MAMA 3W9VA 1US5A 4BDRA 1B7ZA 3DELB 1PB8A 2F97A 3MZ1A 2VGQA 3IL1B 1A99A 4IO3A 4F18A 5IAIA 1B4HA 1JEVA 1MXZA 1TFDA 2PYYA 1SYHA 2QRYA 1NNTA 2ZYOA 3PD8A 1NNFA 4IGRA 4POXA 4U4SA 4KYDA 1I6QA 3RY3A 4FAJA 3FIRA 3FVKA 4ESXA 1Z7NE 3H06B 1DPPA 1MDQA 3SEXA 2H98A 2X7QA 3DLNA 4NF5B 3N94A 3PPOA 4G68A 4OESA 5F1QA 3KZGA 3HPIA 4M4GA 4R2FA 3AXFA 3RN8A 3SEVA 1IIWA 4IO5A 3PU5A 4NE4A 2P1SA 3ECRA 4U23A 5H8HB 3SEWA 1UIVA 3RTWB 1B3FA 3KBRA 2Q89A 3KFMA 2DVCA 4P0IA 1NL5A 2XX8A 2Y7IA 3CG3A 3EN3A 1P1QA 2AIXA 2DSFA 1IXIA 3KOTA 4QFNA 1UQWA 4R2BA 1MDP1 3QUJA 2I49A 3RQTA 3TELA 3MZBA 1GR2A 2FNCA 4QFLA 1B32A 1LLSA 4H67A 1POY1 1EZ9A 1FQEA 3N6TA 3C9HA 2YPNA 2F35A 2UVHA 4IB2A 4LZ5A 4DXBA 5KCJA 2A5TB 1B2HA 1XHYA 2B3FA 2X7PA 3L6GA 2H4IA 5EHSA 2Q2AA 1A54A 3I3VA 4GWOA 4F3SA 3GZGA 1D9YA 5ITOA 1OQHA 3UN6A 2PBWA 2DOJA 3IOTA 4FE8A 1ANFA 1ZBMA 3EF7A 3H7MA 3MBPA 4LZ8A 4OFJA 1MS7A 3O28A 4LA9A 4YZZA 4YICA 3T66A 3T9UA 4E0XA 1FTJA 1UIUA 2ONKE 3TFLA 2LAOA 4DDDA 2DXRA 5ELVA 3T9HB 3TTNA 4HCWA 1P99A 1PBQA 3FV1A 3H3GA 4DCXA 1JW1A 3MVYA 1B46A 3TKDA 2Z23A 1LFIA 5HPQA 3N5LA 1QULA 2I0BA 4LQ2A 1H43A 3VVFA 5I58A 4C1UA 5HBCA 4N13A 1XVXA 4I62A 1R9QA 3BBRA 4PFWA 3B6WA 5DVFA 2OZZA 1LSTA 3IO4A 3EPEA 3Q27A 2RC8A 1O64A 4OZ9A 2YLNA 4BDLA 1O63A 5AA2A 1I6AA 1N76A 3PPNA 4GXAA 2DE4A 2F6GA 5L9OA 4U21A 3USDA 1HSLA 1UTBB 1PEBA 1ELJA 4OETA 4G2ZA 3S2VA 2VOZA 5I58B 5KDTA 2I3WA 2REJA 3TQLA 4KCDA 3MJNA 4IY5A 3WAEA 4DE8A 4E0WA 1AL3A 2OK2A 1TFAA 4XIGQ 3FATA 5FHNA 4JBZA 1WVJA 2I4CA 4BDQA 1MXXA 4QHQA 4GD5A 3C4MA 3A09A 1VFEA 2UXAA 2QS1A 1BIYA 2FA7A 3IB2A 3MC2A 3OEMA 3OMBA 2XXWA 4RPNA 4DLDA 2G93A 5AA4A 4RK9A 4OVJA 2D21A 4GVOA 3U72A 1XT8A 5L9MA 2XHDA 1N7XA 5KDTB 3VLWA 1XS5A 4R9GA 1ZLQA 4F1YA 1OLAA 2DWAA 1Y1ZA 3H6VA 4GIZA 4QFOA 1M5EA 1NH8A 3IK6B 3M3KA 2OLBA 4G68C 4LP2B 4XKQA 5H8HA 1HSEA 2HAVA 4NF8B 4ZZAA 1QVSA 3H4ZA 1SI1A 1B3LA 5TP9A 2HFBA 4ELOA 3I5OA 2AL5A 3O9PA 4EXLA 3OO9A 2H25A 2XXTA 5DEXA 5EYFA 3RUMA 4JSOA 1B1HA 3C32A 4MF3A 3IOWA 1P1NA 4U22A 2VD3A 2RINA 2REGA 5I57A 3SEUA 4BDNA 2ZYMA 2RC7A 4QSEA 1IEJA 4L17A 1ZMGA 2QSXA 2XD2A 4QRZA 2DWJA 1A7LA 2O6AA 3IORA 1POTA 3G3GA 1JNFA 1TXFA 3FJ7A 1BTJA 3R6UA 2DE2A 1QKAA 2DE3A 3N6UA 3C33A 3E9XA 4OEUA 4OYVA 4XTCQ 3TCFA 1F9BA 1R1NA 2ZNSA 3PD9A 1LBCA 2D5WA 3ZKLA 1MY4A 2F5XA 1JQFA 1WODA 3O6GA 1S7YA 2IEEA 1LGBC 1ZIUA 2Q9TA 1A55A 2V93A 1NKXA 2XXVA 3D4CA 3FXQA 3QAXA 4ZE9A 4YKKA 4R9FA 1VR5A 1VE4A 3UK4A 4F29A 4EUOA 5AA2D 1SD3A 5H8NA 1B7HA 1DTZA 4R6YA 2V25A 4JB7A 5CMMA 3IJOB 3RPWA 5I57B 5JEIA 3MUQA 2ZNUA 3KSXA 2PT1A 3K0VA 3VLUA 1VSOA 5JTYB 3B6QA 3EHSA 3K2DA 4G8HA 4ISUA 1II5A 3QXMA 4Z0IA 4WEPA 3R26A 3BFTA 1ZTYA 1H3DA 4XXUA 1B51A 4ZE8A 4TLMB 5CRYA 3UIFA 4P11A 4Q0CA 1ZU0A 3TTMA 1DTGA 3SETA 2O7IA 3K4UA 4YB5A 4ELQA 4NF4B 2UYFA 2ABHA 4JWOA 1B05A 4OWDA 1MPBA 4RJZA 4HW8A 4OFOA 1B5JA 2B65A 4ND9A 3QYTA 4NF8A 1MXWA 3E3KA 3IR1A 3V8XB 5I56A 3H6UA 2HXWA 4RNSA 1I69A 4MFIA 4EQBA 4ESWA 2ALUA 4LONB 2XX7A 3EHUA 4KYSA 2PX1A 2G29A 2HAUA 3FXUA 3HV1A 4YKJA 1N3WA 5M2VA 2V3TA 3KG2A 3OD7A 5DVJA 3CSGA 3MVZA 3OXNA 2NVUB 3VFJA 1AIVA 4IO6A 1MY2A 2Z22A 4MLVA 1GGGA 1D3KA 3BFUA 4FEDA 4UA8A 3K01A 4ZEKA 2F7AA 2UVJA 2NXOA 4FIMA 4GXSB 1MXYA 2F34A 1MM6A 1B3GA 4JSDA 2R71A 1T0KA 4H65A 3V89B 1FW0A 4I1DA 5CMBA 3VE1B 2R9JA 2Z8EA 3S9MC 2ZXTA 2A5SA 3KOSA 3OENA 4KR5A 1B3EA 3H6WA 1Y9UA 4NF4A 5HM4B 4PFYA 1A8EA 4FECA 4H5GA 1M5DA 1RKMA 2DXYA 3JYRA 3RT8A 4YU0A 1Y3NA 2XXYA 3HO7A 3OO8A 3SERA 3WAFA 1B40A 2XD3A 2H9BA 3MVWA 5AA1A 1Q35A 1YAEA 1JETA 2CZLA 3OSQA 4IY6A 4FORA 3T96B 4YB7A 3THIA 2ONRA 5I2KB 3M3FA 4ECFA 3LC8A 4OEVA 3FUZA 5ICQA 3CFXA 3HSTA 3FVGA 4QSDA 4R6HA 4ZEIA 2I3VA 4R73A 5JTYA 1IZ1A 2RCAA 1JVXA 1RYXA 4AB5A 2DWIA 4WXJA 2O1MA 3B7DA 3C31A 3MVXA 3VV5A 1PB9A 3IX1A 5IKBA 3IOUA 1IXCA 4ZEDA 4NF5A 3O6HA 4POWA 2R6GE 2P2AA 1B7UA 4HCYA 3E13X 2IA4A 3SDFA 1YTVA 3KGCA 3PPPA 4R72A 3TMGA 3PUXE 1PC3A 1MXUA 1S9TA 4OFLA 1B5HA 3IB1A 4H6DA 1US4A 4GL8A 1MQGA 2O1LA 4TQUQ 5DVIA 5KZTA 1MM7A 3UORA 4U1ZA 1LB9A 4GRKA 2Z8DA 3CIJA 1FTOA 3QSLA 4YMBA 4X1DA 4G77A 2Y7KA 4O3AA 1B58A 1Y1MA 3ILUB 4LZ7A 1FQFA 1CB6A 3I6VA 1B4ZA 1N3XA 2Y7WA 2XX9A 3Q26A 4RXLA 3OO7A 3FVOA 2VHAA 2I58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHG A;  1XC1 A;  4U1O A;  4OHN A;  1WDN A;  1DPE A;  2XXR A;  4HS7 A;  4X1B A;  5A5X B;  3IO6 A;  4PP0 A;  3MWB A;  4PFT A;  3U94 A;  4OEN A;  1QJM A;  4F3P A;  3UA8 A;  1PDA A;  5LOM A;  1A40 A;  3DP8 A;  3G3H A;  4GL0 A;  4KYE A;  4RYA A;  1UTH A;  4C0R A;  1NNP A;  3BKI B;  4R74 A;  3FZV A;  1YCJ A;  2B3B A;  2RKM A;  3KEI A;  4XKN A;  3UGW A;  3VDF A;  1LFH A;  2XXU A;  4ELR A;  1N0T A;  2I6E A;  3Q28 A;  1NFT A;  3EQ1 A;  4GQO A;  1M5C A;  1N7W A;  1SW5 A;  3A3C A;  3CI8 A;  1JVY A;  1LB8 A;  3K6V A;  3OOA A;  3PPR A;  2DWH A;  4N6P A;  1JEU A;  4WED A;  3PGF A;  3SES A;  3MP1 A;  5TPA A;  2OWT A;  4F3G A;  4ELP A;  2H99 A;  3K6W A;  4RPO A;  3PV0 E;  2GFE A;  2O51 A;  2V84 A;  3RLF E;  3PUW E;  1FQA A;  4JXI A;  5H8Q B;  1LAH E;  1EH3 A;  2PT2 A;  4PET A;  2XXH A;  2F36 A;  3U92 A;  4Q8R A;  4Z7E A;  5BWJ A;  3S4U A;  3D4G A;  3R7X A;  3K1N A;  2QL3 A;  2DVZ A;  2UVG A;  1PBP A;  3IJX B;  4PE5 B;  3RT6 B;  1MH3 A;  3PPQ A;  2I4B A;  5DEX B;  5FHM A;  3VVE A;  4FEB A;  3T9X B;  3F11 A;  5H8S A;  2QS2 A;  1FCK A;  1JW5 A;  1OVT A;  2GRV A;  5H8F A;  4IO2 A;  5TU0 A;  5AA4 B;  2QPQ A;  1HSJ A;  4H5F A;  3GBA A;  1Y3Q A;  2NOO A;  4NWD A;  1ZJL A;  4AQ4 A;  2KLF A;  4GF8 A;  1URG A;  1SVX B;  3FV2 A;  