4OTXL

Structure of the anti-francisella tularensis o-antigen antibody n203 fab fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
211
Chain Sequence
b'QIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEAPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N203 light chain
publication title Functional and Structural Characterization of Francisella tularensis O-Antigen Antibodies at the Low End of Antigen Reactivity.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 211
sequence length 218
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4otxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4otxL01
1QFWI 1FO0B 2IF7A 1NBYB 1NH6A 5EORL 4XVJH 4LBEB 3TH4T 4GAGL 3KXFD 2K1MA 3FMGL 4IS6B 1MRCH 5KVMC 2APWA 5GGRY 1D9KD 1X5IA 3D39B 1LP9A 4OB5L 1T1WA 1T83C 2OLDA 1D5IH 4HJGB 4J1UB 4WUUB 5HHQB 1SJEA 4JREB 3LH2H 2C4XA 4M6MH 2Z92B 4PLJD 3T0WA 4JY4B 3BYYA 4ODWA 4U6YA 3EFFB 3L5XH 4UUJA 2HH0H 5D7IF 1S9XA 3FHAA 1AD9A 3CGTA 4JO4H 1IAIM 4OFDA 1IGFH 4XP5H 3NZ8B 4ELKA 2OTPA 3QAZB 2WSKA 2BVYA 1CLOL 4HMCA 4JFEA 5CJOH 2FJGA 2QADD 5DYOA 2HWZH 2FZ3A 3ARGD 1JZ8A 1I8KA 1EO7A 3DURB 1CWVA 3BE1H 4DW2H 1NGXB 1WZ1L 2AEQH 1BD2B 2FCBA 4MD0B 3V4PL 2X40A 2GFBA 3N0PB 1P84J 5FKAB 3FOMB 1SY6H 4M00A 2V7NB 4PG2A 1EVTC 3IKCB 1ZS8B 5GRYA 1VHPA 2NY2C 1UM6H 2E7BA 4FXGB 2Z31B 1OARL 2Z91B 4FQCH 1GC1L 2HRLA 2E6JA 5E2TL 4JN2B 5EORH 1MVFA 2FATL 4OUOA 3GSQA 4OCSH 3FMGH 4P4RB 5D7JA 3SY0B 1RZGB 4M93C 4OB5H 3KPQB 5CEYB 1TJGL 5CUSL 2DM2A 4NKIL 4P9HL 4BUGA 5JW5B 3OKMB 1K4DA 2YSSA 1YNTB 2XPGB 1XGTA 5JDJA 2BK8A 2H9GA 3QH3B 5LXGL 4U1NB 3NCBB 4Y5VC 3VE0B 2HA1A 5IR1A 1S7UA 4P2QA 1FAKT 2B0SH 3PV6B 4JO1H 2HTLD 4E41B 1KLGB 5JIKA 5E99L 3P9WB 4AG4L 1FO0L 4AZ8A 1WZ1H 4EI5B 2DM4A 1YN7B 5JW4M 3V4PH 1P7KA 1X5XA 1C12B 3F7VB 3KNBA 4L8BB 1Z9MA 3P73B 1CTNA 5H35B 1MI5A 3KDMA 1X5ZA 4PGEB 5F9WC 4L9LC 3PP3H 5C09A 3MRIA 4KMQA 3GJFK 3IXTA 3VMPA 4KJYB 3QPXL 3FQNA 3SDXF 4NN7C 3JUYA 5T3XD 1OARH 3OR7A 4BKLA 5L88L 5MEQA 4HX1B 1GC1H 1ZE3C 1XF3B 3GNML 5E2TH 5L0QC 4LVOC 4PJCA 1ZLWK 1OAKL 2FATH 1S7VA 2BOBA 3DVNA 4MJIB 4A6YB 5D1QD 5DJ0A 5I9QB 1TJGH 3EZJB 5CUSH 1WK0A 1X5KA 4P9HH 4NQCA 3RWFA 3WIFB 2NX5D 1KSRA 3UTQA 5ICXA 3OG4B 1IEBB 4FFYH 5I19H 4F9LA 5C9JA 4MQXC 4OIBA 1QLRA 1D5XA 1HN1A 3BVNB 1VDGA 3KPSA 4NPYB 1FNFA 3GB7A 4OD3L 4HS6B 5BVJB 1F5WA 2GY7B 3DPBA 3J7HA 3NFPA 4PJ7B 4R7DA 1J0JA 3BMVA 3TO2B 3ZTJG 1F2QA 2VZ1A 4Z77A 3CDCA 4O51A 3H7BB 4MS8D 5J12B 4OJFL 4YFEA 1ACYL 5E99H 4F7EA 4AG4H 2D9QB 1T03L 1FO0H 4LCUB 2R1YB 1MAML 1B2WL 1RZ7L 1A6ZA 4HKXB 4JDVB 4U1HA 1CU4H 2ILLA 4S1RL 2AJVL 4XPAL 3SGKA 4YUEL 4OFKA 3WIHA 5L6YL 2P42B 4L4VD 1EH9A 1HXMB 4PGCA 4LPYA 2EEBA 4PJXA 3QPXH 4HH8A 3AGVA 4JM2B 4LLDA 3SQOL 5FM5O 5FF6A 5D6DC 5IVZA 5L88H 1A6TA 4S2SB 1W8OA 4FQHB 4YXLL 