4OTUA

Crystal structure of the gamma-glutamyltranspeptidase from bacillus licheniformis in complex with l-glutamate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
363
structure length
363
Chain Sequence
DKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETKETSIINSRERAPEGAKPDMFLDEDGKVIPFSERSRHGNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQDKLSKTAAKDIFLPDGEPLKEGDILVQKDMAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYDPKSFEKYHLLAETMHLSYADRAAYAGDPEFVDVPLRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQPEDKTIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma glutamyl transpeptidase
publication title Low resolution X-ray structure of gamma-glutamyltranspeptidase from Bacillus licheniformis: Opened active site cleft and a cluster of acid residues potentially involved in the recognition of a metal ion.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 91
structure length 363
sequence length 363
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2014-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4otuA02
2Z8KA 5B5TA 4ZBKA 3WHSA 2DBXA 2E0YA 2Z8IA 3WHQA 2DG5A 4OTUA 2Z8JA 2QMCA 2V36A 5BPKA 4GDXA 4ZCGA 2DBWA 2DBUA 4OTTA 4Z9OA 2QM6A 4ZC6A 2NQOA 3A75A 3WHRA 3FNMA 4GG2A 2E0XA
chains in the Genus database with same CATH superfamily
3LU6A 2BXFA 2DYMA 2BXEA 3V09A 5IJFA 2DBXA 2KWFA 1KDXA 2XMOA 1HK4A 3FWCC 1MUSA 4OT2A 2AGHB 1BKEA 4N0FD 2BXCA 5IFOA 3V03A 2DG5A 4LB2A 1TF0A 5GIPA 2QHBA 4JK4A 1MUHA 2QMCA 2V36A 1E7EA 1NT2B 2OZBB 2BXOA 3SQJA 2XSIA 4HGMB 3G9KD 2XVVA 1AO6A 2LOQA 4OTTA 4F5UA 1FOUA 2NQOA 1J7EA 1MM8A 3KIKA 2BXDA 1GNIA 3GQUA 4J2VA 3W1SA 5IIUA 3FWBC 2EFDA 2K0NA 2VDBA 2BXHA 2BXKA 5GHKA 4ZUXV 4LUHA 4N3ZA 1UORA 1E7FA 2Z8KA 2YDFA 4F5SA 1LNSA 5B5TA 1KXPD 2XVUA 4MBEC 1TXUA 4ZBQA 5IIXA 2BXPA 2XVWA 1IJGA 3SIUB 3MHHB 5DBYA 2EFCA 4C31B 4LA0A 5IJ5A 2ROHA 3B9LA 5BPKA 4ZCGA 2LQIA 1BJ5A 5ID7A 1GNJA 2XW1A 5FUOA 4TQ0A 2BXBA 4L9QA 4LUFA 2BXQA 5HOZA 3MHSB 4L9KA 3M99C 4W4UB 3GA9L 4ZBRA 5IJEA 1E78A 1E7HA 4G01A 4DM0A 3NVKA 4M70B 4I9OA 4FJCB 1HK3A 2VUEA 4Z69A 4S1YA 2BX8A 4TQ1A 2E0XA 1J78A 3UIVA 3GQXA 4WA6B 4ZBKA 3WHSA 2BXGA 2E0YA 4FK5B 2BXIA 2NNWA 2CKXA 3TDLA 2DYOA 4OTUA 2Z8JA 5ID9A 3ICXA 2KBZA 4GDXA 2LXSA 4GDLB 4K71A 4IW1A 2VUFA 4PO0A 5IIHA 4NAWB 1HK2A 4FIPB 4LB9A 4L8UA 