4OTXH

Structure of the anti-francisella tularensis o-antigen antibody n203 fab fragment
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
213
structure length
207
Chain Sequence
EVQLQQSGAELARPGASVKLSCKASGYTFTSYWMQWVKQRPGQGLEWIGAIYPGDGDTRYTQKFKGKATLTADKSSSTAYMQLSSLASEDSAVYYCARRWDYWGQGTTLTVSSAKTTAPSVYPLAPVCSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N203 light chain
publication title Functional and Structural Characterization of Francisella tularensis O-Antigen Antibodies at the Low End of Antigen Reactivity.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 207
sequence length 213
chains with identical sequence I
ec nomenclature
pdb deposition date 2014-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4otxH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4otxH02
4HIIA 1XGUB 3ARDD 3CXHK 4OGZA 3MQIA 2VDML 5SWQB 2VWEE 4LEXH 4AG4H 4KHXL 5MENA 43CAA 4LPXA 2VL4A 4P2CG 4XBEL 4F7PA 3GMLB 4H0HB 3OL2A 4I18B 4FZEH 3TZVB 3RNQB 1I7ZA 2PO6B 4A6YH 4GRLC 2W60B 1H3PH 2XQBL 4X7FC 4KDVA 4M3KB 4HXAH 4X80L 1WIUA 5FO7B 2X4SA 1QRND 3QG7L 4PFEA 3G5YA 4HZAA 1IZJA 5E03A 4YX2L 4HK3N 4KGJA 5C0CE 2PW1A 2PXYA 4JFDB 4V1DE 2HT3D 4MQTB 5IBLD 2F54B 3SDAD 5C9JB 2M26A 4WNQB 2DBLL 3AS2A 3QCTL 4Z7NE 5FKAB 4RX4D 4QOKE 2VAJA 4X6CF 3U83A 2QKIA 1D5XA 5BQ7A 5HVHB 1FFNB 3LEYH 1L7TH 3GSQB 2G9HB 3R06A 3N1GC 2X05A 1TIUA 1T20A 4ELMB 4PD4K 1EFXB 1BD2D 2FBJH 1B0GB 4NZUH 5SWSE 1TTGA 3EO9L 4HULB 1UA6L 1HYSD 3MV7B 2VITA 3LKOB 4P2RD 5J3HD 1J0IA 1S7VA 1NCNA 4M62H 4HMEA 2R9HD 1MVFA 3HE7A 5DQ9B 4IOSD 5GGSB 1HYRC 2C7UB 2DQIL 4UUJB 4NZTL 4Q9BA 8CGTA 1IEHA 4OZ4B 3MGTA 1N59B 3ARBB 4Z7UA 2P44B 2P46B 4KKAD 4XWOD 2JLLA 3BUYB 5A43C 3IAQA 1LEKA 5FECA 2PN5A 3UTTE 2AS5M 3QEQE 2V5YA 4K3EL 3OXRB 1R3IH 4PG2C 5JHDA 2APTA 1MVUA 4XXCC 3AU1B 4W6WB 4HUUB 5FV1L 1A3LH 5HHVH 3ARFD 4BK5A 4UDUA 1UXSA 1M05A 1BPVA 2JB5L 4RMUA 2UZXB 1C5DB 1G6RA 3V6ZA 4R4FL 5JLZA 3HZVB 1ETZA 3GK8L 2OL3L 5C0DA 3DARA 3MOBL 4XC3H 4DGVL 4FQCL 1YMHB 4HT1L 43C9A 5I30L 3S36L 3CMOL 4O9HH 5E2TH 3L5HA 3I50H 3U2SB 5JOPE 4XPBH 1I8KB 1JWMA 1VFAB 4HIIB 3BP7A 4U3HA 2DM7A 1YEGH 4KI1A 5MENB 4PJEF 2Q8AH 1RUAL 5IVXE 4GAJH 4JM4H 4M02A 5LCVL 4F7PB 3FT2A 3P73A 2XA8H 4XPFL 5HPOA 4MB3A 3NAAL 2Q76A 4HS8H 3HC4L 1CFQA 3VI4F 3MLUL 1JNLL 3FO9B 5E2UL 1FCGA 1H3UA 2F58L 3G5YB 3S6CA 4G9FB 4NKMA 3K80A 2PW1B 3JBG7 2PXYB 1MFEH 3MLWL 3U0TB 5I8KH 2MKWA 3CVHL 3NCEB 4HMCA 4PJGE 3RVVD 4PTUA 4XNQA 3HAEH 1D5XB 3C87A 1YN7B 1DANT 2VXTL 4XCCL 3R06B 2QL1A 1T20B 1IBGH 3GNMH 3QCVH 4XVUC 5AG9A 3WLBA 3VD4A 4JRYB 2OMBA 2JIXD 4S1QL 1OLLA 2AV7A 5D1QA 5K9JH 2VITB 4N0UA 4GS7C 1L7IL 4ESKA 1T7YA 2HWZL 3A67L 1S7VB 1MFBL 5DK0A 1T03H 4U6VH 1D9KC 1YDPA 2A6JA 7FABL 5J57B 2NY4D 4LRNL 4HCRL 4YK4B 4GMSH 2ZSVA 4Z7UB 4NPYA 3C6LB 3AS0A 2WQ8A 2Y07L 3ZKSD 3LSOB 5C0ND 3MPCA 1NC2B 2R4RH 1FO0L 2QR0B 1NUDA 2FH8A 1XR9A 1AR1D 4UNTA 4X4YB 2LAAA 2B1HH 1QSFE 1IQDA 1T89C 4B7IA 5JHDB 5D1ZC 3V6OC 2OTUB 1MVUB 3W0WD 1JPSL 1KPUA 1BQHG 2WWKT 5DJ6A 4PRIE 3ZKXC 4JZNA 4UDUB 5CZKA 2NW2A 1FNAA 2BP3A 1MHPH 1WUNT 4ODSL 4A6YB 3MREA 5GGTL 1TVBB 1WAAE 2IQ9L 3V6ZB 4WI8A 1A1MA 3IDYC 1ETZB 5GHWL 5C0DB 1KT2A 4HKZA 1J1OH 4M03A 5F7KC 5GSRA 3QUYB 3VXTA 3BRGC 1DLHB 1U2HA 3ZL4H 3LV3A 3SDYL 4DUWA 2E9IA 1GGIH 4Z7WA 4D9LL 2DMKA 3LEVL 4JFFA 3RHWF 4XB8A 4PLJD 3HAEA 3MZGB 5K59E 4MXQC 5AWNH 5IJVA 2IAMC 2UWEE 5I17A 4JHZA 4BH7A 1NEZB 5DMIL 3D0VA 5GRWA 5TPWH 4EIGB 1PG7W 3ZTJG 1DBBH 3LQZA 4FQXA 1XGPA 3P0VH 1UYWL 1JF1A 5EN2A 4XCEB 1MFCL 3VGBA 4WRLA 1NGXB 3ZKND 5BV7C 2IPTH 1MRCL 3QEUA 1P6FA 3BN9C 2PYEA 2X41A 3MR9B 4Z7OF 3VGFA 1ZGLM 3SGDH 4RIRB 4PTUB 3SE8L 3ZDXF 5JPNB 5TE7L 2P4AB 2FECL 4KK6C 5CJOL 4LNRB 1WCBA 2XXMB 5LGHL 1UH3A 2EE9A 4X5XA 3WLBB 5KSAC 4O51A 1UT9A 4OIAA 2RR3A 2X70A 4J6RH 4HIEB 2AV7B 5CP7B 5D1QB 5T5FH 4B50A 4NNYA 1U92B 2OSLA 1ZT1A 1KBGL 5I71C 1LK3L 2F74A 4NUJB 4F58H 2DI9A 1F4YH 1YDPB 4R2GC 5FGCB 4OF0A 4P9MH 4R8WH 5CSZB 3M8OL 1A7OL 3BKYH 5HHMD 5CLWA 1GGYA 5MHSD 5FF6A 2ZSVB 5L8KB 4QRRA 2X09A 2BSED 1P7KA 3QDGB 3KDMA 4MVBD 4NPYB 4LVHB 5DSCA 4FOMA 3WSQH 4N90D 3X3GL 5CJ5A 4MXVF 2AJUH 1CVRA 3JWOH 4S1RH 3RU8L 1H8SA 1XR9B 2NW3B 3MUGB 2FSEA 2J88H 2ZSWB 1TVDA 3MRGB 1P7HL 1RURH 4UOW1 1NMAL 4U6HA 3ZDZF 3IT8D 1KPUB 5C6TH 5F9WB 3MUY1 3T0EC 3S5LG 1MQKH 5IBUB 1T22B 4NQUA 1TVHA 2NW2B 4HZLB 4H1LB 4JO1H 3MREB 5FCUL 1GOFA 1ZVHA 3P4NB 2E9BA 4LLAA 2HFTA 1KT2B 3BP5A 5GSRB 3BPCA 3BP4B 1KENH 2GJZA 1PZ5A 4NO0A 1JHTA 3OKKB 4KTEL 4Z7WB 3OAYH 4JY5L 1J0YA 4RMQA 4MQXD 4XI5D 4JFDE 3HAEB 2HT2D 2F54E 1KELH 5HSFA 1T1YA 4M8VA 5ALCL 3KNBB 1KEMH 3EYQD 1TXKA 4K7PX 1P4LB 2ICWI 1R0AL 5GRJL 1I85A 3IDNA 4CMMA 5ACLA 1CICD 1GPOH 4W4OA 4AY0A 3OKDA 4P2YA 4D9QD 3D0VB 2YHGA 2W9LA 1NGPH 4JN1L 5AZ2H 1XGPB 3Q1SH 4RGND 1HQ4A 1JF1B 5HI5C 3GDBA 3TBYA 2UZIH 3NN8B 3MV7E 4FMKA 5EN2B 1UM4L 4FTVA 4XAWL 3QEUB 2B1AH 3BEVB 4CVXA 4IIQB 2PNDA 4JFZL 4HS3B 3VXQA 5EO0B 1F4WH 1WCBB 2AGJH 5B22A 3FHQA 4APQA 1YMME 4X5XB 4OQTH 3GI9L 3QPQD 4O51B 4P46C 3ARDC 1F4XH 1ADQL 1S5HB 4OZHF 5BZDA 5HY9A 2OSLB 2ILLA 4LF3A 4PS4H 4M6ML 4MX7B 2Z31C 4U6YA 4M5ZH 3FT3B 1UQSA 4FRWA 4YEFA 1I9JL 4TSBL 2VXUL 3STZA 4LAQL 5HI4D 3UJJL 