4OTLA

X-ray crystal structure of serine hydroxymethyl transferase from burkholderia cenocepacia bound to plp and glycine
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
409
structure length
409
Chain Sequence
STIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDAATIERVRAQVAELTKRFPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine hydroxymethyltransferase
publication title X-ray Crystal Structure of Serine Hydroxymethyl Transferase from Burkholderia cenocepacia bound to PLP and Glycine
rcsb
source organism Burkholderia cenocepacia
molecule tags Transferase
total genus 154
structure length 409
sequence length 409
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4otlA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4otlA02
3PA9A 1M0OA 1B4XA 4U2HA 2O0RA 1YOOA 3LG0A 4LW2A 4OMAA 3KGWA 4UHMA 2W8WA 4JEYA 1W3UA 1JG8A 3QHXA 3NDNA 1GEXA 2OQXA 2BI2A 2D66A 2R0TA 1E5FA 3PAAA 2YCPA 4RITA 1OHVA 2BWPA 3EIAA 2YKVA 4WBTA 4CBRA 1Z3ZA 1YIZA 5FT8A 3FQ8A 4WYFA 3MEBA 2R5CB 1KMKA 1MAPA 3AOWA 4L0OA 3DRDA 1ASNA 3GZDC 1W7MA 2AY2A 1WYUB 4EFFA 1LK9A 2W7EA 3JU7A 3NYTA 4RM1A 4MQQA 5HHYA 3WCNA 1EJIA 1BJ4A 2CSTA 3KE3A 3EI6A 3E2FA 1I41A 2Z61A 3FRKA 3L8AA 3PGYA 4GEBA 3RBLA 1GC0A 2HP1A 2YRRA 4WB0A 3RI6A 2EZ2A 2OATA 5JAYA 4W8IA 3K40A 2PO3A 3FD0A 1CQ8A 3FVXA 4Q31A 4M2JA 1GCKA 1TOIA 3N5MA 3R4TA 3DODA 1TARA 3BWNA 3CAIA 3ECDA 3FCRA 1S06A 4RJ0A 4LNMA 2NMPA 2WK8A 1CQ7A 3VOMA 2AEUA 4ZDPA 2AY1A 3NU8A 2JJEA 4R5ZA 4DQ6A 2DOUA 4WYDA 1AJSA 4F5HA 4M2MA 2AY4A 2W7GA 3P6KA 5D95A 1QZ9A 3AV7A 5DJ9A 5EFSA 2VMRA 3H14A 1BJOA 1YJZA 1AHXA 2BYJA 1AY8A 3PD6A 2VMZA 3A9YA 4K2BA 3RBFA 3PDBB 3A9XA 2E54A 4IXZA 5M49A 3VK3A 1MDOA 4F4EA 4RJYA 4RAEA 4EU1A 3E77A 1ASBA 3PIUA 5BJ3A 4GRXA 4JEXA 5G0AA 4E77A 1YIYA 4Y0IA 4ADDA 1GBNA 2HUIA 2CJHA 1AX4A 4AZJA 1GD9A 3FSLA 4N0WA 2JJFA 5G4JA 4BA5A 1AHEA 2DGKA 2CFBA 1FG3A 2VGSA 3DU4A 3RUYA 3VP6A 3BCXA 4JF1A 4WXFA 2X5DA 4XQ2A 4GE9A 3ACZA 1CS1A 4TV7A 4Q76A 3JTXA 2HORA 4JE5A 5EUDA 3AEOA 2ZY5A 1AHFA 1G7XA 1ECXA 1VP4A 1M4NA 1PFFA 4WXGA 2BYLA 5F8VA 2YKXA 2E7UA 4XJPA 4ZLVA 3TQXA 1S09A 4ZSYA 3LWSA 1TATA 2V1PA 1AHGA 1V2FA 1TOKA 1KL2A 3GWPA 3Q8NA 1D7UA 4PFNA 2AATA 4EMYA 4XJLA 2CANA 3FKDA 3FVSA 1VEFA 2QA3A 2FQ6A 2ZY4A 1UU1A 5G2PA 1KMJA 5FT5A 2W8JA 2W7KA 2EGYA 2O7CA 4WYCA 1PMOA 4LW4A 5EAVA 3EI5A 1OATA 3QI6A 4XK1A 3W1HA 2VIAA 3BCBA 2W7IA 2BWOA 4LC3A 3QM2A 2VI9A 1G7WA 4ADBA 2FYFA 3H7FA 4PFFA 3B1DA 1IJIA 1B8GA 4XJOA 1DFOA 2VMXA 2GMUA 2FNUA 2HUUA 3B1CA 3CQ5A 3KGXA 3GETA 4PIWA 4GSAA 1FG7A 4MQRA 1LW4A 1ELUA 3LVMA 4ZSWA 1LS3A 5M4BA 4E3RA 2DR1A 3B1EA 1B9IA 1G4VA 1IX8A 4IXOA 5FT6A 3WGBA 1O4SA 3WCOA 3WY7A 1W23A 3FZ8A 1BJOB 1M0NA 2CJDA 3ELEA 1IUGA 1D7RA 2D65A 4MQPA 3PD6B 4OC9A 3II0A 4Y0HA 2R2NA 1ARSA 4JEWA 4ATQA 3AEJA 4CBSA 2Z67A 4OBVA 1AMSA 2BWNA 3RQ1A 3ZRQA 2C44A 1EQBA 2W8UA 1KKPA 1OXOA 5M4DA 1IX6A 5EIGB 4U1TA 1YAAA 2OKKA 5E4ZA 2VLHA 1SVVA 3OP7A 3QBOA 2BIEA 3EZ1A 3TATA 3FDBA 3F0HA 1CZCA 1JS6A 2QMAA 1AKCA 1BQDA 3E2ZA 1I48A 3NNKA 4JEVA 4XJMA 4CVQA 2DGLA 5HXXA 2EO5A 2X3LA 3ZZKA 4F5MA 2QB3A 2O1BA 2Z1ZA 2W7LA 3KKIA 4ADEA 4F5GA 2JISA 1ARHA 5C6UA 4F5JA 2VMUA 4O6ZA 2CY8A 4ADCA 2HZPA 2CTZA 4WLHA 1ASMA 2Z20A 1AMAA 1S08A 2C0RA 3N75A 1MDXA 5FT4A 3WLXA 4AO9A 5DX5A 4A72A 4OTLA 2YRIA 1ZOBA 4RIZA 1BT4A 3NTJA 4UQVA 5EQCA 2PB2A 2GB3A 4E3QA 1EG5A 1D2FA 3D6KA 4H51A 3COGA 1B5PA 3DR7A 3EZSA 4AH3A 1GEWA 2YKUA 2FNIA 2XH1A 2VGVA 3ZZJA 3HT4A 3BWOA 1JS3A 2R5EA 4DGTA 3HL2A 3MC6A 3HLMA 1DTYA 3FQAA 1AAWA 4ZM3A 1WYTA 1RV3A 2HOXA 4JE5D 1C0NA 2DKJA 1BJWA 4KYOA 5G09A 2W8VA 1ZODA 1G4XA 3G8MA 2OKJA 1ASDA 4WLJA 4P3MA 5EUEA 2FM1A 2JGTA 3NUBA 5IWQA 1GC3A 2EPJA 3VAXA 3NU7A 1ARIA 3LV2A 5G2QA 3VK2A 4WXBA 4AOAA 2HUFA 3A9ZA 3EIBA 3BWNC 2ZSLA 4RLGA 1N31A 1ASCA 2HOYA 1QITA 5EIGA 4AO4A 4ITGA 4KXKA 3AEMA 4MKKA 4J5UA 1DGDA 3L44A 4OBUA 1D7SA 2VLFA 3USFA 1H0CA 4LNJA 3AEPA 3IHJA 4A6RA 4BQ0A 2CINA 2YCTA 3G7QA 1JF9A 5E3KA 5LH9A 1S0AA 4E1OA 3W1IA 3WKSA 3ISLA 3MAUA 4W5KA 1LW5A 1UU0A 1SPAA 3ATHA 1ASEA 1ARTA 2CH2A 2EZ1A 2VYCA 3UE8A 1PG8A 2Z9WA 4MKJA 2BI1A 3W1JA 5G4IA 2ZUKA 2YKYA 2CB1A 3FQ7A 3AENA 4B98A 2VI8A 3M5UA 5HDMA 4UHOA 2Q7WA 2W7FA 1SZKA 4ISYA 5M46A 3ELPA 2WK9A 4PVFA 1H1CA 3JWBA 3E2ZB 1MDZA 3B8XA 2XBNA 1V2DA 4J8LA 4XAUA 2D5YA 1BW0A 1GC2A 4A0RA 2BIAA 1AKAA 2AY9A 4N0BA 1AAMA 1QISA 4R2NA 1M0QA 2QBTA 4WP0A 1C7NA 1CQ6A 7AATA 2WKAA 2HOZA 1CZEA 1WSTA 4TN4A 1DGEA 4HF8A 2JG2A 3CBFA 2ZYJA 4GDYA 3GBXA 3HBXA 4ZWMA 2BI3A 1WKHA 1M32A 1WKGA 3PJ0A 4MY5A 1FC4A 4OYTA 4W1WA 1IAYA 3TFUA 3WX9A 1QIRA 3QN6A 2GMSA 4FFCA 5AX8A 1GEYA 2E7IA 1TOEA 1KKJA 1C4KA 4Q75A 3DYDA 2VMSA 1B9HA 1ORDA 3MBBA 4P7YA 4IYOA 4RKDA 1CL2A 4ZM4A 1WYTB 4W91A 2ZY2A 3FVUA 3FFHA 2ORDA 1SF2A 4MGRA 2ZY3A 3E9KA 1PMMA 1O62A 1AIAA 3I4JA 2PB0A 2V0YA 1YJSA 2D61A 1KL1A 1D7VA 5EUNA 3AELA 3MADA 4EB7A 2VMQA 2X8UA 1C9CA 3B46A 4ATPA 1RVYA 3QPGA 1YNUA 2Z9UA 1J04A 3WKRA 2CH1A 2AY3A 2D7ZA 2VMVA 3A8UX 1AKBA 1T3IA 3CQ6A 3GZDA 4ITXA 1TASA 1IX7A 1ZC9A 5E5IA 2ZP7A 4IW7A 4F5LA 1I29A 1OHYA 2VMNA 4BMKA 1YJYA 1DKAA 4NOGA 4CXQA 1MGVA 1XI9A 1X0MA 1IVRA 1OHWA 2GSAA 3AOVA 3DR4A 1MAQA 3AEJC 3ASBA 4LNLA 3MKJA 4EB5A 3BN1A 4WYAA 1C7OA 3K28A 3BCAA 1AJRA 1XEYA 4BA4A 1TOJA 2VMTA 1ASAA 1SFFA 1V72A 2F8JA 4Q6RA 4GE7A 3GSBA 3NRAA 3AENB 4UOYA 4A0FA 1CL1A 4K2MA 4W1VA 2AY6A 5K8BA 5D5SA 1LC8A 1IBJA 2Z9XA 2AY7A 4QGRA 1WYVA 1ASLA 4F5FA 1X2AA 2AY5A 1LC7A 3F9TA 4ZDOA 3GJUA 2QB2A 3NUIA 3LVKA 2D64A 4ZWVA 4F5IA 3FDDA 2VGTA 3HVYA 2TPLA 4UHNA 2X5FA 5EAAA 1E5EA 5I92A 3MAFA 4I8AA 5TF5A 1DJUA 3E6GA 4A6TA 3IF2A 3FZ7A 4JF0A 5J8QA 2W7JA 3JWAA 3N0LA 4A0HA 1S07A 2ZSMA 2OGEA 4CXRA 2QLRA 3WGCA 2D7YA 1W7NA 4B9BA 2E7JA 3I16A 2BIGA 3JW9A 3DXWA 2WK7A 2VGZA 3UAKA 3LY1A 1U08A 3CQ4A 3MC6C 2JJGA 4M2KA 3LVJA 3ZRPA 1UKJA 2HP2A 3VK4A 2AY8A 1CJ0A 2ZJGA 1N2TA 3ASAA 3DZZA 4MSOA 4IYOB 3RCHA 1LC5A 4Y0DA 1X28A 4IXSA 2VMOA 2VMPA 3QGUA 3A2BA 1C7GA 1W7LA 3HDOA 2W7DA 3P1TA 3HQTA 3T32A 3HMUA 1M6SA 1O61A 1IAXA 3BB8A 4WYGA 1QGNA 1AIBA 