3LSW A;  4KQP A;  1LCF A;  3LSX A;  3HN0 A;  4QSC A;  3TQW A;  4BDO A;  3CRB A;  4F39 A;  3QK6 A;  4I8C A;  2F8D A;  3CFL A;  2V3Q A;  4UAC A;  3IOV A;  1OMP A;  3O29 A;  4JWY A;  1IIT A;  4U4X A;  1P1U A;  4F31 B;  2NUV A;  3U93 A;  3FAS A;  1EZP A;  4P0G A;  2HQ0 A;  3C35 A;  3O2A A;  5I2K A;  5I56 B;  4EQ7 A;  1B0L A;  3JV9 A;  4KPT A;  4QF9 A;  1MQI A;  1P1O A;  2CMO A;  5JK4 A;  2V3U A;  3G3K A;  3T93 B;  4F1U A;  1B5I A;  2PMS A;  1QUI A;  4OXV A;  4F22 A;  4EF1 A;  4WKM A;  5FTI A;  1UTB A;  3LSL A;  4K3F A;  3T22 A;  3TCG A;  3DM0 A;  1P1W A;  4DXC A;  3ZS6 A;  4YMA A;  5AA3 A;  5B70 A;  4THI A;  4XKR A;  4YB6 A;  3G3I A;  1FTM A;  3GXA A;  5F7V A;  1B0H A;  1MY0 A;  1ZKB A;  3KN3 A;  1I6B A;  3M8U A;  3ODB A;  4AB6 A;  1GV8 A;  1MXV A;  1J1N A;  1QW0 A;  2QS3 A;  5I59 B;  4RK2 A;  4H8I A;  1SI0 A;  5ISU A;  1B3H A;  1D4N A;  1SQY A;  3G3F A;  2O69 A;  5TPA B;  3OEL A;  3FD3 A;  2UYE A;  3QUF A;  3VXB A;  2Q2C A;  3CSB A;  4I9D A;  4LQ5 A;  1MPC A;  1FQC A;  2X26 A;  3U1O A;  1M5F A;  4N07 A;  5CI5 A;  1KWH A;  4ONY A;  4ZEF A;  1EZO A;  4O3B A;  2HCA A;  1USY H;  3C34 A;  4GLI A;  3JZJ A;  2ANJ A;  5J1D A;  1SW1 A;  2ZMB A;  1MRP A;  1IXG A;  3HCQ A;  4YKI A;  4ZDM A;  3V83 A;  2NWJ A;  3W15 C;  3TPA A;  5BUU A;  3FGS A;  1IUD A;  4LUB A;  1QUK A;  3RTF B;  4DIG A;  2BJJ X;  1RYO A;  4Q30 B;  3G7W A;  2Y84 A;  3GBB A;  2DS9 A;  4X48 A;  3IAZ A;  4LVQ A;  3TOD A;  1GVC A;  4OER A;  2O84 X;  4EDP A;  1BLF A;  1LAF E;  1LAX A;  1MQD A;  1AH5 A;  1JW4 A;  1PB7 A;  3Q29 A;  5EHM A;  4BDM A;  4F2O A;  3MP6 A;  2OBG A;  3UP9 A;  2Y7R A;  1H44 A;  1LCT A;  2PVU A;  3PMX A;  4TOZ A;  1VFD A;  1OLC A;  2M8C A;  3MZ9 A;  2Q8J A;  1ATG A;  1B1X A;  4MH5 A;  3KN7 A;  5FHO A;  3G3J A;  5H8F B;  2UVI A;  3ONM A;  3RNN A;  4G4P A;  4H1X A;  4TLL B;  4EF2 A;  3TEP A;  4HTG A;  3FVN A;  1Y4C A;  3O66 A;  5I2N A;  1S50 A;  4IO7 A;  2XXX A;  4U2R A;  3O6I A;  2QS4 A;  3V5A A;  5CBS A;  2RF1 A;  5CBR A;  2ZYK A;  3M3L A;  5H8Q A;  3VXC A;  2H5Y A;  1USY E;  3TCH A;  5ITP A;  3TUS A;  2RC9 A;  3O97 A;  2XXI A;  1BP5 A;  1Q1K A;  1SW4 A;  1LFG A;  4NMY A;  5TP9 B;  1XOC A;  3H03 A;  3LUY A;  4R75 A;  1N04 A;  3K02 A;  3E4R A;  3KJT A;  3FJM A;  2HZK A;  3OSR A;  2Y7P A;  4MBP A;  3B6T A;  3KN8 A;  1L5T A;  1URS A;  3IB0 A;  3K00 A;  3TTR A;  5A5X A;  4EQ9 A;  4ZZE A;  5H8N B;  1H45 A;  2YJP A;  2ZNT A;  3K6X A;  3LR1 A;  4ZEC A;  3LSF B;  3MW0 A;  5CMK A;  1DMB A;  3C36 A;  1FTL A;  4KCC A;  4QFK A;  4YAH X;  4DCY A;  3TTK A;  2QMX A;  4OMB A;  1SBP A;  3H6T A;  4Q5T A;  4BLA A;  2F78 A;  1B9J A;  2F7C A;  3CG1 A;  3TAJ A;  2FYI A;  4O3C A;  1B52 A;  1Y4T A;  2HZL A;  4MLQ A;  3MPK A;  4NWC A;  5DTB A;  3A3U A;  3OEK A;  1B6H A;  1N84 A;  2I48 A;  4M1V A;  3VLV A;  1R6Z A;  1Y20 A;  2F6P A;  4G8M A;  4G8N A;  4C1T A;  1UTH B;  5B7D A;  2THI A;  3T9V A;  2Q88 A;  3Q25 A;  4RA1 A;  2GH9 A;  2QMW A;  2RCB A;  4LAT A;  5ICT A;  5K2X A;  1OIB A;  2O68 A;  2OJT A;  1MY1 A;  2P0S A;  4FAT A;  1LBB A;  1MH4 A;  3TYH A;  3K1P A;  2GHA A;  4FJP A;  4DZ1 A;  1AMF A;  3KSJ A;  4NF6 A;  1O7T A;  3S9E A;  4KHZ E;  1QUJ A;  4NED A;  1TWY A;  4IO4 A;  3CVG A;  3SKP A;  2VD2 A;  5FTH A;  3ZKK A;  2DYX A;  4H0W A;  2W7Y A;  3ILT B;  3GLB A;  1QKB A;  5K2Y A;  1FQB A;  3U8Q A;  1R9L A;  5L8D A;  1SYI A;  2HEU A;  3PUV E;  5AA2 B;  1CE2 A;  5CC2 A;  3CR9 A;  2OWS A;  3MP8 A;  4JDF A;  2AYS A;  5I59 A;  3S9L C;  3MPL A;  4ZEB A;  1M5B A;  4PQJ A;  4YKP A;  1NNK A;  1DSN A;  1IQ7 A;  1MPD A;  3FXR A;  5CM6 A;  3PMV A;  3TDJ A;  2DP8 A;  2I0C A;  4OTE A;  2GHB A;  4F19 A;  2VP1 A;  3VVD A;  5L9S A;  4RY1 A;  2XXQ A;  3FJG A;  3PUZ E;  3N26 A;  4H8J A;  2WKY A;  2QJE A;  4X9T A;  3S9N C;  4OQO A;  3CFZ A;  2O7U A;  3P7I A;  3K1M A;  1H76 A;  1GTK A;  4KD5 A;  4KFQ A;  3SEY A;  1AOV A;  4QFP A;  3DP6 A;  4XKP A;  4F3B A;  4IGT A;  4KI0 E;  3PMW A;  4GFR A;  4NTL A;  5CMC A;  3OO6 A;  5DT6 A;  5AE4 A;  3L6H A;  2AL4 A;  4ZS9 A;  3LBS A;  2A5T A;  4F1V A;  3MQ9 A;  4R6K A;  4GOT A;  4F2Q A;  1LAG E;  3EHT A;  3PUY E;  5DYH A;  3TZA A;  1DOT A;  4EXK A;  5KCJ B;  1A8F A;  1XVY A;  1YPN A;  1NH7 A;  1Y3P A;  1IXH A;  3DP4 A;  1TT1 A;  5I2N B;  3W9W A;  1OQG A;  2ZYN A;  1EU8 A;  1OVB A;  1URD A;  3RGY A;  1FQD A;  2ONS A;  4NF6 B;  3ZSF A;  1MQH A;  2Z8F A;  1SW2 A;  2ESN A;  4DXU A;  3HHF A;  1SDX A;  1MG1 A;  2E0S A;  2D3I A;  3QIM A;  2XXP A;  5I84 A;  1NMU A;  1Z7M E;  1D9V A;  4PFU A;  3TTL A;  3K6U A;  2F7B A;  4G68 B;  1BKA A;  1FTK A;  1MQJ A;  2E1S A;  4JWX A;  3KJ7 A;  1MY3 A;  2OCU A;  2DQV A;  3MAM A;  3W9V A;  1US5 A;  4BDR A;  1B7Z A;  3DEL B;  1PB8 A;  2F97 A;  3MZ1 A;  2VGQ A;  3IL1 B;  1A99 A;  4IO3 A;  4F18 A;  5IAI A;  1B4H A;  1JEV A;  1MXZ A;  1TFD A;  2PYY A;  1SYH A;  2QRY A;  1NNT A;  2ZYO A;  3PD8 A;  1NNF A;  4IGR A;  4POX A;  4U4S A;  4KYD A;  1I6Q A;  3RY3 A;  4FAJ A;  3FIR A;  3FVK A;  4ESX A;  1Z7N E;  3H06 B;  1DPP A;  1MDQ A;  3SEX A;  2H98 A;  2X7Q A;  3DLN A;  4NF5 B;  3N94 A;  3PPO A;  4G68 A;  4OES A;  5F1Q A;  3KZG A;  3HPI A;  4M4G A;  4R2F A;  3AXF A;  3RN8 A;  3SEV A;  1IIW A;  4IO5 A;  3PU5 A;  4NE4 A;  2P1S A;  3ECR A;  4U23 A;  5H8H B;  3SEW A;  1UIV A;  3RTW B;  1B3F A;  3KBR A;  2Q89 A;  3KFM A;  2DVC A;  4P0I A;  1NL5 A;  2XX8 A;  2Y7I A;  3CG3 A;  3EN3 A;  1P1Q A;  2AIX A;  2DSF