3VQIA 4K2CA 3V08A 2BXAA 2DBUA 3A73A 4Z9OA 2QM6A 1MA9A 4F5VA 2EFEA 4DHXB 3BPJA 1HK1A 3H3AA 4D7XA 3B9MA 1E7IA 2GUTA 1VFIA 3FNMA 5D7GA 4GG2A 3CX9A 1H9ZA 2JUHA 2XW0A 4BY9C 1SB0A 3H37A 3LU7A 4BKEA 3PLAA 3KJLA 4GDKB 1HK5A 3NMUA 2Z8IA 4G03A 3WHQA 1MIVA 3ECPA 1BM0A 4OR0A 5DQFA 1LOTA 1KW2A 4G04A 4N0UD 3NVMA 5GINA 2LXTA 2DBWA 2EFHA 2BXNA 1MIWA 1E7AA 3JQZA 1MIYA 2BXMA 2XVQA 1HA2A 2I2ZA 3SIVB 1O9XA 3JRYA 4ZC6A 3LU8A 2OT3A 3A75A 1H5WA 2LQHA 5GIOA 1E7CA 3WHRA 1E7BA 4E99A 1VZSA 1N5UA 4EMXA 4F5TA 2BXLA 1E7GA 2I30A 4IW2A 3NVIA 1JNBA 4HGKA 2AJEA
chains in the Genus database with same CATH topology
3LU6A 2BXFA 2DYMA 2BXEA 3V09A 5IJFA 2DBXA 2XMOA 1HK4A 3FWCC 4OT2A 5GIPA 1BKEA 4N0FD 2BXCA 5IFOA 3V03A 2DG5A 4LB2A 1TF0A 2QHBA 4JK4A 2QMCA 2V36A 1E7EA 1NT2B 2OZBB 2BXOA 3SQJA 2XSIA 4HGMB 3G9KD 2XVVA 1AO6A 2LOQA 4OTTA 4F5UA 1FOUA 2NQOA 1J7EA 3KIKA 2BXDA 1GNIA 3GQUA 4J2VA 3W1SA 5IIUA 3FWBC 2EFDA 2VDBA 2BXHA 2BXKA 5GHKA 4ZUXV 4LUHA 4N3ZA 1UORA 1E7FA 2Z8KA 2YDFA 4F5SA 1LNSA 5B5TA 1KXPD 2XVUA 4MBEC 1TXUA 4ZBQA 5IIXA 2BXPA 2XVWA 1IJGA 3SIUB 3MHHB 5DBYA 2EFCA 4C31B 4LA0A 5IJ5A 2ROHA 3B9LA 5BPKA 4ZCGA 1BJ5A 5ID7A 1GNJA 2XW1A 5FUOA 4TQ0A 2BXBA 4L9QA 4LUFA 2BXQA 5HOZA 3MHSB 4L9KA 3M99C 4W4UB 3GA9L 4ZBRA 5IJEA 1E78A 1E7HA 4G01A 3NVKA 4M70B 4FJCB 1HK3A 2VUEA 4Z69A 4S1YA 2BX8A 4TQ1A 2E0XA 1J78A 3UIVA 3GQXA 4WA6B 4ZBKA 3WHSA 2BXGA 2E0YA 4FK5B 2BXIA 2NNWA 2CKXA 3TDLA 2DYOA 4OTUA 2Z8JA 5ID9A 3ICXA 2KBZA 4GDXA 4GDLB 4K71A 4IW1A 2VUFA 4PO0A 5IIHA 4NAWB 1HK2A 4FIPB 4LB9A 4L8UA 3VQIA 4K2CA 3V08A 2BXAA 2DBUA 3A73A 4Z9OA 2QM6A 1MA9A 4F5VA 2EFEA 4DHXB 1HK1A 3H3AA 3B9MA 1E7IA 1VFIA 3FNMA 5D7GA 4GG2A 3CX9A 1H9ZA 2JUHA 2XW0A 4BY9C 3H37A 3LU7A 4BKEA 3PLAA 3KJLA 4GDKB 1HK5A 3NMUA 2Z8IA 4G03A 3WHQA 1MIVA 1BM0A 4OR0A 5DQFA 1LOTA 1KW2A 4G04A 4N0UD 3NVMA 5GINA 2DBWA 2EFHA 2BXNA 1MIWA 1E7AA 3JQZA 1MIYA 2BXMA 2XVQA 1HA2A 2I2ZA 3SIVB 1O9XA 3JRYA 4ZC6A 3LU8A 2OT3A 3A75A 1H5WA 5GIOA 1E7CA 3WHRA 1E7BA 4E99A 1VZSA 1N5UA 4EMXA 4F5TA 2BXLA 1E7GA 2I30A 4IW2A 3NVIA 1JNBA 4HGKA 2AJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8K A;  5B5T A;  4ZBK A;  3WHS A;  2DBX A;  2E0Y A;  2Z8I A;  3WHQ A;  2DG5 A;  4OTU A;  2Z8J A;  2QMC A;  2V36 A;  5BPK A;  4GDX A;  4ZCG A;  2DBW A;  2DBU A;  4OTT A;  4Z9O A;  2QM6 A;  4ZC6 A;  2NQO A;  3A75 A;  3WHR A;  3FNM A;  4GG2 A;  2E0X A; 