4DUXA 5LAXA 5FF6B 3TGXA 2W0KA 2QHRH 4QRRB 1P7KB 1XIWB 3KDMB 5DSCB 3WFBL 3SDAC 5I74C 4MJID 5E70A 4NZJA 1AO7D 1U8KA 1OF2A 3KYKL 5D8JL 3WLWD 1PVHA 3S35X 1MWAH 3S96A 5DA0B 5FHAH 2DQUH 1XAUA 1FZOB 4U6HB 5I1EH 3X13B 5E8DL 3VXMD 3KPTA 1EJOL 4GG6F 5EZIL 4NKIL 3PABA 4WTZG 1TVHB 1P1ZA 3CX5K 4PP1C 5MENE 2CO7B 3PP4H 1JGUH 3RVWD 1P4BL 3WJJC 4ENED 2YWZA 4L8SA 4IBLT 5TE4L 2AAVA 3BP5B 2B0SL 3FMGH 3AM8C 2FX8L 2GJZB 1PZ5B 2A74B 3BZEA 3DVFA 4NO0B 1JHTB 3RL2A 3I2CH 4XWOC 3QUZA 4LLUA 4G9FE 1UZ6F 1B4JL 2B5IC 5TFSH 4HKXA 3L5XH 1MCNA 4JDTL 4GSDH 1QLFA 1X5HA 1YC7A 4UT9H 4YXLH 5JQ6H 3IDNB 4CVUA 1HHGB 1ACYH 2AEPL 3G6AA 4OGAD 4RNRA 3HB3D 3ARFC 4Z77A 5IESH 1DFBL 3HCVB 1HQ4B 4U1IA 4ETQA 4JFHE 3QUKA 4Q9RL 1MHHA 4KJPD 4YO0A 1CGSL 4FTVB 2AXJA 2Z4QA 1KOAA 3GJEA 2OR9L 4J3XA 3VXQB 4K9EH 1D5MA 4K8RH 3MLZL 3PQYD 4APQB 4POZC 2AXFB 4TPRL 1MFAH 4NM8H 2VNCA 3PDOA 4UQ3A 4Z7UE 1RJLA 3H2WA 3D1MC 3DYPA 1MWAA 4ALAL 2ADIA 2D31A 1JF6A 2XXCB 3A6BH 5DUPH 5HY9B 1I4FA 1JV5A 1AQDA 4U6YB 1UQSB 1F90H 5DJZB 1QQDA 5DD5H 2DAVA 1G0XA 1I3RA 1W0VA 5JHDE 3B6SA 3NIDE 3QQ4B 3N1PC 4YHMH 3B9KA 2PKDA 2ICEB 2JJSC 4HQQH 5LAXB 5FOBA 2APXA 4WV1B 5TH2A 3O8XC 3PWPB 4X6DA 5HHQA 2D0HA 5HBBA 3G5ZA 5JXEA 3HI5L 4KI5F 4OLXL 3S3JA 3C5ZA 5IFJA 5HYSB 3F7YA 3BPNC 3RVVC 1U8KB 1IGYB 3EFDH 2VDPH 3QRFM 5DEGA 1Q72L 3F5WB 3CVIH 4Q7DA 3MTRA 2EDTA 4QGYA 2HKHH 2OS7A 4ACPA 1B90A 5D7JC 1I7TA 3PABB 4JO3L 4U0RC 4CADB 1MQ8A 3MRFA 2JCCF 1JYVA 5DRNA 5EBLA 1KTDA 4NN5C 4GAYA 4PB0L 2R0ZH 4TNWK 5DUML 1H9VA 3K74B 4Q9QH 5EZOL 4OCSL 5FO8A 3BH8B 4HX1B 2H9GA 3BZEB 4M5YL 1A47A 5DEZA 3CZFA 3QUZB 5C0NC 2O26U 1HSBA 3G6JF 3GMMA 4P2QB 3D0LB 3EBAA 3HLAA 4P5KB 3D9AL 3DI2B 1KV3A 5DT1L 1QLFB 3NIGE 1A0QH 4DEPC 2FX7H 32C2A 4LCWD 1RAMA 1LO3L 1HHHA 1RMFH 1YNTA 4YXHH 1LMKA 2JTDA 3G6AB 3L3JA 5EG6C 2ARJA 4TQEL 1XZ0B 5HHOD 4NO3A 1BEYH 2EEBA 4U1IB 5KSBA 4ETQB 1FFOA 5HVGB 3D2UD 4U6TA 3VXOA 1EK3A 2RFXB 4EJ1C 1S5IH 1A7PL 4EUPG 5BOPA 4UV4L 4N0RA 2LE9A 2OI9C 3MLXL 4HS6A 1YYML 1D5MB 5DDHA 4BZ1L 1KG0B 2E8ZA 5I1GL 5B3JF 4R97C 3TPUB 1BF8A 4UQ3B 1RJLB 3CFKA 1A3RH 1MWAB 2ADIB 3VGAC 3MJ7A 2XN9B 1I4FB 1KCRL 3BHBB 2ORBL 2VZSA 5L9DL 1QEWB 3IFLL 5E2WH 3SDCC 2YPVL 3B6SB 4Z0BL 4D94A 3RL1B 3E8UL 2X9XA 3SPVA 3NH7H 1FLTX 5GZOD 1DBAH 1Y0LA 1AY1L 4NJ9H 2P8LB 5FOBB 1OAYH 1IGMH 3LS5L 5HHQB 3G5ZB 4ZSOB 1IGCL 2R69H 3X11A 3C5ZB 5IFJB 2I9TA 3F7YB 5D2LF 1OTUC 4LVOB 4F7EA 5GJSH 5L6YH 1MHCA 1MJJB 2C3HA 1NBYA 4NNXA 3U0WL 1VEMA 3C8DA 4JFOB 2VLKA 5DD6A 2HRLA 1Q9OA 1QLRA 4Z7WE 2Y9RT 1H5BA 1I7TB 3QFDA 1PG7X 4LVNB 3QHZL 1F42A 3ZDYE 5MEQB 3MRFB 1U42A 1X4XA 2NY0B 3F6LA 4P3WA 1AC6A 1MFDH 3BT2H 5DRNB 4GXUM 5EBLB 3WEXA 5SV4A 1JBJA 2AEQL 2CRMA 1J0JA 3MYZA 1JGVH 4BQ6A 1E4XH 5ADOH 3NGBC 2NCMA 1A1NA 5EC1B 1WIPA 5IVNA 2AJSH 4OLWL 3LPFA 1A7NL 5D7LA 1TITA 4TTGA 2XFXA 3GMMB 1KJ2A 1OP5K 3HLAB 4ZFOL 3GKWL 1X4YA 3QZWA 4JPWH 5H2BA 1NAKL 1ND0A 32C2B 2R0WL 1HHHB 2N7BA 3N9GH 2FZ3B 2NY3B 3HPJA 4Y4HA 5JIKA 2Q3AA 2WMPA 3RPIB 2CDGB 4S1DC 3QHFL 4KXZI 3FN3A 1FFOB 3A6CH 4XAKE 4Y4KC 5T3XH 3O3BB 1LP9A 4JFEB 3AS1A 4DTGL 2VDRH 4Y89A 3F58H 4HS6B 4YHLH 4RAHA 3ROLB 5DDHB 2HJKB 2R0LH 3U9PL 4K2UL 3NOIA 1B6DA 2NY1B 3IDXH 4QRRE 1YUHA 4QRTA 1UH4A 2VLLA 2Z8WC 3KJ6L 3T3MF 1NDGB 4X4MA 3CFKB 1ZGLP 2VDLL 1FBIH 3MJ7B 4U31A 1FIGH 5EOCL 4O58H 3BGFB 3BWUC 2DLEA 3UO1H 3NBNA 1PLGH 4UMGA 4RFEB 4ZOBA 3WUWA 4M7ZB 1FH5L 5C8JA 1OAXH 5JW5A 4EOWH 1SBSH 3SPVB 2VIRA 3AY4C 1Y0LB 3G6DH 1J1XH 2YD6A 4S0TD 5BJTB 2NXZB 1A6TA 3S37L 3X11B 3L5WB 4PG9B 3NIFF 4YHKL 2J8UF 3N0PB 3N1MC 1MHCB 4KK9C 5CLTA 3WD5H 1RZJL 2W9EL 1S7WB 4Y5YA 5IB3A 4GXUN 4NQEB 2VLKB 5DD6B 4CN1A 4RFNC 4NQDA 1IC5L 1Q9OB 1T2QH 5HD8C 4P5TB 4U2YA 4F7MB 3QFDB 4Z5RA 2LABA 3B4NA 4QT5B 3JV6B 5GXBB 2LAGB 4IRJB 4HPYH 2DWDA 1BIIA 3L3OA 5BS0A 4QWWC 1QFOA 1YEFL 4LK4A 1NANI 3ILPA 2DOCA 3LMJL 1QKZH 2M1KA 1JZ5A 2GTWB 5HXMA 4R9HA 1J8KA 3ULUC 4I5BA 4E41A 4AQ1B 2NY2D 2XZAL 1HHKB 4FTVE 3C60A 1WBXA 4HK3J 1ND0B 2VQUA 2GT9B 1VFUA 4D8PA 2XZCL 4Z7QE 4EIZC 4RBPH 3IDMA 3PWJA 2E7CA 2HTLD 3HPJB 4Y4HB 1NCUA 4GOSA 1CFVL 2FJFA 4WWKA 3WIHH 4PGZA 4PREA 4OV5A 2FGWH 4S2SA 3RVWC 1MCPL 4LHUA 1LP9B 4ENEC 4EI6B 3D18A 1W0YT 1U41A 2XPGA 1U3YA 3KPOB 4W81A 4NO5A 1S3KL 1ZK9A 3LZFH 5D71L 5A2KH 2WSKA 1YUHB 5F6IC 4KRPB 4KQ3L 4R3SB 4XT1C 1TNNA 4RBPK 4U1GC 3VFOB 4C57C 2YOCA 1AE6H 2CRIA 1N6UA 2X89D 4HF5H 5I18L 1EMTL 1A1OB 2E27L 1HOCB 3WUWB 2VERN 4OGAC 5JW5B 2H41A 1G7HB 1SJXA 1AXTH 1JJUA 2DQFA 2W91A 2FGZA 4XVJL 4TYUA 1UWEH 1U3ZA 1AJ7H 1CGWA 3U4BL 3RKDC 4NWTL 1WTLA 1EEYA 3GIZH 5E5MA 3ULVF 2D9CA 1CDUA 2WANA 4P23D 5DO2D 1LNUA 5EOQL 2OJZH 2X1XR 3I75B 5IB3B 1MH5B 4HKJA 5ESAA 4HJ0C 1CLYH 1WZ1L 4LMQE 2OQJA 4Z5RB 3PL6C 3OBAA 4OSUL 1IAIL 2Y23A 2B39A 5KANG 4LARH 2ZKHH 2DWDB 2ZCKH 3SKMB 3TN0D 5BS0B 1JNHA 3O4LD 3WIHA 4JPKL 4KUCD 3BVNA 1PEZA 4R7DA 5EULV 5JMRA 1BZ7A 2EDNA 5AD0A 1M6OA 2BVEA 1P53A 4I5BB 5LBSL 3VE0B 1JIBA 2D03L 5CEXA 4HUWA 4UTAH 5C07D 4ZQKB 4P59L 3L7FA 2OJEA 2F9BT 1UKSA 3SOBH 2LU7A 3WNKA 4ODTH 4D8PB 2DWEB 4HLZG 4M43H 5DLML 2VQ1B 1C5BH 4TUJA 5JNYA 3C5SB 4JAMA 1QLEL 1A02N 3QUXB 4JGUA 4OV5B 4O4YL 4S2SB 5BW7C 3EO1A 3GSWB 2DLTA 1AGDA 5EA0H 3D18B 5B4MD 4Y88A 2MQ3A 2XPGB 