A;  1IXI A;  3KOT A;  4QFN A;  1UQW A;  4R2B A;  1MDP 1;  3QUJ A;  2I49 A;  3RQT A;  3TEL A;  3MZB A;  1GR2 A;  2FNC A;  4QFL A;  1B32 A;  1LLS A;  4H67 A;  1POY 1;  1EZ9 A;  1FQE A;  3N6T A;  3C9H A;  2YPN A;  2F35 A;  2UVH A;  4IB2 A;  4LZ5 A;  4DXB A;  5KCJ A;  2A5T B;  1B2H A;  1XHY A;  2B3F A;  2X7P A;  3L6G A;  2H4I A;  5EHS A;  2Q2A A;  1A54 A;  3I3V A;  4GWO A;  4F3S A;  3GZG A;  1D9Y A;  5ITO A;  1OQH A;  3UN6 A;  2PBW A;  2DOJ A;  3IOT A;  4FE8 A;  1ANF A;  1ZBM A;  3EF7 A;  3H7M A;  3MBP A;  4LZ8 A;  4OFJ A;  1MS7 A;  3O28 A;  4LA9 A;  4YZZ A;  4YIC A;  3T66 A;  3T9U A;  4E0X A;  1FTJ A;  1UIU A;  2ONK E;  3TFL A;  2LAO A;  4DDD A;  2DXR A;  5ELV A;  3T9H B;  3TTN A;  4HCW A;  1P99 A;  1PBQ A;  3FV1 A;  3H3G A;  4DCX A;  1JW1 A;  3MVY A;  1B46 A;  3TKD A;  2Z23 A;  1LFI A;  5HPQ A;  3N5L A;  1QUL A;  2I0B A;  4LQ2 A;  1H43 A;  3VVF A;  5I58 A;  4C1U A;  5HBC A;  4N13 A;  1XVX A;  4I62 A;  1R9Q A;  3BBR A;  4PFW A;  3B6W A;  5DVF A;  2OZZ A;  1LST A;  3IO4 A;  3EPE A;  3Q27 A;  2RC8 A;  1O64 A;  4OZ9 A;  2YLN A;  4BDL A;  1O63 A;  5AA2 A;  1I6A A;  1N76 A;  3PPN A;  4GXA A;  2DE4 A;  2F6G A;  5L9O A;  4U21 A;  3USD A;  1HSL A;  1UTB B;  1PEB A;  1ELJ A;  4OET A;  4G2Z A;  3S2V A;  2VOZ A;  5I58 B;  5KDT A;  2I3W A;  2REJ A;  3TQL A;  4KCD A;  3MJN A;  4IY5 A;  3WAE A;  4DE8 A;  4E0W A;  1AL3 A;  2OK2 A;  1TFA A;  4XIG Q;  3FAT A;  5FHN A;  4JBZ A;  1WVJ A;  2I4C A;  4BDQ A;  1MXX A;  4QHQ A;  4GD5 A;  3C4M A;  3A09 A;  1VFE A;  2UXA A;  2QS1 A;  1BIY A;  2FA7 A;  3IB2 A;  3MC2 A;  3OEM A;  3OMB A;  2XXW A;  4RPN A;  4DLD A;  2G93 A;  5AA4 A;  4RK9 A;  4OVJ A;  2D21 A;  4GVO A;  3U72 A;  1XT8 A;  5L9M A;  2XHD A;  1N7X A;  5KDT B;  3VLW A;  1XS5 A;  4R9G A;  1ZLQ A;  4F1Y A;  1OLA A;  2DWA A;  1Y1Z A;  3H6V A;  4GIZ A;  4QFO A;  1M5E A;  1NH8 A;  3IK6 B;  3M3K A;  2OLB A;  4G68 C;  4LP2 B;  4XKQ A;  5H8H A;  1HSE A;  2HAV A;  4NF8 B;  4ZZA A;  1QVS A;  3H4Z A;  1SI1 A;  1B3L A;  5TP9 A;  2HFB A;  4ELO A;  3I5O A;  2AL5 A;  3O9P A;  4EXL A;  3OO9 A;  2H25 A;  2XXT A;  5DEX A;  5EYF A;  3RUM A;  4JSO A;  1B1H A;  3C32 A;  4MF3 A;  3IOW A;  1P1N A;  4U22 A;  2VD3 A;  2RIN A;  2REG A;  5I57 A;  3SEU A;  4BDN A;  2ZYM A;  2RC7 A;  4QSE A;  1IEJ A;  4L17 A;  1ZMG A;  2QSX A;  2XD2 A;  4QRZ A;  2DWJ A;  1A7L A;  2O6A A;  3IOR A;  1POT A;  3G3G A;  1JNF A;  1TXF A;  3FJ7 A;  1BTJ A;  3R6U A;  2DE2 A;  1QKA A;  2DE3 A;  3N6U A;  3C33 A;  3E9X A;  4OEU A;  4OYV A;  4XTC Q;  3TCF A;  1F9B A;  1R1N A;  2ZNS A;  3PD9 A;  1LBC A;  2D5W A;  3ZKL A;  1MY4 A;  2F5X A;  1JQF A;  1WOD A;  3O6G A;  1S7Y A;  2IEE A;  1LGB C;  1ZIU A;  2Q9T A;  1A55 A;  2V93 A;  1NKX A;  2XXV A;  3D4C A;  3FXQ A;  3QAX A;  4ZE9 A;  4YKK A;  4R9F A;  1VR5 A;  1VE4 A;  3UK4 A;  4F29 A;  4EUO A;  5AA2 D;  1SD3 A;  5H8N A;  1B7H A;  1DTZ A;  4R6Y A;  2V25 A;  4JB7 A;  5CMM A;  3IJO B;  3RPW A;  5I57 B;  5JEI A;  3MUQ A;  2ZNU A;  3KSX A;  2PT1 A;  3K0V A;  3VLU A;  1VSO A;  5JTY B;  3B6Q A;  3EHS A;  3K2D A;  4G8H A;  4ISU A;  1II5 A;  3QXM A;  4Z0I A;  4WEP A;  3R26 A;  3BFT A;  1ZTY A;  1H3D A;  4XXU A;  1B51 A;  4ZE8 A;  4TLM B;  5CRY A;  3UIF A;  4P11 A;  4Q0C A;  1ZU0 A;  3TTM A;  1DTG A;  3SET A;  2O7I A;  3K4U A;  4YB5 A;  4ELQ A;  4NF4 B;  2UYF A;  2ABH A;  4JWO A;  1B05 A;  4OWD A;  1MPB A;  4RJZ A;  4HW8 A;  4OFO A;  1B5J A;  2B65 A;  4ND9 A;  3QYT A;  4NF8 A;  1MXW A;  3E3K A;  3IR1 A;  3V8X B;  5I56 A;  3H6U A;  2HXW A;  4RNS A;  1I69 A;  4MFI A;  4EQB A;  4ESW A;  2ALU A;  4LON B;  2XX7 A;  3EHU A;  4KYS A;  2PX1 A;  2G29 A;  2HAU A;  3FXU A;  3HV1 A;  4YKJ A;  1N3W A;  5M2V A;  2V3T A;  3KG2 A;  3OD7 A;  5DVJ A;  3CSG A;  3MVZ A;  3OXN A;  2NVU B;  3VFJ A;  1AIV A;  4IO6 A;  1MY2 A;  2Z22 A;  4MLV A;  1GGG A;  1D3K A;  3BFU A;  4FED A;  4UA8 A;  3K01 A;  4ZEK A;  2F7A A;  2UVJ A;  2NXO A;  4FIM A;  4GXS B;  1MXY A;  2F34 A;  1MM6 A;  1B3G A;  4JSD A;  2R71 A;  1T0K A;  4H65 A;  3V89 B;  1FW0 A;  4I1D A;  5CMB A;  3VE1 B;  2R9J A;  2Z8E A;  3S9M C;  2ZXT A;  2A5S A;  3KOS A;  3OEN A;  4KR5 A;  1B3E A;  3H6W A;  1Y9U A;  4NF4 A;  5HM4 B;  4PFY A;  1A8E A;  4FEC A;  4H5G A;  1M5D A;  1RKM A;  2DXY A;  3JYR A;  3RT8 A;  4YU0 A;  1Y3N A;  2XXY A;  3HO7 A;  3OO8 A;  3SER A;  3WAF A;  1B40 A;  2XD3 A;  2H9B A;  3MVW A;  5AA1 A;  1Q35 A;  1YAE A;  1JET A;  2CZL A;  3OSQ A;  4IY6 A;  4FOR A;  3T96 B;  4YB7 A;  3THI A;  2ONR A;  5I2K B;  3M3F A;  4ECF A;  3LC8 A;  4OEV A;  3FUZ A;  5ICQ A;  3CFX A;  3HST A;  3FVG A;  4QSD A;  4R6H A;  4ZEI A;  2I3V A;  4R73 A;  5JTY A;  1IZ1 A;  2RCA A;  1JVX A;  1RYX A;  4AB5 A;  2DWI A;  4WXJ A;  2O1M A;  3B7D A;  3C31 A;  3MVX A;  3VV5 A;  1PB9 A;  3IX1 A;  5IKB A;  3IOU A;  1IXC A;  4ZED A;  4NF5 A;  3O6H A;  4POW A;  2R6G E;  2P2A A;  1B7U A;  4HCY A;  3E13 X;  2IA4 A;  3SDF A;  1YTV A;  3KGC A;  3PPP A;  4R72 A;  3TMG A;  3PUX E;  1PC3 A;  1MXU A;  1S9T A;  4OFL A;  1B5H A;  3IB1 A;  4H6D A;  1US4 A;  4GL8 A;  1MQG A;  2O1L A;  4TQU Q;  5DVI A;  5KZT A;  1MM7 A;  3UOR A;  4U1Z A;  1LB9 A;  4GRK A;  2Z8D A;  3CIJ A;  1FTO A;  3QSL A;  4YMB A;  4X1D A;  4G77 A;  2Y7K A;  4O3A A;  1B58 A;  1Y1M A;  3ILU B;  4LZ7 A;  1FQF A;  1CB6 A;  3I6V A;  1B4Z A;  1N3X A;  2Y7W A;  2XX9 A;  3Q26 A;  4RXL A;  3OO7 A;  3FVO A;  2VHA A;  2I58 A; 
#chains in the Genus database with same CATH topology