3EI9A 3I5TA 3ZRRA 3EUCA 4A0GA 3NYSA 5BJ4A 2Z9VA 3LVLB 1ASFA 2AEVA 1RV4A 2Z1YA 3AEMC 2W8TA 3R9AA 2R5CA 4R5FA 3FFRA 1AICA 4K2IA 5F9SA 3F6TA 4ZAHA 1GC4A 3PDXA 1UU2A 1WYUA 1TOGA 1DJ9A 3G0TA 1GDEA 2GQNA 3E2YA 4IY7A 4R8DA 3DC1A 1MLYA 3WZFA 2VGUA 1N8PA 2OGAA 5DB5A 4TMRA 2VGWA 1BQAA 3EI8A 1AMQA 4OT8A 1J32A 1M0PA 2YCNA 3K7YA 1SZUA 2BI5A 3JZLA 1BS0A 4AZKA 2CJGA 4BHDA 1M7YA 1ELQA 2VMYA 4OCAA 1P3WA 1DJEA 1OXPA 1RVUA 1SZSA 3DXVA 4F5KA 1QJ3A 1Y4IA 3PPLA 1O69A 1ASGA 2BKWA 5DJ1A 8AATA 1BKGA 3BS8A 2W7HA 4A00A 1MLZA 2DGMA 2VMWA 4ZASA 1WYVB 4ZDLA 2D63A 2W7MA 2RFVA 3TFTA 3BC8A 1X29A 3EI7A 4W1XA 2YOBA 2ZC0A 2FN6A 2BI9A 3MAFB 4WB0B 3PDBA 4WYEA 1V2EA 3NYUA 3BV0A 3GZCA 1B5OA 4HVKA 4GE4A 4JEZA 4XEWA 5LHAA 1QJ5A 3NX3A 4FL0A 1AHYA 1AY5A 2JJHA 1AMRA 4WD2A 1AY4A 2G6WA 3TCMA 2EH6A 4IX8A 1ARGA 2YHKA 1I43A 1VJOA 1LKCA 3OKSA 1AJSB 1Z7DA 3AATA 4DBCA 2C7TA 2DKBA 2BHXA 3RCHB 2VIBA 4A6UA 1TPLA 3FZ6A 3GR9A 4KAMA 3UWCA 1BJNA 4RKCA 3FTBA 2C81A 9AATA
chains in the Genus database with same CATH superfamily
2EYQA 3PA9A 1M0OA 1B4XA 4U2HA 2O0RA 1YOOA 3LG0A 4LW2A 4OMAA 3KGWA 4UHMA 2W8WA 4JEYA 1W3UA 1JG8A 3QHXA 3NDNA 1GEXA 2OQXA 2BI2A 2D66A 2R0TA 1E5FA 3PAAA 2YCPA 4RITA 1OHVA 2BWPA 3EIAA 2YKVA 4WBTA 4CBRA 1Z3ZA 1YIZA 5FT8A 3FQ8A 4WYFA 3MEBA 2R5CB 1KMKA 1MAPA 3AOWA 2FKIA 4L0OA 3DRDA 1ASNA 3GZDC 1W7MA 2AY2A 1WYUB 4EFFA 1LK9A 2W7EA 3JU7A 3NYTA 4RM1A 4MQQA 5HHYA 3WCNA 1EJIA 1BJ4A 2CSTA 3KE3A 3EI6A 3E2FA 1I41A 2Z61A 3FRKA 3L8AA 3PGYA 4GEBA 3RBLA 1GC0A 2HP1A 2YRRA 4WB0A 3RI6A 2EZ2A 2OATA 5JAYA 4W8IA 3K40A 2PO3A 3FD0A 1CQ8A 3FVXA 4Q31A 4M2JA 1GCKA 1TOIA 3N5MA 3R4TA 3DODA 1TARA 3BWNA 3CAIA 3ECDA 3FCRA 1S06A 4RJ0A 4LNMA 2NMPA 2WK8A 1CQ7A 3VOMA 2AEUA 4ZDPA 2AY1A 3NU8A 2JJEA 4R5ZA 4DQ6A 2DOUA 4WYDA 1AJSA 4F5HA 4M2MA 2AY4A 2W7GA 3P6KA 5D95A 1QZ9A 3AV7A 5DJ9A 5EFSA 2VMRA 3H14A 1BJOA 1YJZA 1AHXA 2BYJA 1AY8A 3PD6A 2VMZA 3A9YA 4K2BA 3RBFA 3PDBB 3A9XA 2E54A 4IXZA 5M49A 3VK3A 1MDOA 4F4EA 4RJYA 4RAEA 4EU1A 3E77A 1ASBA 3PIUA 5BJ3A 4GRXA 4JEXA 5G0AA 4E77A 1YIYA 4Y0IA 4ADDA 1GBNA 2HUIA 2CJHA 1AX4A 4AZJA 1GD9A 3FSLA 4N0WA 2JJFA 5G4JA 4BA5A 1AHEA 2DGKA 2CFBA 1FG3A 2VGSA 3DU4A 3RUYA 3VP6A 3BCXA 4JF1A 4WXFA 2X5DA 4XQ2A 4GE9A 3ACZA 1CS1A 4TV7A 4Q76A 3JTXA 2HORA 4JE5A 5EUDA 3AEOA 2ZY5A 1AHFA 1G7XA 1ECXA 1VP4A 1M4NA 1PFFA 4WXGA 2BYLA 5F8VA 2YKXA 2E7UA 4XJPA 4ZLVA 3TQXA 1S09A 4ZSYA 3LWSA 1TATA 2V1PA 1AHGA 1V2FA 1TOKA 1KL2A 3GWPA 3Q8NA 1D7UA 4PFNA 2AATA 4EMYA 4XJLA 2CANA 3FKDA 3FVSA 1VEFA 2QA3A 2FQ6A 2ZY4A 1UU1A 5G2PA 1KMJA 5FT5A 2W8JA 2W7KA 2EGYA 2O7CA 4WYCA 1PMOA 4LW4A 5EAVA 3EI5A 1OATA 3QI6A 4XK1A 3W1HA 2VIAA 3BCBA 2W7IA 2BWOA 4LC3A 3QM2A 2VI9A 1G7WA 4ADBA 2FYFA 3H7FA 4PFFA 3B1DA 1IJIA 1B8GA 4XJOA 1DFOA 2VMXA 2GMUA 2FNUA 2HUUA 3B1CA 3CQ5A 3KGXA 3GETA 4PIWA 4GSAA 1FG7A 4MQRA 1LW4A 1ELUA 3LVMA 4ZSWA 1LS3A 5M4BA 4E3RA 2DR1A 3B1EA 1B9IA 1G4VA 1IX8A 4IXOA 5FT6A 3WGBA 1O4SA 3WCOA 3WY7A 1W23A 3N4SA 3FZ8A 1BJOB 1M0NA 2CJDA 3ELEA 1IUGA 1D7RA 2D65A 4MQPA 3PD6B 4OC9A 3II0A 4Y0HA 2R2NA 1ARSA 4JEWA 4ATQA 3AEJA 4CBSA 2Z67A 4OBVA 2G7JA 4H63Q 1AMSA 2BWNA 3RQ1A 3ZRQA 2C44A 1EQBA 2W8UA 1KKPA 1OXOA 3N7NA 5M4DA 1IX6A 5EIGB 4U1TA 1YAAA 2OKKA 5E4ZA 2VLHA 1SVVA 3OP7A 3QBOA 2BIEA 3EZ1A 3TATA 3FDBA 3F0HA 1CZCA 1JS6A 2QMAA 1AKCA 1BQDA 3E2ZA 1I48A 3NNKA 4JEVA 4XJMA 4CVQA 2DGLA 5HXXA 2EO5A 2X3LA 3ZZKA 4F5MA 2QB3A 2A1VA 2O1BA 2Z1ZA 2W7LA 3KKIA 4ADEA 4F5GA 2JISA 1ARHA 5C6UA 4F5JA 4K05A 2VMUA 4O6ZA 2CY8A 4ADCA 2HZPA 2CTZA 4WLHA 1ASMA 2Z20A 1AMAA 1S08A 2C0RA 3N75A 1MDXA 5FT4A 3WLXA 4AO9A 5DX5A 4A72A 4OTLA 2YRIA 1ZOBA 4RIZA 1BT4A 3NTJA 4UQVA 5EQCA 2PB2A 2GB3A 4E3QA 1EG5A 2QSRA 1D2FA 3D6KA 4H51A 3COGA 1B5PA 3DR7A 3EZSA 4AH3A 1GEWA 2YKUA 2FNIA 2XH1A 2VGVA 3ZZJA 3HT4A 3BWOA 1JS3A 2R5EA 4DGTA 3HL2A 3MC6A 3HLMA 1DTYA 3FQAA 1AAWA 4ZM3A 1WYTA 1RV3A 2HOXA 4JE5D 1C0NA 2DKJA 1BJWA 4KYOA 5G09A 2W8VA 1ZODA 1G4XA 3G8MA 2OKJA 1ASDA 4WLJA 4P3MA 5EUEA 2FM1A 2JGTA 3NUBA 5IWQA 1GC3A 3H9XA 2EPJA 3VAXA 3NU7A 1ARIA 3LV2A 5G2QA 3VK2A 4WXBA 4AOAA 2HUFA 3A9ZA 3EIBA 3BWNC 2ZSLA 4RLGA 1N31A 1ASCA 2HOYA 1QITA 5EIGA 4AO4A 4ITGA 4KXKA 3AEMA 4MKKA 4J5UA 1DGDA 3L44A 4OBUA 1D7SA 2VLFA 3USFA 1H0CA 4LNJA 3AEPA 3IHJA 4A6RA 4BQ0A 2CINA 2YCTA 3G7QA 1JF9A 5E3KA 5LH9A 1S0AA 4E1OA 3W1IA 3WKSA 3ISLA 3MAUA 4W5KA 1LW5A 1UU0A 1SPAA 3ATHA 1ASEA 1ARTA 2CH2A 2EZ1A 2VYCA 3UE8A 1PG8A 2Z9WA 4MKJA 2BI1A 3W1JA 5G4IA 2ZUKA 2YKYA 2CB1A 3FQ7A 3AENA 4B98A 2VI8A 3M5UA 5HDMA 4UHOA 2Q7WA 2W7FA 1SZKA 4ISYA 5M46A 3ELPA 2WK9A 4PVFA 1H1CA 3JWBA 3E2ZB 1MDZA 3B8XA 2XBNA 1V2DA 4J8LA 4XAUA 2D5YA 1BW0A 1GC2A 4A0RA 2BIAA 1AKAA 2AY9A 4N0BA 1AAMA 1QISA 4R2NA 1M0QA 2QBTA 4WP0A 1C7NA 1CQ6A 7AATA 2WKAA 2HOZA 1CZEA 1WSTA 4TN4A 1DGEA 4HF8A 2JG2A 3CBFA 2ZYJA 4GDYA 3GBXA 3HBXA 4ZWMA 2BI3A 1WKHA 1M32A 1WKGA 3PJ0A 4MY5A 1FC4A 4OYTA 4W1WA 1IAYA 3TFUA 3WX9A 1QIRA 3QN6A 2GMSA 4FFCA 5AX8A 1GEYA 2E7IA 1TOEA 1KKJA 1C4KA 4Q75A 3DYDA 2VMSA 1B9HA 1ORDA 3MBBA 4P7YA 3N4XA 4IYOA 4RKDA 1CL2A 4ZM4A 1WYTB 4W91A 2ZY2A 3FVUA 3FFHA 2ORDA 1SF2A 4MGRA 2WB6A 2ZY3A 3E9KA 1PMMA 1O62A 1AIAA 3I4JA 2PB0A 2V0YA 1YJSA 2D61A 1KL1A 1D7VA 5EUNA 3AELA 3MADA 4EB7A 2VMQA 2X8UA 1C9CA 3B46A 4ATPA 1RVYA 3QPGA 1YNUA 2Z9UA 1J04A 3WKRA 2CH1A 2AY3A 2D7ZA 2VMVA 3A8UX 1AKBA 1T3IA 3CQ6A 3GZDA 4ITXA 1TASA 1IX7A 1ZC9A 5E5IA 2ZP7A 4IW7A 4F5LA 1I29A 1OHYA 2VMNA 4BMKA 1YJYA 1DKAA 4NOGA 4CXQA 1MGVA 1XI9A 1X0MA 1IVRA 1OHWA 2GSAA 3AOVA 3DR4A 1MAQA 3AEJC 3ASBA 4LNLA 3MKJA 4EB5A 3BN1A 4WYAA 1C7OA 3K28A 3BCAA 1AJRA 1XEYA 4BA4A 1TOJA 2VMTA 1ASAA 1SFFA 1V72A 2F8JA 4Q6RA 4GE7A 3GSBA 3NRAA 3AENB 4UOYA 4A0FA 1CL1A 4K2MA 4W1VA 2AY6A 5K8BA 5D5SA 1LC8A 1IBJA 2Z9XA 2AY7A 4QGRA 1WYVA 1ASLA 4F5FA 1X2AA 2AY5A 1LC7A 3F9TA 4ZDOA 3GJUA 2QB2A 3NUIA 3LVKA 2D64A 4ZWVA 4F5IA 3FDDA 2VGTA 3HVYA 2TPLA 4UHNA 2X5FA 5EAAA 1E5EA 5I92A 3MAFA 4I8AA 5TF5A 1DJUA 3E6GA 4A6TA 3IF2A 3FZ7A 4JF0A 5J8QA 2W7JA 3JWAA 3N0LA 4A0HA 1S07A 2ZSMA 2OGEA 4CXRA 2QLRA 3WGCA 2D7YA 1W7NA 4B9BA 2E7JA 