3AMLA 3QDJE 3W0WE 1OAKH 4PRIE 4Y0GA 1L7TL 4WW2B 4PJDB 4YDJB 3P4OA 3L3OA 1T04B 4LDLB 2B39A 4MJ4A 2BX5A 4F7PB 3TBWA 3QFJA 5F70A 4EOWH 3O4LE 2DLHA 2V2WB 3DX9A 4WTZG 5LBSL 3N06B 2X44D 2FL5B 3NFNB 4AM0B 1HHIB 3G04A 3CDGA 4IDJL 1BJMA 3DMMA 1EHLL 3TH3T 4LVHC 2C3VB 3HRPA 1CFNA 2DWEB 4OJFH 2KKQA 3X13B 3D2UA 1ACYH 4I0KA 4LPXA 1T03H 4FFVC 3DV6A 1HQ4A 3C5JA 3ULSB 3G5XB 1MAMH 1B2WH 1F4YL 4OD2B 3K7UA 3FFCB 3QUYC 3NVQA 3AFLA 2AJVH 1A9EA 4XPAH 3IAPA 4A6YL 5EU4A 4YUEH 3R8BB 5L6YH 2JCCA 3HC0B 4P5TA 3PP3K 1TIUA 1AH1A 3SQOH 1G7QA 1IM3A 4CNIA 4DZBA 3RIAF 2OZ4H 1L7TH 3VD4A 2NY2B 1W0WA 3RKDC 4F3FA 4KRPC 5D2NC 1T4KA 2FX9L 1ORQA 1WT5A 1RI8A 3MV7B 4S0SD 5CILL 4NCDA 4X7CC 2ZUXA 1XR8A 4E42B 4HGWB 1ULVA 3BZ4A 2B2XL 3QUZA 4GW1A 2I9LA 4M93B 5E9DA 1KIUA 2EIBA 4PRNA 3RY5A 5IJKA 3VD9A 4KH2A 4IDJH 4CL7A 3BQUA 1EHLH 3GBLA 1BIIB 4WFFE 3W81A 1FHGA 3CDYA 3IJYB 1P9MA 4Y5VB 3T3PE 4MJ6A 4FZEL 3VA2C 1OW0A 1U8MB 4JFHD 2X1OA 4A6YH 4ZAKD 3ZKNC 3K80A 3BO8B 3EOBA 3SJVA 4QCIB 2J12B 5DC9B 3LKPB 3RNKA 4Q58C 2XN9A 1A22B 5DJ6B 4FFWD 2XNAA 1DP0A 4UQ3B 5F9WB 4L9LB 4FG6C 2O26U 3IFLL 5HYIA 3X3GH 4JFZL 8CGTA 4QRQA 1NCAL 3MQIA 1U8IA 4NN7B 1I8IA 3OPZL 4X6BA 4WFHD 1GGTA 4W4NA 5L0QB 3MTRA 2FX9H 4LVOB 3TP4A 4PJ9D 1VFAB 1I1AD 5CILH 4X83A 1Q38A 2ICWB 1XCQB 1U8HB 2P7TA 5IROC 4DK3A 4KK9C 4IDLA 1UENA 1AQKL 2B2XH 5DD3L 4ZUVA 5HVGB 3AUVA 2NY6D 2EYSB 1ZGLM 4DN3L 4NNXA 5IOPA 1AKJB 4MD5B 2Y5TA 1QRKA 1YYLL 3LD8C 1OGAE 2VR4A 2BVPB 3WS3B 3QNYA 1KIQA 1Z2KA 4N0UE 4TVPL 3IDNB 2JIXD 4FZEH 3LKNA 4NUGL 1WEJL 4ZYKB 4OZGA 3DO3A 1NFIA 4APQB 4PJEA 4QHNA 3LSOA 3GO1L 1JHTA 1KIRB 4GS7C 5E7FA 2YWZA 3BUYB 4XZUA 1T7VA 5FDWA 4OSUL 5CD5C 5CD3A 1EJ6A 1BAFL 5IB3B 2VB5A 1B88A 4YGAB 5I2IA 3DHMA 4GRWB 3MGOB 3OGCA 1JZ3A 4HLZH 1FZKB 3IFLH 1E28B 1FZOA 4JFZH 2V2TA 4Z7WB 1NCAH 1FYTE 4HS8L 4ODSL 1P7QA 3VCLA 4PBXA 5A3IC 3OPZH 4ZFZB 3SKMB 4B0MM 2FECL 2MHAA 3H9ZA 4PBWD 4DGIL 1CGSL 4PIRF 1CLYH 4JRXE 4DVBA 1A0QL 1MCIA 1QBBA 5SWZD 3MACL 5KG9B 3F12B 4JGMA 5DD3H 1AQKH 4OCWL 4KI5E 1NC2A 1VGKA 3SDAB 5KVGL 5C0AB 2C3HA 3NIFE 4DN3H 1VFOA 4UZGA 1YC8A 1YYLH 2X4SB 3BOVA 3ARTA 4JR9L 3RAJL 2QSVA 4TVPH 4LSTL 1C16B 1WEJH 4LBEA 2OR7A 1F58L 2VABA 5DRZB 4OGYL 4IS6A 4LVHB 3MBEC 3F8UB 3GO1H 4ETQB 2P48B 4PJIB 4FN0A 4LIQE 5BZDA 1YEFL 1C7TA 4OSUH 2VSDA 4HH9B 2IPTL 3B5TA 3GMPB 3ZE1F 4JY4A 1L0QA 1BAFH 1HWHB 4MDJA 3QUYB 1LEIA 1NBVL 2AVGA 1UKTA 5K9KA 5KSBF 1F6FB 2GJ6D 5BZWA 3U7YL 2UWEB 1O5DT 4HHAA 4NM8L 3UBXA 4ETYA 1HHKB 3MRPB 3O2DA 2OCFD 4HS8H 3GSRB 1ERNA 3VFUA 1UM4L 3HI6L 4PRHB 4N1EA 4ONHA 4PGZA 1I7TA 4DGIH 1CGSH 1A0QH 2EH7L 1ODAA 4OCYL 1CXIA 3MACH 3QO1B 5GPRA 1HNGA 4YLQT 3GSXB 1ZWIB 3FOMA 4OCWH 2V7NA 4KK6D 1UJ3C 1ZS8A 3OMZA 1AIFA 1OVZA 4I9WD 4KRPB 1PX3A 5D2NB 1IFHL 4OCMC 1CDCA 1UQSA 1VADB 4BUHA 3P30L 4FXGA 