4OTTA

Crystal structure of the gamma-glutamyltranspeptidase from bacillus licheniformis.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
357
structure length
357
Chain Sequence
DKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETKETSIINSRERAPEGAKPDMFLDEDGKVIPFSERSRHGNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQDKLSKTAAKDIFLPDGEPLKEGDILVQKDMAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYDPKSFEKYHLLAETMHLSYADRAAYAGDPEFVDVPLRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma glutamyl transpeptidase
publication title Low resolution X-ray structure of gamma-glutamyltranspeptidase from Bacillus licheniformis: Opened active site cleft and a cluster of acid residues potentially involved in the recognition of a metal ion.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 91
structure length 357
sequence length 357
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2014-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4ottA02
4Z9OA 4OTTA 2DBXA 2QM6A 4OTUA 3WHRA 3WHSA 2DBUA 4ZBKA 5BPKA 2DG5A 2Z8JA 2DBWA 4ZCGA 2NQOA 2Z8KA 2E0XA 2Z8IA 2E0YA 2QMCA 4ZC6A 3FNMA 4GDXA 3WHQA 4GG2A 2V36A 3A75A 5B5TA
chains in the Genus database with same CATH superfamily
1E78A 2DBXA 3A73A 1H9ZA 5IFOA 3V08A 4FK5B 2GUTA 2JUHA 4JK4A 4GDKB 3UIVA 3WHRA 1UORA 4F5VA 5GINA 1TXUA 3PLAA 2DBUA 5DQFA 1E7HA 1JNBA 2XSIA 4N0UD 1E7CA 3FWBC 1BKEA 1MA9A 2DBWA 4FJCB 1HK4A 2BXKA 2VDBA 1N5UA 1LOTA 3H37A 1HK2A 3B9LA 3MHHB 5D7GA 4BKEA 4C31B 4TQ1A 5IJFA 4N3ZA 3JRYA 2KBZA 4OR0A 4G04A 3WHQA 1E7AA 1MUSA 3NMUA 2BXBA 4WA6B 4S1YA 4LUHA 5IIHA 4J2VA 2KWFA 4HGKA 1KDXA 4NAWB 3JQZA 1FOUA 4M70B 2OZBB 4K71A 3KIKA 4OTUA 5DBYA 3TDLA 4L9KA 2XVWA 4OT2A 2BXMA 4ZBRA 2NNWA 1E7BA 5GIPA 2BXAA 2Z8JA 2BXIA 5FUOA 2XVQA 4LB9A 2BX8A 3LU8A 5IJEA 1NT2B 2E0XA 2LXSA 2QMCA 2VUEA 2YDFA 3NVMA 3ECPA 3FNMA 5IIXA 3MHSB 3SQJA 4DHXB 5ID9A 2I2ZA 3SIUB 2EFEA 3ICXA 1E7FA 1VFIA 3G9KD 3BPJA 2BXNA 3A75A 2I30A 4N0FD 2QHBA 2EFCA 3H3AA 3LU6A 2LXTA 5B5TA 1O9XA 4G01A 4Z9OA 4IW2A 1GNJA 4EMXA 2QM6A 2BXPA 2DYOA 5GHKA 4F5TA 2K0NA 3V09A 1GNIA 2BXFA 4ZUXV 2BXEA 4ZBKA 1HA2A 2BXQA 5BPKA 3GA9L 2DG5A 1J78A 4F5SA 4L9QA 1MM8A 1HK1A 1J7EA 3GQUA 1VZSA 3M99C 4HGMB 4K2CA 3W1SA 4LA0A 2Z8IA 4DM0A 1KW2A 4ZC6A 2XW0A 1E7EA 2XW1A 2LQIA 2DYMA 4LUFA 