3I16A 2BIGA 3JW9A 3DXWA 2WK7A 2VGZA 3UAKA 3LY1A 1U08A 3CQ4A 3MC6C 2JJGA 4M2KA 3LVJA 3ZRPA 1UKJA 2HP2A 3VK4A 2AY8A 1CJ0A 2ZJGA 1N2TA 3ASAA 3DZZA 4MSOA 4IYOB 3RCHA 1LC5A 4Y0DA 1X28A 4IXSA 2VMOA 2VMPA 3QGUA 3A2BA 1C7GA 1W7LA 3HDOA 2W7DA 3P1TA 3HQTA 3T32A 3HMUA 1M6SA 1O61A 1IAXA 3BB8A 4WYGA 1QGNA 1AIBA 3EI9A 3I5TA 3ZRRA 3EUCA 4A0GA 3NYSA 5BJ4A 2Z9VA 3LVLB 1ASFA 2AEVA 1RV4A 2Z1YA 3AEMC 2W8TA 3R9AA 2R5CA 4R5FA 3FFRA 1AICA 4K2IA 5F9SA 3F6TA 4ZAHA 1GC4A 3PDXA 1UU2A 1WYUA 1TOGA 1DJ9A 3G0TA 1GDEA 2GQNA 3E2YA 4IY7A 4R8DA 3DC1A 1MLYA 3WZFA 2VGUA 1N8PA 2OGAA 5DB5A 4TMRA 2VGWA 1BQAA 3EI8A 3N4RA 1AMQA 4OT8A 1J32A 1M0PA 2YCNA 3K7YA 1SZUA 2BI5A 3JZLA 1BS0A 4AZKA 2CJGA 4BHDA 1M7YA 1ELQA 2VMYA 4OCAA 1P3WA 1DJEA 1OXPA 1RVUA 1SZSA 3DXVA 4F5KA 1QJ3A 1Y4IA 3PPLA 1O69A 1ASGA 2BKWA 5DJ1A 8AATA 5KTBA 1BKGA 3BS8A 2W7HA 4A00A 1MLZA 2DGMA 2VMWA 4ZASA 1WYVB 4ZDLA 2D63A 2W7MA 2RFVA 3TFTA 3BC8A 1X29A 3EI7A 4W1XA 2YOBA 2ZC0A 2FN6A 2BI9A 3MAFB 4WB0B 3PDBA 4WYEA 1V2EA 3NYUA 3BV0A 3GZCA 1B5OA 4HVKA 4GE4A 4JEZA 4XEWA 5LHAA 1QJ5A 3NX3A 4FL0A 1AHYA 1AY5A 2JJHA 1AMRA 4WD2A 1AY4A 2G6WA 3TCMA 2EH6A 4IX8A 1KAFA 1ARGA 2YHKA 1I43A 1VJOA 1LKCA 3OKSA 1AJSB 1Z7DA 3AATA 4DBCA 2C7TA 2DKBA 2BHXA 3RCHB 2VIBA 4A6UA 1TPLA 3FZ6A 3GR9A 4KAMA 3UWCA 1BJNA 4RKCA 2KFPA 3FTBA 2C81A 9AATA
chains in the Genus database with same CATH topology
2EYQA 3PA9A 1M0OA 1B4XA 4U2HA 2O0RA 1YOOA 3LG0A 4LW2A 4OMAA 3KGWA 4UHMA 2W8WA 4JEYA 1W3UA 1JG8A 3QHXA 3NDNA 1GEXA 2OQXA 2BI2A 2D66A 2R0TA 1E5FA 3PAAA 2YCPA 4RITA 1OHVA 2BWPA 3EIAA 2YKVA 4WBTA 4CBRA 1Z3ZA 1YIZA 5FT8A 3FQ8A 4WYFA 3MEBA 2R5CB 1KMKA 1MAPA 3AOWA 2FKIA 4L0OA 3DRDA 1ASNA 3GZDC 1W7MA 2AY2A 1WYUB 4EFFA 1LK9A 2W7EA 3JU7A 3NYTA 4RM1A 4MQQA 5HHYA 3WCNA 1EJIA 1BJ4A 2CSTA 3KE3A 3EI6A 3E2FA 1I41A 2Z61A 3FRKA 3L8AA 3PGYA 4GEBA 3RBLA 1GC0A 2HP1A 2YRRA 4WB0A 3RI6A 2EZ2A 2OATA 5JAYA 4W8IA 3K40A 2PO3A 3FD0A 1CQ8A 3FVXA 4Q31A 4M2JA 1GCKA 1TOIA 3N5MA 3R4TA 3DODA 1TARA 3BWNA 3CAIA 3ECDA 3FCRA 1S06A 4RJ0A 4LNMA 2NMPA 2WK8A 1CQ7A 3VOMA 2AEUA 4ZDPA 2AY1A 3NU8A 2JJEA 4R5ZA 4DQ6A 2DOUA 4WYDA 1AJSA 4F5HA 4M2MA 2AY4A 2W7GA 3P6KA 5D95A 1QZ9A 3AV7A 5DJ9A 5EFSA 2VMRA 3H14A 1BJOA 1YJZA 1AHXA 2BYJA 1AY8A 3PD6A 2VMZA 3A9YA 4K2BA 3RBFA 3PDBB 3A9XA 2E54A 4IXZA 5M49A 3VK3A 1MDOA 4F4EA 4RJYA 4RAEA 4EU1A 3E77A 1ASBA 3PIUA 5BJ3A 4GRXA 4JEXA 5G0AA 4E77A 1YIYA 4Y0IA 4ADDA 1GBNA 2HUIA 2CJHA 1AX4A 4AZJA 1GD9A 3FSLA 4N0WA 2JJFA 5G4JA 4BA5A 1AHEA 2DGKA 2CFBA 1FG3A 2VGSA 3DU4A 3RUYA 3VP6A 3BCXA 4JF1A 4WXFA 2X5DA 4XQ2A 4GE9A 3ACZA 1CS1A 4TV7A 4Q76A 3JTXA 2HORA 4JE5A 5EUDA 3AEOA 2ZY5A 1AHFA 1G7XA 1ECXA 1VP4A 1M4NA 1PFFA 4WXGA 2BYLA 5F8VA 2YKXA 2E7UA 4XJPA 4ZLVA 3TQXA 1S09A 4ZSYA 3LWSA 1TATA 2V1PA 1AHGA 1V2FA 1TOKA 1KL2A 3GWPA 3Q8NA 1D7UA 4PFNA 2AATA 4EMYA 4XJLA 2CANA 3FKDA 3FVSA 1VEFA 2QA3A 2FQ6A 2ZY4A 1UU1A 5G2PA 1KMJA 5FT5A 2W8JA 2W7KA 2EGYA 2O7CA 4WYCA 1PMOA 4LW4A 5EAVA 3EI5A 1OATA 3QI6A 4XK1A 3W1HA 2VIAA 3BCBA 2W7IA 2BWOA 4LC3A 3QM2A 2VI9A 1G7WA 4ADBA 2FYFA 3H7FA 4PFFA 3B1DA 1IJIA 1B8GA 4XJOA 1DFOA 2VMXA 2GMUA 2FNUA 2HUUA 3B1CA 3CQ5A 3KGXA 3GETA 4PIWA 4GSAA 1FG7A 4MQRA 1LW4A 1ELUA 3LVMA 4ZSWA 1LS3A 5M4BA 4E3RA 2DR1A 3B1EA 1B9IA 1G4VA 1IX8A 4IXOA 5FT6A 3WGBA 1O4SA 3WCOA 3WY7A 1W23A 3N4SA 3FZ8A 1BJOB 1M0NA 2CJDA 3ELEA 1IUGA 1D7RA 2D65A 4MQPA 3PD6B 4OC9A 3II0A 4Y0HA 2R2NA 1ARSA 4JEWA 4ATQA 3AEJA 4CBSA 2Z67A 4OBVA 2G7JA 4H63Q 1AMSA 2BWNA 3RQ1A 3ZRQA 2C44A 1EQBA 2W8UA 1KKPA 1OXOA 3N7NA 5M4DA 1IX6A 5EIGB 4U1TA 1YAAA 2OKKA 5E4ZA 2VLHA 1SVVA 3OP7A 3QBOA 2BIEA 3EZ1A 3TATA 3FDBA 3F0HA 1CZCA 1JS6A 2QMAA 1AKCA 1BQDA 3E2ZA 1I48A 3NNKA 4JEVA 4XJMA 4CVQA 2DGLA 5HXXA 2EO5A 2X3LA 3ZZKA 4F5MA 2QB3A 2A1VA 2O1BA 2Z1ZA 2W7LA 3KKIA 4ADEA 4F5GA 2JISA 1ARHA 5C6UA 4F5JA 4K05A 2VMUA 4O6ZA 2CY8A 4ADCA 2HZPA 2CTZA 4WLHA 1ASMA 2Z20A 1AMAA 1S08A 2C0RA 3N75A 1MDXA 5FT4A 3WLXA 4AO9A 5DX5A 4A72A 4OTLA 2YRIA 1ZOBA 4RIZA 1BT4A 3NTJA 4UQVA 5EQCA 2PB2A 2GB3A 4E3QA 1EG5A 2QSRA 1D2FA 3D6KA 4H51A 3COGA 1B5PA 3DR7A 3EZSA 4AH3A 1GEWA 2YKUA 2FNIA 2XH1A 2VGVA 3ZZJA 3HT4A 3BWOA 1JS3A 2R5EA 4DGTA 3HL2A 3MC6A 3HLMA 1DTYA 3FQAA 1AAWA 4ZM3A 1WYTA 1RV3A 2HOXA 4JE5D 1C0NA 2DKJA 1BJWA 4KYOA 5G09A 2W8VA 1ZODA 1G4XA 3G8MA 2OKJA 1ASDA 4WLJA 4P3MA 5EUEA 2FM1A 2JGTA 3NUBA 5IWQA 1GC3A 3H9XA 2EPJA 3VAXA 3NU7A 1ARIA 3LV2A 5G2QA 3VK2A 4WXBA 4AOAA 2HUFA 3A9ZA 3EIBA 3BWNC 2ZSLA 4RLGA 1N31A 1ASCA 2HOYA 1QITA 5EIGA 4AO4A 4ITGA 4KXKA 3AEMA 4MKKA 4J5UA 1DGDA 3L44A 4OBUA 1D7SA 2VLFA 3USFA 1H0CA 4LNJA 3AEPA 3IHJA 4A6RA 4BQ0A 2CINA 2YCTA 3G7QA 1JF9A 5E3KA 5LH9A 1S0AA 4E1OA 3W1IA 3WKSA 3ISLA 3MAUA 4W5KA 1LW5A 1UU0A 1SPAA 3ATHA 1ASEA 1ARTA 2CH2A 2EZ1A 2VYCA 3UE8A 1PG8A 2Z9WA 4MKJA 2BI1A 3W1JA 5G4IA 2ZUKA 2YKYA 2CB1A 3FQ7A 3AENA 4B98A 2VI8A 3M5UA 5HDMA 4UHOA 2Q7WA 2W7FA 1SZKA 4ISYA 5M46A 3ELPA 2WK9A 4PVFA 1H1CA 3JWBA 3E2ZB 1MDZA 3B8XA 2XBNA 1V2DA 4J8LA 4XAUA 2D5YA 1BW0A 1GC2A 4A0RA 2BIAA 1AKAA 2AY9A 4N0BA 1AAMA 1QISA 4R2NA 1M0QA 2QBTA 4WP0A 1C7NA 1CQ6A 7AATA 2WKAA 2HOZA 1CZEA 1WSTA 4TN4A 1DGEA 4HF8A 2JG2A 3CBFA 2ZYJA 4GDYA 3GBXA 3HBXA 4ZWMA 2BI3A 1WKHA 1M32A 1WKGA 3PJ0A 4MY5A 1FC4A 4OYTA 4W1WA 1IAYA 3TFUA 3WX9A 1QIRA 3QN6A 2GMSA 4FFCA 5AX8A 1GEYA 2E7IA 1TOEA 1KKJA 1C4KA 4Q75A 3DYDA 2VMSA 1B9HA 1ORDA 3MBBA 4P7YA 3N4XA 4IYOA 4RKDA 1CL2A 4ZM4A 1WYTB 4W91A 2ZY2A 3FVUA 3FFHA 2ORDA 1SF2A 4MGRA 2WB6A 2ZY3A 3E9KA 1PMMA 1O62A 1AIAA 3I4JA 2PB0A 2V0YA 1YJSA 2D61A 1KL1A 1D7VA 5EUNA 3AELA 3MADA 4EB7A 2VMQA 2X8UA 1C9CA 3B46A 4ATPA 1RVYA 3QPGA 1YNUA 2Z9UA 1J04A 3WKRA 2CH1A 2AY3A 2D7ZA 2VMVA 3A8UX 1AKBA 1T3IA 3CQ6A 3GZDA 4ITXA 1TASA 1IX7A 1ZC9A 5E5IA 2ZP7A 4IW7A 4F5LA 1I29A 1OHYA 2VMNA 4BMKA 1YJYA 1DKAA 4NOGA 4CXQA 1MGVA 1XI9A 1X0MA 1IVRA 1OHWA 2GSAA 3AOVA 3DR4A 1MAQA 3AEJC 3ASBA 4LNLA 3MKJA 4EB5A 3BN1A 4WYAA 1C7OA 3K28A 3BCAA 1AJRA 1XEYA 4BA4A 1TOJA 2VMTA 1ASAA 1SFFA 1V72A 2F8JA 4Q6RA 4GE7A 3GSBA 3NRAA 3AENB 4UOYA 4A0FA 1CL1A 4K2MA 4W1VA 2AY6A 5K8BA 5D5SA 