 3HHG A;  2WBD A;  4PP0 A;  3DP8 A;  4GL0 A;  4KXP A;  1YCJ A;  4XKN A;  2XXU A;  3Q28 A;  1NFT A;  4LN5 A;  2KR0 A;  2V84 A;  3RLF E;  2QFL A;  4Z7E A;  2F36 A;  3U92 A;  3K1N A;  2ZZV A;  1DCU A;  3F11 A;  1FCK A;  1OVT A;  4IO2 A;  2QPQ A;  2NOO A;  4AQ4 A;  4NF0 A;  4BDO A;  3CRB A;  3CFL A;  4UAC A;  3IOV A;  4JWY A;  1NV5 A;  5I56 B;  2FVZ A;  4KPT A;  4QF9 A;  3RPL A;  2V3U A;  4F1U A;  4OXV A;  4EF1 A;  4WKM A;  1UTB A;  1EYK A;  3G3I A;  3GXA A;  1B0H A;  3ODB A;  3M8U A;  4NAP A;  4AB6 A;  5I56 A;  1J1N A;  1QW0 A;  1SI0 A;  1B3H A;  4GX3 A;  3G3F A;  2O69 A;  2UYE A;  1DK4 A;  3QUF A;  2Q2C A;  1M5F A;  4N07 A;  3JZJ A;  1MRP A;  3HCQ A;  4LUB A;  4GWU A;  3RTF B;  4X48 A;  4EDP A;  1BLF A;  1LAX A;  1MQD A;  4F2O A;  1CNQ A;  5EHM A;  4HE1 A;  3UP9 A;  1LCT A;  3PMX A;  4TOZ A;  1OLC A;  1ATG A;  3RNN A;  3ONM A;  3O66 A;  3O6I A;  5CBR A;  3VXC A;  3TUS A;  5ITP A;  1SW4 A;  1LFG A;  4PDH A;  3H03 A;  3FJM A;  4ZZE A;  3K6X A;  4ZEC A;  1FTL A;  4QFK A;  1FBE A;  3TTK A;  4OMB A;  1SBP A;  2F78 A;  1B9J A;  3CG1 A;  2V4C A;  5DTB A;  3OEK A;  1LEV A;  1R6Z A;  1Y20 A;  4G8N A;  2Q88 A;  2RCB A;  4FAT A;  2P0S A;  4AS5 A;  1QUJ A;  4IO4 A;  3CVG A;  2VD2 A;  1FPD A;  2DYX A;  4H0W A;  2W7Y A;  4N8G A;  5K2Y A;  5CC2 A;  2AYS A;  1M5B A;  4PQJ A;  4YKP A;  1DSN A;  3T0J A;  5CM6 A;  2HPG A;  2DP8 A;  1RDX A;  3FJG A;  3PUZ E;  2WKY A;  4OVQ A;  2QJE A;  4X9T A;  5EQ9 A;  2O7U A;  3P7I A;  4PGP A;  1INP A;  4KFQ A;  4OVT A;  4HXV A;  1K9Z A;  4XKP A;  4F3B A;  3PMW A;  4NTL A;  4UAB A;  4ZS9 A;  3LBS A;  2A5T A;  3MQ9 A;  1NV3 A;  1LAG E;  1DOT A;  1A8F A;  1XVY A;  4PGN A;  1YPN A;  1EYI A;  5DW8 A;  1URD A;  1FQD A;  1SW2 A;  1AWB A;  4PFU A;  2QVU A;  1BKA A;  3W9V A;  2DQV A;  2XWO A;  3MAM A;  1US5 A;  3MZ1 A;  2VGQ A;  3IL1 B;  1A99 A;  4F18 A;  4MHF A;  4OVP A;  5IAI A;  1JEV A;  1TFD A;  4POX A;  4FAJ A;  1Z7N E;  1DPP A;  3N94 A;  5F1Q A;  3KZG A;  2CZH A;  4M4G A;  4P1L A;  2WX9 A;  2Y5L A;  5H8H B;  4GWS A;  3EN3 A;  1P1Q A;  3KOT A;  3RQT A;  3TEL A;  3MZB A;  2FNC A;  4PF6 A;  4MX6 A;  2A5T B;  1B2H A;  2H4I A;  4F3S A;  4N6D A;  3IOT A;  4OFJ A;  1ANF A;  1ZBM A;  4LZ8 A;  3T66 A;  4LA9 A;  4E0X A;  2ONK E;  1B46 A;  1NV1 A;  4LQ2 A;  5DVF A;  3IO4 A;  3EPE A;  3PPN A;  4P3L A;  2DE4 A;  4PTK A;  1ELJ A;  5I58 B;  4KCD A;  4DE8 A;  1AL3 A;  1TFA A;  1VFE A;  3IB2 A;  1BIY A;  4RPN A;  2G93 A;  2VPN A;  5AA4 A;  3U72 A;  1N7X A;  4R9G A;  1OLA A;  2DWA A;  3H6V A;  4QFO A;  1NH8 A;  4HE0 A;  4XKQ A;  2OLB A;  2HAV A;  4ELO A;  4MF3 A;  3C32 A;  1P1N A;  4U22 A;  5I57 A;  2REG A;  3SEU A;  2RC7 A;  1IEJ A;  3MST A;  2QSX A;  4QRZ A;  1DBZ A;  2O6A A;  2DE3 A;  2ZNS A;  2D5W A;  1MY4 A;  1IMA A;  1JQF A;  3O6G A;  2XXV A;  3EKI A;  4YKK A;  5AA2 D;  1B7H A;  2V25 A;  5JEI A;  2VPO A;  3KSX A;  3K0V A;  3EHS A;  1II5 A;  2F3B A;  1ZTY A;  1H3D A;  4XXU A;  1B51 A;  4ZE8 A;  4Q0C A;  1DTG A;  5I7I A;  4OWD A;  4HW8 A;  4OFO A;  4ND9 A;  3H6U A;  4N91 A;  5EQA A;  4MFI A;  2ALU A;  4OA4 A;  2VT5 A;  1FPF A;  2G29 A;  5M2V A;  2V3T A;  3KG2 A;  4FIM A;  1FPE A;  1B3G A;  4I3Y A;  3H6W A;  4P8B A;  4FEC A;  4H5G A;  1RKM A;  2DXY A;  3JYR A;  3SER A;  1Y3N A;  3WAF A;  4PE3 A;  3UN6 A;  3MVW A;  2CZL A;  3THI A;  4IY6 A;  4YB7 A;  1NI9 A;  3M3F A;  3FUZ A;  4R73 A;  1JVX A;  1RYX A;  4AB5 A;  4G61 A;  1PB9 A;  4MNP A;  3IOU A;  1IXC A;  3E13 X;  2IA4 A;  1YTV A;  3PPP A;  1FPI A;  1S9T A;  1B5H A;  1FBD A;  5KZT A;  4U1Z A;  2Z8D A;  4X1D A;  1B58 A;  4H45 A;  4X1B A;  3U94 A;  3MWB A;  4PFT A;  4OEN A;  3UA8 A;  5LOM A;  4GWW A;  4C0R A;  1UTH A;  4R74 A;  2B3B A;  1YYZ A;  4HE2 A;  4EXK A;  4WED A;  4ELP A;  3PV0 E;  2O51 A;  3SDF A;  1FQA A;  4JXI A;  4Q8R A;  4AS4 A;  2XXH A;  4JVD A;  3S4U A;  2QL3 A;  2DVZ A;  3IJX B;  1PBP A;  3RT6 B;  1MH3 A;  3VVE A;  5H8S A;  5TU0 A;  4H5F A;  4NHB A;  1Y3Q A;  4GF8 A;  1SVX B;  3FV2 A;  3LSX A;  4PCD A;  4QSC A;  3TQW A;  2V3Q A;  5IZ1 A;  2HQ0 A;  3LUZ A;  2XA5 A;  1P1O A;  1IME A;  4YMA A;  3T22 A;  4DXC A;  3ZS6 A;  5B70 A;  4XKR A;  4YB6 A;  1FTM A;  1MY0 A;  1I6B A;  4N8Y A;  5I59 B;  2QS3 A;  2XWV A;  4RK2 A;  4H8I A;  1D4N A;  5TPA B;  3OEL A;  3CSB A;  4I9D A;  5CI5 A;  1KWH A;  1USY H;  1KZ8 A;  4GLI A;  4JVI A;  2ANJ A;  5J1D A;  4PBH A;  4ZDM A;  2NWJ A;  3TPA A;  1IUD A;  1QUK A;  2BJJ X;  3G7W A;  4XF5 A;  2OX3 A;  2DS9 A;  2KQZ A;  1LAF E;  4BDM A;  1PB7 A;  3Q29 A;  2OBG A;  2Y7R A;  2PVU A;  4OAN A;  5ET7 A;  2Q8J A;  2CEY A;  1B1X A;  3KN7 A;  1G0H A;  4TLL B;  3FVN A;  1Y4C A;  3A29 A;  5I2N A;  2WYP A;  4P47 A;  2ZYK A;  3M3L A;  5H8Q A;  3TCH A;  1N04 A;  3K02 A;  4EQ9 A;  3LR1 A;  3MW0 A;  4BLA A;  3TAJ A;  5ESY A;  4O3C A;  4NWC A;  1B6H A;  2THI A;  4MNC A;  3T9V A;  3Q25 A;  5ICT A;  2QMW A;  4LAT A;  4MAG A;  3T1B A;  4FJP A;  4NF6 A;  1O7T A;  4NED A;  1TWY A;  3SKP A;  3ZKK A;  3BIG A;  3ILT B;  3GLB A;  1SYI A;  2CEX A;  4JDF A;  1FBP A;  1NNK A;  1IQ7 A;  3TDJ A;  2GHB A;  4F19 A;  5L9S A;  4RY1 A;  3N26 A;  1QGX A;  4KD5 A;  3SEY A;  4QFP A;  3DP6 A;  4IGT A;  5DT6 A;  3L6H A;  4F1V A;  3EHT A;  5DYH A;  5KCJ B;  5I2N B;  1OQG A;  4O8M A;  2ONS A;  4PFR A;  2ESN A;  1MG1 A;  2D3I A;  1NMU A;  3K6U A;  2F7B A;  4G68 B;  4JWX A;  4BDR A;  3DEL B;  2F97 A;  4IO3 A;  4HS7 A;  1B4H A;  2PYY A;  3PD8 