3HNTH 5HDLA 4GRLA 4OCRL 4NO5B 4HMDA 3MROA 4CNIA 3ULVL 4PJGF 1CS6A 1MPAH 4QHKI 5F97E 1YJDL 2D2OA 4X6DE 5E1AA 1KEGL 1KN4H 2ZJSL 3QCUH 5IHZA 2QSVA 3IDIA 4M3JA 4K3DL 2MCG1 5I8CA 4OD1L 3RZCD 1OAKH 1N3NA 2V17L 5HYJD 3TBVB 4HH8A 4YGAB 4IOFC 1RZIA 3O3EB 5C09D 1YQ2A 3GRWL 4KVCL 5SWZA 5IBTL 3GSRB 3NPSC 4HHAA 2DQFB 2F19H 3O2DL 5CD3A 3MCLH 2O5ZL 3BIKA 4OCXL 4OCWL 3ZYIA 4OLUL 3BPLC 2W59A 4UU9A 1T3FB 4QTIL 5IB5B 1FNLA 5GGRA 4PBWD 1UM6H 5JOFA 1FLRH 5K9QG 1FSKC 2YPLD 2DN7A 2EZ0D 1LNUB 5L7XL 1KLGA 2EDXA 2P5EA 1WSST 4RWHA 1INEL 4HKJB 4IRZH 3E1F1 4QHMB 2BHUA 3SDDC 4PV8B 4UILH 5C2UB 1MIEH 3DSNA 5EO1B 4WFFD 1VENA 1S9WA 1FP5A 4LSSL 1XH3A 3HG1D 4JQVC 3PWVA 1MRFL 1OVZA 3DGGB 3EDFA 5CILH 4PG2A 4KMQA 3JTSA 1ZLUH 1TQBC 1JNHB 5DI8A 4XXCA 1VERA 2DQTH 3GI8H 1FC2D 3BVNB 4R7DB 3GBML 5K9KA 1BZ7B 1DL7L 1WAAF 2CIIA 3OXSB 3MRKB 5B39B 3OKMA 5KSBE 1M6OB 3MV8A 3EO0B 3GHEH 1KTRL 4TVSa 1XF2A 4C54A 4JFEE 2DQHH 5ISZA 4YE4L 3RWGA 2QADC 5JPMA 2EDLA 5K93A 3OGOE 4KQ4H 1OAQL 1U95A 2WBJD 4KPHH 1RVFH 1BOGA 5ESVB 4ZXBD 4WFED 1QOKA 2ERJC 2VZVA 5K59F 1NCAH 1M1SA 5KSVA 3BAEL 2HKFL 3OB0H 4H20L 3UC0L 2UWEF 1Q0XL 3VFVA 3VFWA 4JAMB 4L5FH 2LTQB 2DIAA 4ZD3H 3CFJB 5K9QI 1PY4A 3GHBL 1BVKB 3EO1B 4PJ5D 1AGDB 1BVLB 1CYGA 3GSOA 4LSPL 3CDGA 1U8PA 4TVPH 2P24A 5F3HA 3MROB 4OGXH 4ZFFA 5AG8A 2F15A 4X6FA 4D0DA 3AREC 1SQ2N 5IFAL 5E1AB 1JUFB 3SCMD 1D6VL 5IHZB 3C9NA 4YIQA 2NMSA 4HIJA 3MODL 3VGGA 1NAMH 4TNVF 5I8CB 3OB0K 2DDQH 1WF5A 1HH6A 3EYSH 3Q2CA 3TP4A 2VLKE 2IALB 4HHAB 3GUTA 1JYXA 5IMOA 5IV2A 3T65B 3DHJA 4UU9B 3K2UH 5GGRB 5CMAA 4QF1A 1BM3H 3IXTB 1W72L 3X3FL 4KKCD 1V7NH 3ZE2E 5EBGA 3F7PC 1HSAB 4UB0L 3O0RL 4NQXA 3CK0H 1FYTD 5IP4A 1CU4H 3EHBD 3OPZL 4ELKA 3T2NH 1JNNH 1QNZH 4NP4L 4FQIH 5D7LE 1UCBH 3FTGA 3OJDB 1C7SA 1OCWH 3OR7B 3TZVD 2KPNA 1GAFL 3PWVB 5ERWB 3JTSB 1T89A 1OM3L 5D1ZA 2JELL 3V6OA 3BDBA 5EZLB 1BQLL 3HNSL 1ITCA 4W6YB 1K6QH 5K9KB 3VXUD 3KYNA 2MCPL 2DJUA 2DQJH 5CJXC 4K55A 3DVIA 2O93L 3OG6B 3QQ9C 1MCCA 4HKBB 3T2OA 5D9SB 4DGIL 5EUOF 1NC4D 1DSFH 3DRTA 3HE6C 1XF2B 4X9BA 1LP9E 1RZFL 1L6XA 3DX9A 1N7MH 3EJYD 2XI9A 5ISZB 3RWGB 1YEKL 2QQLH 2D0FA 3T0XA 1U95B 1BOGB 5C0JA 4P99A 4QYOA 4EI5D 2Z0BA 1NAMA 2FL5B 2ZUYA 4X4ME 2ADFL 1CWVA 4WUUD 1UM5L 3U6RB 5JHLH 1TFHA 4IJ3C 2BRRL 5HHXH 4GQ9L 2ZG1A 4J3UA 5L8LB 4PRDA 1A64A 2FDBP 1DQML 4XHJD 1U8IB 1U8PB 3S36X 4UI2A 5F3HB 3VXRB 3U4EA 1Y6NR 4D0DB 2ZPKH 1CF8H 3MRJA 2VWEC 3INUL 4PRBA 4OI8A 1ZTXL 2NY2C 1P6AB 3AVEA 4J2XA 4PJ8C 2H2SC 4KH2A 4YIQB 3ETBF 1LO2L 5DZNA 4NBXB 3UTSD 3I6KA 4TUKH 3KLHD 3HUJA 1VACA 3TESA 1TPXC 4ZS7H 2B4CL 4CVZB 1MCSA 1PQZA 3PP3H 4DKFH 3QP3A 4J23A 1BJ1J 1UEMA 3TM6A 3FJTA 1FGVH 5EU4A 3TJEL 1KTKE 4ZDHA 1JZ8A 2DTML 4NFBA 1ZLWK 5J8OA 4OFYA 4XWGL 5KSAA 3GUTB 4NQDE 5IV2B 5BO1L 1WIOA 5F93C 5DQDL 1RI8A 4M4PA 4YDLB 3DWTA 1T4KB 5EU5A 2H6PA 4Y16D 2UY7A 4QF1B 4LEOB 2H3NA 3IFOA 4O5LH 5GRUL 5DR5H 4RAVA 1RUKL 4RAUA 5BS0E 2CSPA 4UINH 4U1NA 4JGJA 4X0KA 4Y1AD 5T3XE 4FXKB 2EDWA 2BSTB 4FP8H 4NC1E 3PP3K 5SX4H 1FNEA 4F80A 4E41E 1LE9A 1T0NA 1IAII 3CAFA 4K94H 1KCVL 4YPGA 2ICWA 4JM2F 3U7WL 5M94B 2XA3A 5IFHL 1KIPA 3GBNL 4DVRL 4PPTA 5DRXA 4ODUA 2AK4D 5JW3H 4GKZA 1WZMA 4HK0B 1KCKA 4UT7H 3QWQB 1PDKA 2AVGA 4F2MA 5C70A 1D6EA 3TCXA 2IANA 3VW3L 2R56L 3T0EA 4LLYB 1U3HB 3RP1A 1NMCB 4W70A 4GJTB 4OIIH 2FX9L 3C09C 4QY8B 4WI2A 5HGAA 4P9HL 2XTJB 1G9MC 4P23C 5DO2C 4DKDC 1KC5L 1JZ6A 1PGRB 5HDQL 3NACH 4Q6IC 4ZFGH 5A2JH 5IWLA 1W0WB 1IQWL 5C9KA 1V8HA 3P11H 2XZQH 1XF3A 1XGTA 1NAMB 5E0QA 4PJAA 3UTPD 5I1DB 2YZ8A 2VE6B 1J0HA 2GK0B 3MRDB 3SQBA 5B21A 1KPVA 1MAJA 3PIQA 4MNQD 2ESVD 1N8ZB 1K4DA 1N4XL 5I6XB 4Y4FD 1PW3A 4MCYA 5CKAA 2CXGA 4PRBB 1A9EA 2G75A 4BFIB 1KB5L 1CD0A 1FFQA 1KFAH 2KBGA 3Q48A 3HUJB 1JGLL 1IKFH 4FFWD 1E0OB 1PQZB 1F2XK 4Z7UF 5HGDA 3JWDL 3O4OB 5JIIA 3MJ9L 2WUBL 1J86A 4ZDHB 2W9DL 5KSAB 3ZT6A 3ARDA 3O9WD 4FQQA 3BE1H 3HI6H 4GMTL 2VL5B 3NIDF 2C5DC 5DVNA 4PJDB 1CFNA 1UENA 3TBWB 2HLAB 5F7HA 5I71B 2H3NB 2HA1A 2FJGB 5CGYD 5C0FB 5FYJU 4R96B 4RAUB 4XNZB 3PWNA 1QRNA 4U1NB 4X0KB 4NHCL 3Q0HA 3VA6A 1P84J 5EU7E 1U8NA 5LVEA 3SDAA 1MHEB 2PCPA 5IB2B 5LG1A 1V05A 2A9NL 2Q3ZA 4QRPD 3GM8A 3NTCL 4JKPH 2J4WL 5EO9A 5C08B 4OZFH 4F7TA 3VGHA 1BD2A 1D6EB 1I7UB 3LQAH 4XC1L 1NSNH 2NY6C 5A3ID 1IM3A 4IMLA 4QHUA 3QIWC 4P2RA 3MRRA 4ZS6C 4MAUL 5LQBL 5HGAB 2V7NA 3HZKB 1F4AA 4PJFB 1R3KA 3QB7C 1EHLL 4LLDA 2EZ0C 3IFNH 3MRCB 5LGJA 4NM4H 3WJJA 3V95A 4HH9A 1T0PB 2YUZA 4M6AA 5CUSL 4QHKJ 4KHTL 1TJGL 3AM8A 1X5GA 2OBGA 4PJHA 4XP1L 2AJ3A 4ZO7A 1XF3B 1XGTB 4LCIL 3ZHKA 4JVPA 3UAJC 3DUHA 3E6HB 1FPTL 2E6PA 3JV5A 3KPRD 5DJ2A 4G7YL 1EGJL 1VFOA 3D85D 4FZ8H 4WO4D 3W9DA 2VH5H 2NNAA 3M17A 1NCCH 1NCBL 2EICA 2L0DA 3N50A 5SWZE 4LKCB 4AG4L 1H15B 3ARFA 2ZUTA 1YC8A 1RIHL 3RGVC 4AEIH 2G75B 1LGVA 1H3PL 4G43A 4MLSA 1G6RL 4P3CH 2X4TB 4ISVA 1PX3A 1QTYT 4YXKH 5FYLD 4QNPE 4LSTH 3RTQD 1FL5A 5C92A 5DVLA 2FO4A 3SEPA 1KB9J 1QO3A 5B8CC 2EH8H 4K7PH 2MHAB 3NVQA 3R0MA 3IRZA 4E42A 4FQQB 1NGQH 2R0KL 3BWAA 3MLVL 3QG6B 2GTZB 1P5VA 2HN7B 2R15A 1BFOA 4OF3A 1J8HD 2FBJL 3NCYP 4XCFH 1MCIA 1SYSB 2ZNWA 1JE6A 1FNHA 1QRNB 5FGBC 2JJSA 2AQ2A 3LKPB 1IGJB 1FVCA 2AABL 3HMXH 1H8OA 4ODWA 3SCMC 3IKCA 5SV3A 4BJLA 3DYOA 