1LC8A 1IBJA 2Z9XA 2AY7A 4QGRA 1WYVA 1ASLA 4F5FA 1X2AA 2AY5A 1LC7A 3F9TA 4ZDOA 3GJUA 2QB2A 3NUIA 3LVKA 2D64A 4ZWVA 4F5IA 3FDDA 2VGTA 3HVYA 2TPLA 4UHNA 2X5FA 5EAAA 1E5EA 5I92A 3MAFA 4I8AA 5TF5A 1DJUA 3E6GA 4A6TA 3IF2A 3FZ7A 4JF0A 5J8QA 2W7JA 3JWAA 3N0LA 4A0HA 1S07A 2ZSMA 2OGEA 4CXRA 2QLRA 3WGCA 2D7YA 1W7NA 4B9BA 2E7JA 3I16A 2BIGA 3JW9A 3DXWA 2WK7A 2VGZA 3UAKA 3LY1A 1U08A 3CQ4A 3MC6C 2JJGA 4M2KA 3LVJA 3ZRPA 1UKJA 2HP2A 3VK4A 2AY8A 1CJ0A 2ZJGA 1N2TA 3ASAA 3DZZA 4MSOA 4IYOB 3RCHA 1LC5A 4Y0DA 1X28A 4IXSA 2VMOA 2VMPA 3QGUA 3A2BA 1C7GA 1W7LA 3HDOA 2W7DA 3P1TA 3HQTA 3T32A 3HMUA 1M6SA 1O61A 1IAXA 3BB8A 4WYGA 1QGNA 1AIBA 3EI9A 3I5TA 3ZRRA 3EUCA 4A0GA 3NYSA 5BJ4A 2Z9VA 3LVLB 1ASFA 2AEVA 1RV4A 2Z1YA 3AEMC 2W8TA 3R9AA 2R5CA 4R5FA 3FFRA 1AICA 4K2IA 5F9SA 3F6TA 4ZAHA 1GC4A 3PDXA 1UU2A 1WYUA 1TOGA 1DJ9A 3G0TA 1GDEA 2GQNA 3E2YA 4IY7A 4R8DA 3DC1A 1MLYA 3WZFA 2VGUA 1N8PA 2OGAA 5DB5A 4TMRA 2VGWA 1BQAA 3EI8A 3N4RA 1AMQA 4OT8A 1J32A 1M0PA 2YCNA 3K7YA 1SZUA 2BI5A 3JZLA 1BS0A 4AZKA 2CJGA 4BHDA 1M7YA 1ELQA 2VMYA 4OCAA 1P3WA 1DJEA 1OXPA 1RVUA 1SZSA 3DXVA 4F5KA 1QJ3A 1Y4IA 3PPLA 1O69A 1ASGA 2BKWA 5DJ1A 8AATA 5KTBA 1BKGA 3BS8A 2W7HA 4A00A 1MLZA 2DGMA 2VMWA 4ZASA 1WYVB 4ZDLA 2D63A 2W7MA 2RFVA 3TFTA 3BC8A 1X29A 3EI7A 4W1XA 2YOBA 2ZC0A 2FN6A 2BI9A 3MAFB 4WB0B 3PDBA 4WYEA 1V2EA 3NYUA 3BV0A 3GZCA 1B5OA 4HVKA 4GE4A 4JEZA 4XEWA 5LHAA 1QJ5A 3NX3A 4FL0A 1AHYA 1AY5A 2JJHA 1AMRA 4WD2A 1AY4A 2G6WA 3TCMA 2EH6A 4IX8A 1ARGA 2YHKA 1I43A 1VJOA 1LKCA 3OKSA 1AJSB 1Z7DA 3AATA 4DBCA 2C7TA 2DKBA 2BHXA 3RCHB 2VIBA 4A6UA 1TPLA 3FZ6A 3GR9A 4KAMA 3UWCA 1BJNA 4RKCA 2KFPA 3FTBA 2C81A 9AATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PA9 A;  1M0O A;  1B4X A;  4U2H A;  2O0R A;  1YOO A;  3LG0 A;  4LW2 A;  4OMA A;  3KGW A;  4UHM A;  2W8W A;  4JEY A;  1W3U A;  1JG8 A;  3QHX A;  3NDN A;  1GEX A;  2OQX A;  2BI2 A;  2D66 A;  2R0T A;  1E5F A;  3PAA A;  2YCP A;  4RIT A;  1OHV A;  2BWP A;  3EIA A;  2YKV A;  4WBT A;  4CBR A;  1Z3Z A;  1YIZ A;  5FT8 A;  3FQ8 A;  4WYF A;  3MEB A;  2R5C B;  1KMK A;  1MAP A;  3AOW A;  4L0O A;  3DRD A;  1ASN A;  3GZD C;  1W7M A;  2AY2 A;  1WYU B;  4EFF A;  1LK9 A;  2W7E A;  3JU7 A;  3NYT A;  4RM1 A;  4MQQ A;  5HHY A;  3WCN A;  1EJI A;  1BJ4 A;  2CST A;  3KE3 A;  3EI6 A;  3E2F A;  1I41 A;  2Z61 A;  3FRK A;  3L8A A;  3PGY A;  4GEB A;  3RBL A;  1GC0 A;  2HP1 A;  2YRR A;  4WB0 A;  3RI6 A;  2EZ2 A;  2OAT A;  5JAY A;  4W8I A;  3K40 A;  2PO3 A;  3FD0 A;  1CQ8 A;  3FVX A;  4Q31 A;  4M2J A;  1GCK A;  1TOI A;  3N5M A;  3R4T A;  3DOD A;  1TAR A;  3BWN A;  3CAI A;  3ECD A;  3FCR A;  1S06 A;  4RJ0 A;  4LNM A;  2NMP A;  2WK8 A;  1CQ7 A;  3VOM A;  2AEU A;  4ZDP A;  2AY1 A;  3NU8 A;  2JJE A;  4R5Z A;  4DQ6 A;  2DOU A;  4WYD A;  1AJS A;  4F5H A;  4M2M A;  2AY4 A;  2W7G A;  3P6K A;  5D95 A;  1QZ9 A;  3AV7 A;  5DJ9 A;  5EFS A;  2VMR A;  3H14 A;  1BJO A;  1YJZ A;  1AHX A;  2BYJ A;  1AY8 A;  3PD6 A;  2VMZ A;  3A9Y A;  4K2B A;  3RBF A;  3PDB B;  3A9X A;  2E54 A;  4IXZ A;  5M49 A;  3VK3 A;  1MDO A;  4F4E A;  4RJY A;  4RAE A;  4EU1 A;  3E77 A;  1ASB A;  3PIU A;  5BJ3 A;  4GRX A;  4JEX A;  5G0A A;  4E77 A;  1YIY A;  4Y0I A;  4ADD A;  1GBN A;  2HUI A;  2CJH A;  1AX4 A;  4AZJ A;  1GD9 A;  3FSL A;  4N0W A;  2JJF A;  5G4J A;  4BA5 A;  1AHE A;  2DGK A;  2CFB A;  1FG3 A;  2VGS A;  3DU4 A;  3RUY A;  3VP6 A;  3BCX A;  4JF1 A;  4WXF A;  2X5D A;  4XQ2 A;  4GE9 A;  3ACZ A;  1CS1 A;  4TV7 A;  4Q76 A;  3JTX A;  2HOR A;  4JE5 A;  5EUD A;  3AEO A;  2ZY5 A;  1AHF A;  1G7X A;  1ECX A;  1VP4 A;  1M4N A;  1PFF A;  4WXG A;  2BYL A;  5F8V A;  2YKX A;  2E7U A;  4XJP A;  4ZLV A;  3TQX A;  1S09 A;  4ZSY A;  3LWS A;  1TAT A;  2V1P A;  1AHG A;  1V2F A;  1TOK A;  1KL2 A;  3GWP A;  3Q8N A;  1D7U A;  4PFN A;  2AAT A;  4EMY A;  4XJL A;  2CAN A;  3FKD A;  3FVS A;  1VEF A;  2QA3 A;  2FQ6 A;  2ZY4 A;  1UU1 A;  5G2P A;  1KMJ A;  5FT5 A;  2W8J A;  2W7K A;  2EGY A;  2O7C A;  4WYC A;  1PMO A;  4LW4 A;  5EAV A;  3EI5 A;  1OAT A;  3QI6 A;  4XK1 A;  3W1H A;  2VIA A;  3BCB A;  2W7I A;  2BWO A;  4LC3 A;  3QM2 A;  2VI9 A;  1G7W A;  4ADB A;  2FYF A;  3H7F A;  4PFF A;  3B1D A;  1IJI A;  1B8G A;  4XJO A;  1DFO A;  2VMX A;  2GMU A;  2FNU A;  2HUU A;  3B1C A;  3CQ5 A;  3KGX A;  3GET A;  4PIW A;  4GSA A;  1FG7 A;  4MQR A;  1LW4 A;  1ELU A;  3LVM A;  4ZSW A;  1LS3 A;  5M4B A;  4E3R A;  2DR1 A;  3B1E A;  1B9I A;  1G4V A;  1IX8 A;  4IXO A;  5FT6 A;  3WGB A;  1O4S A;  3WCO A;  3WY7 A;  1W23 A;  3FZ8 A;  1BJO B;  1M0N A;  2CJD A;  3ELE A;  1IUG A;  1D7R A;  2D65 A;  4MQP A;  3PD6 B;  4OC9 A;  3II0 A;  4Y0H A;  2R2N A;  1ARS A;  4JEW A;  4ATQ A;  3AEJ A;  4CBS A;  2Z67 A;  4OBV A;  1AMS A;  2BWN A;  3RQ1 A;  3ZRQ A;  2C44 A;  1EQB A;  2W8U A;  1KKP A;  1OXO A;  5M4D A;  1IX6 A;  5EIG B;  4U1T A;  1YAA A;  2OKK A;  5E4Z A;  2VLH A;  1SVV A;  3OP7 A;  3QBO A;  2BIE A;  3EZ1 A;  3TAT A;  3FDB A;  3F0H A;  1CZC A;  1JS6 A;  2QMA A;  1AKC A;  1BQD A;  3E2Z A;  1I48 A;  3NNK A;  4JEV A;  4XJM A;  4CVQ A;  2DGL A;  5HXX A;  2EO5 A;  2X3L A;  3ZZK A;  4F5M A;  2QB3 A;  2O1B A;  2Z1Z A;  2W7L A;  3KKI A;  4ADE A;  4F5G A;  2JIS A;  1ARH A;  5C6U A;  4F5J A;  2VMU A;  4O6Z A;  2CY8 A;  4ADC A;  2HZP A;  2CTZ A;  4WLH A;  1ASM A;  2Z20 A;  1AMA A;  1S08 A;  2C0R A;  3N75 A;  1MDX A;  5FT4 A;  3WLX A;  4AO9 A;  5DX5 A;  4A72 A;  4OTL A;  2YRI A;  1ZOB A;  4RIZ A;  1BT4 A;  3NTJ A;  4UQV A;  5EQC A;  2PB2 A;  2GB3 A;  4E3Q A;  1EG5 A;  1D2F A;  3D6K A;  4H51 A;  3COG A;  1B5P A;  3DR7 A;  3EZS A;  4AH3 A;  1GEW A;  2YKU A;  2FNI A;  2XH1 A;  2VGV A;  3ZZJ A;  3HT4 A;  3BWO A;  1JS3 A;  2R5E A;  4DGT A;  3HL2 A;  3MC6 A;  3HLM A;  1DTY A;  3FQA A;  1AAW A;  4ZM3 A;  1WYT A;  1RV3 A;  2HOX A;  4JE5 D;  1C0N A;  2DKJ A;  1BJW A;  4KYO A;  5G09 A;  2W8V A;  1ZOD A;  1G4X A;  3G8M A;  2OKJ A;  1ASD A;  4WLJ A;  4P3M A;  5EUE A;  2FM1 A;  2JGT