A;  5A5X B;  1SYH A;  4GWZ A;  1NNT A;  1NNF A;  4KYD A;  4PF8 A;  4ESX A;  4NF5 B;  4G68 A;  4R2F A;  3AXF A;  3RN8 A;  4IO5 A;  4U23 A;  4NE4 A;  2PCR A;  3ECR A;  3SEW A;  3RTW B;  1B3F A;  3KFM A;  4P0I A;  2DVC A;  1NL5 A;  2XX8 A;  3CG3 A;  5EYH A;  4R2B A;  5EYG A;  3BIH A;  1POY 1;  1EZ9 A;  3N6T A;  2YPN A;  5KCJ A;  5LTC A;  3L6G A;  3I3V A;  3U65 A;  1D9Y A;  1OQH A;  5TP9 B;  3H7M A;  1NUZ A;  3MBP A;  1MS7 A;  1FTJ A;  1UIU A;  3TFL A;  2LAO A;  4HCW A;  1P99 A;  1PBQ A;  3MVY A;  5HPQ A;  1LFI A;  3N5L A;  1QUL A;  2XWI A;  4C1U A;  4N13 A;  1XVX A;  3B6W A;  2OZZ A;  1LST A;  4DI4 B;  3Q27 A;  4U21 A;  3USD A;  1PEB A;  4OET A;  2VOZ A;  3TQL A;  4IY5 A;  4E0W A;  5FHN A;  1WVJ A;  4BDQ A;  4GD5 A;  3A09 A;  4GIZ A;  3OMB A;  4F1Y A;  4DLD A;  4RK9 A;  4OVJ A;  4GVO A;  4I3E A;  1Y1Z A;  3IK6 B;  5H8H A;  1QVS A;  2HFB A;  3O9P A;  3OO9 A;  5EYF A;  1B1H A;  2VD3 A;  2CZK A;  3IFC A;  1A7L A;  4PET A;  1BTJ A;  3R6U A;  2DE2 A;  3TCF A;  3N6U A;  3C33 A;  4OEU A;  1LBZ A;  1LBC A;  3D4C A;  4ZE9 A;  3FXQ A;  4R9F A;  1VR5 A;  3UK4 A;  5CMM A;  3B6Q A;  3QXM A;  1IMB A;  4P11 A;  1ZU0 A;  3SET A;  2O7I A;  4YB5 A;  4JWO A;  1B05 A;  1FJ6 A;  1LBV A;  1MPB A;  1B5J A;  2FIE A;  1NUY A;  3E3K A;  3IR1 A;  3V8X B;  2HXW A;  4N6K A;  4RNS A;  3EHU A;  1NUW A;  3HV1 A;  4YKJ A;  3VFJ A;  4IO6 A;  2Z22 A;  1D3K A;  2R8T A;  4DI3 D;  2UVJ A;  4H65 A;  1FW0 A;  3VE1 B;  5CMB A;  3S9M C;  5EQ7 A;  3OEN A;  1B3E A;  1Y9U A;  1A8E A;  3OO8 A;  2XD3 A;  2P3V A;  4ECF A;  4OEV A;  5ICQ A;  3HST A;  4NN3 A;  3FVG A;  4O7M A;  4R6H A;  1IZ1 A;  2FHY A;  2O1M A;  3B7D A;  3VV5 A;  4O94 A;  4NF5 A;  3O6H A;  4POW A;  2R6G E;  5J16 A;  3KGC A;  4R72 A;  1MXU A;  1US4 A;  2O1L A;  5DVI A;  1MM7 A;  1LB9 A;  1FTO A;  4YMB A;  4O3A A;  4BDN A;  3ILU B;  1FQF A;  1CB6 A;  3Q26 A;  1B4Z A;  2ZZX A;  2XX9 A;  4IR8 A;  2VHA A;  2I58 A;  1XC1 A;  4OHN A;  1DPE A;  2XXR A;  4F3P A;  1PDA A;  4KYE A;  1NNP A;  3FZV A;  3UGW A;  1LFH A;  2I6E A;  4GQO A;  3PPR A;  1N7W A;  3D1R A;  1FBC A;  3A3C A;  3CI8 A;  3K6V A;  3VVF A;  1XI6 A;  5IM2 A;  3PGF A;  1FBF A;  5TPA A;  2OWT A;  2H99 A;  4RPO A;  2GFE A;  3PUW E;  5H8Q B;  1LAH E;  2PT2 A;  5BWJ A;  3D4G A;  3R7X A;  2UVG A;  5DEX B;  1NV2 A;  3T9X B;  1KA1 A;  5AA4 B;  1FPK A;  1ZJL A;  2KLF A;  1URG A;  1LBX A;  4F39 A;  3QK6 A;  2F8D A;  3O29 A;  4F31 B;  2NUV A;  1Q9D A;  5I2K A;  2CMO A;  3T93 B;  2PMS A;  3PTY A;  3LSL A;  4K3F A;  3TCG A;  5AA3 A;  1YXI A;  1ZKB A;  5ET5 A;  2L5V A;  1GV8 A;  1MXV A;  1SQY A;  4LQ5 A;  1MPC A;  2X26 A;  4ZEF A;  4ONY A;  4O3B A;  3C34 A;  2XWK A;  2ZMB A;  2OWZ A;  4YKI A;  5I5P A;  4PC9 A;  4DIG A;  3KC0 A;  4Q30 B;  2Y84 A;  3LV0 A;  3IAZ A;  3TOD A;  4OER A;  2O84 X;  5H8F A;  1JW4 A;  4GBV A;  2CZI A;  1H44 A;  1VFD A;  2M8C A;  4MH5 A;  5FHO A;  3G3J A;  2UVI A;  4FBP A;  4G4P A;  3TEP A;  1S50 A;  4IO7 A;  3V5A A;  5CBS A;  5IZ3 A;  3O97 A;  1BP5 A;  1Q1K A;  1XOC A;  3E4R A;  3KJT A;  1L5T A;  3KN8 A;  3TTR A;  1URS A;  3IB0 A;  3K00 A;  5A5X A;  5H8N B;  1FBG A;  1H45 A;  3LSF B;  3C36 A;  4YAH X;  2QMX A;  3H6T A;  4Q5T A;  1B52 A;  2HZL A;  3MPK A;  3A3U A;  1N84 A;  4C1T A;  1UTH B;  5B7D A;  2GH9 A;  1OIB A;  2OJT A;  1MY1 A;  1MH4 A;  3TYH A;  3K1P A;  4DZ1 A;  5IZZ A;  4KHZ E;  4PFI A;  4O7I A;  2F3D A;  1R9L A;  2HEU A;  3ISP A;  1CE2 A;  3S9L C;  3PMV A;  2I0C A;  4OTE A;  3VVD A;  4H8J A;  4NX1 A;  5F24 A;  4MEV A;  4KI0 E;  4GFR A;  5CMC A;  3OO6 A;  5AE4 A;  2WEF A;  4R6K A;  4GOT A;  4F2Q A;  2DDK A;  3PUY E;  3TZA A;  1Y3P A;  3CHG A;  1TT1 A;  3RGY A;  4NF6 B;  2Z8F A;  5IZ3 B;  4DXU A;  1FPL A;  3HHF A;  1SDX A;  1LBW A;  3QIM A;  5I84 A;  1Z7M E;  1D9V A;  1FTK A;  2E1S A;  3KJ7 A;  1B7Z A;  2ZYO A;  3SES A;  3RY3 A;  1I6Q A;  3FIR A;  3FVK A;  3SEX A;  2X7Q A;  3DLN A;  4PAI A;  3HPI A;  3SEV A;  1IIW A;  3PU5 A;  4GWY A;  2FIX A;  3KBR A;  2DSF A;  3KBZ A;  1IXI A;  1UQW A;  1MDP 1;  3QUJ A;  4QFL A;  3B50 A;  1FQE A;  3C9H A;  2F35 A;  3GZG A;  2DOJ A;  4FE8 A;  4YZZ A;  4ZED A;  3O28 A;  3T9U A;  1FSA A;  4DDD A;  2DXR A;  5ELV A;  1RDY A;  3T9H B;  2B4L A;  3FV1 A;  4DCX A;  1JW1 A;  4H46 A;  3TKD A;  2Z23 A;  2I0B A;  5HBC A;  1R9Q A;  3BBR A;  4PFW A;  4PDD A;  1O64 A;  2YLN A;  1I6A A;  1N76 A;  1HSL A;  4G2Z A;  3S2V A;  5KDT A;  2I3W A;  2REJ A;  4PFB A;  4OVR A;  3FAT A;  2I4C A;  1MXX A;  4QHQ A;  3MC2 A;  3OEM A;  2XXW A;  2D21 A;  5L9M A;  2XHD A;  5KDT B;  5ET6 A;  4GX4 A;  1ZLQ A;  1FJ9 A;  1M5E A;  4NF8 B;  5TP9 A;  1SI1 A;  2H25 A;  2XXT A;  4JSO A;  3E78 A;  3IOW A;  4QSE A;  4L17 A;  1ZMG A;  2PFZ A;  2XD2 A;  2DWJ A;  3IOR A;  1TXF A;  3RUM A;  3ZSF A;  1QKA A;  3GYY A;  3E9X A;  4OYV A;  1F9B A;  1R1N A;  3U1O A;  2IEE A;  1YZ0 A;  1ZIU A;  2Q9T A;  3QAX A;  2BJI A;  1VE4 A;  4F29 A;  1SD3 A;  5H8N A;  1DTZ A;  4JB7 A;  5I57 B;  3IJO B;  3RPW A;  4ISU A;  3K2D A;  4PBQ A;  4Z0I A;  5CRY A;  1VDW A;  4NGU A;  3K4U A;  4ELQ A;  4NF4 B;  2UYF A;  2ABH A;  4RJZ A;  2B65 A;  4NF8 A;  2WYK A;  2XX7 A;  4KYS A;  2PX1 A;  2HAU A;  1SPI A;  4N15 A;  5DVJ A;  3MVZ A;  3OXN A;  1AIV A;  4UA8 A;  4MLV A;  2XXK A;  3K01 A;  2NXO A;  4PAK A;  4GXS B;  1MXY A;  1MM6 A;  1T0K A;  2R71 A;  2Z8E A;  4KR5 A;  2A5S A;  4XFE A;  1FTA A;  1M5D A;  2XXY A;  1B40 A;  5AA1 A;  4GX6 A;  