2JK5B 4JR9H 5EULV 3SOBL 2Z91A 1F4WL 1YPZA 4A2MA 4BM7A 4FQ1L 4LSTH 4OZIE 2VITB 1F58H 3IU3B 1ZK9A 3IGAB 3KPRA 1BVKB 4OGYH 3QEQE 4P4RA 3SY0A 1RZGA 4F7TA 1I8MB 4WTXA 3U6RB 3RI5F 1A4JB 3WLBB 4P2RE 1VFUA 1YEFH 1RJZA 5DEGB 2IPTH 1YNTA 2XPGA 4FQXC 32C2B 1NBVH 3MFGB 4U1NA 3MRGA 3O3EA 3SDDB 2EDWA 1BPVA 2OZ4A 2Y07L 3U7YH 4ZO7A 4NM8H 3NPZB 4I0PD 2VDKL 2VR9A 1FNSL 4J7RA 3LVEA 4YIQB 1KEMH 4C56A 4Y4KD 4E41A 3HI6H 3P40A 3VFGL 1ZVHA 1IVLA 3ULUD 5C0ND 1KLGA 5SWSE 2E8YA 2AXHA 3VD3A 1D3CA 4GMSL 5T1MA 1YY8B 3VXSD 6CGTA 4HS3B 4EI5A 2MTPA 2EH7H 4OCYH 4P5MB 2AQ2A 1YA5A 4HIXL 5JXAL 4L8BA 3HZKA 4NQEA 3ILQD 2H6PB 3PWPD 3VFSA 5AG9A 4D9LL 2R8SL 1IFHH 3K2UL 3ZHKA 3HE7C 4LASL 1VACB 2J8UB 2Z93A 4XX1G 1QO3A 3SOBH 1S7WB 1F4WH 3TT1L 1LP9F 4Y16C 4GRWH 4FQ1H 5TDOB 2AJXL 2X7LB 2IADB 1LE5B 2APVA 4MJIA 1OAZH 4A6YA 3LD8B 4XCYB 1ZSDA 2DYPD 1BZ7A 4XPBL 3WIFA 4NBYB 3G6DH 3S5LG 4WO4A 5EUOB 5EU6B 1MUJA 1EBPA 2IAND 2YZ1A 3FTGB 1RJYB 4F37F 4LRIC 4GS7B 1H15A 2Y07H 2PXYC 2VDKH 1FNSH 3UTTD 1M1SA 4LOUD 3V0VA 3VWKD 1F6AB 4RGOL 1YN6B 1VB9A 3VFGH 4TN9A 5JO5B 4XNQA 5MENB 5C0BE 2X4UA 1NMCC 4GMSH 4N5ED 2GSGB 4LCUA 2Y7QB 5CBAB 3O6FD 4G8GD 4GG8B 4JDVA 1FL6B 5JXAH 4HIXH 1FN4A 4XBGB 4D9LH 5GRJL 2R8SH 2M1KA 3K2UH 4CW1B 4NQUA 4BELD 5C0GA 3H3BC 5D2LA 3U4BL 1HXYA 1BM3L 4LASH 3QI9D 5EU3A 43CAA 3WNOA 3C6LD 1JNLH 3TBSA 3TT1H 4O58H 1EO8L 3KPTA 4FQHA 1WC7A 5DSCB 2AJXH 4HC1L 2Y5EA 1KELL 4WW2A 5HHMB 5D7IE 3T3MF 1T04A 1U8NB 1I3RB 1DBAL 4XPBH 4K2UL 5D8JL 5SWQB 1BBJB 3ULVC 3LEVL 2PYEA 4YNYB 2VJXA 3ZMRA 5EU5B 3MBEB 3CXDL 5K33A 1JE6A 5FHBL 4AT6B 4I48A 3MC0A 4LPCA 5IB1B 5CKGA 2G2RA 4R26L 1DSFL 2YA2A 4RGOH 2C3VA 5IM7A 1YDPA 3GJEB 2GKIA 4Z95L 1BQLL 3SGEH 4YBQD 5J57B 4F9PC 5C8JB 4QRRE 1FL3A 2OR9L 4RAVA 4X5XA 1PG7L 3K8KA 5CLTA 2WINB 1YMME 4IOIB 5GRJH 5L9DH 3TV3H 3U4BH 1XGYL 1BM3H 5HYJD 1HILB 1QBLL 4OM0L 4Y1AA 3K4DA 1EO8H 1QP1A 2APFA 4ODXB 2JJTA 1R5VB 1UJ3B 3MV9B 2B1AL 2D2OA 4HC1H 3O11A 4L3ED 4Q6YA 4LRNH 1ZVSB 2YA0A 1DBAH 1IGTA 1V3LA 1X7QA 4K2UH 3R06A 5D8JH 4DEPC 2CO6B 3RHWF 4XBEL 3S6CA 3K81A 3LEVH 4Z7UF 5DJZA 1IQDB 4BSVB 1KUMA 3TNMA 3C60B 1FH5L 3IF1B 1TNMA 5I0DA 3UZEA 3VWJC 2R15A 1YY9D 2YUZA 3KWWB 2NY1D 1WV7T 4R26H 1JNHB 1DSFH 5BJTB 4JQXC 2PTVA 4FQXB 3AXLA 4Z95H 2AJYH 1G84A 1BQLH 3HAEH 5CP7A 4CBPA 3G6AA 2MKWA 3B6SA 4NO3B 1N5YL 4PJXF 5TE6L 2OR9H 1PG7H 2MPAL 3BXNB 2ZWLT 3HNSL 3JV0A 5J3HD 5T1LB 4LPVA 4C54A 4D8PA 4IHOB 1N7ML 1XGYH 1D5BA 3QA3A 1AGCB 1QBLH 4OM0H 4KV5F 1AO7E 4JKMA 1S7SB 4B41A 1CT8A 1A3RL 1YEDA 1T2XA 3G08A 1AFVH 2IALB 2B1AH 4RX4A 3HMWL 5I75C 3MPCA 5CIPB 3HE7B 5I1JL 5CBEA 3T8XB 2GITA 3P0YL 5FM8A 3T2NL 3ARFC 3IVKB 4Y16B 2A1WL 4LK4A 3CVIL 3U83A 4XBEH 5HYQA 4MNQE 3EGSB 1QBML 1WVZA 4HKJA 3FB7B 1FH5H 2KUTA 2FIRT 4GW4A 2CIIB 3RZCC 5CSZB 4Z5RB 3S37H 4P46C 1PZUB 