A;  3NUB A;  5IWQ A;  1GC3 A;  2EPJ A;  3VAX A;  3NU7 A;  1ARI A;  3LV2 A;  5G2Q A;  3VK2 A;  4WXB A;  4AOA A;  2HUF A;  3A9Z A;  3EIB A;  3BWN C;  2ZSL A;  4RLG A;  1N31 A;  1ASC A;  2HOY A;  1QIT A;  5EIG A;  4AO4 A;  4ITG A;  4KXK A;  3AEM A;  4MKK A;  4J5U A;  1DGD A;  3L44 A;  4OBU A;  1D7S A;  2VLF A;  3USF A;  1H0C A;  4LNJ A;  3AEP A;  3IHJ A;  4A6R A;  4BQ0 A;  2CIN A;  2YCT A;  3G7Q A;  1JF9 A;  5E3K A;  5LH9 A;  1S0A A;  4E1O A;  3W1I A;  3WKS A;  3ISL A;  3MAU A;  4W5K A;  1LW5 A;  1UU0 A;  1SPA A;  3ATH A;  1ASE A;  1ART A;  2CH2 A;  2EZ1 A;  2VYC A;  3UE8 A;  1PG8 A;  2Z9W A;  4MKJ A;  2BI1 A;  3W1J A;  5G4I A;  2ZUK A;  2YKY A;  2CB1 A;  3FQ7 A;  3AEN A;  4B98 A;  2VI8 A;  3M5U A;  5HDM A;  4UHO A;  2Q7W A;  2W7F A;  1SZK A;  4ISY A;  5M46 A;  3ELP A;  2WK9 A;  4PVF A;  1H1C A;  3JWB A;  3E2Z B;  1MDZ A;  3B8X A;  2XBN A;  1V2D A;  4J8L A;  4XAU A;  2D5Y A;  1BW0 A;  1GC2 A;  4A0R A;  2BIA A;  1AKA A;  2AY9 A;  4N0B A;  1AAM A;  1QIS A;  4R2N A;  1M0Q A;  2QBT A;  4WP0 A;  1C7N A;  1CQ6 A;  7AAT A;  2WKA A;  2HOZ A;  1CZE A;  1WST A;  4TN4 A;  1DGE A;  4HF8 A;  2JG2 A;  3CBF A;  2ZYJ A;  4GDY A;  3GBX A;  3HBX A;  4ZWM A;  2BI3 A;  1WKH A;  1M32 A;  1WKG A;  3PJ0 A;  4MY5 A;  1FC4 A;  4OYT A;  4W1W A;  1IAY A;  3TFU A;  3WX9 A;  1QIR A;  3QN6 A;  2GMS A;  4FFC A;  5AX8 A;  1GEY A;  2E7I A;  1TOE A;  1KKJ A;  1C4K A;  4Q75 A;  3DYD A;  2VMS A;  1B9H A;  1ORD A;  3MBB A;  4P7Y A;  4IYO A;  4RKD A;  1CL2 A;  4ZM4 A;  1WYT B;  4W91 A;  2ZY2 A;  3FVU A;  3FFH A;  2ORD A;  1SF2 A;  4MGR A;  2ZY3 A;  3E9K A;  1PMM A;  1O62 A;  1AIA A;  3I4J A;  2PB0 A;  2V0Y A;  1YJS A;  2D61 A;  1KL1 A;  1D7V A;  5EUN A;  3AEL A;  3MAD A;  4EB7 A;  2VMQ A;  2X8U A;  1C9C A;  3B46 A;  4ATP A;  1RVY A;  3QPG A;  1YNU A;  2Z9U A;  1J04 A;  3WKR A;  2CH1 A;  2AY3 A;  2D7Z A;  2VMV A;  3A8U X;  1AKB A;  1T3I A;  3CQ6 A;  3GZD A;  4ITX A;  1TAS A;  1IX7 A;  1ZC9 A;  5E5I A;  2ZP7 A;  4IW7 A;  4F5L A;  1I29 A;  1OHY A;  2VMN A;  4BMK A;  1YJY A;  1DKA A;  4NOG A;  4CXQ A;  1MGV A;  1XI9 A;  1X0M A;  1IVR A;  1OHW A;  2GSA A;  3AOV A;  3DR4 A;  1MAQ A;  3AEJ C;  3ASB A;  4LNL A;  3MKJ A;  4EB5 A;  3BN1 A;  4WYA A;  1C7O A;  3K28 A;  3BCA A;  1AJR A;  1XEY A;  4BA4 A;  1TOJ A;  2VMT A;  1ASA A;  1SFF A;  1V72 A;  2F8J A;  4Q6R A;  4GE7 A;  3GSB A;  3NRA A;  3AEN B;  4UOY A;  4A0F A;  1CL1 A;  4K2M A;  4W1V A;  2AY6 A;  5K8B A;  5D5S A;  1LC8 A;  1IBJ A;  2Z9X A;  2AY7 A;  4QGR A;  1WYV A;  1ASL A;  4F5F A;  1X2A A;  2AY5 A;  1LC7 A;  3F9T A;  4ZDO A;  3GJU A;  2QB2 A;  3NUI A;  3LVK A;  2D64 A;  4ZWV A;  4F5I A;  3FDD A;  2VGT A;  3HVY A;  2TPL A;  4UHN A;  2X5F A;  5EAA A;  1E5E A;  5I92 A;  3MAF A;  4I8A A;  5TF5 A;  1DJU A;  3E6G A;  4A6T A;  3IF2 A;  3FZ7 A;  4JF0 A;  5J8Q A;  2W7J A;  3JWA A;  3N0L A;  4A0H A;  1S07 A;  2ZSM A;  2OGE A;  4CXR A;  2QLR A;  3WGC A;  2D7Y A;  1W7N A;  4B9B A;  2E7J A;  3I16 A;  2BIG A;  3JW9 A;  3DXW A;  2WK7 A;  2VGZ A;  3UAK A;  3LY1 A;  1U08 A;  3CQ4 A;  3MC6 C;  2JJG A;  4M2K A;  3LVJ A;  3ZRP A;  1UKJ A;  2HP2 A;  3VK4 A;  2AY8 A;  1CJ0 A;  2ZJG A;  1N2T A;  3ASA A;  3DZZ A;  4MSO A;  4IYO B;  3RCH A;  1LC5 A;  4Y0D A;  1X28 A;  4IXS A;  2VMO A;  2VMP A;  3QGU A;  3A2B A;  1C7G A;  1W7L A;  3HDO A;  2W7D A;  3P1T A;  3HQT A;  3T32 A;  3HMU A;  1M6S A;  1O61 A;  1IAX A;  3BB8 A;  4WYG A;  1QGN A;  1AIB A;  3EI9 A;  3I5T A;  3ZRR A;  3EUC A;  4A0G A;  3NYS A;  5BJ4 A;  2Z9V A;  3LVL B;  1ASF A;  2AEV A;  1RV4 A;  2Z1Y A;  3AEM C;  2W8T A;  3R9A A;  2R5C A;  4R5F A;  3FFR A;  1AIC A;  4K2I A;  5F9S A;  3F6T A;  4ZAH A;  1GC4 A;  3PDX A;  1UU2 A;  1WYU A;  1TOG A;  1DJ9 A;  3G0T A;  1GDE A;  2GQN A;  3E2Y A;  4IY7 A;  4R8D A;  3DC1 A;  1MLY A;  3WZF A;  2VGU A;  1N8P A;  2OGA A;  5DB5 A;  4TMR A;  2VGW A;  1BQA A;  3EI8 A;  1AMQ A;  4OT8 A;  1J32 A;  1M0P A;  2YCN A;  3K7Y A;  1SZU A;  2BI5 A;  3JZL A;  1BS0 A;  4AZK A;  2CJG A;  4BHD A;  1M7Y A;  1ELQ A;  2VMY A;  4OCA A;  1P3W A;  1DJE A;  1OXP A;  1RVU A;  1SZS A;  3DXV A;  4F5K A;  1QJ3 A;  1Y4I A;  3PPL A;  1O69 A;  1ASG A;  2BKW A;  5DJ1 A;  8AAT A;  1BKG A;  3BS8 A;  2W7H A;  4A00 A;  1MLZ A;  2DGM A;  2VMW A;  4ZAS A;  1WYV B;  4ZDL A;  2D63 A;  2W7M A;  2RFV A;  3TFT A;  3BC8 A;  1X29 A;  3EI7 A;  4W1X A;  2YOB A;  2ZC0 A;  2FN6 A;  2BI9 A;  3MAF B;  4WB0 B;  3PDB A;  4WYE A;  1V2E A;  3NYU A;  3BV0 A;  3GZC A;  1B5O A;  4HVK A;  4GE4 A;  4JEZ A;  4XEW A;  5LHA A;  1QJ5 A;  3NX3 A;  4FL0 A;  1AHY A;  1AY5 A;  2JJH A;  1AMR A;  4WD2 A;  1AY4 A;  2G6W A;  3TCM A;  2EH6 A;  4IX8 A;  1ARG A;  2YHK A;  1I43 A;  1VJO A;  1LKC A;  3OKS A;  1AJS B;  1Z7D A;  3AAT A;  4DBC A;  2C7T A;  2DKB A;  2BHX A;  3RCH B;  2VIB A;  4A6U A;  1TPL A;  3FZ6 A;  3GR9 A;  4KAM A;  3UWC A;  1BJN A;  4RKC A;  3FTB A;  2C81 A;  9AAT A; 
#chains in the Genus database with same CATH topology
 2EYQ A;  3PA9 A;  1M0O A;  1B4X A;  4U2H A;  2O0R A;  1YOO A;  3LG0 A;  4LW2 A;  4OMA A;  3KGW A;  4UHM A;  2W8W A;  4JEY A;  1W3U A;  1JG8 A;  3QHX A;  3NDN A;  1GEX A;  2OQX A;  2BI2 A;  2D66 A;  2R0T A;  1E5F A;  3PAA A;  2YCP A;  4RIT A;  1OHV A;  2BWP A;  3EIA A;  2YKV A;  4WBT A;  4CBR A;  1Z3Z A;  1YIZ A;  5FT8 A;  3FQ8 A;  4WYF A;  3MEB A;  2R5C B;  1KMK A;  1MAP A;  3AOW A;  2FKI A;  4L0O A;  3DRD A;  1ASN A;  3GZD C;  1W7M A;  2AY2 A;  1WYU B;  4EFF A;  1LK9 A;  2W7E A;  3JU7 A;  3NYT A;  4RM1 A;  4MQQ A;  5HHY A;  3WCN A;  1EJI A;  1BJ4 A;  2CST A;  3KE3 A;  3EI6 A;  3E2F A;  1I41 A;  2Z61 A;  3FRK A;  3L8A A;  3PGY A;  4GEB A;  3RBL A;  1GC0 A;  2HP1 A;  2YRR A;  4WB0 A;  3RI6 A;  2EZ2 A;  2OAT A;  5JAY A;  4W8I A;  3K40 A;  2PO3 A;  3FD0 A;  1CQ8 A;  3FVX A;  4Q31 A;  4M2J A;  1GCK A;  1TOI A;  3N5M A;  3R4T A;  3DOD A;  1TAR A;  3BWN A;  3CAI A;  3ECD A;  3FCR A;  