1YAE A;  4FOR A;  5I2K B;  1IMD A;  3LC8 A;  3CFX A;  4QSD A;  5JTY A;  2RCA A;  2DWI A;  4WXJ A;  2WBB A;  3PUX E;  1PC3 A;  4OFL A;  4H6D A;  4GL8 A;  1MQG A;  5EQ8 A;  3VDF A;  3I6V A;  1N3X A;  4RXL A;  4LP2 B;  4U1O A;  1WDN A;  3IO6 A;  1QJM A;  1A40 A;  3G3H A;  4RYA A;  3BKI B;  2RKM A;  3KEI A;  4ELR A;  1N0T A;  3EQ1 A;  1M5C A;  1SW5 A;  4N6P A;  1JVY A;  1LB8 A;  3OOA A;  2DWH A;  1JEU A;  3MP1 A;  4F3G A;  3K6W A;  1EH3 A;  3RYD A;  5A5L A;  4MIJ A;  4PE5 B;  3PPQ A;  2I4B A;  5FHM A;  4FEB A;  2QS2 A;  4JVC A;  1JW5 A;  2GRV A;  1HSJ A;  3GBA A;  4NWD A;  2HHM A;  3LSW A;  4KQP A;  1LCF A;  3HN0 A;  4I8C A;  1OMP A;  1IIT A;  4U4X A;  1P1U A;  1EZP A;  3U93 A;  3FAS A;  4P0G A;  3C35 A;  3O2A A;  4OVS A;  4EQ7 A;  1B0L A;  3JV9 A;  1MQI A;  5JK4 A;  1FPG A;  3G3K A;  2JJK A;  1B5I A;  1QUI A;  4F22 A;  5FTI A;  3DM0 A;  1P1W A;  4THI A;  5F7V A;  3KN3 A;  2Y5K A;  5ISU A;  2Q8M A;  1NUX A;  4QXD A;  3FD3 A;  1RDZ A;  3VXB A;  1FQC A;  3HFU A;  1EZO A;  2HCA A;  1SW1 A;  3V83 A;  1IXG A;  4MJO A;  5BUU A;  3FGS A;  3ROJ A;  1RYO A;  4GBW A;  3GBB A;  4LVQ A;  1GVC A;  3E79 A;  1AH5 A;  3MP6 A;  4MNI A;  4QBA A;  2HXR A;  3MZ9 A;  5H8F B;  4EF2 A;  4H1X A;  4HTG A;  2XXX A;  4U2R A;  2QS4 A;  2RF1 A;  2H5Y A;  1USY E;  4MCO A;  2RC9 A;  2XXI A;  4NMY A;  3LUY A;  4R75 A;  2FBP A;  4GWX A;  4MBP A;  2HZK A;  3OSR A;  2Y7P A;  3B6T A;  1NV7 A;  2YJP A;  2ZNT A;  5CMK A;  1DMB A;  4KCC A;  4N81 A;  4DCY A;  1NV0 A;  2Q74 A;  2F7C A;  2FYI A;  1Y4T A;  4MLQ A;  2I48 A;  4M1V A;  3VLV A;  2F6P A;  4G8M A;  4RA1 A;  5K2X A;  2P3N A;  1FRP A;  2O68 A;  1LBB A;  5FBP A;  2GHA A;  1AMF A;  3KSJ A;  3S9E A;  4N17 A;  1K9Y A;  1QKB A;  1FQB A;  3U8Q A;  5L8D A;  3PUV E;  5AA2 B;  3CR9 A;  2OWS A;  3MP8 A;  5I59 A;  3MPL A;  4ZEB A;  1EYJ A;  3FXR A;  1MPD A;  2VP1 A;  2XXQ A;  3S9N C;  4OQO A;  3CFZ A;  3K1M A;  1H76 A;  1GTK A;  1AOV A;  1FBH A;  2AL4 A;  1LBY A;  1NH7 A;  1IXH A;  5ET8 A;  3DP4 A;  3W9W A;  2ZYN A;  1EU8 A;  1OVB A;  4X8R A;  1MQH A;  2E0S A;  2QVR A;  2XXP A;  3TTL A;  1MQJ A;  1IMF A;  1MY3 A;  2OCU A;  1PB8 A;  2MKZ A;  3FBP A;  1MXZ A;  2QRY A;  4IGR A;  3W15 C;  4U4S A;  5T3J A;  3FXB A;  3H06 B;  1MDQ A;  2H98 A;  3PPO A;  3SZP A;  4OES A;  2P1S A;  1UIV A;  2Q89 A;  2Y7I A;  4QFN A;  2AIX A;  4BDL A;  2I49 A;  1GR2 A;  1B32 A;  1LLS A;  4H67 A;  2UVH A;  4IB2 A;  4LZ5 A;  4DXB A;  1XHY A;  2B3F A;  2X7P A;  5EHS A;  2Q2A A;  1A54 A;  4GWO A;  1NV6 A;  5ITO A;  2PBW A;  3EF7 A;  4YIC A;  2ZZW A;  3TTN A;  3H3G A;  1H43 A;  5I58 A;  4NG7 A;  4I62 A;  1IMC A;  1D9Q A;  4OZ9 A;  2RC8 A;  5AA2 A;  1O63 A;  4GXA A;  2F6G A;  5L9O A;  1UTB B;  3WAE A;  3MJN A;  4N4U A;  2OK2 A;  4XIG Q;  4JBZ A;  4P56 A;  3C4M A;  3KC1 A;  2UXA A;  1G0I A;  2FA7 A;  2QS1 A;  3QMF A;  1XT8 A;  1BK4 A;  1KA0 A;  3VLW A;  1XS5 A;  2QVV A;  3M3K A;  4G68 C;  1HSE A;  4ZZA A;  5IGA A;  3H4Z A;  1B3L A;  3I5O A;  2AL5 A;  4EXL A;  3RPL B;  5DEX A;  3IFA A;  4P1E A;  2RIN A;  2ZYM A;  1POT A;  3G3G A;  1JNF A;  5FTH A;  3FJ7 A;  4XTC Q;  3PD9 A;  4X04 A;  3ZKL A;  1JP4 A;  2F5X A;  1WOD A;  1FPB A;  1FPJ A;  1S7Y A;  1LGB C;  2V93 A;  1A55 A;  1NKX A;  4EUO A;  4R6Y A;  3MUQ A;  2ZNU A;  2PT1 A;  3VLU A;  1VSO A;  5JTY B;  4NQ8 A;  4G8H A;  2PFY A;  4WEP A;  3R26 A;  3BFT A;  4TLM B;  3UIF A;  3TTM A;  2GQ1 A;  1NV4 A;  3QYT A;  1MXW A;  2B4M A;  1I69 A;  4EQB A;  4ESW A;  4LON B;  3FXU A;  1N3W A;  4I40 A;  3OD7 A;  3CSG A;  2NVU B;  1MY2 A;  4ZEK A;  1GGG A;  4FED A;  3BFU A;  2F7A A;  5LDZ A;  2F34 A;  4JSD A;  3V89 B;  4I1D A;  2R9J A;  2ZXT A;  3KOS A;  5HM4 B;  4NF4 A;  4PFY A;  3RT8 A;  4YU0 A;  3HO7 A;  2H9B A;  1Q35 A;  3MYU A;  1JET A;  3T96 B;  3OSQ A;  2ONR A;  4ZEI A;  2I3V A;  3C31 A;  3MVX A;  3IX1 A;  5IKB A;  2P2A A;  1B7U A;  4HCY A;  4P9K A;  4MMP A;  3TMG A;  4TQU Q;  3IB1 A;  4XEQ A;  3UOR A;  4GRK A;  3CIJ A;  4PAF A;  3B8B A;  3QSL A;  3NOH A;  4G77 A;  2Y7K A;  1Y1M A;  4LZ7 A;  2Y7W A;  3OO7 A;  3FVO A;  5I3S A; 
#chains in the Genus database with same CATH homology
 3HHG A;  1XC1 A;  4U1O A;  4OHN A;  1WDN A;  1DPE A;  2XXR A;  4HS7 A;  4X1B A;  5A5X B;  3IO6 A;  4PP0 A;  3MWB A;  4PFT A;  3U94 A;  4OEN A;  1QJM A;  4F3P A;  3UA8 A;  1PDA A;  5LOM A;  1A40 A;  3DP8 A;  3G3H A;  4GL0 A;  4KYE A;  4RYA A;  1UTH A;  4C0R A;  1NNP A;  3BKI B;  4R74 A;  3FZV A;  1YCJ A;  2B3B A;  2RKM A;  3KEI A;  4XKN A;  3UGW A;  3VDF A;  1LFH A;  2XXU A;  4ELR A;  1N0T A;  2I6E A;  3Q28 A;  1NFT A;  3EQ1 A;  4GQO A;  1M5C A;  1N7W A;  1SW5 A;  3A3C A;  3CI8 A;  1JVY A;  1LB8 A;  3K6V A;  3OOA A;  3PPR A;  2DWH A;  4N6P A;  1JEU A;  4WED A;  3PGF A;  3SES A;  3MP1 A;  5TPA A;  2OWT A;  4F3G A;  4ELP A;  2H99 A;  3K6W A;  4RPO A;  3PV0 E;  2GFE A;  2O51 A;  2V84 A;  3RLF E;  3PUW E;  1FQA A;  4JXI A;  5H8Q B;  1LAH E;  1EH3 A;  2PT2 A;  4PET A;  2XXH A;  2F36 A;  3U92 A;  4Q8R A;  4Z7E A;  5BWJ A;  3S4U A;  3D4G A;  3R7X A;  3K1N A;  2QL3 A;  2DVZ A;  2UVG A;  1PBP A;  3IJX B;  4PE5 B;  3RT6 B;  1MH3 A;  3PPQ A;  2I4B A;  5DEX B;  5FHM A;  3VVE A;  4FEB A;  3T9X B;  3F11 A;  5H8S A;  2QS2 A;  1FCK A;  1JW5 A;  1OVT A;  2GRV A;  5H8F A;  4IO2 A;  5TU0 A;  5AA4 B;  2QPQ A;  1HSJ A;  4H5F A;  3GBA A;  1Y3Q A;  2NOO A;  4NWD A;  1ZJL A;  4AQ4 A;  2KLF A;  4GF8 A;  1URG A;  1SVX B;  3FV2 A;  