4OTUA

Crystal structure of the gamma-glutamyltranspeptidase from bacillus licheniformis in complex with l-glutamate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
363
structure length
363
Chain Sequence
DKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETKETSIINSRERAPEGAKPDMFLDEDGKVIPFSERSRHGNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQDKLSKTAAKDIFLPDGEPLKEGDILVQKDMAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYDPKSFEKYHLLAETMHLSYADRAAYAGDPEFVDVPLRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQPEDKTIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Low resolution X-ray structure of gamma-glutamyltranspeptidase from Bacillus licheniformis: Opened active site cleft and a cluster of acid residues potentially involved in the recognition of a metal ion.
pubmed doi rcsb
molecule keywords Gamma glutamyl transpeptidase
molecule tags Hydrolase
source organism Bacillus licheniformis
total genus 91
structure length 363
sequence length 363
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2014-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4otuA02
2NQOA 2V36A 3FNMA 4OTUA 2Z8KA 4GDXA 5B5TA 2DBUA 2Z8IA 4OTTA 4ZCGA 2QM6A 2DBXA 4ZBKA 5BPKA 3WHRA 2DBWA 4ZC6A 2QMCA 3A75A 2E0YA 3WHSA 4GG2A 2DG5A 4Z9OA 2E0XA 2Z8JA 3WHQA
chains in the Genus database with same CATH superfamily
3ICXA 1VZSA 4K2CA 4OR0A 3MHSB 3GA9L 4F5VA 1GNJA 2BXQA 2BXDA 1TF0A 5DBYA 2EFEA 5FUOA 4S1YA 5IIUA 2DBUA 4LUFA 1HA2A 2LOQA 3ECPA 4OTTA 3NVIA 1O9XA 4ZCGA 1E7CA 2BXBA 2DBXA 2OT3A 4ZBKA 3V03A 1E7BA 1HK2A 2VUFA 2XVVA 5IJEA 1IJGA 4ZBRA 3CX9A 4TQ0A 3WHSA 5ID9A 3GQUA 4BKEA 2BXIA 4WA6B 2NNWA 5GIOA 3PLAA 2BXAA 2LXTA 2BXMA 2XVUA 4GDLB 4TQ1A 4LA0A 4GDKB 4E99A 2V36A 2XW0A 2EFDA 2BXNA 1E7AA 4GDXA 1J78A 1N5UA 2LQHA 2XSIA 5IIHA 2VDBA 4D7XA 2DYOA 4LB9A 3LU6A 1HK4A 4EMXA 1E7HA 2QM6A 4MBEC 4BY9C 4G04A 1FOUA 4FJCB 3GQXA 5IJ5A 3H3AA 4FIPB 2I2ZA 4ZC6A 2XVWA 2BXHA 3A75A 2E0YA 4L8UA 3NMUA 2BXGA 1E78A 4HGMB 4I9OA 2DG5A 3B9LA 2QHBA 2BXEA 1KXPD 4JK4A 4L9KA 4Z9OA 1E7FA 4G01A 3SIVB 5B5TA 5GIPA 3SQJA 2EFCA 2AGHB 1KDXA 3NVMA 4W4UB 4N3ZA 4G03A 3KJLA 3H37A 3FNMA 2BXPA 4IW2A 5DQFA 4Z69A 5IIXA 4OTUA 2Z8KA 1BM0A 1MIYA 4OT2A 5GINA 2ROHA 1E7IA 1MUSA 4K71A 2Z8IA 2EFHA 1HK3A 1MM8A 3M99C 3BPJA 2BXOA 2BXCA 1HK1A 1TXUA 5BPKA 1BJ5A 2DBWA 