1S06 A;  4RJ0 A;  4LNM A;  2NMP A;  2WK8 A;  1CQ7 A;  3VOM A;  2AEU A;  4ZDP A;  2AY1 A;  3NU8 A;  2JJE A;  4R5Z A;  4DQ6 A;  2DOU A;  4WYD A;  1AJS A;  4F5H A;  4M2M A;  2AY4 A;  2W7G A;  3P6K A;  5D95 A;  1QZ9 A;  3AV7 A;  5DJ9 A;  5EFS A;  2VMR A;  3H14 A;  1BJO A;  1YJZ A;  1AHX A;  2BYJ A;  1AY8 A;  3PD6 A;  2VMZ A;  3A9Y A;  4K2B A;  3RBF A;  3PDB B;  3A9X A;  2E54 A;  4IXZ A;  5M49 A;  3VK3 A;  1MDO A;  4F4E A;  4RJY A;  4RAE A;  4EU1 A;  3E77 A;  1ASB A;  3PIU A;  5BJ3 A;  4GRX A;  4JEX A;  5G0A A;  4E77 A;  1YIY A;  4Y0I A;  4ADD A;  1GBN A;  2HUI A;  2CJH A;  1AX4 A;  4AZJ A;  1GD9 A;  3FSL A;  4N0W A;  2JJF A;  5G4J A;  4BA5 A;  1AHE A;  2DGK A;  2CFB A;  1FG3 A;  2VGS A;  3DU4 A;  3RUY A;  3VP6 A;  3BCX A;  4JF1 A;  4WXF A;  2X5D A;  4XQ2 A;  4GE9 A;  3ACZ A;  1CS1 A;  4TV7 A;  4Q76 A;  3JTX A;  2HOR A;  4JE5 A;  5EUD A;  3AEO A;  2ZY5 A;  1AHF A;  1G7X A;  1ECX A;  1VP4 A;  1M4N A;  1PFF A;  4WXG A;  2BYL A;  5F8V A;  2YKX A;  2E7U A;  4XJP A;  4ZLV A;  3TQX A;  1S09 A;  4ZSY A;  3LWS A;  1TAT A;  2V1P A;  1AHG A;  1V2F A;  1TOK A;  1KL2 A;  3GWP A;  3Q8N A;  1D7U A;  4PFN A;  2AAT A;  4EMY A;  4XJL A;  2CAN A;  3FKD A;  3FVS A;  1VEF A;  2QA3 A;  2FQ6 A;  2ZY4 A;  1UU1 A;  5G2P A;  1KMJ A;  5FT5 A;  2W8J A;  2W7K A;  2EGY A;  2O7C A;  4WYC A;  1PMO A;  4LW4 A;  5EAV A;  3EI5 A;  1OAT A;  3QI6 A;  4XK1 A;  3W1H A;  2VIA A;  3BCB A;  2W7I A;  2BWO A;  4LC3 A;  3QM2 A;  2VI9 A;  1G7W A;  4ADB A;  2FYF A;  3H7F A;  4PFF A;  3B1D A;  1IJI A;  1B8G A;  4XJO A;  1DFO A;  2VMX A;  2GMU A;  2FNU A;  2HUU A;  3B1C A;  3CQ5 A;  3KGX A;  3GET A;  4PIW A;  4GSA A;  1FG7 A;  4MQR A;  1LW4 A;  1ELU A;  3LVM A;  4ZSW A;  1LS3 A;  5M4B A;  4E3R A;  2DR1 A;  3B1E A;  1B9I A;  1G4V A;  1IX8 A;  4IXO A;  5FT6 A;  3WGB A;  1O4S A;  3WCO A;  3WY7 A;  1W23 A;  3N4S A;  3FZ8 A;  1BJO B;  1M0N A;  2CJD A;  3ELE A;  1IUG A;  1D7R A;  2D65 A;  4MQP A;  3PD6 B;  4OC9 A;  3II0 A;  4Y0H A;  2R2N A;  1ARS A;  4JEW A;  4ATQ A;  3AEJ A;  4CBS A;  2Z67 A;  4OBV A;  2G7J A;  4H63 Q;  1AMS A;  2BWN A;  3RQ1 A;  3ZRQ A;  2C44 A;  1EQB A;  2W8U A;  1KKP A;  1OXO A;  3N7N A;  5M4D A;  1IX6 A;  5EIG B;  4U1T A;  1YAA A;  2OKK A;  5E4Z A;  2VLH A;  1SVV A;  3OP7 A;  3QBO A;  2BIE A;  3EZ1 A;  3TAT A;  3FDB A;  3F0H A;  1CZC A;  1JS6 A;  2QMA A;  1AKC A;  1BQD A;  3E2Z A;  1I48 A;  3NNK A;  4JEV A;  4XJM A;  4CVQ A;  2DGL A;  5HXX A;  2EO5 A;  2X3L A;  3ZZK A;  4F5M A;  2QB3 A;  2A1V A;  2O1B A;  2Z1Z A;  2W7L A;  3KKI A;  4ADE A;  4F5G A;  2JIS A;  1ARH A;  5C6U A;  4F5J A;  4K05 A;  2VMU A;  4O6Z A;  2CY8 A;  4ADC A;  2HZP A;  2CTZ A;  4WLH A;  1ASM A;  2Z20 A;  1AMA A;  1S08 A;  2C0R A;  3N75 A;  1MDX A;  5FT4 A;  3WLX A;  4AO9 A;  5DX5 A;  4A72 A;  4OTL A;  2YRI A;  1ZOB A;  4RIZ A;  1BT4 A;  3NTJ A;  4UQV A;  5EQC A;  2PB2 A;  2GB3 A;  4E3Q A;  1EG5 A;  2QSR A;  1D2F A;  3D6K A;  4H51 A;  3COG A;  1B5P A;  3DR7 A;  3EZS A;  4AH3 A;  1GEW A;  2YKU A;  2FNI A;  2XH1 A;  2VGV A;  3ZZJ A;  3HT4 A;  3BWO A;  1JS3 A;  2R5E A;  4DGT A;  3HL2 A;  3MC6 A;  3HLM A;  1DTY A;  3FQA A;  1AAW A;  4ZM3 A;  1WYT A;  1RV3 A;  2HOX A;  4JE5 D;  1C0N A;  2DKJ A;  1BJW A;  4KYO A;  5G09 A;  2W8V A;  1ZOD A;  1G4X A;  3G8M A;  2OKJ A;  1ASD A;  4WLJ A;  4P3M A;  5EUE A;  2FM1 A;  2JGT A;  3NUB A;  5IWQ A;  1GC3 A;  3H9X A;  2EPJ A;  3VAX A;  3NU7 A;  1ARI A;  3LV2 A;  5G2Q A;  3VK2 A;  4WXB A;  4AOA A;  2HUF A;  3A9Z A;  3EIB A;  3BWN C;  2ZSL A;  4RLG A;  1N31 A;  1ASC A;  2HOY A;  1QIT A;  5EIG A;  4AO4 A;  4ITG A;  4KXK A;  3AEM A;  4MKK A;  4J5U A;  1DGD A;  3L44 A;  4OBU A;  1D7S A;  2VLF A;  3USF A;  1H0C A;  4LNJ A;  3AEP A;  3IHJ A;  4A6R A;  4BQ0 A;  2CIN A;  2YCT A;  3G7Q A;  1JF9 A;  5E3K A;  5LH9 A;  1S0A A;  4E1O A;  3W1I A;  3WKS A;  3ISL A;  3MAU A;  4W5K A;  1LW5 A;  1UU0 A;  1SPA A;  3ATH A;  1ASE A;  1ART A;  2CH2 A;  2EZ1 A;  2VYC A;  3UE8 A;  1PG8 A;  2Z9W A;  4MKJ A;  2BI1 A;  3W1J A;  5G4I A;  2ZUK A;  2YKY A;  2CB1 A;  3FQ7 A;  3AEN A;  4B98 A;  2VI8 A;  3M5U A;  5HDM A;  4UHO A;  2Q7W A;  2W7F A;  1SZK A;  4ISY A;  5M46 A;  3ELP A;  2WK9 A;  4PVF A;  1H1C A;  3JWB A;  3E2Z B;  1MDZ A;  3B8X A;  2XBN A;  1V2D A;  4J8L A;  4XAU A;  2D5Y A;  1BW0 A;  1GC2 A;  4A0R A;  2BIA A;  1AKA A;  2AY9 A;  4N0B A;  1AAM A;  1QIS A;  4R2N A;  1M0Q A;  2QBT A;  4WP0 A;  1C7N A;  1CQ6 A;  7AAT A;  2WKA A;  2HOZ A;  1CZE A;  1WST A;  4TN4 A;  1DGE A;  4HF8 A;  2JG2 A;  3CBF A;  2ZYJ A;  4GDY A;  3GBX A;  3HBX A;  4ZWM A;  2BI3 A;  1WKH A;  1M32 A;  1WKG A;  3PJ0 A;  4MY5 A;  1FC4 A;  4OYT A;  4W1W A;  1IAY A;  3TFU A;  3WX9 A;  1QIR A;  3QN6 A;  2GMS A;  4FFC A;  5AX8 A;  1GEY A;  2E7I A;  1TOE A;  1KKJ A;  1C4K A;  4Q75 A;  3DYD A;  2VMS A;  1B9H A;  1ORD A;  3MBB A;  4P7Y A;  3N4X A;  4IYO A;  4RKD A;  1CL2 A;  4ZM4 A;  1WYT B;  4W91 A;  2ZY2 A;  3FVU A;  3FFH A;  2ORD A;  1SF2 A;  4MGR A;  2WB6 A;  2ZY3 A;  3E9K A;  1PMM A;  1O62 A;  1AIA A;  3I4J A;  2PB0 A;  2V0Y A;  1YJS A;  2D61 A;  1KL1 A;  1D7V A;  5EUN A;  3AEL A;  3MAD A;  4EB7 A;  2VMQ A;  2X8U A;  1C9C A;  3B46 A;  4ATP A;  1RVY A;  3QPG A;  1YNU A;  2Z9U A;  1J04 A;  3WKR A;  2CH1 A;  2AY3 A;  2D7Z A;  2VMV A;  3A8U X;  1AKB A;  1T3I A;  3CQ6 A;  3GZD A;  4ITX A;  1TAS A;  1IX7 A;  1ZC9 A;  5E5I A;  2ZP7 A;  4IW7 A;  4F5L A;  1I29 A;  1OHY A;  2VMN A;  4BMK A;  1YJY A;  1DKA A;  4NOG A;  4CXQ A;  1MGV A;  1XI9 A;  1X0M A;  1IVR A;  1OHW A;  2GSA A;  3AOV A;  3DR4 A;  1MAQ A;  3AEJ C;  3ASB A;  4LNL A;  3MKJ A;  4EB5 A;  3BN1 A;  4WYA A;  1C7O A;  3K28 A;  3BCA A;  1AJR A;  1XEY A;  4BA4 A;  1TOJ A;  2VMT A;  1ASA A;  1SFF A;  1V72 A;  2F8J A;  4Q6R A;  4GE7 A;  3GSB A;  3NRA A;  3AEN B;  4UOY A;  4A0F A;  1CL1 A;  4K2M A;  4W1V A;  2AY6 A;  5K8B A;  5D5S A;  1LC8 A;  1IBJ A;  2Z9X A;  2AY7 