3LSW A;  4KQP A;  1LCF A;  3LSX A;  3HN0 A;  4QSC A;  3TQW A;  4BDO A;  3CRB A;  4F39 A;  3QK6 A;  4I8C A;  2F8D A;  3CFL A;  2V3Q A;  4UAC A;  3IOV A;  1OMP A;  3O29 A;  4JWY A;  1IIT A;  4U4X A;  1P1U A;  4F31 B;  2NUV A;  3U93 A;  3FAS A;  1EZP A;  4P0G A;  2HQ0 A;  3C35 A;  3O2A A;  5I2K A;  5I56 B;  4EQ7 A;  1B0L A;  3JV9 A;  4KPT A;  4QF9 A;  1MQI A;  1P1O A;  2CMO A;  5JK4 A;  2V3U A;  3G3K A;  3T93 B;  4F1U A;  1B5I A;  2PMS A;  1QUI A;  4OXV A;  4F22 A;  4EF1 A;  4WKM A;  5FTI A;  1UTB A;  3LSL A;  4K3F A;  3T22 A;  3TCG A;  3DM0 A;  1P1W A;  4DXC A;  3ZS6 A;  4YMA A;  5AA3 A;  5B70 A;  4THI A;  4XKR A;  4YB6 A;  3G3I A;  1FTM A;  3GXA A;  5F7V A;  1B0H A;  1MY0 A;  1ZKB A;  3KN3 A;  1I6B A;  3M8U A;  3ODB A;  4AB6 A;  1GV8 A;  1MXV A;  1J1N A;  1QW0 A;  2QS3 A;  5I59 B;  4RK2 A;  4H8I A;  1SI0 A;  5ISU A;  1B3H A;  1D4N A;  1SQY A;  3G3F A;  2O69 A;  5TPA B;  3OEL A;  3FD3 A;  2UYE A;  3QUF A;  3VXB A;  2Q2C A;  3CSB A;  4I9D A;  4LQ5 A;  1MPC A;  1FQC A;  2X26 A;  3U1O A;  1M5F A;  4N07 A;  5CI5 A;  1KWH A;  4ONY A;  4ZEF A;  1EZO A;  4O3B A;  2HCA A;  1USY H;  3C34 A;  4GLI A;  3JZJ A;  2ANJ A;  5J1D A;  1SW1 A;  2ZMB A;  1MRP A;  1IXG A;  3HCQ A;  4YKI A;  4ZDM A;  3V83 A;  2NWJ A;  3W15 C;  3TPA A;  5BUU A;  3FGS A;  1IUD A;  4LUB A;  1QUK A;  3RTF B;  4DIG A;  2BJJ X;  1RYO A;  4Q30 B;  3G7W A;  2Y84 A;  3GBB A;  2DS9 A;  4X48 A;  3IAZ A;  4LVQ A;  3TOD A;  1GVC A;  4OER A;  2O84 X;  4EDP A;  1BLF A;  1LAF E;  1LAX A;  1MQD A;  1AH5 A;  1JW4 A;  1PB7 A;  3Q29 A;  5EHM A;  4BDM A;  4F2O A;  3MP6 A;  2OBG A;  3UP9 A;  2Y7R A;  1H44 A;  1LCT A;  2PVU A;  3PMX A;  4TOZ A;  1VFD A;  1OLC A;  2M8C A;  3MZ9 A;  2Q8J A;  1ATG A;  1B1X A;  4MH5 A;  3KN7 A;  5FHO A;  3G3J A;  5H8F B;  2UVI A;  3ONM A;  3RNN A;  4G4P A;  4H1X A;  4TLL B;  4EF2 A;  3TEP A;  4HTG A;  3FVN A;  1Y4C A;  3O66 A;  5I2N A;  1S50 A;  4IO7 A;  2XXX A;  4U2R A;  3O6I A;  2QS4 A;  3V5A A;  5CBS A;  2RF1 A;  5CBR A;  2ZYK A;  3M3L A;  5H8Q A;  3VXC A;  2H5Y A;  1USY E;  3TCH A;  5ITP A;  3TUS A;  2RC9 A;  3O97 A;  2XXI A;  1BP5 A;  1Q1K A;  1SW4 A;  1LFG A;  4NMY A;  5TP9 B;  1XOC A;  3H03 A;  3LUY A;  4R75 A;  1N04 A;  3K02 A;  3E4R A;  3KJT A;  3FJM A;  2HZK A;  3OSR A;  2Y7P A;  4MBP A;  3B6T A;  3KN8 A;  1L5T A;  1URS A;  3IB0 A;  3K00 A;  3TTR A;  5A5X A;  4EQ9 A;  4ZZE A;  5H8N B;  1H45 A;  2YJP A;  2ZNT A;  3K6X A;  3LR1 A;  4ZEC A;  3LSF B;  3MW0 A;  5CMK A;  1DMB A;  3C36 A;  1FTL A;  4KCC A;  4QFK A;  4YAH X;  4DCY A;  3TTK A;  2QMX A;  4OMB A;  1SBP A;  3H6T A;  4Q5T A;  4BLA A;  2F78 A;  1B9J A;  2F7C A;  3CG1 A;  3TAJ A;  2FYI A;  4O3C A;  1B52 A;  1Y4T A;  2HZL A;  4MLQ A;  3MPK A;  4NWC A;  5DTB A;  3A3U A;  3OEK A;  1B6H A;  1N84 A;  2I48 A;  4M1V A;  3VLV A;  1R6Z A;  1Y20 A;  2F6P A;  4G8M A;  4G8N A;  4C1T A;  1UTH B;  5B7D A;  2THI A;  3T9V A;  2Q88 A;  3Q25 A;  4RA1 A;  2GH9 A;  2QMW A;  2RCB A;  4LAT A;  5ICT A;  5K2X A;  1OIB A;  2O68 A;  2OJT A;  1MY1 A;  2P0S A;  4FAT A;  1LBB A;  1MH4 A;  3TYH A;  3K1P A;  2GHA A;  4FJP A;  4DZ1 A;  1AMF A;  3KSJ A;  4NF6 A;  1O7T A;  3S9E A;  4KHZ E;  1QUJ A;  4NED A;  1TWY A;  4IO4 A;  3CVG A;  3SKP A;  2VD2 A;  5FTH A;  3ZKK A;  2DYX A;  4H0W A;  2W7Y A;  3ILT B;  3GLB A;  1QKB A;  5K2Y A;  1FQB A;  3U8Q A;  1R9L A;  5L8D A;  1SYI A;  2HEU A;  3PUV E;  5AA2 B;  1CE2 A;  5CC2 A;  3CR9 A;  2OWS A;  3MP8 A;  4JDF A;  2AYS A;  5I59 A;  3S9L C;  3MPL A;  4ZEB A;  1M5B A;  4PQJ A;  4YKP A;  1NNK A;  1DSN A;  1IQ7 A;  1MPD A;  3FXR A;  5CM6 A;  3PMV A;  3TDJ A;  2DP8 A;  2I0C A;  4OTE A;  2GHB A;  4F19 A;  2VP1 A;  3VVD A;  5L9S A;  4RY1 A;  2XXQ A;  3FJG A;  3PUZ E;  3N26 A;  4H8J A;  2WKY A;  2QJE A;  4X9T A;  3S9N C;  4OQO A;  3CFZ A;  2O7U A;  3P7I A;  3K1M A;  1H76 A;  1GTK A;  4KD5 A;  4KFQ A;  3SEY A;  1AOV A;  4QFP A;  3DP6 A;  4XKP A;  4F3B A;  4IGT A;  4KI0 E;  3PMW A;  4GFR A;  4NTL A;  5CMC A;  3OO6 A;  5DT6 A;  5AE4 A;  3L6H A;  2AL4 A;  4ZS9 A;  3LBS A;  2A5T A;  4F1V A;  3MQ9 A;  4R6K A;  4GOT A;  4F2Q A;  1LAG E;  3EHT A;  3PUY E;  5DYH A;  3TZA A;  1DOT A;  4EXK A;  5KCJ B;  1A8F A;  1XVY A;  1YPN A;  1NH7 A;  1Y3P A;  1IXH A;  3DP4 A;  1TT1 A;  5I2N B;  3W9W A;  1OQG A;  2ZYN A;  1EU8 A;  1OVB A;  1URD A;  3RGY A;  1FQD A;  2ONS A;  4NF6 B;  3ZSF A;  1MQH A;  2Z8F A;  1SW2 A;  2ESN A;  4DXU A;  3HHF A;  1SDX A;  1MG1 A;  2E0S A;  2D3I A;  3QIM A;  2XXP A;  5I84 A;  1NMU A;  1Z7M E;  1D9V A;  4PFU A;  3TTL A;  3K6U A;  2F7B A;  4G68 B;  1BKA A;  1FTK A;  1MQJ A;  2E1S A;  4JWX A;  3KJ7 A;  1MY3 A;  2OCU A;  2DQV A;  3MAM A;  3W9V A;  1US5 A;  4BDR A;  1B7Z A;  3DEL B;  1PB8 A;  2F97 A;  3MZ1 A;  2VGQ A;  3IL1 B;  1A99 A;  4IO3 A;  4F18 A;  5IAI A;  1B4H A;  1JEV A;  1MXZ A;  1TFD A;  2PYY A;  1SYH A;  2QRY A;  1NNT A;  2ZYO A;  3PD8 A;  1NNF A;  4IGR A;  4POX A;  4U4S A;  4KYD A;  1I6Q A;  3RY3 A;  4FAJ A;  3FIR A;  3FVK A;  4ESX A;  1Z7N E;  3H06 B;  1DPP A;  1MDQ A;  3SEX A;  2H98 A;  2X7Q A;  3DLN A;  4NF5 B;  3N94 A;  3PPO A;  4G68 A;  4OES A;  5F1Q A;  3KZG A;  3HPI A;  4M4G A;  4R2F A;  3AXF A;  3RN8 A;  3SEV A;  1IIW A;  4IO5 A;  3PU5 A;  4NE4 A;  2P1S A;  3ECR A;  4U23 A;  5H8H B;  3SEW A;  1UIV A;  3RTW B;  1B3F A;  3KBR A;  2Q89 A;  3KFM A;  2DVC A;  4P0I A;  1NL5 A;  2XX8 A;  2Y7I A;  3CG3 A;  3EN3 A;  1P1Q A;  2AIX A;  2DSF A;  