1MIVA 3WHRA 1LOTA 4NAWB 2K0NA 3V08A 4DHXB 3B9MA 2CKXA 5HOZA 4GG2A 4M70B 1J7EA 1H9ZA 2I30A 3LU7A 3LU8A 4N0UD 2BXFA 4PO0A 4ZUXV 3FWBC 1GNIA 2Z8JA 3V09A 5D7GA 3WHQA 2BX8A 1KW2A 2KBZA 2VUEA 3KIKA 4HGKA 3NVKA 3FWCC 1JNBA 1BKEA 2NQOA 4F5UA 1MA9A 1H5WA 1AO6A 1E7GA 3JRYA 4J2VA 3UIVA 2GUTA 4DM0A 2KWFA 1MUHA 4N0FD 3A73A 4L9QA 1UORA 2LXSA 4LB2A 3SIUB 4C31B 5IJFA 2XMOA 3G9KD 2BXKA 4F5SA 5IFOA 1VFIA 2OZBB 2JUHA 2BXLA 2QMCA 4LUHA 4F5TA 3W1SA 2AJEA 3VQIA 3MHHB 1MIWA 3JQZA 1SB0A 2YDFA 1E7EA 2XW1A 4FK5B 4ZBQA 2XVQA 2DYMA 1HK5A 1LNSA 1NT2B 2E0XA 2LQIA 5ID7A 5GHKA 4IW1A 3TDLA
chains in the Genus database with same CATH topology
3ICXA 1VZSA 4K2CA 4OR0A 3MHSB 3GA9L 4F5VA 1GNJA 2BXQA 2BXDA 1TF0A 5DBYA 2EFEA 5FUOA 4S1YA 5IIUA 2DBUA 4LUFA 1HA2A 2LOQA 4OTTA 3NVIA 1O9XA 4ZCGA 1E7CA 2BXBA 2DBXA 2OT3A 4ZBKA 3V03A 1E7BA 1HK2A 2VUFA 2XVVA 5IJEA 1IJGA 4ZBRA 3CX9A 4TQ0A 3WHSA 5ID9A 3GQUA 4BKEA 2BXIA 4WA6B 2NNWA 5GIOA 3PLAA 2BXAA 2XVUA 2BXMA 4GDLB 4TQ1A 4LA0A 4GDKB 4E99A 2V36A 2XW0A 2EFDA 2BXNA 1E7AA 4GDXA 1J78A 1N5UA 5IIHA 2XSIA 2VDBA 2DYOA 4LB9A 3LU6A 1HK4A 4EMXA 1E7HA 2QM6A 4MBEC 4BY9C 4G04A 1FOUA 4FJCB 3GQXA 5IJ5A 3H3AA 4FIPB 2I2ZA 4ZC6A 2XVWA 2BXHA 3A75A 2E0YA 4L8UA 3NMUA 2BXGA 1E78A 4HGMB 2DG5A 3B9LA 2QHBA 2BXEA 1KXPD 4JK4A 4L9KA 4Z9OA 1E7FA 4G01A 3SIVB 5B5TA 5GIPA 3SQJA 2EFCA 3NVMA 4W4UB 4N3ZA 4G03A 3KJLA 3H37A 3FNMA 2BXPA 4IW2A 5DQFA 4Z69A 5IIXA 4OTUA 2Z8KA 1BM0A 1MIYA 4OT2A 5GINA 2ROHA 1E7IA 4K71A 2Z8IA 2EFHA 1HK3A 3M99C 2BXOA 2BXCA 1HK1A 1TXUA 5BPKA 1BJ5A 2DBWA 1MIVA 3WHRA 1LOTA 4NAWB 3V08A 4DHXB 3B9MA 2CKXA 5HOZA 4GG2A 4M70B 1J7EA 1H9ZA 2I30A 3LU7A 3LU8A 4N0UD 2BXFA 4PO0A 4ZUXV 3FWBC 1GNIA 2Z8JA 3V09A 5D7GA 3WHQA 2BX8A 1KW2A 2KBZA 2VUEA 3KIKA 4HGKA 3NVKA 3FWCC 1JNBA 1BKEA 2NQOA 4F5UA 1MA9A 1H5WA 1AO6A 1E7GA 3JRYA 4J2VA 3UIVA 4N0FD 3A73A 4L9QA 1UORA 4LB2A 3SIUB 4C31B 5IJFA 2XMOA 3G9KD 2BXKA 4F5SA 5IFOA 1VFIA 2OZBB 2JUHA 2BXLA 2QMCA 4LUHA 4F5TA 3W1SA 2AJEA 3VQIA 3MHHB 1MIWA 3JQZA 2YDFA 1E7EA 2XW1A 4FK5B 4ZBQA 2XVQA 2DYMA 1HK5A 1LNSA 1NT2B 2E0XA 5ID7A 5GHKA 4IW1A 3TDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQO A;  2V36 A;  3FNM A;  4OTU A;  2Z8K A;  4GDX A;  5B5T A;  2DBU A;  2Z8I A;  4OTT A;  4ZCG A;  2QM6 A;  2DBX A;  4ZBK A;  5BPK A;  3WHR A;  2DBW A;  4ZC6 A;  2QMC A;  3A75 A;  2E0Y A;  3WHS A;  4GG2 A;  2DG5 A;  4Z9O A;  2E0X A;  2Z8J A;  3WHQ A; 