3MNZA 2HAZA 3RWJB 1U8PA 3TNNB 4RWHA 3UBXI 3TPKA 4Q9QL 3GSVB 1LDSA 3QUXA 2BVPA 3STBA 3WS3A 4ZO6A 1DLFL 4WU7B 2JCCF 3TF7C 3U9PL 4NO2A 2PXYB 3HCVA 3WHXA 2QHRL 1NJ9B 1N5YH 3UJJL 5B39B 1CG9A 5TE6H 4APQA 3KGRA 1KIRA 4F7CB 3HNSH 4LLWA 3BUYA 1NMCB 4JFDD 3PDOA 1ZA6A 1A02N 2CMRH 1A3RH 1Q1JH 1A1MB 1DL7L 2LTQC 1U8JA 3HMWH 4J4PD 3HG1E 4Y88A 3BT2L 4HK3N 1ADQA 1EGJL 3GGWB 4OI8A 2F8OA 2VAJA 4KKBD 3P0YH 4LKXA 3T77B 5GXBB 1FORL 3CVIH 2ZPKL 4JZOB 1QBMH 3WE6B 3GMNB 4GLRH 3MRHA 4FTVB 1R3IL 2CGRL 2ICWJ 3BIAX 3SDAA 3LKQB 2CR3A 1MF2L 4DQOH 2X2YA 4XVSL 1A21A 4Y2DC 4G6FD 3B83A 3BAEL 4KK8C 4N8VB 4Q9QH 1J12A 1ZT1B 3QEHB 4JFFE 1Q9LA 2I9TB 5D71H 1OD7A 1QR4A 1DLFH 3OXSB 4JHAL 4GW5A 2QHRH 1C16A 3LY6A 3UJJH 5IW1A 2ZCKL 5DRZA 4DUVA 3O6ML 2EXYD 4KKCC 3SPVA 3QIWD 2UYLA 2XKSA 5ISZD 3ZYJA 4LKCA 4F33B 1EEUA 4U3XA 4PUBH 5EOTA 2VKWA 4ZPVA 3ZZ1A 1DL7H 5I18L 1A7OL 3JVGA 3T2QA 5A16A 2UWEA 3E6HA 1T5WB 3BT2H 3GSRA 1EGJH 3BP4B 3D39D 1DANU 3QBTB 2NYYC 5E8EA 4GG6A 1T7ZA 4H1LB 1FORH 4WUUD 4LFHG 1T2QL 4PRHA 1MVUB 1D6EB 1OAYL 5FKPB 2ZPKH 1FJ1B 1I7UA 3HMXL 5FA4B 2DLGA 3GSXA 3V5KB 4JJ5B 1R3IH 2DI7A 4MNHA 2CGRH 1JWMA 4YBLC 2K9UA 3G5ZB 4DEPB 1MF2H 2WP3T 1OWRM 5F3BB 2UZIL 4XVSH 3BMWA 4OZGF 3BAEH 1P7HL 3LMJL 1T7XA 4ZUSB 3VXUB 5DHYB 1AY1L 3VWJB 1BD2D 3VFOA 5JPMA 5JR1L 2VITA 2H32B 1AXSB 4C58B 2YMXL 2ZCKH 3FCTA 3O6MH 5CIPH 3AU1A 2EDNA 4TQEL 3UTSB 5C0CA 3OB8A 5DK2B 1A4JA 2FYYA 2XY2A 4TULL 1C8PA 2Z31D 1YEGH 1B3JA 3V5DB 2HFTA 2D3VA 5E4EC 5C3LD 3ZO0A 2WZPD 1F8TL 3SDDA 5I18H 1A7OH 2HJLA 4NJ9L 1BFVL 4G8FA 1T89C 3EAKA 3ULVL 1NKRA 4HLZG 3CH1B 4BFIA 3V2AR 1T2QH 4CU7A 2FX7L 3BPOC 5HVWA 1OAYH 2DQFB 5B8CC 3VI3F 1YY8A 2VDQL 3QQ3A 3P9LA 5H94A 1ZTXL 3S4SB 4LP5A 3ZKQD 4CGTA 5IB4B 4DAGH 4QF1A 2NY5C 5HHVL 5FGCB 1JCKA 2J2ZA 5HYEA 3SO5A 1CGWA 3ARFB 1DQQB 2HLAB 1ETZA 2DICA 3DX8B 3HI5L 4KTEL 1FLRL 3ELAT 3LMJH 3HAEA 2DQDL 5EBLA 3LN5A 1AY1H 3RZCB 3RTQC 5ADPL 3ALPA 4QHKJ 4TUOA 4P46B 4PJ5E 5JR1H 1L0YA 1PLGL 1S9VA 4GBXC 1KF9B 1IBGL 2YMXH 3VXOA 3ORJA 4PJ8C 4JRYD 4R9HA 4TQEH 4YEEA 4RSVA 3ZKSD 4NBXB 2X70B 3HR5A 2H45A 5E94B 5JDSA 3LKSA 3WEXA 1LO4L 4AIZB 4TULH 3GBNL 5GS1A 3D0VB 1F6LL 5FM4A 5B38B 5EN2B 1U6AL 5CEXB 1B6DA 1ZVYA 3PF2A 4NC0B 2GTZA 1F8TH 4L8DB 4GKOA 4XCEA 2XWTB 1BZ9A 1LGVA 1UCTA 4LGPB 3B5GA 2GSIA 3GUTA 5IWLC 4NJ9H 3ULVH 2OJEA 1F6AA 3WJLA 1TPXC 4JVPA 4P5KB 2MCPL 3U36B 1YN6A 4PREB 1N0XL 1MHCA 1FV1B 3ROLA 4UTBH 3S34L 4V2BA 1T3FB 2LTQB 5BS0E 3ROOB 1ORSA 2VDQH 3FN3A 3JWOC 1ZTXH 3U4EB 1I7RB 4GG8A 1I85C 4X80L 1XFPA 5HHVH 4NNYA 4HIIB 4LFHD 3V6OE 1JFQH 3GSNB 3AVEA 2P1YA 3CVHA 2DDQL 3LZFL 2O5ZL 1JV5A 5JXEA 3HI5H 4XH2B 4KTEH 1FLRH 1LO2L 1UC6A 5IMKA 1MCLA 1CGTA 3BEVB 4NYLB 3OAUL 1T66D 2DQDH 2P5WD 1C5CL 3TBTB 5ADPH 1JBJA 3H0TB 1PLGH 4Q9RL 3ZE1E 4GRLC 3I3BA 4HCRL 3T4AB 3SHSA 