1U8NB 5I74B 2J8OA 1UWXH 3FB7A 3R0NA 3PXHA 4C4KO 3DGCR 5ISZE 4HFUH 4I9WE 5EO9B 3T1FB 3ZDYF 1BD2B 4G3YH 1Q9LB 3AGVA 2FEDC 4H0IA 5IM7A 2VDNH 2WW8A 4QHUB 1E6JH 2BVPA 1UKQA 2N7AA 4PRNA 2QEJA 4X5LA 5CINH 5D7JA 5KTEH 1XCQA 5MEOB 4WENB 5I1KL 2SEBA 2F5BH 4P2RB 3MRRB 3BPOC 2RIKA 4M1DH 1AP2B 1JFQL 4KKCC 3IJYA 2Z8RA 5LGJB 4LCUA 4WY7H 4HH9B 5HHVL 1UWXK 3S35H 1A9BA 1F3RB 1G7LA 2JF1A 4DW2H 2HVKA 4DKAA 4FN0A 2KQMA 1CCZA 4H25B 1IGIL 1HCFX 2B5IB 4KV5E 3IU4H 1AQKH 3TZVC 1MCOH 4OD2A 3MLRL 5E8PB 3VWKD 3W9DB 2NNAB 1OGAD 2NY5C 4XPBL 1IEBA 2YZ1A 3PNWA 3B5TA 3W0WA 2CUHA 1KJMB 2X4OA 3V4VL 1YEGL 1JI1A 5FHBH 1SJEA 1XIWD 1QRKA 3ARFB 4GAJL 2APWA 5MERA 5EBMA 4G5ZH 3TLRA 1BBDL 1LO5A 3MACH 3LRSA 2HLFD 3FHAA 4HS8L 3VMOA 5HVHC 5GS0C 5FKPA 3ARPA 2BVTA 4LSQL 1JWUA 4EI5C 1MFNA 1E4JA 1I1YB 1QFWI 3LAFA 3P30L 4E42B 4JREB 1A3QA 3BWAB 1KPRA 3RVUC 3RY6C 3U48A 5FA4B 5I19H 3STLA 5I1LA 4J3OC 3RIAF 4RMSA 1XF5B 4OZFB 4QEGA 3VFRB 3ZMRA 1IBGL 1N64L 5FYJD 3CMGA 3H9HA 4XHJC 1JL8A 3SDCA 3V6OE 3HKFA 1MCJA 2C4FT 1OD7A 5K9JL 3ARBC 2ITCA 3OZ9H 5T33H 1FVCB 3IDJB 3BW9B 3C2AH 4HXBH 3ARWA 4L3CB 5I9QB 1U8OA 4U6VL 4AEHH 1GOHA 2DLFH 1AHWB 4NZRH 4ZTOL 1TTFA 5INCA 4TVPE 3BPNB 3HC3H 1HH9B 4QXGL 3WXWH 4UTBH 2O61A 3FB8A 5FDWB 1XF4A 3RNKA 4UAOB 5DUBA 1N26A 4HPOH 3DECA 4G42A 2BC4A 5I76A 3MLYL 4J1UB 2JIXB 5IM7B 5TJWK 3QNZB 1NFIA 1DN0B 2B1HL 2IH1B 4Y16C 2V2TA 4PJIF 1MI5D 3QXVA 5GS2H 3IJYB 2WBWB 3C5JA 4ETYA 2NY4B 4LL9A 4Z6AT 4U7SA 1EO8L 4X4XA 1YEDA 3MXWH 4N0CC 4L1DA 1G7LB 2HVKB 2QBWA 4LU5H 4Y8AA 3CC5B 1GZPB 3G08B 4Z7QF 3CLEL 1RJCA 4PRHD 2EYRA 3HUJE 4OD2B 3KPPA 4O2CA 3VMNA 3ZL4L 3PHOA 2C3VA 1NMBH 1GC1H 1GGIL 1P69B 3AB0B 1S7UB 3PNWB 4XRCA 3EOBB 3W0WB 3K0WA 1I1AD 4UV7H 4DGYH 4LRIC 2PXYC 1WBZB 4GFTB 4OZGA 5MERB 1HEZA 1LO5B 3LRSB 4GUPA 4Y4KA 4PJDE 3MNZA 4JO2H 5FKPB 5TPWL 3WFEH 5IW3A 3VI3E 1DBBL 2DF3A 4O2EB 3TBSA 1FGNH 2IMNA 5J89A 1SMAA 4HG4J 3FO2A 5IHUH 3BQUD 4AEEA 1JWSB 4WI3A 4R97B 2A73A 5D7SH 1KPRB 3NFPA 4N1EA 4M00A 3MFFB 4RMTA 1RK1A 3RDTD 4ORZC 5GZND 3FQWA 3OMZA 3F7RA 1CICA 1MCLA 4X6EA 4YK4C 1FE8H 1JNJA 3Q6GH 3LHPL 5KAQG 3C6LC 3THML 3AY4A 3T0EE 3U30C 5T1DH 2VJXA 2I07B 2D7NA 4OM0H 1NGZA 4P2QD 3OV6A 4JJ5A 3ELAT 4YHYC 3E6FB 3FN0H 4R8WL 5F96H 5DYOA 3WDHA 4YAQA 3MZTA 3BKYL 5INCB 4Y2DD 4NJAH 3CFBB 1I9RH 3OKEB 2AI0H 5F7LB 2O61B 3FB8B 3QHTC 4CJ0A 2E5EA 2AV1B 5I66A 4X8JA 3WSQL 4G42B 5J56B 2BC4B 3TNMA 4Z76A 1NKRA 1ZKAA 1IJ9A 3EFFA 5F1KC 1G84A 1T7WA 3JWOL 4NC2B 2Y06H 4S1RL 4AIOA 3CPLA 3SE3C 2XICA 1NFIB 4OB5L 3ZE1E 2DRUA 4PJAE 2J88L 3LN9A 1X9QA 3BYTA 5KJRL 3H0TB 3CD4A 4QHNA 3TA3D 1N5AA 1G9NL 1OAUH 5C6TL 4YGVA 3WFDL 1MQKL 4EVNA 3QUYC 1IAKB 1WQVT 5C6PB 4U1SA 4U3CA 1E6OH 5HHMB 4O02L 4C56B 2XTLA 1Z5LA 3RX7A 3BGAA 3AAZA 3FOMB 1SEBB 2BX5A 4LSRH 4NRXA 5F8RC 4MJIA 2E7HA 3VXSD 1C16B 1A6AA 1AO7A 1ONQA 3TV3H 1KENL 3KPPB 5KVGH 1RZKH 5B38A 3VWJD 4GW5A 1RULH 3CSYB 4Z95H 3VXMA 2VSDA 4YNYA 5BZWA 1CE1L 5A3IC 4DZ8A 4AL8L 2ZUWA 1IGFH 1KEML 4OCLC 4OZGB 2EDKA 3Q6FB 4OBRA 1U8HA 1HEZB 4KMTL 4BFBD 4LNVA 4GUPB 5DVKA 1J18A 3MNWA 1NGYA 2R2HB 3FB5A 3MNZB 3Q5OA 5ITFA 1NUGA 5K9OB 3K1KC 4QRSA 2QJDA 4NQCD 5D7IB 2APVA 3TBSB 4X6DF 5AZ2L 3VFTB 4R0LB 5DJ0B 4JCLA 1QRNE 2UZIL 3FO2B 5EIIA 5C0RH 1A7RL 3DHMA 2A73B 1QP1A 3MOQA 3RBSA 1K5NA 2NY0D 3CDCA 2YRZA 5D4QA 3CXDH 2V2WA 4D3CH 3MV9D 4CU6A 3MRLA 2XT1B 1CICB 2Z9TA 4X6EB 5FM4A 1F4XL 3B3IB 1BD2E 2GY5A 4K3GA 3R1GL 5DWUH 5H35A 3QRGH 5IG7A 2YKLL 3KWWA 4RGNB 5A16A 5IBUG 4PRPA 5E56A 1NGZB 1RU9L 3C2SA 4P2RE 4JFXA 4JJ5B 5E6YA 3CUPA 4YAQB 4NKOA 3VDBA 3QI9D 4AIZA 2HRPH 1NCWH 2QHRL 4NCC2 2J6EA 3K2MC 5FV2A 4JPVL 1PKQA 3PQYA 5I66B 2A38A 4X8JB 3X12A 3QPXH 3TNMB 2DLHA 4Z76B 3REWB 3TT3L 2FWOA 2R29L 1CFTA 3S37X 3QFJD 5C0CD 1MWAL 1S9XA 2E3VA 2DQEL 4HIXL 5FHAL 4MA7H 4BFGA 2A2QT 2DQUL 4FHBD 1A6WH 3HAEG 4IRSD 3OAUH 3K81A 5I1EL 4QHNB 4QOKD 1N5AB 3B9DA 2PW2B 4Y19D 5E00A 1OAZH 5KSBF 2IG2L 5IT2L 4U1SB 2A83A 4G6KH 4DQOH 4YHOH 1Z5LB 3MRNB 1KCSH 4MD5A 3I84A 4XPTL 4NRXB 4MJIB 1CXLA 5I1JL 3FONA 4D2NA 4W68A 3MRHB 3S8WA 1AO7B 2V5MA 4JZJB 3W2DH 5HYEA 1HWGB 2XRAH 1F58H 1HHIA 3DJ9A 4KK5D 1UACH 3LY6A 5B38B 4GW5B 4J3VA 3VXPA 2DQCH 5JUEH 4C4KT 3ULVD 5GGSY 2R39A 3CH1B 4YNYB 5BZWB 1WBYA 4GSDL 4DZ8B 4IDJH 4LAJH 3UYRH 3UTTD 4EQ2A 4YXLL 5JQ6L 5D2NC 4XVTH 4IIQC 1TZGH 3MNWB 2IBZY 1NGYB 1SHMA 3FB5B 4KWUA 4LCYA 2V5RA 5BW7A 5AZEH 4S1SH 4YDKL 5IW1A 4PBXA 3IDGA 5IESL 1PEWA 3V52H 5EIIB 5JO5B 3MMEA 4P5TD 1QZ1A 3MUZ1 3MOAH 5C0BD 2P7TA 1WV7T 4YDIH 4IRJD 2GJ6B 3N1FC 4PJBF 1Q9WA 2BOBB 1HQRA 2V2WB 3C8KA 3NABL 4K8RL 3MRLB 1QSED 4TRPH 4LCWA 1MFAL 5TF1H 5EORH 4NM8L 4KMLB 5F7DA 1P7QA 3V6FA 1XIWC 25C8H 1HXMA 5DD3H 4YDJB 1D3CA 5I15H 3KWWB 1VCAA 4LP4A 1F90L 2ZCLL 3D3VD 3ZE2F 1QA9A 5DD5L 2HLFC 4Y0GA 5F88B 1YECL 2DIBA 4YHML 3MLSH 3GSNL 3TFKD 5C0EB 3MNVB 4HQQL 4AIZB 1RIVH 1HINH 4BZ2L 3IGAB 4Z7VA 5HGBB 2CPCA 4I1NB 5HDOA 3PQYB 1T1XA 2Z35B 4N8VA 3X12B 4OBSA 3EFDL 2YR3A 2OX5A 2VDPL 4MDIB 1UWGL 2CK0L 1NCTA 1QVOB 3CVIL 4JDVB 2WZPD 5IOPA 4WUKL 3QXAB 2A83B 5GJTL 3W0WE 2A6IB 2F8VA 3L6FB 3LKQA 2VC2L 3U36B 1QBAA 4MD5B 3I9GL 2BJML 3QEGL 1LP9F 4LLWB 5EPMB 4R4NC 4DWHA 2H8PA 5DC0A 1YEHL 3P9WB 5E4EB 4XCNA 4XVSL 2EXWC 