#chains in the Genus database with same CATH topology
 3ICX A;  1VZS A;  4K2C A;  4OR0 A;  3MHS B;  3GA9 L;  4F5V A;  1GNJ A;  2BXQ A;  2BXD A;  1TF0 A;  5DBY A;  2EFE A;  5FUO A;  4S1Y A;  5IIU A;  2DBU A;  4LUF A;  1HA2 A;  2LOQ A;  3ECP A;  4OTT A;  3NVI A;  1O9X A;  4ZCG A;  1E7C A;  2BXB A;  2DBX A;  2OT3 A;  4ZBK A;  3V03 A;  1E7B A;  1HK2 A;  2VUF A;  2XVV A;  5IJE A;  1IJG A;  4ZBR A;  3CX9 A;  4TQ0 A;  3WHS A;  5ID9 A;  3GQU A;  4BKE A;  2BXI A;  4WA6 B;  2NNW A;  5GIO A;  3PLA A;  2BXA A;  2LXT A;  2BXM A;  2XVU A;  4GDL B;  4TQ1 A;  4LA0 A;  4GDK B;  4E99 A;  2V36 A;  2XW0 A;  2EFD A;  2BXN A;  1E7A A;  4GDX A;  1J78 A;  1N5U A;  2LQH A;  2XSI A;  5IIH A;  2VDB A;  4D7X A;  2DYO A;  4LB9 A;  3LU6 A;  1HK4 A;  4EMX A;  1E7H A;  2QM6 A;  4MBE C;  4BY9 C;  4G04 A;  1FOU A;  4FJC B;  3GQX A;  5IJ5 A;  3H3A A;  4FIP B;  2I2Z A;  4ZC6 A;  2XVW A;  2BXH A;  3A75 A;  2E0Y A;  4L8U A;  3NMU A;  2BXG A;  1E78 A;  4HGM B;  4I9O A;  2DG5 A;  3B9L A;  2QHB A;  2BXE A;  1KXP D;  4JK4 A;  4L9K A;  4Z9O A;  1E7F A;  4G01 A;  3SIV B;  5B5T A;  5GIP A;  3SQJ A;  2EFC A;  2AGH B;  1KDX A;  3NVM A;  4W4U B;  4N3Z A;  4G03 A;  3KJL A;  3H37 A;  3FNM A;  2BXP A;  4IW2 A;  5DQF A;  4Z69 A;  5IIX A;  4OTU A;  2Z8K A;  1BM0 A;  1MIY A;  4OT2 A;  5GIN A;  2ROH A;  1E7I A;  1MUS A;  4K71 A;  2Z8I A;  2EFH A;  1HK3 A;  1MM8 A;  3M99 C;  3BPJ A;  2BXO A;  2BXC A;  1HK1 A;  1TXU A;  5BPK A;  1BJ5 A;  2DBW A;  1MIV A;  3WHR A;  1LOT A;  4NAW B;  2K0N A;  3V08 A;  4DHX B;  3B9M A;  2CKX A;  5HOZ A;  4GG2 A;  4M70 B;  1J7E A;  1H9Z A;  2I30 A;  3LU7 A;  3LU8 A;  4N0U D;  2BXF A;  4PO0 A;  4ZUX V;  3FWB C;  1GNI A;  2Z8J A;  3V09 A;  5D7G A;  3WHQ A;  2BX8 A;  1KW2 A;  2KBZ A;  2VUE A;  3KIK A;  4HGK A;  3NVK A;  3FWC C;  1JNB A;  1BKE A;  2NQO A;  4F5U A;  1MA9 A;  1H5W A;  1AO6 A;  1E7G A;  3JRY A;  4J2V A;  3UIV A;  2GUT A;  4DM0 A;  2KWF A;  1MUH A;  4N0F D;  3A73 A;  4L9Q A;  1UOR A;  2LXS A;  4LB2 A;  3SIU B;  4C31 B;  5IJF A;  2XMO A;  3G9K D;  2BXK A;  4F5S A;  5IFO A;  1VFI A;  2OZB B;  2JUH A;  2BXL A;  2QMC A;  4LUH A;  4F5T A;  3W1S A;  2AJE A;  3VQI A;  3MHH B;  1MIW A;  3JQZ A;  1SB0 A;  2YDF A;  1E7E A;  2XW1 A;  4FK5 B;  4ZBQ A;  2XVQ A;  2DYM A;  1HK5 A;  1LNS A;  1NT2 B;  2E0X A;  2LQI A;  5ID7 A;  5GHK A;  4IW1 A;  3TDL A; 