4GO6B 2NTFB 4JKKA 3VGDA 1LO4H 4H1LH 4LNVA 4MZ2A 4D0DB 3GBNH 1ZEAL 4WV1A 2W9LA 1AGDB 3OHXA 4PY7B 4LLUA 4YNYA 5E8PB 5EU5A 1U6AH 4MAYC 5C2UB 4LSUH 5IBLC 4ZFOB 3F65A 4BJLA 3RVUC 3AY4A 4NZRL 2EDFA 4MXWL 4M4PA 2MCPH 1MHEB 3I84A 3GJEA 4JGUA 1WFOA 3IDIA 3S34H 1F11A 5C8JA 5I76B 3MZTA 4Y19A 4P2CG 2EEDA 5DRWB 3C5ZC 1MJJA 5AUMB 5TE7L 4N0CD 1YUHB 4QRPE 2H32H 4X80H 1RJLB 3MLXL 5BW7A 5JNYA 4LDEB 4IOIA 2CDGA 3O41B 2DDQH 3LZFH 2O5ZH 1DQLL 3C9NA 3EUUA 3MRQA 4L8CA 3VGAC 2KDGA 1HILA 4HXAL 1LO2H 3OKOA 4U6VL 1BMGA 5FK9A 5D6CA 4KJQC 4ZUWB 4YBLB 1C5CH 3PJSA 1FVEA 1WCBB 4M8QB 4Q9RH 3FFCD 5GIRA 1BHGA 2ZG1A 3DO7B 1CICA 3WKML 1QRND 1FFOA 4HCRH 3TYGL 5CJ5A 4HSQA 3CU1A 5D7LD 1F4AA 4N90D 1L7IL 1WAAA 1IGYA 1ZEAH 2CRMA 1JHKL 1EJOL 1A6WL 4BSWB 3C60A 4FFZL 3IF1A 3V7AE 4AENB 5IVOA 4O2FB 1GGYA 4N8PA 4L29A 2Q86B 2K3TA 3GSNL 3D3VE 2GIYA 2NY2D 4NZRH 3OKYA 4MXWH 3GIZL 1KPUA 3QIUA 1WBYA 1CFVL 4WEBL 5E4EB 3RY4A 4ONGL 2GJ6E 3MV7D 3OJMB 3V6BR 3WNKA 1Q9KA 4M9OA 3L5WB 5TE7H 4JM2F 5DJ8B 3X11A 4V1DB 1NUDA 2PR4L 1XH3A 3MLXH 1LP9E 2WWMD 3X12B 4OT1L 3RWHB 1MFAL 1U41A 3RVXC 2HFEB 3BPOB 2I60L 5I1AB 1DQLH 4Q97A 5B8CB 1KFAL 4AMKL 2X4OA 4WW2F 4HXAH 3IJSB 1A7NL 4U6VH 2AK4B 1DLHA 5CZKA 1KXVC 2BZDA 5C07D 4ZFOL 1L0XA 5GQBA 3BRFA 1ZHNA 4JFEE 5ICZB 3DUUB 5IKCB 1G7MB 3WKMH 2K7QA 4P23C 3TYGH 4WI4A 4NQDB 5FYLL 4Y16A 4HWNA 5FGBC 1L7IH 3RTQB 3MLTA 2W0PA 1AR1C 1JHKH 4JCMA 3EGSA 5AYQA 1EJOH 1A6WH 4GBXB 4JGJA 3L5JA 4FFZH 4PJ8B 3BZFB 2CIIA 3FAXA 3GSNH 5JLZB 3KLAB 1OSZA 4D9QD 1UACH 5DFTA 3GIZH 5LQBL 1H3GA 3U46A 4WEBH 1CFVH 1MCRA 4N8CL 3RVVC 1I1FB 15C8L 4KY1H 4AYFA 3UPRB 3O4OB 2RJMA 3HI1A 4ONGH 4K23L 5DXWA 3EDEA 1I4FB 1H8SA 4BZ2L 1TQCC 2D7QA 3TZVC 1TPXB 2PR4H 1AXIB 3UYOD 3J8F7 1E4KA 4OT1H 3VFRA 1ES0A 1FCCA 1MFAH 2VLRB 4LGSB 2MOVA 2I60H 4WHTB 1AKJD 5JHDB 3O2VH 1KFAH 1JPTH 1DVFA 4RA3A 4IRZL 4PJGB 1A7NH 4OF8A 3MLRL 4MCYB 3QISA 2PW1B 5CJBA 2VZTA 2ZJSL 5E5UB 3MLSL 3ES6A 1HI6B 3ZKXC 4QHKI 4P2QE 1IKFL 1T0MA 5LGJB 1HINL 2N7AA 3C87A 1HDMA 3E3QC 3VXNA 4NN6C 5FYLH 1FNAA 4G3YL 1MHPH 1DQML 4RA0C 2Y9RT 3IFOB 4GRLB 4RDQG 1MI5E 4B7IA 5C09E 5C3TA 3WDIA 2V17L 4ELMB 3P3YA 2CK2A 3RDTA 5GSVB 1H8NA 4MAYB 1QLFA 4UIKL 5EZLB 5LQBH 1ZT1A 2KZWA 4N8CH 2NY5L 2VC2L 4DVRL 1HQRB 4PJCE 2VLLA 4X6EB 4K23H 4UTAL 4L4TB 1JGLH 4BZ2H 3WCYA 4ZSOA 1M7IA 5HPOA 5DEFB 2BY0A 5JORA 3QXDB 2EH8L 4ZPTB 3O9WA 4NQCE 5JOPD 2BSRA 3LN4A 4L1DA 3VFWB 5IFHL 4F33A 4H8WL 3BZEA 1DQTA 3K8LA 1INEL 4XPFH 1KULA 4D0BB 3D0LB 4IRZH 1YEHL 3MLRH 3MOBH 2ZJSH 4Y5XC 2IH1B 3MLSH 4OAWB 5T3ZL 4Z7UE 4WI3A 3PQYB 1T5WA 1X5GA 3HE6D 1HINH 3VGAB 3BP4A 3PHSA 4WHDA 5IJVB 4Y4FD 4FFVD 5CJXC 4G3YH 3JV5A 1DQMH 3QUYD 1GGIL 2DQCL 2Q8BL 3MROA 5C0IB 5D9SA 3QEUB 2LU7A 2V17H 2A6IB 1XGUB 3BW9B 4PJXE 2GJZB 2GCYA 3KYMB 1S8DB 1MWAA 3JWOL 1CD1A 