1AO6A 2CKXA 4G03A 4GDXA 4D7XA 1BM0A 1KXPD 3LU7A 5IIUA 4BY9C 5ID7A 4L8UA 2ROHA 4IW1A 1MIWA 5IJ5A 2AJEA 1SB0A 1MIYA 2BXOA 1H5WA 1LNSA 4OTTA 4Z69A 4W4UB 1IJGA 1MIVA 4GDLB 3WHSA 1HK3A 1HK5A 2AGHB 2BXLA 3VQIA 4I9OA 2VUFA 3NVKA 4TQ0A 4ZCGA 3SIVB 2NQOA 4E99A 3KJLA 1BJ5A 2Z8KA 5HOZA 2E0YA 2XMOA 3B9MA 4MBEC 2EFDA 4PO0A 2EFHA 3NVIA 1E7IA 2XVVA 2BXGA 2LQHA 1TF0A 2BXHA 4GG2A 2BXDA 4ZBQA 1MUHA 2XVUA 3V03A 2BXCA 3GQXA 4F5UA 2V36A 2OT3A 4LB2A 5GIOA 1E7GA 3CX9A 2LOQA 4FIPB 3FWCC
chains in the Genus database with same CATH topology
1E78A 2DBXA 3A73A 1H9ZA 5IFOA 3V08A 4FK5B 4JK4A 2JUHA 3UIVA 4GDKB 3WHRA 4F5VA 1UORA 5GINA 1TXUA 3PLAA 2DBUA 5DQFA 1E7HA 1JNBA 2XSIA 4N0UD 1E7CA 3FWBC 1BKEA 1MA9A 2DBWA 4FJCB 1HK4A 2BXKA 2VDBA 1N5UA 1LOTA 3H37A 1HK2A 3B9LA 3MHHB 5D7GA 4BKEA 4C31B 4TQ1A 5IJFA 4N3ZA 3JRYA 2KBZA 4OR0A 4G04A 3WHQA 1E7AA 3NMUA 2BXBA 4WA6B 4S1YA 4LUHA 5IIHA 4J2VA 4HGKA 4NAWB 3JQZA 1FOUA 4M70B 2OZBB 4K71A 3KIKA 4OTUA 5DBYA 3TDLA 4L9KA 2XVWA 4OT2A 2BXMA 4ZBRA 2NNWA 1E7BA 5GIPA 2BXAA 2Z8JA 2BXIA 5FUOA 2XVQA 4LB9A 2BX8A 3LU8A 5IJEA 1NT2B 2E0XA 2QMCA 2VUEA 2YDFA 3NVMA 3FNMA 5IIXA 3MHSB 3SQJA 4DHXB 5ID9A 2I2ZA 3SIUB 2EFEA 3ICXA 1E7FA 1VFIA 3G9KD 4N0FD 2BXNA 3A75A 2I30A 2QHBA 2EFCA 3H3AA 3LU6A 5B5TA 1O9XA 4G01A 4Z9OA 4IW2A 1GNJA 4EMXA 2QM6A 2BXPA 2DYOA 5GHKA 4F5TA 3V09A 1GNIA 2BXFA 4ZUXV 2BXEA 4ZBKA 1HA2A 2BXQA 5BPKA 3GA9L 2DG5A 1J78A 4F5SA 4L9QA 1HK1A 1J7EA 3GQUA 1VZSA 3M99C 4HGMB 4K2CA 3W1SA 4LA0A 2Z8IA 1KW2A 4ZC6A 2XW0A 1E7EA 2XW1A 2DYMA 4LUFA 1AO6A 2CKXA 4G03A 4GDXA 1BM0A 1KXPD 3LU7A 5IIUA 4BY9C 5ID7A 4L8UA 2ROHA 4IW1A 1MIWA 5IJ5A 2AJEA 1MIYA 2BXOA 1H5WA 1LNSA 4OTTA 4Z69A 4W4UB 1IJGA 1MIVA 4GDLB 3WHSA 1HK3A 1HK5A 2BXLA 3VQIA 3NVKA 2VUFA 4TQ0A 4ZCGA 3SIVB 2NQOA 4E99A 3KJLA 1BJ5A 2Z8KA 5HOZA 2E0YA 2XMOA 3B9MA 4MBEC 2EFDA 4PO0A 2EFHA 3NVIA 1E7IA 2XVVA 2BXGA 1TF0A 2BXHA 4GG2A 2BXDA 4ZBQA 2XVUA 3V03A 2BXCA 3GQXA 4F5UA 2V36A 2OT3A 4LB2A 5GIOA 1E7GA 3CX9A 2LOQA 4FIPB 3FWCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9O A;  4OTT A;  2DBX A;  2QM6 A;  4OTU A;  3WHR A;  3WHS A;  2DBU A;  4ZBK A;  5BPK A;  2DG5 A;  2Z8J A;  2DBW A;  4ZCG A;  2NQO A;  2Z8K A;  2E0X A;  2Z8I A;  2E0Y A;  2QMC A;  4ZC6 A;  3FNM A;  4GDX A;  3WHQ A;  4GG2 A;  2V36 A;  3A75 A;  5B5T A; 