#chains in the Genus database with same CATH homology
 3ICX A;  1VZS A;  4K2C A;  4OR0 A;  3MHS B;  3GA9 L;  4F5V A;  1GNJ A;  2BXQ A;  2BXD A;  1TF0 A;  5DBY A;  2EFE A;  5FUO A;  4S1Y A;  5IIU A;  2DBU A;  4LUF A;  1HA2 A;  2LOQ A;  4OTT A;  3NVI A;  1O9X A;  4ZCG A;  1E7C A;  2BXB A;  2DBX A;  2OT3 A;  4ZBK A;  3V03 A;  1E7B A;  1HK2 A;  2VUF A;  2XVV A;  5IJE A;  1IJG A;  4ZBR A;  3CX9 A;  4TQ0 A;  3WHS A;  5ID9 A;  3GQU A;  4BKE A;  2BXI A;  4WA6 B;  2NNW A;  5GIO A;  3PLA A;  2BXA A;  2XVU A;  2BXM A;  4GDL B;  4TQ1 A;  4LA0 A;  4GDK B;  4E99 A;  2V36 A;  2XW0 A;  2EFD A;  2BXN A;  1E7A A;  4GDX A;  1J78 A;  1N5U A;  5IIH A;  2XSI A;  2VDB A;  2DYO A;  4LB9 A;  3LU6 A;  1HK4 A;  4EMX A;  1E7H A;  2QM6 A;  4MBE C;  4BY9 C;  4G04 A;  1FOU A;  4FJC B;  3GQX A;  5IJ5 A;  3H3A A;  4FIP B;  2I2Z A;  4ZC6 A;  2XVW A;  2BXH A;  3A75 A;  2E0Y A;  4L8U A;  3NMU A;  2BXG A;  1E78 A;  4HGM B;  2DG5 A;  3B9L A;  2QHB A;  2BXE A;  1KXP D;  4JK4 A;  4L9K A;  4Z9O A;  1E7F A;  4G01 A;  3SIV B;  5B5T A;  5GIP A;  3SQJ A;  2EFC A;  3NVM A;  4W4U B;  4N3Z A;  4G03 A;  3KJL A;  3H37 A;  3FNM A;  2BXP A;  4IW2 A;  5DQF A;  4Z69 A;  5IIX A;  4OTU A;  2Z8K A;  1BM0 A;  1MIY A;  4OT2 A;  5GIN A;  2ROH A;  1E7I A;  4K71 A;  2Z8I A;  2EFH A;  1HK3 A;  3M99 C;  2BXO A;  2BXC A;  1HK1 A;  1TXU A;  5BPK A;  1BJ5 A;  2DBW A;  1MIV A;  3WHR A;  1LOT A;  4NAW B;  3V08 A;  4DHX B;  3B9M A;  2CKX A;  5HOZ A;  4GG2 A;  4M70 B;  1J7E A;  1H9Z A;  2I30 A;  3LU7 A;  3LU8 A;  4N0U D;  2BXF A;  4PO0 A;  4ZUX V;  3FWB C;  1GNI A;  2Z8J A;  3V09 A;  5D7G A;  3WHQ A;  2BX8 A;  1KW2 A;  2KBZ A;  2VUE A;  3KIK A;  4HGK A;  3NVK A;  3FWC C;  1JNB A;  1BKE A;  2NQO A;  4F5U A;  1MA9 A;  1H5W A;  1AO6 A;  1E7G A;  3JRY A;  4J2V A;  3UIV A;  4N0F D;  3A73 A;  4L9Q A;  1UOR A;  4LB2 A;  3SIU B;  4C31 B;  5IJF A;  2XMO A;  3G9K D;  2BXK A;  4F5S A;  5IFO A;  1VFI A;  2OZB B;  2JUH A;  2BXL A;  2QMC A;  4LUH A;  4F5T A;  3W1S A;  2AJE A;  3VQI A;  3MHH B;  1MIW A;  3JQZ A;  2YDF A;  1E7E A;  2XW1 A;  4FK5 B;  4ZBQ A;  2XVQ A;  2DYM A;  1HK5 A;  1LNS A;  1NT2 B;  2E0X A;  5ID7 A;  5GHK A;  4IW1 A;  3TDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...