A;  4QGR A;  1WYV A;  1ASL A;  4F5F A;  1X2A A;  2AY5 A;  1LC7 A;  3F9T A;  4ZDO A;  3GJU A;  2QB2 A;  3NUI A;  3LVK A;  2D64 A;  4ZWV A;  4F5I A;  3FDD A;  2VGT A;  3HVY A;  2TPL A;  4UHN A;  2X5F A;  5EAA A;  1E5E A;  5I92 A;  3MAF A;  4I8A A;  5TF5 A;  1DJU A;  3E6G A;  4A6T A;  3IF2 A;  3FZ7 A;  4JF0 A;  5J8Q A;  2W7J A;  3JWA A;  3N0L A;  4A0H A;  1S07 A;  2ZSM A;  2OGE A;  4CXR A;  2QLR A;  3WGC A;  2D7Y A;  1W7N A;  4B9B A;  2E7J A;  3I16 A;  2BIG A;  3JW9 A;  3DXW A;  2WK7 A;  2VGZ A;  3UAK A;  3LY1 A;  1U08 A;  3CQ4 A;  3MC6 C;  2JJG A;  4M2K A;  3LVJ A;  3ZRP A;  1UKJ A;  2HP2 A;  3VK4 A;  2AY8 A;  1CJ0 A;  2ZJG A;  1N2T A;  3ASA A;  3DZZ A;  4MSO A;  4IYO B;  3RCH A;  1LC5 A;  4Y0D A;  1X28 A;  4IXS A;  2VMO A;  2VMP A;  3QGU A;  3A2B A;  1C7G A;  1W7L A;  3HDO A;  2W7D A;  3P1T A;  3HQT A;  3T32 A;  3HMU A;  1M6S A;  1O61 A;  1IAX A;  3BB8 A;  4WYG A;  1QGN A;  1AIB A;  3EI9 A;  3I5T A;  3ZRR A;  3EUC A;  4A0G A;  3NYS A;  5BJ4 A;  2Z9V A;  3LVL B;  1ASF A;  2AEV A;  1RV4 A;  2Z1Y A;  3AEM C;  2W8T A;  3R9A A;  2R5C A;  4R5F A;  3FFR A;  1AIC A;  4K2I A;  5F9S A;  3F6T A;  4ZAH A;  1GC4 A;  3PDX A;  1UU2 A;  1WYU A;  1TOG A;  1DJ9 A;  3G0T A;  1GDE A;  2GQN A;  3E2Y A;  4IY7 A;  4R8D A;  3DC1 A;  1MLY A;  3WZF A;  2VGU A;  1N8P A;  2OGA A;  5DB5 A;  4TMR A;  2VGW A;  1BQA A;  3EI8 A;  3N4R A;  1AMQ A;  4OT8 A;  1J32 A;  1M0P A;  2YCN A;  3K7Y A;  1SZU A;  2BI5 A;  3JZL A;  1BS0 A;  4AZK A;  2CJG A;  4BHD A;  1M7Y A;  1ELQ A;  2VMY A;  4OCA A;  1P3W A;  1DJE A;  1OXP A;  1RVU A;  1SZS A;  3DXV A;  4F5K A;  1QJ3 A;  1Y4I A;  3PPL A;  1O69 A;  1ASG A;  2BKW A;  5DJ1 A;  8AAT A;  5KTB A;  1BKG A;  3BS8 A;  2W7H A;  4A00 A;  1MLZ A;  2DGM A;  2VMW A;  4ZAS A;  1WYV B;  4ZDL A;  2D63 A;  2W7M A;  2RFV A;  3TFT A;  3BC8 A;  1X29 A;  3EI7 A;  4W1X A;  2YOB A;  2ZC0 A;  2FN6 A;  2BI9 A;  3MAF B;  4WB0 B;  3PDB A;  4WYE A;  1V2E A;  3NYU A;  3BV0 A;  3GZC A;  1B5O A;  4HVK A;  4GE4 A;  4JEZ A;  4XEW A;  5LHA A;  1QJ5 A;  3NX3 A;  4FL0 A;  1AHY A;  1AY5 A;  2JJH A;  1AMR A;  4WD2 A;  1AY4 A;  2G6W A;  3TCM A;  2EH6 A;  4IX8 A;  1KAF A;  1ARG A;  2YHK A;  1I43 A;  1VJO A;  1LKC A;  3OKS A;  1AJS B;  1Z7D A;  3AAT A;  4DBC A;  2C7T A;  2DKB A;  2BHX A;  3RCH B;  2VIB A;  4A6U A;  1TPL A;  3FZ6 A;  3GR9 A;  4KAM A;  3UWC A;  1BJN A;  4RKC A;  2KFP A;  3FTB A;  2C81 A;  9AAT A; 
#chains in the Genus database with same CATH homology
 2EYQ A;  3PA9 A;  1M0O A;  1B4X A;  4U2H A;  2O0R A;  1YOO A;  3LG0 A;  4LW2 A;  4OMA A;  3KGW A;  4UHM A;  2W8W A;  4JEY A;  1W3U A;  1JG8 A;  3QHX A;  3NDN A;  1GEX A;  2OQX A;  2BI2 A;  2D66 A;  2R0T A;  1E5F A;  3PAA A;  2YCP A;  4RIT A;  1OHV A;  2BWP A;  3EIA A;  2YKV A;  4WBT A;  4CBR A;  1Z3Z A;  1YIZ A;  5FT8 A;  3FQ8 A;  4WYF A;  3MEB A;  2R5C B;  1KMK A;  1MAP A;  3AOW A;  2FKI A;  4L0O A;  3DRD A;  1ASN A;  3GZD C;  1W7M A;  2AY2 A;  1WYU B;  4EFF A;  1LK9 A;  2W7E A;  3JU7 A;  3NYT A;  4RM1 A;  4MQQ A;  5HHY A;  3WCN A;  1EJI A;  1BJ4 A;  2CST A;  3KE3 A;  3EI6 A;  3E2F A;  1I41 A;  2Z61 A;  3FRK A;  3L8A A;  3PGY A;  4GEB A;  3RBL A;  1GC0 A;  2HP1 A;  2YRR A;  4WB0 A;  3RI6 A;  2EZ2 A;  2OAT A;  5JAY A;  4W8I A;  3K40 A;  2PO3 A;  3FD0 A;  1CQ8 A;  3FVX A;  4Q31 A;  4M2J A;  1GCK A;  1TOI A;  3N5M A;  3R4T A;  3DOD A;  1TAR A;  3BWN A;  3CAI A;  3ECD A;  3FCR A;  1S06 A;  4RJ0 A;  4LNM A;  2NMP A;  2WK8 A;  1CQ7 A;  3VOM A;  2AEU A;  4ZDP A;  2AY1 A;  3NU8 A;  2JJE A;  4R5Z A;  4DQ6 A;  2DOU A;  4WYD A;  1AJS A;  4F5H A;  4M2M A;  2AY4 A;  2W7G A;  3P6K A;  5D95 A;  1QZ9 A;  3AV7 A;  5DJ9 A;  5EFS A;  2VMR A;  3H14 A;  1BJO A;  1YJZ A;  1AHX A;  2BYJ A;  1AY8 A;  3PD6 A;  2VMZ A;  3A9Y A;  4K2B A;  3RBF A;  3PDB B;  3A9X A;  2E54 A;  4IXZ A;  5M49 A;  3VK3 A;  1MDO A;  4F4E A;  4RJY A;  4RAE A;  4EU1 A;  3E77 A;  1ASB A;  3PIU A;  5BJ3 A;  4GRX A;  4JEX A;  5G0A A;  4E77 A;  1YIY A;  4Y0I A;  4ADD A;  1GBN A;  2HUI A;  2CJH A;  1AX4 A;  4AZJ A;  1GD9 A;  3FSL A;  4N0W A;  2JJF A;  5G4J A;  4BA5 A;  1AHE A;  2DGK A;  2CFB A;  1FG3 A;  2VGS A;  3DU4 A;  3RUY A;  3VP6 A;  3BCX A;  4JF1 A;  4WXF A;  2X5D A;  4XQ2 A;  4GE9 A;  3ACZ A;  1CS1 A;  4TV7 A;  4Q76 A;  3JTX A;  2HOR A;  4JE5 A;  5EUD A;  3AEO A;  2ZY5 A;  1AHF A;  1G7X A;  1ECX A;  1VP4 A;  1M4N A;  1PFF A;  4WXG A;  2BYL A;  5F8V A;  2YKX A;  2E7U A;  4XJP A;  4ZLV A;  3TQX A;  1S09 A;  4ZSY A;  3LWS A;  1TAT A;  2V1P A;  1AHG A;  1V2F A;  1TOK A;  1KL2 A;  3GWP A;  3Q8N A;  1D7U A;  4PFN A;  2AAT A;  4EMY A;  4XJL A;  2CAN A;  3FKD A;  3FVS A;  1VEF A;  2QA3 A;  2FQ6 A;  2ZY4 A;  1UU1 A;  5G2P A;  1KMJ A;  5FT5 A;  2W8J A;  2W7K A;  2EGY A;  2O7C A;  4WYC A;  1PMO A;  4LW4 A;  5EAV A;  3EI5 A;  1OAT A;  3QI6 A;  4XK1 A;  3W1H A;  2VIA A;  3BCB A;  2W7I A;  2BWO A;  4LC3 A;  3QM2 A;  2VI9 A;  1G7W A;  4ADB A;  2FYF A;  3H7F A;  4PFF A;  3B1D A;  1IJI A;  1B8G A;  4XJO A;  1DFO A;  2VMX A;  2GMU A;  2FNU A;  2HUU A;  3B1C A;  3CQ5 A;  3KGX A;  3GET A;  4PIW A;  4GSA A;  1FG7 A;  4MQR A;  1LW4 A;  1ELU A;  3LVM A;  4ZSW A;  1LS3 A;  5M4B A;  4E3R A;  2DR1 A;  3B1E A;  1B9I A;  1G4V A;  1IX8 A;  4IXO A;  5FT6 A;  3WGB A;  1O4S A;  3WCO A;  3WY7 A;  1W23 A;  3N4S A;  3FZ8 A;  1BJO B;  1M0N A;  2CJD A;  3ELE A;  1IUG A;  1D7R A;  2D65 A;  4MQP A;  3PD6 B;  4OC9 A;  3II0 A;  4Y0H A;  2R2N A;  1ARS A;  4JEW A;  4ATQ A;  3AEJ A;  4CBS A;  2Z67 A;  4OBV A;  2G7J A;  4H63 Q;  1AMS A;  2BWN A;  3RQ1 A;  3ZRQ A;  2C44 A;  1EQB A;  2W8U A;  1KKP A;  1OXO A;  3N7N A;  5M4D A;  1IX6 A;  5EIG B;  4U1T A;  1YAA A;  2OKK A;  5E4Z A;  2VLH A;  1SVV A;  3OP7 A;  3QBO A;  2BIE A;  3EZ1 A;  3TAT A;  3FDB A;  3F0H A;  1CZC A;  1JS6 A;  2QMA A;  1AKC A;  1BQD A;  3E2Z A;  1I48 A;  3NNK A;  4JEV A;  4XJM A;  4CVQ A;  2DGL A;  5HXX A;  2EO5 A;  