1RUML 1FNGA 4W4OC 2FYYA 1N6QH 5F1OB 3BO8B 1INDH 2EKSB 2VLRB 1MLBA 1BJ8A 3OKLA 5F6HJ 3FCTB 1QFHA 2VN4A 3DX6A 1MF2H 1LK2B 1WBYB 4XPHL 1BLNA 4YDVA 3KS0H 2X40A 2FX7L 3S97C 3V4PL 4YXHL 1CE6A 4LCYB 3OF6D 4PV9B 5IW1B 4EQ3A 2BHZA 4I2XA 3IJSB 3IDGB 1BEYL 4WU5B 4UT6H 2X6MA 5T1KD 4NO2A 2CDEA 2HTKC 3AREA 2G2RB 1A2YA 3L1OH 1S5IL 3QXUA 3IDUA 1VFBA 4L8CB 2GUOA 2W0LA 2YSSB 4HC1H 5LKNA 3SGDI 3IF1B 1KJ2L 5I8EA 2RCSH 4U49A 3L95A 4PP2A 4YBQC 35C8L 1Q9WB 1H8NA 2GAZA 4ODXA 3S4SB 3UZVB 4LCWB 1X7QA 2NY7H 3PGCA 2ADGB 3LB6D 1WJ3A 5F7DB 3KR3L 1JGEB 4MHHG 4WV1C 5DMGC 5HHOB 4XMPH 1HXMB 1I9IH 3NPSB 2I9LA 4DCQA 4Z78B 1ZHBA 3PDDA 3D2UB 1C08A 1QA9B 3L5JA 4XX1E 2YN3A 3B2VL 4WCYH 3UPAA 3FQNA 3PXJA 1ROWA 5F9OL 3NH7L 3HNVL 1DBAL 3VFSA 3BH9A 3RWFB 1IGML 5H94A 5MHSE 2Y6SD 1T1XB 2R69L 4N8VB 5HJ3A 5LWYH 3IU3A 1EZVY 5GJSL 5L6YL 2FR4A 4LLVB 4N90E 4X4ZA 5TQ0L 4OLEA 5E6ZA 3D69A 5F1IA 2DQGH 5J9PA 1GYAA 5IOPB 1GGCL 3WFZA 3MBXL 2E6QA 4Z0XB 1DBJH 3O6FD 1TQBB 2JJTC 4PJXA 1JPGB 1MOEA 4N8CL 4HUXA 3ZTNL 2J1KA 1CDBA 4PTTB 4P4KD 2UY6A 1MFDL 3BT2L 5CJXA 4OZGE 5ICZA 4JB9H 2H8PB 4WGWB 3OQ3B 1RIUL 5I1CH 2DL9A 1QBMH 3HE6A 1FNGB 2FYYB 2OK0H 3BXNA 2PTTB 3OJMB 4MHHI 2NZ9C 5E6ID 4OM1H 3WFHB 3FQTA 4N9OB 5CD5D 2HH0L 2ERJB 2MQCA 2WWMD 2IEPA 4RGOH 1BLNB 2X2YA 4P3DA 4WHYH 4YDVB 2OTWA 4JPWL 5DD0H 4JRXD 4YUEH 5HGHA 4XNUL 2OCFD 5L2KD 4JY6A 1CE6B 3N9GL 3LS4L 2XNAA 1F8TH 4I2XB 5ID0A 1F3DJ 3ES6A 1P2CA 2F5AL 3A6CL 1E28A 5T3XL 1DQTA 4NO2B 3O41A 4RGNE 1IFHH 1YPZA 1VFBB 1YY8A 2GUOB 1SMOA 4M48H 1IM9A 4LMQI 2QSQA 3H3BC 5LGKA 4PJ8A 1CL7L 4OT1H 3TYFB 2HYMA 3L95B 4ZODA 4YHLL 2EDOA 2GAZB 5ID1A 1JTTA 3VWJC 2R0LL 1T21A 1OT2A 3ZSTA 1T0MB 3PGCB 1S7SB 3W9EA 3ZLQC 4KZDH 2VAAA 3KYOA 2ZUXA 1K8DA 1TZIA 4LBEB 4ERSH 1Z3GH 4O58L 1EBPA 5IQ9A 1ZE3C 2ZUQC 2ZOKA 3UO1L 1A5FH 1N6VA 1ZHBB 2BNUA 5ILTH 4TTDC 2VMFA 4LVOC 3B83A 2ATKB 4M61A 1MCBA 3AUVA 2BFVL 4PGCA 1G7PA 3RGHA 3FQNB 4EOWL 3NZ8A 3TIEA 1SBSL 3G6DL 1J1XL 5J6GA 4XBEH 3TO4D 1OHQA 5FYKU 1R5WA 5E9DD 4LVNC 1U8MA 2FR4B 5GGUA 4OAWA 3QUMH 4MJIE 2NY0C 2FNBA 3C08H 3R4DA 3D69B 4CRPA 1AO7E 5J9PB 5HI3C 2X89A 3MC0A 2DBLH 4WWID 1I8IA 1KLUB 3VG9B 3VXME 2X1WL 4HUXB 4ONHA 3DTXA 3T8XA 3WNOA 1K9TA 4JHBA 1CGYA 4P5MB 3QEQA 2YBRA 5ICZB 3GIVB 1LD9B 4K9EC 3EO9H 4KK8D 1T1WA 1UA6H 2AJXL 4L4TD 2AXGB 1A7QL 4KRMB 4P23A 2ED9A 1QKZL 2NY3C 3V5HA 3OG4B 5ITBL 1BWWA 1NQBA 1TJHH 3DURA 4IOIA 5F7WC 2DQIH 3RWCA 1IILE 5HGHB 5KS9A 4JY6B 4U7MA 3LN5A 3O6KH 4YHPA 3H9SB 1LVEA 4ORGA 3ES6B 3EZJB 3O4LA 3VFMB 3WIHL 2HMID 1MCDA 2NY1C 1E28B 4JM2D 5F9AC 2FGWL 4JR9H 2I26N 4ONOA 4R7NB 3RUGA 4QNPF 3BGFC 2PR4L 5IVXA 1OTSD 3EYVA 4ZO9A 3ZE0E 2VUOA 3SQOH 4EDXA 4AYFA 5ID1B 2P5WD 3EAKA 5CGTA 1CXKA 1PKQE 3PQYE 2VAAB 3GK8H 3QUMA 2UZYB 3MOBH 2UVFA 4FQCH 2XWBB 4M4RA 4PGDA 5IQ9B 4HT1H 2ZOKB 2BNUB 4PJCA 3RJQB 4YC2B 2GQHA 5EDXA 4K23H 2AJZA 4KTDH 2CDFA 4PGCB 1G7PB 3NZ8B 3RVTC 1AXTL 3UTQA 1R3JB 1RUAH 5J6GB 4M93B 4K07A 5FCSH 1BQHB 2KL6A 5DJCB 1R5WB 4P5TC 1H3XA 4XPFH 4MJ5A 3NAAH 1U8MB 5GGUB 1JNLH 4OAWB 1FHGA 5E2UH 2F58H 4IRJC 5KVDL 4ZUVA 2Q20A 3I02B 3RZCA 2OJZL 5CBAA 3MLWH 3QNXB 3CVHH 3HE7D 3QZWG 4P2OD 5C09A 2XZZA 4K71B 4N0YL 4V2BA 3V0VA 3VXRD 1UXWB 4LSUL 2VXTH 4FABH 4XCCH 4F9PA 3JSSA 2W1NA 3O6LL 1CGTA 1FVDA 2ZKHL 4XP6L 5CZXD 1HILA 4S1QH 3TFKC 4B7LA 3L3KA 4P23B 1F00I 1K3ZA 1ZA6B 4QCIB 1L7IH 2CKBA 1B6UA 4WW2B 5J13B 5D5MA 4HWBL 4Y4HC 2VZ1A 2O5YL 3WNNA 1NL0H 1AXSB 4KV5F 5EU3A 1W8OA 1M4KA 4I4WB 4ONGH 1HNGA 1PSKL 4MNHA 3DURB 4IOIB 2APFA 7FABH 4UTAL 3VD9A 4LRNH 1KIQA 1WFTA 2EDDA 3RWCB 2A1WH 2BVOA 1ZSDA 1OGTB 5CJBA 1QHPA 1S7TA 1GIGL 4HV8B 3F8UB 5KS9B 2WK2A 3DO3A 5C2BL 2VTFA 5EIQA 1CZ8L 1IC7H 1FDLL 3BUTA 4YHPB 4LCWE 1FFPA 3TN0B 4OZIB 1IC4L 3O4LB 4I0PB 1HZHL 2D3VA 3WUWG 1IEAB 4MXWH 1G0YR 4RMWA 3VDCA 1EX0A 4KRPC 4DKEL 1W8NA 3QA3A 4FG6C 4J4PD 3RUGB 1JPSH 2HVJB 3RGVA 3VDAA 3GO1H 5IMKB 4RWYH 5C07B 4ZUUB 3EYVB 4FS0A 4MMXC 4J12A 1MPAL 5GGTH 2CRYA 4Z7VE 2WBJA 4OKVA 1NBZA 1KN4L 4ZXBA 2HFGL 5GHWH 1ZT4A 3QCUL 1JGDA 5B8CA 3T4YB 5DHVH 1U3HD 2FIKA 2J7LA 5AYQA 3V5KA 1MLCA 2R2BA 1KACB 3QJHA 3ILQC 2AJZB 3DYMA 3T3PF 5L0QB 4PJ5A 1KNOA 2VABA 3MCLL 2I27N 4C58B 4U6XA 1U9KA 5FYKD 4NWUH 3S5LB 1D5ZB 2DJSA 3DXAD 3WXVL 1BZ9A 1VADB 4MJ5B 3SCMA 1R5IA 1DBMH 1X5JA 1CDYA 5FIEA 5E1HB 4ZUVB 2VLJD 1UYWH 3RZCB 1U3JA 5CBAB 3QQNA 1JMZA 2BSRA 1MFCH 5HYJB 4XNMA 3GMRB 4IRZL 3QULB 5DJYA 2K3TA 3A0OA 3LB6C 1P5UA 3CIQA 4UILL 1MIEL 4YFEA 5TE7H 1YEEL 5CJOH 3L5IA 5LGHH 2IF7A 3MSPA 1VEPA 5C86A 1VDGA 3KLAA 1NKOA 3L9RB 5I0DA 4NYLA 2A77H 2L7JA 4MJ6A 2YPLB 3UZQA 1X3DA 3H9ZA 1X5KA 4LHUG 2EDEA 4I2XE 4I3RH 1LK3H 5D5MB 1NDMA 4XGZB 2Z93A 5DZLA 3UP1A 2VDKH 3TWCL 1XGUA 3M8OH 4GRWH 1A7OH 3HUJF 2EXYD 2NYYD 2V7HA 1KIQB 3QUXC 2V2XA 1ZSDB 2QQKL 3GMLA 3N85H 3QDAA 3TZVA 3HG1B 4KPHL 1RVFL 3RNQA 4OF8A 2W60A 5FOJA 3X3GH 1F11B 2NR6C 1FFPB 3RI5K 1RJYB 1CXIA 3RU8H 4PLOB 3RVXC 3S88H 2YD4A 4X6CB 4P4KC 3ALXA 4L5FL 4LPVA 3VXUA 3W81A 1RHHB 2XG4A 4JFFD 4BYHA 5IMLA 1FZJA 2F54A 5C9JA 3VI3F 4KKNA 1LO0H 4TVPL 1CL7I 4HFWA 3H6JA 3GSQA 1MEXH 3O2WL 1JVKA 1HKLH 5FCUH 5C08D 3HS0B 4ELMA 4IS6A 2E8YA 1EFXA 2WBJB 3PJSB 1B0GA 1LEGA 2K9UA 3FZUC 4ZXBB 3MCG1 5IW6A 4EI5A 5CD5C 