2EDRA 2NY5H 5D1XC 2VC2H 4DVRH 3DNKA 1KJMB 2DQGH 2P5EA 3LQZB 2VXUL 4UTAH 3G5YB 2H32A 4KV5E 4R7NB 1AXSA 5KSAC 4QOKB 5E6IC 4GRWF 3RKDD 2EH8H 4YAQA 4KRPD 1RD6A 5FUZL 2DQUL 1TJHL 5IFHH 4H8WH 4YXHL 2XACC 4I3GA 1INEH 5HSFA 4Z7WF 3QFJE 5HGDB 4NZTL 1YEHH 4DN4L 1S7TB 1BOGA 3ARDC 3GBML 4EVNB 2OXHA 1NAMA 5T3ZH 3MSPA 2YPLB 4UBDC 4YWGL 4IOFC 1YMHB 3IFPA 1BVZA 1FNGB 4RBPH 1EUUA 4OD1L 2LQRA 3L1OL 3DRTB 1HH6B 1PYWB 2A6KB 4HJ0C 3UP1A 4YHPA 4B7LA 2Y06L 1GGIH 4XX1E 4L3EE 2DQCH 2Q8BH 1CDBA 3ZKND 1IAKB 2VLJA 4P23B 2JCCE 4JG0L 4ZXBA 2BCKB 1J10A 5DD6A 4CUCA 1R3KA 3JWOH 3ZDZF 4I77L 1K5NA 1XGQB 4G6KL 3U9UA 1PGRB 4K07A 3V6FB 2R1XB 3FKUS 1P6AB 1CCZA 2B5IC 3WL9B 1CLZL 5L7XH 3U0TA 5BRZD 3BEWB 5F7MC 1RUMH 2EYTB 4AK1A 5FUZH 2DQUH 1TJHH 4AQOA 3D85A 1QHOA 1S78C 3D48R 1DN2A 2UWEF 1F3DH 5FV2A 2SEBB 5TE4L 4NZTH 3ZLQC 1TQCB 2VAAB 1RUKH 3TZVB 3MRFA 4OZHA 3NAAL 4PRPB 4K8RC 3GBMH 1V7NL 4O2EB 2AXJA 2VL4A 3EYFB 2FR4A 3QXWA 1F13A 4LCCB 1J87A 4YWGH 3UPCA 4QT5B 5E5MB 3TM6A 2ED8A 2XKUA 4QHMA 3NN8B 4N0RA 1ZHBA 3TIEA 4OD1H 1KTLB 1FV1A 3L1OH 4GKZB 5DRXA 4AH2A 4MD4A 4QTHB 1T3FA 4L3CB 5EU6D 1KG0B 3ZKXB 4R3SA 5D5MA 3MJ7A 2Y06H 5J6HB 1RZFL 4XC3L 2NMSA 1EBAA 4FMKA 3QDMD 5D7KD 4ZD3L 3GSNA 3OJVC 4NN6B 4JG0H 3SJVE 4R96A 1U95A 2ADJB 5CGYC 5DJDB 1Q94B 4HW6A 3BWUC 2FLRT 1FRGL 5CD5D 1EDQA 3PWLB 4XNMA 2XN9E 4OM1L 5EO1A 3EHBC 3KHOA 1HE7A 5MEND 1MCOH 3GM8A 2F8VA 5E6YA 3RWGA 5HGHB 4NYLA 4G6KH 2H3NA 1RZJH 1RHFA 3GMQB 4X6CB 3BGMA 4M02A 2OK0L 1I7ZB 1MCSA 4QXUL 1JF5A 2F74A 1CLZH 4OFYA 1BQHA 1UJTA 4P9ML 3T4AA 3M45A 4LCWB 4D0DA 2C7UB 3TO4C 1HZHL 5HHNB 1UYWH 1AGDA 5E8PA 5TE4H 4P48A 3L3DB 4W6XB 1RK1A 3H9SB 4HF5L 3NAAH 1TETH 4EUPB 5TQ0L 2EIZA 1T80A 1J1OL 3A6BL 2NQCA 4J3TA 5CGTA 5HHMD 3T0EC 4ZOEA 3OKDA 5HDBF 3PABA 2BVQA 2ESVB 4OKVA 2DI8A 2F53D 5MERA 4RBPK 2DMKA 4LNRA 4Y5XB 4U3CA 1D9KC 4OF3A 1WIUA 1EX0A 3P2TA 4OZGE 3GHEL 5AUMA 1RZFH 3I6KB 4XC3H 4OGXL 3MBED 1F02I 2J8UF 3HRZB 1RJLA 4PLJC 4ZD3H 3RWDA 5F7KC 3VXRA 4ODHL 1NCTA 5DD0L 5B39G 4OM1H 1HOCA 2YPKA 4LLVB 1I3UA 2D7TL 1L9MA 1R3LA 5IK3B 5D7JD 4HUUA 5TH2B 1NC4B 4NO0B 5FECB 5EUOF 2OK0H 1H3PL 4BFGA 4QXUH 1SQ2N 5DVMA 4P9MH 1SBSL 5EUKA 4CN1A 5JMOC 4ZQKB 1QFOA 5D1XB 5DVKA 1QVOB 1H3UA 1HZHH 5F7EL 2IH3B 1K8DA 4HKZB 1IL1A 5T1KD 3N85L 4HF5H 1JHLL 3EO1B 5KSAB 2X89A 3G9VA 3MV9D 1NANH 5E6IB 3JV4B 3MLPA 4O2FA 3P4NA 4OF6A 3A6BH 1QA9B 3VI3E 1TZHB 3WV0A 1JGVL 4U6XA 3TESA 4HIEA 2R4RL 4LSSL 1E27B 2JLLA 5EZOL 2W60A 3ARDB 5ITFA 2GT9B 4U7KA 4TUKL 5IQ7L 3GHEH 4CADA 4NC2B 3L5WA 2VTFA 4OGXH 4N8VG 2P8MA 4RGNC 1U92A 3X12A 4I2XB 3MNVB 4OTXL 3PWVA 3RWHA 4PRDA 4FNLL 1EPFA 2Y72A 4ODHH 3V8OA 3OB0H 4R8WL 5DD0H 3FO1A 1ND0A 4FQXD 1F3JA 1AE6H 4TOYH 3CLFL 3S88H 2D7TH 12E8L 5DDHA 4OZ4B 2HTLC 3LCYA 3OTTA 1BQUA 5TDNA 1CFBA 3B43A 1H3PH 5HHOB 4DKFL 