#chains in the Genus database with same CATH topology
 3LU6 A;  2BXF A;  2DYM A;  2BXE A;  3V09 A;  5IJF A;  2DBX A;  2KWF A;  1KDX A;  2XMO A;  1HK4 A;  3FWC C;  1MUS A;  4OT2 A;  2AGH B;  1BKE A;  4N0F D;  2BXC A;  5IFO A;  3V03 A;  2DG5 A;  4LB2 A;  1TF0 A;  5GIP A;  2QHB A;  4JK4 A;  1MUH A;  2QMC A;  2V36 A;  1E7E A;  1NT2 B;  2OZB B;  2BXO A;  3SQJ A;  2XSI A;  4HGM B;  3G9K D;  2XVV A;  1AO6 A;  2LOQ A;  4OTT A;  4F5U A;  1FOU A;  2NQO A;  1J7E A;  1MM8 A;  3KIK A;  2BXD A;  1GNI A;  3GQU A;  4J2V A;  3W1S A;  5IIU A;  3FWB C;  2EFD A;  2K0N A;  2VDB A;  2BXH A;  2BXK A;  5GHK A;  4ZUX V;  4LUH A;  4N3Z A;  1UOR A;  1E7F A;  2Z8K A;  2YDF A;  4F5S A;  1LNS A;  5B5T A;  1KXP D;  2XVU A;  4MBE C;  1TXU A;  4ZBQ A;  5IIX A;  2BXP A;  2XVW A;  1IJG A;  3SIU B;  3MHH B;  5DBY A;  2EFC A;  4C31 B;  4LA0 A;  5IJ5 A;  2ROH A;  3B9L A;  5BPK A;  4ZCG A;  2LQI A;  1BJ5 A;  5ID7 A;  1GNJ A;  2XW1 A;  5FUO A;  4TQ0 A;  2BXB A;  4L9Q A;  4LUF A;  2BXQ A;  5HOZ A;  3MHS B;  4L9K A;  3M99 C;  4W4U B;  3GA9 L;  4ZBR A;  5IJE A;  1E78 A;  1E7H A;  4G01 A;  4DM0 A;  3NVK A;  4M70 B;  4I9O A;  4FJC B;  1HK3 A;  2VUE A;  4Z69 A;  4S1Y A;  2BX8 A;  4TQ1 A;  2E0X A;  1J78 A;  3UIV A;  3GQX A;  4WA6 B;  4ZBK A;  3WHS A;  2BXG A;  2E0Y A;  4FK5 B;  2BXI A;  2NNW A;  2CKX A;  3TDL A;  2DYO A;  4OTU A;  2Z8J A;  5ID9 A;  3ICX A;  2KBZ A;  4GDX A;  2LXS A;  4GDL B;  4K71 A;  4IW1 A;  2VUF A;  4PO0 A;  5IIH A;  4NAW B;  1HK2 A;  4FIP B;  4LB9 A;  4L8U A;  3VQI A;  4K2C A;  3V08 A;  2BXA A;  2DBU A;  3A73 A;  4Z9O A;  2QM6 A;  1MA9 A;  4F5V A;  2EFE A;  4DHX B;  3BPJ A;  1HK1 A;  3H3A A;  4D7X A;  3B9M A;  1E7I A;  2GUT A;  1VFI A;  3FNM A;  5D7G A;  4GG2 A;  3CX9 A;  1H9Z A;  2JUH A;  2XW0 A;  4BY9 C;  1SB0 A;  3H37 A;  3LU7 A;  4BKE A;  3PLA A;  3KJL A;  4GDK B;  1HK5 A;  3NMU A;  2Z8I A;  4G03 A;  3WHQ A;  1MIV A;  3ECP A;  1BM0 A;  4OR0 A;  5DQF A;  1LOT A;  1KW2 A;  4G04 A;  4N0U D;  3NVM A;  5GIN A;  2LXT A;  2DBW A;  2EFH A;  2BXN A;  1MIW A;  1E7A A;  3JQZ A;  1MIY A;  2BXM A;  2XVQ A;  1HA2 A;  2I2Z A;  3SIV B;  1O9X A;  3JRY A;  4ZC6 A;  3LU8 A;  2OT3 A;  3A75 A;  1H5W A;  2LQH A;  5GIO A;  1E7C A;  3WHR A;  1E7B A;  4E99 A;  1VZS A;  1N5U A;  4EMX A;  4F5T A;  2BXL A;  1E7G A;  2I30 A;  4IW2 A;  3NVI A;  1JNB A;  4HGK A;  2AJE A; 