4FQXD 3V5KB 2FIKB 5GGQH 4G6JH 3LKOA 4S11A 4FQPA 3RY6A 1MLCB 2DDQL 3CVHB 1R24A 2R2BB 5DJ8A 4JY5H 3RHWK 2PUQT 2PYED 1NFKA 3OX8A 5DQ9A 3F62A 5GGSA 5TDPA 4XPAL 4CW1A 5ALCH 2C7UA 4UUJA 4U6XB 1X44A 4OZ4A 1R0AH 5GRJH 5D6DA 1N59A 1BZ9B 3ARBA 3K2UL 2HJFB 2WUCL 3KG5A 4N5UA 2QSTA 1BM3L 4XMKL 1LDSA 1WK0A 4PB9H 4DUVA 3O2VL 4PR5B 4JN1H 4OFVA 4XAKD 1ZT7A 5BV7L 5JTWA 1EO7A 1CU4L 5E8OA 1QUNA 3Q5TA 1BF2A 3DETD 3RY5A 4XAWH 4J7RA 4PJAF 1OSZB 4HUUA 1XGRB 4MNGA 1QNZL 3VG0L 1UCBL 3NZHL 4L3EB 1JRHL 3ULSB 2P45B 1ZMYA 1OPGH 5F70A 5DZOA 1TLKA 1C5DA 5FUZH 3WMSA 1FO0B 4Y16A 1REIA 1YZZA 4KJWC 4NYLB 3QWRD 3P40A 2BNRD 1FJ1B 1T66D 4MLIA 4PJEB 2DQJL 3SBWA 1NDMB 1FYTB 3DMMD 2Z93B 3LRHA 1I9JH 3HC0B 1KF9B 3WIFB 1I1FA 1F4HA 4LAQH 1I8KA 5KW9H 1VFAA 3UJJH 4KROD 4WFHD 2V7HB 2LTQC 1YPZE 2V2XB 1N7ML 1OTTC 3QQ3A 4MMZC 5D6CA 5DTFA 2QQLL 1NCDL 4TSCL 4UDTB 5DHVB 3KYKH 3FO9A 3UTOA 3SKUD 4XBPB 3HR6A 4H0GA 4L8DB 4WHTB 3VXUB 5JHLL 4G9FA 4LRIA 5IMLB 1FZJB 4CDHA 1MJ8L 3U0TA 3VH8G 5ADPL 4URTB 1EO5A 1H3TA 3ZYZA 3MJGX 2P8PB 5EZIH 1NC4B 4HW6A 5IVOA 1FG2B 1JTOA 1SVZA 4HFWB 1YN7A 3DBXB 1CF8L 5TGBB 4IS6B 4D9RD 1LEGB 2WV3A 4JRYA 5IW6B 4L9LA 4EI5B 1L0QA 3TYGL 3NCJL 3WIIL 1S9YA 1AH1A 2DMBA 2FX8H 4WUUB 5F9JB 2FRGP 1R24B 5DJ8B 4OFPA 4XPGL 1JI2A 1V7ML 1B4JH 4IEFB 3OX8B 5E5UB 2I60L 5TDPB 12E8L 1WISA 4JDTH 4CW1B 2QHLA 3VFGL 2HMIC 2ESVA 1I7RA 2YMXL 3QEHB 1J7VR 3DVNA 4Y4FA 5DJXB 2FD6L 3C6LA 1AI1L 4XTRD 2KH2B 3LSOA 1NC2A 2QR0A 1OTSC 1EJ6A 4PYGA 5DR5L 1ZT7B 3UTSB 3EYOB 1AD9A 2WLZA 4X4YA 1KJVA 4UINL 2V9QA 2HT4C 1IC1A 2C1PA 5F7UA 4PJHF 4Q9RH 4RZCB 5E8OB 4GRWB 1CGSH 3QO0B 2OTUA 4FP8L 1BP3B 4MNGB 3V8OA 2OR9H 4FXLA 2IADA 3HFMH 4TPRH 3SE3A 4A6YA 1TVBA 4MD4A 4Y16B 5KS9E 4UT7L 4ALAH 1K2DB 4MS8D 3KPSB 2VZOA 4YEEA 1WC7B 3PGDA 5D1XD 3QUYA 3O4LE 3NA4A 1DLHA 4OIIL 1CXEA 5FYLH 4BSWB 4Y1AB 1I1FB 1QFUH 4U3XA 2AW2A 3RUGE 1VFMA 2DICA 2R1YA 3OB8A 2BVUA 3QQ3B 5D6CB 1YA5A 5DTFB 2OZ4H 3NACL 5C07E 2IQAA 4H1LH 3HI5H 2AK4B 2XZQL 1NEZA 1DANU 2LVCA 1Y6KR 5BCAA 1FORL 3V9FA 2CJUH 2Z92B 3RWEA 3TVMD 4XCEA 3FT4A 3TBTA 4IDLA 1JP5A 1NGXA 4PJCE 1UCTA 3MR9A 4ZG1A 2VKWA 2R2EB 3ZKMC 5E08H 4RIRA 4KKLC 4EN3D 3DX8B 4OZHA 5JPNA 2D7QA 2ZUUA 4LNRA 4KZEL 4FFYL 4L9LB 4PB0H 5DUMH 4R26L 1KFAL 4IMKA 4OCSH 4HIEA 1S9YB 4H5SB 5CP7A 4YDLC 1IKFL 4HWZA 1U92A 3MCKB 1HN1A 1NPUA 4NUJA 2OXHA 3MRQA 4RRPA 5CSZA 1YNKH 3OKOA 2HJLB 3D9AH 4MNQB 1S7RA 2YD3A 2ESVB 1I7RB 3HI6L 5DT1H 5C09E 2DIJA 1CBVH 3GKZA 4QHLB 3DVNB 2VXQL 1LO3H 3IKKA 3QDGA 4Y4FB 4Q74A 4J4PC 3LPGA 1J0ZA 5CIPH 3U30B 4DOHB 4R6UA 1OLZA 2Q7NA 1ZOXA 4K3JL 4YHZL 5JR1L 4YHYB 3MUGA 1AD9B 2NW3A 3RI5F 5I73C 1KJVB 4G8FB 2ZSWA 2C1PB 3WN5A 3LPWA 3MRGA 2YPLE 3F12B 3N1QC 1BJMA 4U1KB 3UJIL 5D5ME 5CFHA 4UV4H 2DM4A 3LKSB 4PLKD 3B2UC 5ABDE 1T22A 1U3HC 1JHLL 1NMCC 4DK3A 3O9WB 2OZ4A 2IADB 1YYMH 3T0BA 1P84K 4HZLA 4H1LA 2R2CA 4LDLB 1CD9B 4CJ1A 5I1GH 2X4QA 1S7XB 5JW4M 2XTJC 4MD4B 4MD0B 3P4NA 4WFFE 1GVIA 4KKBD 1MNUH 3HG1E 3KPMB 3PGDB 1J5OH 1KCRH 4F3FA 1NSNL 3BP4A 1G7QB 5L9DH 3IFLH 2D7MA 3OKKA 4X6CE 1ZVSA 2YPVH 4Z0BH 1PAMA 3HRPA 3E8UH 3ISWA 4AZ8A 3IFNL 3ZT5A 2R1YB 1WT5C 5C6WH 1AY1H 3KNBA 5I1AB 1GHFL 4QRPB 2EIEA 1P4LA 3P4MA 2IQAB 1CDIA 3CLFH 4FFVD 1IGCH 3GB7B 3KHQA 3D6GA 4JFYA 5IMMB 5I6XC 5FYJH 4WFEE 3U0WH 1A7BA 3RWEB 3NN8A 1EVUA 1EIBA 3FT4B 2AEWA 2HP4A 3TBTB 5DD1L 4NDMB 4UIMA 5GRVL 5D2NA 3BEVA 2VXSL 4IIQA 1U8QB 3A6OA 5T3ZH 3QHZH 4OZHB 2H26A 4PJ5E 4HS3A 3O4OC 1PY9A 3H42H 3BDXA 5EO0A 3RX5A 2A0LD 4AEIL 5DQJB 1AKJD 3SN6N 4QRUA 4G80B 2NYYC 1S5HA 3EDKA 4P3CL 4HWZB 3SE4C 2X4UA 5DURD 4LSTL 4MX7A 3KPRB 4F8TA 3FT3A 3PHQB 3MRQB 1A7NH 3D85B 4WO4B 4XNZC 3OKOB 1BVZA 1S7RB 1KB9K 3EJZD 4C56D 4AIXA 5E99H 3PV6A 1XIWA 5MI0C 2R0WH 3FKUS 1JYNA 2CGRL 1BFVH 1KTLA 2CLVB 2Q86A 1CI5A 4GW1A 3QHFH 4GG6B 1LQSR 4RFOL 4N0FA 3WN5B 2E7MA 5AYUL 3RTQB 5JW4N 1WWBX 1FZOA 4PJEE 3X13A 3B9VA 1JPTL 4H26A 1ZHLA 1JRHI 2NX5D 5AAWA 5GSVB 2Q1EA 4JKLA 3GMOB 3VI4E 4K2UH 2X4QB 5KVEH 3VFNB 1J8HB 5F44A 5H37G 2E6JA 3ET9F 1X6NA 5EOCH 2WIIB 4F3FB 5IWLC 4OLVH 1U6AH 5CINL 1E6JL 2A74A 3PV7A 1T5XA 1TCRA 3BD4A 1ZVSB 1FH5H 3VXUE 4Q9CA 4M1DL 1F6LL 3ARVA 1KXVC 4LGSB 2ITDA 1MCWW 1Y18A 5IROC 1O7SA 4WY7L 5E2VL 1TJIL 3P4MB 5GGRY 1HHGA 4R4BA 4CU8A 3P0YL 3K8LA 4YHKH 5JW4R 4ELME 4JFYB 4DW2L 4AT6A 1OP3H 1RZJH 4MYWB 2W9EH 3HCVA 1MAMH 1AQKL 1EXUA 1IKNA 5GGVY 4WUUE 5D7LD 5GRXG 1MI5A 4UIMB 1IAOA 5D2NB 1IC5H 4ZFOA 3VRIB 1FFRA 2H26B 4XNYL 4PUBH 5FHBL 3PF2A 3LN4A 5CIPB 3DMMC 2AXFA 4OTXL 5I1IL 4ONFL 4K94C 2YN5A 4G5ZL 3WDIA 3MACL 1KIRA 5C3LD 4WEBL 4QRUB 5ELIA 3KJ4C 3WNPA 4JVWA 4PJ7F 1UG9A 2X4UB 4ZNCD 3KXFD 4PRHA 3LMJH 5DJZA 3R8QA 1OP3K 2Q6WA 4M7KL 3VWKB 5I1HL 3QQ4A 2XZAH 1OGAB 4GRWE 4KAQH 1H3GA 2ICEA 3ZYJA 1I1AA 4MNGE 5I19L 3PV6B 4WV1A 3PWPA 2XZCH 2HT3C 1F6AA 5IBLC 4QLRA 1KTLB 5HYSA 2GY7B 4WFGE 5GRYA 1CFVH 5DFTA 1IGYA 2Q86B 4GW1B 3MX0A 3F5WA 4N0FB 3MYJB 2NLJA 1A6ZB 4WU7A 3SO5A 5T33L 4MWFB 2A9ML 2YUVA 4BUHA 3QIBD 1MCPH 5SX4I 2QQNH 3ULUF 4H26B 4H88L 4AEHL 4Y1AE 3BQUA 4M9PA 1ZHLB 2MWCA 3K1DA 1HYSC 5IQ7H 4OKDA 2PYFB 3HC3L 5J3HC 4CADA 5D71H 3GMNA 3WXWL 4UTBL 4HWEL 4JZOA 2R9HC 1NFDF 4H8WH 5IUSA 4GKSB 3BH8A 4HX1A 3G6JB 4KJYA 2JJTA 