3DUUA 4LLMB 1IC7L 1SBSH 3AAZA 2FGWL 3MR9A 5T1LD 1I9IL 3OR6A 2ARJB 1I9RH 3HB3D 1S7RB 4I3RL 4O00A 5F7EH 4XI5C 1JN6B 1BD2E 2G5BA 4MQ7B 3GMRA 3O3AA 3OQ3B 3MJ9L 1MRDL 3N85H 4G9FA 2B5IB 1JHLH 1ZHLA 2HTKC 1QSFB 4H1LG 3QO0B 2ORBL 2YXMA 2VDPL 4I4WA 1SM3L 2VIRB 1G6RB 5ENWA 5JLZA 3HE7D 1JGVH 3EKCA 1HHGB 5DJAB 4M03A 2NXYC 4L8SA 4LSSH 1X5FA 2Q87A 5EZOH 2HN7B 2J8OA 3O45B 5EO9B 3UPRA 4U4BA 1DANT 3TVMC 4P59L 3WXVL 5IQ7H 5L2KD 3RPIB 1X5AA 4XHJC 2NTSP 3GSOA 3B4NA 4K7PX 4GQPH 1CDHA 4OTXH 1VGEL 3O4LA 3MYZA 2FJFA 4FNLH 1VFBB 4R8WH 4K3EL 3CLFH 12E8H 3MRBB 1E4XL 4EUPH 5KS9A 1S9WA 2PXYD 3RP1A 3U7AA 5ANMB 3THML 1WAAF 3MZGB 1G1YA 5LGJA 4C56E 4DKFH 5IV2B 4E41E 5C92A 3WYRA 1IC7H 2P46B 1OHQA 2A73B 2FGWH 2APXA 1I9IH 2VLKB 2VZSA 2CLVB 4PRAA 1UVQB 4I3RH 2EO1A 4U1IA 1I1RA 3MJ9H 1MRDH 4NKDB 1EAPA 3IFOA 4Z78B 5IHZB 2ORBH 2VDPH 2AEPL 2XWBA 3EIFA 4ELMA 4ZFFB 1FNEB 3TO4B 5GSVA 3S4SG 1OPGL 2ICEA 2YD5A 4K7FA 5DJ2B 2VDRL 4J12A 5EZLA 1P2CA 1M71B 3Q3GB 4EDWL 1JZ4A 4UMGA 2OXGA 3MRDA 3MYJA 2EZ0D 4GAJH 3RY6C 3WXVH 3T0EB 5KSUA 4MJIE 4FTVD 1S7XA 1DFBL 2CLRA 4PV9B 1NSNL 5DEFA 3SDYL 4XNXL 1VGEH 4PTUB 3VG0L 3ULVD 1PKQA 4JPIA 4Q0XL 1D9KB 1DEDA 1WWAX 5A2LH 4E0RA 4K3EH 2G75B 3OB0K 5DO2C 3HPJA 4CMMB 5ACLA 3S3JA 25C8L 3IDJA 3UEZA 1E4XH 1EZVY 1N26A 4OUUA 2GYSA 4B50A 3LQMA 3THMH 4G8EB 2ATPA 5TPWL 5B38G 1G6RL 4QTIL 5JOFA 3PHOB 1K8IB 5L8JB 1W2KT 3MUGA 4HIJB 5T5NF 3K1KC 4K8RL 3OXRA 4UINH 4U1MA 1F3DJ 1S9YB 3DYMA 2GK0B 2I07A 5T5FL 3CFIC 1WUNT 2AEPH 4NJAL 1OCWL 3FB5B 1XGUA 2C26A 5F9OL 3BW9A 1OPGH 4M5ZL 3KYMA 1S8DA 3DXAD 2VDRH 4HUWA 1RVFL 4I13B 1U3HA 2VKXA 4FQQA 1J1PL 1FAIL 4EDWH 4YDVA 1QSEA 1N4XL 3IT8D 4U0QB 4YH6A 3TJEL 3TN0C 2DQJL 4R7NA 2CPCA 1OAQL 1DFBH 3V4UL 1NSNH 3QFDA 1YEEL 4QOKA 3SDYH 4XNXH 2A83A 4L5FL 2FO4A 2PYEE 3OKLB 4DWHA 4XGZB 1TQBC 3S36X 1NQBA 1RQ5A 3VFVA 25C8H 2PW2A 4XP9L 2XWJB 3VWJD 4RGNB 5K9OA 4ONFL 1DEEB 2YPLA 5TPWH 4LVEA 4N0UA 1G6RH 4WEUD 3UTSD 3L95B 4QTIH 3DBXA 4UIMB 3WN5B 5JIPA 4WCYL 3QIBC 3ZSSA 2VMFA 4K8RH 2BJML 4PLOB 3B9KC 3JWDC 3X3FL 1RHHB 2G9HA 3C8KA 3CFDA 4LSDA 3QDGA 5T5FH 1DDHB 1KPRB 3LRSA 4X8JB 4NJAH 2YEZB 2Q7YA 1OCWH 5F9OH 1K2DB 4M5ZH 4Y1AE 4N9OB 1G7IB 4NWUL 1RVFH 1T5XB 3K2MC 1FYTA 5GGSA 4TVPE 3B9DA 4NQSB 1OB1A 1PDKA 4CVZB 1LK2A 4WNQA 1J1PH 2ZOLB 4IMLB 2BVTA 1N4XH 4Z0XB 1AGBA 5IEHB 3TJEH 2DQJH 4NN5C 1GCFA 1MCKA 2BFVL 3V4UH 1XF1A 1YEEH 3EDJA 2NXYB 3ARFD 3BEWA 2QTEA 5C0DB 2CDFA 2E8ZA 3MRJB 2DJSA 4HK0B 3EOAB 4L5FH 5DFWH 3TVMB 4PR5A 2OSLB 5IQ9A 4F7MA 3K74B 2BC4B 2ZUTA 3TIDA 4DKDC 4XP9H 1A7PH 3RZCD 5FCSH 2DD8L 4ONFH 4P46D 4OFIA 4LCCA 4PV8B 3O2WL 3QXUA 5DJCB 1SMAA 2FWOA 3KS0H 4WCYH 4L9DA 3B3IA 1KTLA 4GKZA 3NZHL 4FHBD 1L9NA 3BP7B 1FC2D 4QTHA 2N4IA 2BJMH 1YECL 1YNKL 2BVUA 2V5SA 4X4MA 5EZJB 3X3FH 2F5BH 1FGNL 3FQUA 4M62H 2HJFA 