#chains in the Genus database with same CATH homology
 3LU6 A;  2BXF A;  2DYM A;  2BXE A;  3V09 A;  5IJF A;  2DBX A;  2XMO A;  1HK4 A;  3FWC C;  4OT2 A;  5GIP A;  1BKE A;  4N0F D;  2BXC A;  5IFO A;  3V03 A;  2DG5 A;  4LB2 A;  1TF0 A;  2QHB A;  4JK4 A;  2QMC A;  2V36 A;  1E7E A;  1NT2 B;  2OZB B;  2BXO A;  3SQJ A;  2XSI A;  4HGM B;  3G9K D;  2XVV A;  1AO6 A;  2LOQ A;  4OTT A;  4F5U A;  1FOU A;  2NQO A;  1J7E A;  3KIK A;  2BXD A;  1GNI A;  3GQU A;  4J2V A;  3W1S A;  5IIU A;  3FWB C;  2EFD A;  2VDB A;  2BXH A;  2BXK A;  5GHK A;  4ZUX V;  4LUH A;  4N3Z A;  1UOR A;  1E7F A;  2Z8K A;  2YDF A;  4F5S A;  1LNS A;  5B5T A;  1KXP D;  2XVU A;  4MBE C;  1TXU A;  4ZBQ A;  5IIX A;  2BXP A;  2XVW A;  1IJG A;  3SIU B;  3MHH B;  5DBY A;  2EFC A;  4C31 B;  4LA0 A;  5IJ5 A;  2ROH A;  3B9L A;  5BPK A;  4ZCG A;  1BJ5 A;  5ID7 A;  1GNJ A;  2XW1 A;  5FUO A;  4TQ0 A;  2BXB A;  4L9Q A;  4LUF A;  2BXQ A;  5HOZ A;  3MHS B;  4L9K A;  3M99 C;  4W4U B;  3GA9 L;  4ZBR A;  5IJE A;  1E78 A;  1E7H A;  4G01 A;  3NVK A;  4M70 B;  4FJC B;  1HK3 A;  2VUE A;  4Z69 A;  4S1Y A;  2BX8 A;  4TQ1 A;  2E0X A;  1J78 A;  3UIV A;  3GQX A;  4WA6 B;  4ZBK A;  3WHS A;  2BXG A;  2E0Y A;  4FK5 B;  2BXI A;  2NNW A;  2CKX A;  3TDL A;  2DYO A;  4OTU A;  2Z8J A;  5ID9 A;  3ICX A;  2KBZ A;  4GDX A;  4GDL B;  4K71 A;  4IW1 A;  2VUF A;  4PO0 A;  5IIH A;  4NAW B;  1HK2 A;  4FIP B;  4LB9 A;  4L8U A;  3VQI A;  4K2C A;  3V08 A;  2BXA A;  2DBU A;  3A73 A;  4Z9O A;  2QM6 A;  1MA9 A;  4F5V A;  2EFE A;  4DHX B;  1HK1 A;  3H3A A;  3B9M A;  1E7I A;  1VFI A;  3FNM A;  5D7G A;  4GG2 A;  3CX9 A;  1H9Z A;  2JUH A;  2XW0 A;  4BY9 C;  3H37 A;  3LU7 A;  4BKE A;  3PLA A;  3KJL A;  4GDK B;  1HK5 A;  3NMU A;  2Z8I A;  4G03 A;  3WHQ A;  1MIV A;  1BM0 A;  4OR0 A;  5DQF A;  1LOT A;  1KW2 A;  4G04 A;  4N0U D;  3NVM A;  5GIN A;  2DBW A;  2EFH A;  2BXN A;  1MIW A;  1E7A A;  3JQZ A;  1MIY A;  2BXM A;  2XVQ A;  1HA2 A;  2I2Z A;  3SIV B;  1O9X A;  3JRY A;  4ZC6 A;  3LU8 A;  2OT3 A;  3A75 A;  1H5W A;  5GIO A;  1E7C A;  3WHR A;  1E7B A;  4E99 A;  1VZS A;  1N5U A;  4EMX A;  4F5T A;  2BXL A;  1E7G A;  2I30 A;  4IW2 A;  3NVI A;  1JNB A;  4HGK A;  2AJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...