#chains in the Genus database with same CATH topology
 1E78 A;  2DBX A;  3A73 A;  1H9Z A;  5IFO A;  3V08 A;  4FK5 B;  2GUT A;  2JUH A;  4JK4 A;  4GDK B;  3UIV A;  3WHR A;  1UOR A;  4F5V A;  5GIN A;  1TXU A;  3PLA A;  2DBU A;  5DQF A;  1E7H A;  1JNB A;  2XSI A;  4N0U D;  1E7C A;  3FWB C;  1BKE A;  1MA9 A;  2DBW A;  4FJC B;  1HK4 A;  2BXK A;  2VDB A;  1N5U A;  1LOT A;  3H37 A;  1HK2 A;  3B9L A;  3MHH B;  5D7G A;  4BKE A;  4C31 B;  4TQ1 A;  5IJF A;  4N3Z A;  3JRY A;  2KBZ A;  4OR0 A;  4G04 A;  3WHQ A;  1E7A A;  1MUS A;  3NMU A;  2BXB A;  4WA6 B;  4S1Y A;  4LUH A;  5IIH A;  4J2V A;  2KWF A;  4HGK A;  1KDX A;  4NAW B;  3JQZ A;  1FOU A;  4M70 B;  2OZB B;  4K71 A;  3KIK A;  4OTU A;  5DBY A;  3TDL A;  4L9K A;  2XVW A;  4OT2 A;  2BXM A;  4ZBR A;  2NNW A;  1E7B A;  5GIP A;  2BXA A;  2Z8J A;  2BXI A;  5FUO A;  2XVQ A;  4LB9 A;  2BX8 A;  3LU8 A;  5IJE A;  1NT2 B;  2E0X A;  2LXS A;  2QMC A;  2VUE A;  2YDF A;  3NVM A;  3ECP A;  3FNM A;  5IIX A;  3MHS B;  3SQJ A;  4DHX B;  5ID9 A;  2I2Z A;  3SIU B;  2EFE A;  3ICX A;  1E7F A;  1VFI A;  3G9K D;  3BPJ A;  2BXN A;  3A75 A;  2I30 A;  4N0F D;  2QHB A;  2EFC A;  3H3A A;  3LU6 A;  2LXT A;  5B5T A;  1O9X A;  4G01 A;  4Z9O A;  4IW2 A;  1GNJ A;  4EMX A;  2QM6 A;  2BXP A;  2DYO A;  5GHK A;  4F5T A;  2K0N A;  3V09 A;  1GNI A;  2BXF A;  4ZUX V;  2BXE A;  4ZBK A;  1HA2 A;  2BXQ A;  5BPK A;  3GA9 L;  2DG5 A;  1J78 A;  4F5S A;  4L9Q A;  1MM8 A;  1HK1 A;  1J7E A;  3GQU A;  1VZS A;  3M99 C;  4HGM B;  4K2C A;  3W1S A;  4LA0 A;  2Z8I A;  4DM0 A;  1KW2 A;  4ZC6 A;  2XW0 A;  1E7E A;  2XW1 A;  2LQI A;  2DYM A;  4LUF A;  1AO6 A;  2CKX A;  4G03 A;  4GDX A;  4D7X A;  1BM0 A;  1KXP D;  3LU7 A;  5IIU A;  4BY9 C;  5ID7 A;  4L8U A;  2ROH A;  4IW1 A;  1MIW A;  5IJ5 A;  2AJE A;  1SB0 A;  1MIY A;  2BXO A;  1H5W A;  1LNS A;  4OTT A;  4Z69 A;  4W4U B;  1IJG A;  1MIV A;  4GDL B;  3WHS A;  1HK3 A;  1HK5 A;  2AGH B;  2BXL A;  3VQI A;  4I9O A;  2VUF A;  3NVK A;  4TQ0 A;  4ZCG A;  3SIV B;  2NQO A;  4E99 A;  3KJL A;  1BJ5 A;  2Z8K A;  5HOZ A;  2E0Y A;  2XMO A;  3B9M A;  4MBE C;  2EFD A;  4PO0 A;  2EFH A;  3NVI A;  1E7I A;  2XVV A;  2BXG A;  2LQH A;  1TF0 A;  2BXH A;  4GG2 A;  2BXD A;  4ZBQ A;  1MUH A;  2XVU A;  3V03 A;  2BXC A;  3GQX A;  4F5U A;  2V36 A;  2OT3 A;  4LB2 A;  5GIO A;  1E7G A;  3CX9 A;  2LOQ A;  4FIP B;  3FWC C; 