1EMTH 4KKAC 2E27H 1T5XB 1TCRB 3RAJH 3UYPA 1KGCE 2Q87A 1FYHB 2MPAL 4LCCC 4P2QA 3D0LA 2ITDB 3MFGB 1Y18B 4P5KA 2GJ6D 3F7QA 4XVJH 1ZAGA 4OQTA 5DJAA 3MXWL 3U4BH 4NWTH 1R3LA 4R4BB 1PX4A 3MRBB 2BOCA 2YD2A 2FJHB 1XZ0A 1GOGA 4JRYE 5EOQH 4AT6B 5T3XD 1DQDL 5KZCD 1EXUB 1EUUA 5ANMB 3UTPE 2RFXA 1MI5B 5FUCC 4E41D 1IAOB 4DZBA 4ZFOB 4MS8C 3GJFK 5DK2A 5D1XC 2LVEA 2RHEA 4OSUH 2L7UA 2YRLA 4UV7L 2MTPA 3LN4B 4MXVE 2ESVE 1KG0A 4MCZA 1R5VA 4NSKB 3TPUA 1QR1B 1KIRB 4JREC 3ZE0F 4WWKD 1VPOL 3EDDA 3ZDZE 5KN5A 2XN9A 4JO2L 4JPKH 3VXSA 3WFEL 3WL9A 4CMHC 3BHBA 3ULUL 3I3EA 1A22B 4PRHB 1QEWA 4HBQA 2Q6WB 3LQAC 4LHUD 4J3WA 5LBSH 3VWJA 2EYSB 1CDGA 1PKOA 5D2LB 3RL1A 5GQBA 3IETB 3CFCL 2J8UA 4HG4K 1I1AB 3BDYH 5EOTB 2P8LA 3KAAA 4KRNA 5I9QC 1QG3A 1F6AB 3BKJH 4ZSOA 1OSPH 1AHWC 4LOUD 3O81A 1NUFA 3SY0B 1FQ9C 4ZAKD 5D7KE 2IPKB 4EN3C 1MJJA 4UBDD 3C6SB 4HSQA 1UJ3B 4QTHA 2NLJB 4UAOC 4WU7B 4JFOA 2VLRD 3J7HA 5T1DL 1WZLA 1ITBB 2R23B 4HJGB 1Q9KB 1DUZA 3BQUB 1YQVH 3FN0L 3DSFL 1V3JA 1GGTA 4LFHG 4X99B 5HHNB 5MEQA 4NJAL 3ULVH 4F37F 1I9RL 4M6NL 3GMNB 3VGEA 2AI0L 3RDTB 1YJDH 4JZOB 4X98B 5MEPA 4QXUL 1KEGH 2ZJSH 5EBWB 5CEYA 1AC0A 3H3PH 2NY4C 1VKXB 2Y06L 4KJYB 4LVEA 5C3TA 2V17H 1WEJL 5F89A 2AJYH 4HJJH 5EC1A 5A2LH 5DFVD 2DKMA 4KVCH 3QXDB 5IBTH 1D5IL 1OAUL 3D39D 4OLZH 1AR1C 5F3BA 1Z0MA 1EA9C 3O2DH 5JOEA 4KTYA 2O5ZH 3LH2L 1L9NA 5FAAA 4Y2DB 1RUPL 4OLUH 3QI9A 1MRDH 1A6PA 4GRMB 5DJAB 5F1SA 4QTIH 4OZHE 1DDHB 3AB0C 1R3LB 5BOZG 4OGYL 2IH3B 2BOCB 4JFQB 2J6EL 2FZ3A 3B8YA 4QXTB 3RPIA 2CDGA 4QXWA 4OCMC 1CLOH 5MP6L 3QFJA 3AFLA 1F3JA 3NMEA 2EYTB 1INEH 3O3BA 4X7TB 2MSPA 5TE6H 3RA7L 3KPRE 4DZBB 4IRSA 2BSSA 3MJ8B 5JZ7D 4JFEA 3TA3B 5DK2B 4Z95L 1Q0YL 3DROA 5FGCE 1HCVA 2B2XH 3ROLA 4ZO6A 2HJKA 4LSSH 5JA8B 4MCZB 1R5VB 1MRFH 3CFIC 2IGFL 5GIRB 3QDGE 1NDGA 4PLJC 5ICYB 5F7NC 1CQYA 5KN5B 3VXSB 3WL9B 3OGCB 2CQVA 3MGOA 1DL7H 5J12C 5T5NF 4Z7VF 1KULA 4RFEA 3PGFH 1Z2KA 5FYLE 5GS1A 3VWJB 5C0RL 3OHXA 2IPUG 2J8UB 2VISB 2YK1H 5BJTA 1Q1JH 4J3TA 1OAQH 1ODAA 1B9ZA 4D3CL 2ZUQB 3ZKNC 3L5WA 3QDJD 1T6VN 4PG9A 1G6VK 3V0WH 3U46A 3BAEH 2HKFH 4H20H 4QKXB 2G5BB 1MCRA 4XX1G 1UZ6E 1Q0XH 1KN2H 4QTHB 1X5YA 4NQCB 3GJFB 3O3UN 1S7WA 5DMJB 1WTGT 4NQEA 1OP5H 3GHBH 5GS3A 5AUMB 3S3PA 3KLDA 4DAGL 1DUZB 3VCLA 4P5TA 1FL3A 4LSPH 4F7MA 3DVGB 5IIEB 4QT5A 1I8MA 3JV6A 3P4OA 2GCYB 1NCWL 4I3SH 5FEBA 4PYHA 4UIKL 4IRJA 1XGYL 2YXMA 2IBBA 2P1YA 5F7FA 3MV9B 2Y5EA 5MEPB 1QSEA 2VZTA 5CEYB 4FFZL 2P5ED 3IJHA 4X8XA 4Z8FL 4M7LT 4MA7L 4MVBC 5F89B 5DC9B 2GTWA 3K4ZA 1M71A 1A6WL 3V0AC 2X1QA 3PG2A 1HHKA 3O11A 5F3BB 1VGEL 1ORQA 4NRYA 3SGEH 1OAZL 5D2NE 1PJ9A 2IBGA 4GQPH 5DMKB 4DQOL 3QI9B 2GT9A 4G6KL 2EH7H 1FZKB 4LP5A 3WO4B 1MJ7L 2ARJQ 1U58A 3QNYB 4R90H 1W72H 5L8JB 3X3FH 2G5RA 1CGVA 3W2DL 3QFJB 1F3JB 5C0CB 1F58L 4G6MH 4LGPB 3E2HB 3MV8D 4ZUSB 1UACL 4IRSB 1ULVA 4EDWL 2BSSB 2DQCL 4EI6A 3IVKB 5CZVL 4QOKB 4NP4H 3DROB 4Y19B 3CH8A 2JJWA 3KPOA 1OGAE 4R0LC 4YR6A 4EXPX 4Y7MA 1GAFH 1O7VA 2EC9T 4MQXC 4XI5C 1TZGL 1OM3H 2GSIB 3EYFB 3RFZC 2GSGA 1BQLH 2HT2C 4R3SA 3HNSH 3SJVD 5AZEL 2J5LB 3EYQC 3VFOA 3MGOB 2MCPH 1RZ7L 2R1WB 1NBVL 4G8EB 4M9OA 1CICC 3T1WA 1A1OA 5I8OH 1HOCA 5GS1B 3OHXB 5IKCB 1G7HA 4FQ1H 5IHBA 2X7LA 3P3YA 3FAXA 1RZFH 3VRJB 1FVEA 5CJQL 4RGNC 4U7KA 4U1HB 4K7FA 1YEKH 3REVB 4TULL 3TT1L 2CUMA 5A2FA 3UTTB 2RQ8A 4AM0A 5TF1L 5EORL 1K8IB 4ZFZA 3U46B 4PJXF 1WCQA 2ADFH 3GSVB 5FYJE 25C8L 5DD3L 3I75A 4M8QA 3FFDB 2BRRH 3SGJC 1MH5A 3QPQC 3PWUB 1FRGL 4GQ9H 4XVUD 1U0QA 3VCLB 3LDBB 1FL3B 2CLZB 3MLSL 2FATH 2NXYD 4L8BA 5C0BB 5T3ZE 1GC1C 4OV6F 5F7EH 2MJWA 5L2JA 5J06A 3P4OB 3QR2A 1I8MB 2ICWJ 2CK2A 1DUYA 1RIVL 1JZ2A 1HINL 1IAIM 3INUH 4F33B 1W72A 3SKMA 1QSEB 5HI4C 2HFEB 3H9SD 1ZTXH 1D7FA 4TNVK 1D9KD 1LO2H 4ZTPH 3RBGA 4J3SA 4TSAL 3IJHB 3KYMA 5IVZA 5B38G 1LO4L 3WKMH 2B4CH 3LIZH 3KLSA 4PJ9D 3I3BA 1M71B 1XMWA 3D3VB 3QDMD 3TJEH 1CG9A 4JZJC 3VE0A 3WLWC 5JIPA 2DTMH 3O11B 1MI5E 1ORQB 4NRYB 4XWGH 1J88A 4ZQKA 5B3JE 3Q3GB 3ESVF 2ID5A 5DQDH 2R4SL 2DWEA 1UZ8B 4OF7A 3QIBC 3U4AA 5D1ZD 1YPZF 4AENA 1U58B 5GRUH 3PE9A 5L88L 1YNLL 4Q2ZA 2VQ1A 1CDJA 3D48R 1LEIB 2Y1VA 3C5SA 3QUXA 1N6QL 4M7JL 2EDJA 4PJGB 4PRHE 5CWSA 5IGXL 4OJFL 4TVPD 2GHWB 3GSWA 4WDIB 3U7YH 4L1HA 1C8PA 4XMLH 3S3SA 1MF2L 1KCVH 4YR6B 4YWGL 3O6FA 3GSUB 3CFDB 5IFHH 1BQSA 3OAZK 5FUOL 3GBNH 4Z7NF 4DVRH 4P4KA 3PWPE 3RIFF 3WS6C 2GSGB 3VW3H 1Y6MR 3T0WA 3RWHA 3TBVA 4MXQD 2FX9H 4CAGA 2NTSP 4GW4B 2IAMD 3O3EA 4Y5VB 1GZQB 5I75B 3BFOA 1DJSA 3HN3A 3L3DB 3GSRA 3KPLA 3HB3C 4OFDA 4P9HH 2X7LB 5DHXB 4BM7A 1FVEB 4WGVB 3EYUH 1CT8B 4K7FB 1TENA 5HDQH 1XEDA 3AXLB 1T3FA 4KJPC 1IQWH 5IB5A 4JRXA 4X9HA 4LSVH 4Y5XB 1IT9L 4AM0B 2X5PA 4ZFZB 1HXYA 1BMGA 4QRQA 1IVLA 2I5YH 3BN9D 5HPMA 3NFNB 4XMPL 1I9IL 2BXZA 5DHYA 4M8QB 4KK6D 2VUYA 4K7PY 3RWIB 4CGTA 1SY6H 5T1KB 4QHMA 2R8SL 1UH2A 4HIHA 4OFYD 2VQTA 4PV8A 4WCYL 1A4KA 1RJZB 4OUUA 4L8BB 1RZKC 1NLBH 2EE2A 2NTFB 4P2QE 5EO1A 5L2JB 1N4XH 1M7DA 1DUYB 3FQXB 3GGWA 2O5XL 4AH2B 1W72B 3DGGA 1OL0A 2CMRH 5D93B 2VYRE 1KB5H 3HMWH 4R2GD 4I0PD 5TDNA 4Z9KB 1ZEAL 5IVZB 3KYMB 1RUQH 1JPST 1JGLH 3E3QE 4U1LA 1KJ3H 3OXSA 3MRKA 5B39A 2EDQA 1TETL 3SHSA 3MJ9H 5CJ8A 1Q8MA 3EO0A 2WUBH 2GYSA 3UPCA 5E4EC 4JEGB 