1IXI A;  3KOT A;  4QFN A;  1UQW A;  4R2B A;  1MDP 1;  3QUJ A;  2I49 A;  3RQT A;  3TEL A;  3MZB A;  1GR2 A;  2FNC A;  4QFL A;  1B32 A;  1LLS A;  4H67 A;  1POY 1;  1EZ9 A;  1FQE A;  3N6T A;  3C9H A;  2YPN A;  2F35 A;  2UVH A;  4IB2 A;  4LZ5 A;  4DXB A;  5KCJ A;  2A5T B;  1B2H A;  1XHY A;  2B3F A;  2X7P A;  3L6G A;  2H4I A;  5EHS A;  2Q2A A;  1A54 A;  3I3V A;  4GWO A;  4F3S A;  3GZG A;  1D9Y A;  5ITO A;  1OQH A;  3UN6 A;  2PBW A;  2DOJ A;  3IOT A;  4FE8 A;  1ANF A;  1ZBM A;  3EF7 A;  3H7M A;  3MBP A;  4LZ8 A;  4OFJ A;  1MS7 A;  3O28 A;  4LA9 A;  4YZZ A;  4YIC A;  3T66 A;  3T9U A;  4E0X A;  1FTJ A;  1UIU A;  2ONK E;  3TFL A;  2LAO A;  4DDD A;  2DXR A;  5ELV A;  3T9H B;  3TTN A;  4HCW A;  1P99 A;  1PBQ A;  3FV1 A;  3H3G A;  4DCX A;  1JW1 A;  3MVY A;  1B46 A;  3TKD A;  2Z23 A;  1LFI A;  5HPQ A;  3N5L A;  1QUL A;  2I0B A;  4LQ2 A;  1H43 A;  3VVF A;  5I58 A;  4C1U A;  5HBC A;  4N13 A;  1XVX A;  4I62 A;  1R9Q A;  3BBR A;  4PFW A;  3B6W A;  5DVF A;  2OZZ A;  1LST A;  3IO4 A;  3EPE A;  3Q27 A;  2RC8 A;  1O64 A;  4OZ9 A;  2YLN A;  4BDL A;  1O63 A;  5AA2 A;  1I6A A;  1N76 A;  3PPN A;  4GXA A;  2DE4 A;  2F6G A;  5L9O A;  4U21 A;  3USD A;  1HSL A;  1UTB B;  1PEB A;  1ELJ A;  4OET A;  4G2Z A;  3S2V A;  2VOZ A;  5I58 B;  5KDT A;  2I3W A;  2REJ A;  3TQL A;  4KCD A;  3MJN A;  4IY5 A;  3WAE A;  4DE8 A;  4E0W A;  1AL3 A;  2OK2 A;  1TFA A;  4XIG Q;  3FAT A;  5FHN A;  4JBZ A;  1WVJ A;  2I4C A;  4BDQ A;  1MXX A;  4QHQ A;  4GD5 A;  3C4M A;  3A09 A;  1VFE A;  2UXA A;  2QS1 A;  1BIY A;  2FA7 A;  3IB2 A;  3MC2 A;  3OEM A;  3OMB A;  2XXW A;  4RPN A;  4DLD A;  2G93 A;  5AA4 A;  4RK9 A;  4OVJ A;  2D21 A;  4GVO A;  3U72 A;  1XT8 A;  5L9M A;  2XHD A;  1N7X A;  5KDT B;  3VLW A;  1XS5 A;  4R9G A;  1ZLQ A;  4F1Y A;  1OLA A;  2DWA A;  1Y1Z A;  3H6V A;  4GIZ A;  4QFO A;  1M5E A;  1NH8 A;  3IK6 B;  3M3K A;  2OLB A;  4G68 C;  4LP2 B;  4XKQ A;  5H8H A;  1HSE A;  2HAV A;  4NF8 B;  4ZZA A;  1QVS A;  3H4Z A;  1SI1 A;  1B3L A;  5TP9 A;  2HFB A;  4ELO A;  3I5O A;  2AL5 A;  3O9P A;  4EXL A;  3OO9 A;  2H25 A;  2XXT A;  5DEX A;  5EYF A;  3RUM A;  4JSO A;  1B1H A;  3C32 A;  4MF3 A;  3IOW A;  1P1N A;  4U22 A;  2VD3 A;  2RIN A;  2REG A;  5I57 A;  3SEU A;  4BDN A;  2ZYM A;  2RC7 A;  4QSE A;  1IEJ A;  4L17 A;  1ZMG A;  2QSX A;  2XD2 A;  4QRZ A;  2DWJ A;  1A7L A;  2O6A A;  3IOR A;  1POT A;  3G3G A;  1JNF A;  1TXF A;  3FJ7 A;  1BTJ A;  3R6U A;  2DE2 A;  1QKA A;  2DE3 A;  3N6U A;  3C33 A;  3E9X A;  4OEU A;  4OYV A;  4XTC Q;  3TCF A;  1F9B A;  1R1N A;  2ZNS A;  3PD9 A;  1LBC A;  2D5W A;  3ZKL A;  1MY4 A;  2F5X A;  1JQF A;  1WOD A;  3O6G A;  1S7Y A;  2IEE A;  1LGB C;  1ZIU A;  2Q9T A;  1A55 A;  2V93 A;  1NKX A;  2XXV A;  3D4C A;  3FXQ A;  3QAX A;  4ZE9 A;  4YKK A;  4R9F A;  1VR5 A;  1VE4 A;  3UK4 A;  4F29 A;  4EUO A;  5AA2 D;  1SD3 A;  5H8N A;  1B7H A;  1DTZ A;  4R6Y A;  2V25 A;  4JB7 A;  5CMM A;  3IJO B;  3RPW A;  5I57 B;  5JEI A;  3MUQ A;  2ZNU A;  3KSX A;  2PT1 A;  3K0V A;  3VLU A;  1VSO A;  5JTY B;  3B6Q A;  3EHS A;  3K2D A;  4G8H A;  4ISU A;  1II5 A;  3QXM A;  4Z0I A;  4WEP A;  3R26 A;  3BFT A;  1ZTY A;  1H3D A;  4XXU A;  1B51 A;  4ZE8 A;  4TLM B;  5CRY A;  3UIF A;  4P11 A;  4Q0C A;  1ZU0 A;  3TTM A;  1DTG A;  3SET A;  2O7I A;  3K4U A;  4YB5 A;  4ELQ A;  4NF4 B;  2UYF A;  2ABH A;  4JWO A;  1B05 A;  4OWD A;  1MPB A;  4RJZ A;  4HW8 A;  4OFO A;  1B5J A;  2B65 A;  4ND9 A;  3QYT A;  4NF8 A;  1MXW A;  3E3K A;  3IR1 A;  3V8X B;  5I56 A;  3H6U A;  2HXW A;  4RNS A;  1I69 A;  4MFI A;  4EQB A;  4ESW A;  2ALU A;  4LON B;  2XX7 A;  3EHU A;  4KYS A;  2PX1 A;  2G29 A;  2HAU A;  3FXU A;  3HV1 A;  4YKJ A;  1N3W A;  5M2V A;  2V3T A;  3KG2 A;  3OD7 A;  5DVJ A;  3CSG A;  3MVZ A;  3OXN A;  2NVU B;  3VFJ A;  1AIV A;  4IO6 A;  1MY2 A;  2Z22 A;  4MLV A;  1GGG A;  1D3K A;  3BFU A;  4FED A;  4UA8 A;  3K01 A;  4ZEK A;  2F7A A;  2UVJ A;  2NXO A;  4FIM A;  4GXS B;  1MXY A;  2F34 A;  1MM6 A;  1B3G A;  4JSD A;  2R71 A;  1T0K A;  4H65 A;  3V89 B;  1FW0 A;  4I1D A;  5CMB A;  3VE1 B;  2R9J A;  2Z8E A;  3S9M C;  2ZXT A;  2A5S A;  3KOS A;  3OEN A;  4KR5 A;  1B3E A;  3H6W A;  1Y9U A;  4NF4 A;  5HM4 B;  4PFY A;  1A8E A;  4FEC A;  4H5G A;  1M5D A;  1RKM A;  2DXY A;  3JYR A;  3RT8 A;  4YU0 A;  1Y3N A;  2XXY A;  3HO7 A;  3OO8 A;  3SER A;  3WAF A;  1B40 A;  2XD3 A;  2H9B A;  3MVW A;  5AA1 A;  1Q35 A;  1YAE A;  1JET A;  2CZL A;  3OSQ A;  4IY6 A;  4FOR A;  3T96 B;  4YB7 A;  3THI A;  2ONR A;  5I2K B;  3M3F A;  4ECF A;  3LC8 A;  4OEV A;  3FUZ A;  5ICQ A;  3CFX A;  3HST A;  3FVG A;  4QSD A;  4R6H A;  4ZEI A;  2I3V A;  4R73 A;  5JTY A;  1IZ1 A;  2RCA A;  1JVX A;  1RYX A;  4AB5 A;  2DWI A;  4WXJ A;  2O1M A;  3B7D A;  3C31 A;  3MVX A;  3VV5 A;  1PB9 A;  3IX1 A;  5IKB A;  3IOU A;  1IXC A;  4ZED A;  4NF5 A;  3O6H A;  4POW A;  2R6G E;  2P2A A;  1B7U A;  4HCY A;  3E13 X;  2IA4 A;  3SDF A;  1YTV A;  3KGC A;  3PPP A;  4R72 A;  3TMG A;  3PUX E;  1PC3 A;  1MXU A;  1S9T A;  4OFL A;  1B5H A;  3IB1 A;  4H6D A;  1US4 A;  4GL8 A;  1MQG A;  2O1L A;  4TQU Q;  5DVI A;  5KZT A;  1MM7 A;  3UOR A;  4U1Z A;  1LB9 A;  4GRK A;  2Z8D A;  3CIJ A;  1FTO A;  3QSL A;  4YMB A;  4X1D A;  4G77 A;  2Y7K A;  4O3A A;  1B58 A;  1Y1M A;  3ILU B;  4LZ7 A;  1FQF A;  1CB6 A;  3I6V A;  1B4Z A;  1N3X A;  2Y7W A;  2XX9 A;  3Q26 A;  4RXL A;  3OO7 A;  3FVO A;  2VHA A;  2I58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...