#chains in the Genus database with same CATH homology
 1E78 A;  2DBX A;  3A73 A;  1H9Z A;  5IFO A;  3V08 A;  4FK5 B;  4JK4 A;  2JUH A;  3UIV A;  4GDK B;  3WHR A;  4F5V A;  1UOR A;  5GIN A;  1TXU A;  3PLA A;  2DBU A;  5DQF A;  1E7H A;  1JNB A;  2XSI A;  4N0U D;  1E7C A;  3FWB C;  1BKE A;  1MA9 A;  2DBW A;  4FJC B;  1HK4 A;  2BXK A;  2VDB A;  1N5U A;  1LOT A;  3H37 A;  1HK2 A;  3B9L A;  3MHH B;  5D7G A;  4BKE A;  4C31 B;  4TQ1 A;  5IJF A;  4N3Z A;  3JRY A;  2KBZ A;  4OR0 A;  4G04 A;  3WHQ A;  1E7A A;  3NMU A;  2BXB A;  4WA6 B;  4S1Y A;  4LUH A;  5IIH A;  4J2V A;  4HGK A;  4NAW B;  3JQZ A;  1FOU A;  4M70 B;  2OZB B;  4K71 A;  3KIK A;  4OTU A;  5DBY A;  3TDL A;  4L9K A;  2XVW A;  4OT2 A;  2BXM A;  4ZBR A;  2NNW A;  1E7B A;  5GIP A;  2BXA A;  2Z8J A;  2BXI A;  5FUO A;  2XVQ A;  4LB9 A;  2BX8 A;  3LU8 A;  5IJE A;  1NT2 B;  2E0X A;  2QMC A;  2VUE A;  2YDF A;  3NVM A;  3FNM A;  5IIX A;  3MHS B;  3SQJ A;  4DHX B;  5ID9 A;  2I2Z A;  3SIU B;  2EFE A;  3ICX A;  1E7F A;  1VFI A;  3G9K D;  4N0F D;  2BXN A;  3A75 A;  2I30 A;  2QHB A;  2EFC A;  3H3A A;  3LU6 A;  5B5T A;  1O9X A;  4G01 A;  4Z9O A;  4IW2 A;  1GNJ A;  4EMX A;  2QM6 A;  2BXP A;  2DYO A;  5GHK A;  4F5T A;  3V09 A;  1GNI A;  2BXF A;  4ZUX V;  2BXE A;  4ZBK A;  1HA2 A;  2BXQ A;  5BPK A;  3GA9 L;  2DG5 A;  1J78 A;  4F5S A;  4L9Q A;  1HK1 A;  1J7E A;  3GQU A;  1VZS A;  3M99 C;  4HGM B;  4K2C A;  3W1S A;  4LA0 A;  2Z8I A;  1KW2 A;  4ZC6 A;  2XW0 A;  1E7E A;  2XW1 A;  2DYM A;  4LUF A;  1AO6 A;  2CKX A;  4G03 A;  4GDX A;  1BM0 A;  1KXP D;  3LU7 A;  5IIU A;  4BY9 C;  5ID7 A;  4L8U A;  2ROH A;  4IW1 A;  1MIW A;  5IJ5 A;  2AJE A;  1MIY A;  2BXO A;  1H5W A;  1LNS A;  4OTT A;  4Z69 A;  4W4U B;  1IJG A;  1MIV A;  4GDL B;  3WHS A;  1HK3 A;  1HK5 A;  2BXL A;  3VQI A;  3NVK A;  2VUF A;  4TQ0 A;  4ZCG A;  3SIV B;  2NQO A;  4E99 A;  3KJL A;  1BJ5 A;  2Z8K A;  5HOZ A;  2E0Y A;  2XMO A;  3B9M A;  4MBE C;  2EFD A;  4PO0 A;  2EFH A;  3NVI A;  1E7I A;  2XVV A;  2BXG A;  1TF0 A;  2BXH A;  4GG2 A;  2BXD A;  4ZBQ A;  2XVU A;  3V03 A;  2BXC A;  3GQX A;  4F5U A;  2V36 A;  2OT3 A;  4LB2 A;  5GIO A;  1E7G A;  3CX9 A;  2LOQ A;  4FIP B;  3FWC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...