3DV6A 5GGVH 2J3SA 1CG9B 2W9DH 3DIFB 3QIUB 1DBJL 1EH9A 2OR7A 2ZOLA 4EBQL 4GMTH 4WI9A 2FBOJ 5EU6D 4AENB 4IHOA 5ESVA 1T04A 3UROR 1X4ZA 2IAND 4F9LA 5IVXF 4Q2ZB 4HEPG 3T0ED 2XQYG 1KYOJ 5ALBL 1QBML 2XN9E 2C1OA 3FN9A 4GAGH 4NHCH 3CFJA 3VXSE 4HEME 4DK6A 1BVKA 5CWSB 1BVLA 1DE4A 4U4BA 3UDWC 4J8RB 3L7EB 2A9NH 1BBJB 4PGBB 4RDQF 3O6FB 3NIFE 1JZ3A 4PJCF 1VESA 2J8UE 4ODVL 1X5ZA 3NTCH 1EFQA 5ACZB 4YUEL 5DFVC 4P4KB 3JWNC 2J4WH 2X1OA 3RWJA 1JUFA 4NGHH 4ZSOE 3M1BA 5EZJA 1PD6A 5CCKH 5FM8A 5D72L 4LLQA 1L0XA 3RWHB 4ZPVB 1U36A 2Q8BH 4ODHL 3K4DA 4L4TA 1SY6A 2J2ZA 1G9ML 1ZLSL 4NQCE 3BKML 5LQBH 2Y4SA 4FXGB 3KPLB 4ODBD 2IALA 1EHLH 5E6IB 5T5NG 4M48L 4XH2A 4OCNC 5BVPL 2D4FA 3T65A 4N8VG 1DEDA 4OFIA 1TNMA 5CUSH 2KZWA 1L4IA 5HI5D 4JRXB 2VOTA 3EOTL 4GH7B 3FOLA 5L2KB 1JMXA 3BZDA 3IXTA 1HXYB 4QRQB 4U1JA 3MV9E 4KZDL 4B41A 2KDGA 5HPMB 4ERSL 1FPTH 1Z3GL 2EIZB 5KG9B 1HSAA 3UEZA 5DHYB 1EGJH 3MJ9A 1A5FL 4JM2A 5ILTL 2Y5TB 1OT1A 15C8L 4HIHB 3UJTH 4NRZA 4P46D 1NCBH 1A4KB 1G7JB 4OUUB 1V3MA 2QSCH 1AGFA 3OJDA 1M7DB 4C83B 4KUZL 5D5MF 3GGWB 3OR7A 1RIHH 1NLDH 5ERWA 4NN7B 2Z31D 4EXKA 4UNUA 4FQLL 2P5WA 5EZLA 5TDNB 1W2KT 1G6RH 3ZHLA 5GZOC 5EUOB 1G1YA 4U1LB 3QUML 2ICCA 3C08L 5C1MB 2X42A 3QFJE 4HKBA 1ED3A 1GRWA 3DV6B 2DS4A 5D9SA 8FABA 5M95B 2YD5A 2ZOLB 4NBYB 2R0KH 5DRZA 3MLVH 3ZZ1A 4Y19E 2D4DA 4YPJA 3TO4B 4O00A 4IHOB 1T04B 5E9DB 2FL5A 4HDIA 2ZNXA 2JJVA 4KDTC 3U6RA 3GFUA 2C1OB 1EBAA 2AABH 4PP1D 3WE6B 3TEUA 1T1ZB 4L29B 4XXDB 1BGXL 1DE4B 4HUVB 1TJHL 1U8IA 3EKCA 4ZUTB 5M7QA 3C8HA 4P2OA 1JZ4A 4NQSA 2F8XC 1RY7B 1YMMB 3ULVE 3VXRA 3BZFA 3HZYB 3RWJB 5FYKH 3T2PA 3M1BB 5EZJB 3O6KL 1QSZA 4HGMA 4LLQB 1ZVYA 1EGJA 4CVZA 4L4TB 1DCLA 4ZOCA 5I1KH 1DQLL 5C0GB 5AAMA 2CKBL 4JR9L 3MA9H 4NQEE 1JFQH 4JJHA 3EGSA 4XH2B 4L3ED 1NGWB 2CLRB 1QFWM 1HNFA 5C0BE 3V4UH 3SQOL 4LSDA 1T4KA 1KB5B 3FOLB 4LEOA 3I3DA 2W07A 4U1JB 2BNQD 4YFLF 1QSEE 1VGKB 1IGIH 3EIFA 1RFDL 3K8KA 5F8QC 1C5CL 4ZPTB 1SM3L 2BVQB 4JM2B 3MLRH 4L4VD 2Y25A 4FXKA 4POZD 2BSTA 1GGBH 1PBYA 4K23L 4NRZB 3UPRA 4KTDL 3O3DA 4J4PA 1TCMA 3D3VE 3V4VH 2IWGA 1AGFB 43CAB 2COQA 5E4IA 5E95B 2CXKA 3J8F7 5GPRA 2P5WB 1BBDH 4P0DA 1HKFA 1I7ZB 1SEQL 1J11A 3KGRA 4HK0A 3VG9C 5I16A 2AJVH 2AXHA 3FFCD 3MXVH 2X4SB 5DVMA 3W39A 4LLYA 1U3HA 1OARL 4LSQH 3JVGC 1OW0C 3O8XD 3X17A 1ED3B 8FABB 4QY8A 1G9EA 3P30H 1YYLL 1B4RA 5FXCH 4ZO8A 3WUZA 5DRZB 1GJIA 2QKIB 3WKNA 5BQ7B 4YQXL 1K85A 5CEZH 4FABL 1UC6A 1W0WA 1N64H 3DXAA 4CN6A 2E9WA 5KVFH 2NXYC 4HDIB 4FQ2L 1FAIL 4JFPA 1A8JH 4BQCA 5D7JD 4JQIL 4EZMA 4BH8A 1WT5A 4ELMF 3JUYA 5I1DA 2VE6A 2VLMD 2VLJA 1A6UL 1ZLWH 3UBXA 2GK0A 3MRDA 1NL0L 2ENYA 4ONGL 3HE7B 4LQ1A 4ZTOH 4P2OB 4NQSB 1N8ZA 2IFFH 4PJ9C 2K7QA 2A1WL 4QXGH 1CGXA 3BZFB 2A6DA 3MGTB 1AFVH 4LFHD 2H1PL 4OF5A 1HHJA 4BFIA 4G8GD 5FECB 2P43B 1LEKB 2RBLA 1IC7L 4JHAL 5GISH 1CD1A 3MLYH 2EEAA 1T7XA 4Q6YA 4TN9A 4M1GL 4P57A 2IMMA 4XNXL 2B20A 4MXWL 1DLFL 1ERNA 2HTLC 4GLRH 4WIQA 1QFWL 3EGSB 1EEZA 1VA9A 3GO1L 5I0ZA 4RWYL 5KBNC 4YC2C 3IFPA 1EO8H 1UXSB 1M05B 2VL5A 1MCFA 4RA3A 4GRWF 3SE4A 4PJDA 1IARB 2WM0A 3TBWA 2FHBA 2HLAA 1G6RB 3PUCA 3T0DA 1GL4B 5JLZB 2I25N 2FJGA 3KPSD 4MA8H 4NFCA 5C0FA 1O0VA 4JG1H 4R96A 5D70L 4M93C 1T83C 3CLEH 2NY5L 4PY8I 43C9B 4B0MM 3CZJA 4WHYG 5IK3A 4AMKL 1JWMB 3UPRB 3O3DB 4OF6A 3BP7B 2G60L 1MHEA 5IB2A 3RY4A 5I73B 2DYPD 4N5ED 4NWUL 4WTWA 4JY4A 1F45A 3FT2B 3P73B 5GS0L 4NNPH 1EPFA 3FRPA 4K71C 5C08A 1JN6A 2Q76B 3SDCD 5I16B 1CFQB 1I7UA 1Z9MA 4GBXD 1DBML 1QBLL 3W39B 1J0KA 1IL1A 4OI9A 4DN4H 4NKMB 2P47B 2WP3O 3HZKA 4PJFA 1OTUD 4MB4A 5EWIH 3MRCA 4WW2C 4XNQB 2VDOL 3RIAK 5J13C 5IJKC 5BRZD 3WNLA 3DXAB 4KY1L 2A77L 3GMPA 4JFPB 3LHPH 1UVQA 3E6HA 4N0UB 4BH8B 3THMH 2VLJB 2EDBA 5IROA 4I3RL 1J1PH 3UBXB 5CHNA 5DK0B 3TN0C 1RPQA 1MCQA 2VDKL 4I0PC 4CKVX 2YUXA 4Q0XH 2A6JB 1EEQA 1Q94A 1A14L 1INQA 2FIRT 3NCBB 4LKCA 4KVNH 3VMPA 2D7TH 1H15A 2X9WA 2BMKA 2A6DB 2GK2A 3N85L 1HHJB 1VSCA 4RDQG 4JRXE 5HDBE 1CD1B 3JXAA 2X4TA 1CLZH 3QWRA 5L2KE 1QYGH 2BNRA 3HI1A 3S88L 4P57B 4OB5H 1SVCP 1FNSL 5CKGA 1IQDB 3T2QA 1A6VL 5KJRH 3DMMA 1EEZB 1G9NH 4U0QB 2FB4H 2MHAA 4OLYL 4YZFE 3WFDH 4DN3H 5DJ6B 1LO0L 3QG6A 4JZNB 2DD8L 3IFPB 5DC4B 4S1DD 4O02H 2GTZA 2HN7A 1MEXL 3K4AA 5L0QC 5KAQF 2VR9A 1HKLL 4Y4KD 3TH3T 5B4MC 1A1MB 2P8MA 4JVUA 3TF7C 4HKZB 1SYSA 3HRZA 5GGQL 2CH8A 2KUTA 5EUOE 4NC0B 3LKPA 4G6JL 3VXTB 1IGJA 3LV3B 5IK3B 5I2IA 5MI0B 4JFFB 5C7XL 1LHZA 3MRIA 5TQ2L 1CE1H 3RZCC 4HGKC 4RX4A 4AL8H 1D5BA 2C3WA 5H8DA 4JY4B 5IJVB 5I17B 4KMTH 3T1FA 4PJIA 4BH7B 1JN6B 1Q9LA 3NA9H 5E9DE 4PB9L 4F9PC 2PF6A 3LQZB 4FQXB 4PLNC 1IL1B 1FZMA 2CR3A 5MEOA 4JQXC 5GS2D 2XACC 1HE7A 1AP2A 1A7RH 2PYEB 1UEYA 4OQ1A 3OAYK 4KK9D 2A6KA 2QTEA 3MO1A 1N5YL 1OPGL 2YD7A 5FUZL 3ZHDA 5C0IA 3NIGF 3EOAA 3O6ML 2X70B 1DR9A 1FL6A 3GMPB 4H25A 1I3GH 5HD8D 3TO2A 1UVQB 3ECBA 4LCCA 3BSZH 3R1GH 4NNYB 2YKLH 1IGTA 1DVFD 3VFUA 1ZT1B 1DEEA 1UKTA 5CHNB 5E8PA 2F74B 4L4TE 1RU9H 5KW9L 1U8JA 2F8OA 1Q94B 1KJMA 4WI5A 1INQB 4LEXL 4QWWD 1XGQA 2BMKB 2DKUA 4XHQA 4JPVH 4FZEL 3DUUA 2VR5A 4A6YL 3ULUD 3TT3H 4GXVH 2R29H 4HXAL 2BNRB 3HI1B 4HIXH 2DQEH 5D1XA 2FSEB 4LPTA 3FO0H 2WBJC 4I0KA 4ZXBC 1OY3B 3DMMB 1I1YA 3QO1A 1RQ5A 2ZP0T 4KROB 2QLVB 1MSPA