2X3L A;  3ZZK A;  4F5M A;  2QB3 A;  2A1V A;  2O1B A;  2Z1Z A;  2W7L A;  3KKI A;  4ADE A;  4F5G A;  2JIS A;  1ARH A;  5C6U A;  4F5J A;  4K05 A;  2VMU A;  4O6Z A;  2CY8 A;  4ADC A;  2HZP A;  2CTZ A;  4WLH A;  1ASM A;  2Z20 A;  1AMA A;  1S08 A;  2C0R A;  3N75 A;  1MDX A;  5FT4 A;  3WLX A;  4AO9 A;  5DX5 A;  4A72 A;  4OTL A;  2YRI A;  1ZOB A;  4RIZ A;  1BT4 A;  3NTJ A;  4UQV A;  5EQC A;  2PB2 A;  2GB3 A;  4E3Q A;  1EG5 A;  2QSR A;  1D2F A;  3D6K A;  4H51 A;  3COG A;  1B5P A;  3DR7 A;  3EZS A;  4AH3 A;  1GEW A;  2YKU A;  2FNI A;  2XH1 A;  2VGV A;  3ZZJ A;  3HT4 A;  3BWO A;  1JS3 A;  2R5E A;  4DGT A;  3HL2 A;  3MC6 A;  3HLM A;  1DTY A;  3FQA A;  1AAW A;  4ZM3 A;  1WYT A;  1RV3 A;  2HOX A;  4JE5 D;  1C0N A;  2DKJ A;  1BJW A;  4KYO A;  5G09 A;  2W8V A;  1ZOD A;  1G4X A;  3G8M A;  2OKJ A;  1ASD A;  4WLJ A;  4P3M A;  5EUE A;  2FM1 A;  2JGT A;  3NUB A;  5IWQ A;  1GC3 A;  3H9X A;  2EPJ A;  3VAX A;  3NU7 A;  1ARI A;  3LV2 A;  5G2Q A;  3VK2 A;  4WXB A;  4AOA A;  2HUF A;  3A9Z A;  3EIB A;  3BWN C;  2ZSL A;  4RLG A;  1N31 A;  1ASC A;  2HOY A;  1QIT A;  5EIG A;  4AO4 A;  4ITG A;  4KXK A;  3AEM A;  4MKK A;  4J5U A;  1DGD A;  3L44 A;  4OBU A;  1D7S A;  2VLF A;  3USF A;  1H0C A;  4LNJ A;  3AEP A;  3IHJ A;  4A6R A;  4BQ0 A;  2CIN A;  2YCT A;  3G7Q A;  1JF9 A;  5E3K A;  5LH9 A;  1S0A A;  4E1O A;  3W1I A;  3WKS A;  3ISL A;  3MAU A;  4W5K A;  1LW5 A;  1UU0 A;  1SPA A;  3ATH A;  1ASE A;  1ART A;  2CH2 A;  2EZ1 A;  2VYC A;  3UE8 A;  1PG8 A;  2Z9W A;  4MKJ A;  2BI1 A;  3W1J A;  5G4I A;  2ZUK A;  2YKY A;  2CB1 A;  3FQ7 A;  3AEN A;  4B98 A;  2VI8 A;  3M5U A;  5HDM A;  4UHO A;  2Q7W A;  2W7F A;  1SZK A;  4ISY A;  5M46 A;  3ELP A;  2WK9 A;  4PVF A;  1H1C A;  3JWB A;  3E2Z B;  1MDZ A;  3B8X A;  2XBN A;  1V2D A;  4J8L A;  4XAU A;  2D5Y A;  1BW0 A;  1GC2 A;  4A0R A;  2BIA A;  1AKA A;  2AY9 A;  4N0B A;  1AAM A;  1QIS A;  4R2N A;  1M0Q A;  2QBT A;  4WP0 A;  1C7N A;  1CQ6 A;  7AAT A;  2WKA A;  2HOZ A;  1CZE A;  1WST A;  4TN4 A;  1DGE A;  4HF8 A;  2JG2 A;  3CBF A;  2ZYJ A;  4GDY A;  3GBX A;  3HBX A;  4ZWM A;  2BI3 A;  1WKH A;  1M32 A;  1WKG A;  3PJ0 A;  4MY5 A;  1FC4 A;  4OYT A;  4W1W A;  1IAY A;  3TFU A;  3WX9 A;  1QIR A;  3QN6 A;  2GMS A;  4FFC A;  5AX8 A;  1GEY A;  2E7I A;  1TOE A;  1KKJ A;  1C4K A;  4Q75 A;  3DYD A;  2VMS A;  1B9H A;  1ORD A;  3MBB A;  4P7Y A;  3N4X A;  4IYO A;  4RKD A;  1CL2 A;  4ZM4 A;  1WYT B;  4W91 A;  2ZY2 A;  3FVU A;  3FFH A;  2ORD A;  1SF2 A;  4MGR A;  2WB6 A;  2ZY3 A;  3E9K A;  1PMM A;  1O62 A;  1AIA A;  3I4J A;  2PB0 A;  2V0Y A;  1YJS A;  2D61 A;  1KL1 A;  1D7V A;  5EUN A;  3AEL A;  3MAD A;  4EB7 A;  2VMQ A;  2X8U A;  1C9C A;  3B46 A;  4ATP A;  1RVY A;  3QPG A;  1YNU A;  2Z9U A;  1J04 A;  3WKR A;  2CH1 A;  2AY3 A;  2D7Z A;  2VMV A;  3A8U X;  1AKB A;  1T3I A;  3CQ6 A;  3GZD A;  4ITX A;  1TAS A;  1IX7 A;  1ZC9 A;  5E5I A;  2ZP7 A;  4IW7 A;  4F5L A;  1I29 A;  1OHY A;  2VMN A;  4BMK A;  1YJY A;  1DKA A;  4NOG A;  4CXQ A;  1MGV A;  1XI9 A;  1X0M A;  1IVR A;  1OHW A;  2GSA A;  3AOV A;  3DR4 A;  1MAQ A;  3AEJ C;  3ASB A;  4LNL A;  3MKJ A;  4EB5 A;  3BN1 A;  4WYA A;  1C7O A;  3K28 A;  3BCA A;  1AJR A;  1XEY A;  4BA4 A;  1TOJ A;  2VMT A;  1ASA A;  1SFF A;  1V72 A;  2F8J A;  4Q6R A;  4GE7 A;  3GSB A;  3NRA A;  3AEN B;  4UOY A;  4A0F A;  1CL1 A;  4K2M A;  4W1V A;  2AY6 A;  5K8B A;  5D5S A;  1LC8 A;  1IBJ A;  2Z9X A;  2AY7 A;  4QGR A;  1WYV A;  1ASL A;  4F5F A;  1X2A A;  2AY5 A;  1LC7 A;  3F9T A;  4ZDO A;  3GJU A;  2QB2 A;  3NUI A;  3LVK A;  2D64 A;  4ZWV A;  4F5I A;  3FDD A;  2VGT A;  3HVY A;  2TPL A;  4UHN A;  2X5F A;  5EAA A;  1E5E A;  5I92 A;  3MAF A;  4I8A A;  5TF5 A;  1DJU A;  3E6G A;  4A6T A;  3IF2 A;  3FZ7 A;  4JF0 A;  5J8Q A;  2W7J A;  3JWA A;  3N0L A;  4A0H A;  1S07 A;  2ZSM A;  2OGE A;  4CXR A;  2QLR A;  3WGC A;  2D7Y A;  1W7N A;  4B9B A;  2E7J A;  3I16 A;  2BIG A;  3JW9 A;  3DXW A;  2WK7 A;  2VGZ A;  3UAK A;  3LY1 A;  1U08 A;  3CQ4 A;  3MC6 C;  2JJG A;  4M2K A;  3LVJ A;  3ZRP A;  1UKJ A;  2HP2 A;  3VK4 A;  2AY8 A;  1CJ0 A;  2ZJG A;  1N2T A;  3ASA A;  3DZZ A;  4MSO A;  4IYO B;  3RCH A;  1LC5 A;  4Y0D A;  1X28 A;  4IXS A;  2VMO A;  2VMP A;  3QGU A;  3A2B A;  1C7G A;  1W7L A;  3HDO A;  2W7D A;  3P1T A;  3HQT A;  3T32 A;  3HMU A;  1M6S A;  1O61 A;  1IAX A;  3BB8 A;  4WYG A;  1QGN A;  1AIB A;  3EI9 A;  3I5T A;  3ZRR A;  3EUC A;  4A0G A;  3NYS A;  5BJ4 A;  2Z9V A;  3LVL B;  1ASF A;  2AEV A;  1RV4 A;  2Z1Y A;  3AEM C;  2W8T A;  3R9A A;  2R5C A;  4R5F A;  3FFR A;  1AIC A;  4K2I A;  5F9S A;  3F6T A;  4ZAH A;  1GC4 A;  3PDX A;  1UU2 A;  1WYU A;  1TOG A;  1DJ9 A;  3G0T A;  1GDE A;  2GQN A;  3E2Y A;  4IY7 A;  4R8D A;  3DC1 A;  1MLY A;  3WZF A;  2VGU A;  1N8P A;  2OGA A;  5DB5 A;  4TMR A;  2VGW A;  1BQA A;  3EI8 A;  3N4R A;  1AMQ A;  4OT8 A;  1J32 A;  1M0P A;  2YCN A;  3K7Y A;  1SZU A;  2BI5 A;  3JZL A;  1BS0 A;  4AZK A;  2CJG A;  4BHD A;  1M7Y A;  1ELQ A;  2VMY A;  4OCA A;  1P3W A;  1DJE A;  1OXP A;  1RVU A;  1SZS A;  3DXV A;  4F5K A;  1QJ3 A;  1Y4I A;  3PPL A;  1O69 A;  1ASG A;  2BKW A;  5DJ1 A;  8AAT A;  5KTB A;  1BKG A;  3BS8 A;  2W7H A;  4A00 A;  1MLZ A;  2DGM A;  2VMW A;  4ZAS A;  1WYV B;  4ZDL A;  2D63 A;  2W7M A;  2RFV A;  3TFT A;  3BC8 A;  1X29 A;  3EI7 A;  4W1X A;  2YOB A;  2ZC0 A;  2FN6 A;  2BI9 A;  3MAF B;  4WB0 B;  3PDB A;  4WYE A;  1V2E A;  3NYU A;  3BV0 A;  3GZC A;  1B5O A;  4HVK A;  4GE4 A;  4JEZ A;  4XEW A;  5LHA A;  1QJ5 A;  3NX3 A;  4FL0 A;  1AHY A;  1AY5 A;  2JJH A;  1AMR A;  4WD2 A;  1AY4 A;  2G6W A;  3TCM A;  2EH6 A;  4IX8 A;  1ARG A;  2YHK A;  1I43 A;  1VJO A;  1LKC A;  3OKS A;  1AJS B;  1Z7D A;  3AAT A;  4DBC A;  2C7T A;  2DKB A;  2BHX A;  3RCH B;  2VIB A;  4A6U A;  1TPL A;  3FZ6 A;  3GR9 A;  4KAM A;  3UWC A;  1BJN A;  4RKC A;  2KFP A;  3FTB A;  2C81 A;  9AAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...