4J8RA 4M3JA 4XWOC 5FUOH 1TENA 2PETA 2BDNL 4R4FL 1QFUH 4H20H 2E5EA 1BOYA 2E9WA 1OOAA 1RV6X 3PWLA 3MX0A 4NWUH 4L4VB 2AV7A 2QSCH 1RZKC 5GGTL 2ZG2A 2IAMC 5HDOA 3FO0L 5EFIB 2BFVH 4HKBA 3G6JB 2PTTA 5I73C 5IBUB 1DZBA 2IEPA 4M1CC 5EZIL 2C5DC 1QYGL 4ODUB 3C6SA 1EFXA 3JUZA 3L3DA 5F7YC 3H9SA 1YQ2A 1Q0XL 4WGWB 1BLNB 3CSYB 1C5DB 2DD8H 3I9GL 3VH8B 1J8HA 4Y2DD 1W0VB 3O2WH 5E56A 4U6HA 4KK8D 5ALBL 4MYWB 4IRSA 2YD4A 3PIQA 3RL1B 2OMNA 1TTFA 5L8KB 4JO2L 1NCDH 4LMQI 4JFOB 1Y0LB 3NZHH 5C2BL 3KYNA 5INDB 2NLJA 1CFSB 5ACZA 1YECH 3BKCL 1AQDA 1KB5L 1YNKH 2HVJA 3HZYA 3EOTL 3PG2A 4F2MA 1FGNH 2YD1A 3HLAB 3KPOA 2Z4QA 4U1JB 2DQIL 4EN3A 2BDNH 4R4FH 5CWSB 1KENH 1VEMA 4KDVA 2R0WL 3FONB 2GAZB 2DI9A 1UXWB 2F5AL 5FYLD 2HKFL 1NFDA 4GRWE 4HFWB 2AQ1A 3ZT7A 5GGTH 5DT1L 1QR1B 3H8NA 3KPRD 3ARBC 5SWSA 4YDIL 2ZSWB 3RGVC 3FO0H 1OD9A 4H26B 2NYYD 4TNWK 1G7LB 1DUZB 3MO1A 4NQXB 4PJAB 4X5WB 5CJQL 4B5EA 1CGUA 2JB5L 1XF4A 5EZIH 1QYGH 2XQYK 4N9GA 3TN0B 3Q48A 5GS2D 1MAJA 1Q0XH 3I9GH 3NCJL 5C08A 5C0AE 2VLME 2FO1A 3VFTB 1FNHA 5ALBH 5D5MF 3DGGB 4HWBL 1TQBB 1U58A 4JZJA 1BF8A 6FABL 4JO2H 2GEEA 4DK6A 4OI9A 1EIBA 4PP2A 5C2BH 3B8SA 4ZUTB 5D93B 2NNAA 5F89A 3BKCH 4NQED 1RURL 3FT4A 1KB5H 5L2JB 1HHJB 1R5WA 3ZDZE 3EOTH 4IRJA 2M26A 3S96A 3O3DB 1AP2B 2DQIH 1UWXH 2AXFB 3QIBB 1CR9L 4DOHB 3OBAA 3W9EA 2R0WH 3B9KB 1UB6B 5J9PB 2F5AH 1RSFA 2XXCB 2HKFH 4WEMB 1X5LA 3ME0A 1AC6A 5DT1H 1TNNA 3ECBB 4YHIA 2UWEE 4P4KA 4Y4HC 2A38A 4O9HL 3IDUA 4YDIH 1LE9B 4XAWL 4V1DD 3BPCA 4LLMA 4GG6E 1JZ6A 1P4LB 3VXMD 3QXAA 3FJTA 5CJQH 3WJJA 4PRHE 5FO8A 1M7DB 3CD4A 1N59B 2JB5H 1FVCA 4HUNB 1N8ZA 2Q76B 5CINL 5ETUB 1G7PA 4NN5B 2AW2A 3WHE1 5IG7B 2AK4D 1CFTB 2EYRB 1QSFA 3HKFA 1UB5A 2I27N 3NCJH 2VIRA 5D2NE 2O93L 5C71A 3FQTB 3CMOL 2V9TA 4M1GL 2F8XC 3R0MA 6FABH 1PAMA 5F3HA 1FDLL 2IQ9L 2D0GA 4NQDD 3RTQD 3L3HB 3CZFB 3OF6A 4HWUA 3RZWA 3ZYIA 4GBXD 2F54A 5AAWA 3RPIA 1RURH 4PJ8D 1A14H 3SBWA 5C0CE 3ZE2F 5T3ZD 4N68A 1UCBL 3VFMA 4NNPL 2CIKA 3MGAA 2QR0A 1CR9H 1LNUA 2BNQA 5DMKB 5DFVD 5AEAA 1TZIB 2P49B 5E8NB 3ALWA 5EC2A 3PWUA 3VWKC 5IB5B 1EHXA 5DS8A 2BSSA 1H5BC 4O9HH 3VA6A 1U8KB 4XAWH 4XBPA 5B3NA 4QRRA 3ILPA 2ARJQ 2R56L 3D69A 2VLRD 1WISA 4BQCA 3TCXA 5JHDD 3MRKA 4JQIH 1UVQA 2IAMB 2XZAL 4ISVB 1R3HB 5CINH 5HDBE 2VYRE 3T0AA 2DQTL 4XXCA 2YC1B 3AREA 3BWAB 1MPAL 2FDBP 2X41A 3SE4C 1VEPA 1KPVA 3SCMC 4DFHA 5I73B 1EUTA 1AGEA 3CMOH 5C0EA 4M1GH 2J8UE 3NCEB 1OLZA 5E8OB 5ID0B 5K93A 3BDYL 1FDLH 2IQ9H 4OLZL 2VNCA 3JWDL 4OZFB 4WDIB 3EO0B 1M71A 4CVWA 4I18A 3CC5B 4OV5A 1X5YA 2CDEB 4ORZC 3V95A 2BNRA 4U1GB 3DRQB 4GRLD 1JGEB 3INUL 4HWZA 1UCBH 1UXSA 4MMZC 3QWRD 4NNPH 4OQ1A 4U1SB 1IC4H 1KN4L 4PTUA 3KXFA 3W39B 1AXTL 1UWXK 2WBJD 4JPVL 4X8XA 3RWEB 4M3KB 5EUOE 2G75A 4MAYD 3SE8L 2BOCB 3MFFB 4YGVA 3S35X 4XP6L 4CMMA 4EIGB 4U3HA 5IBLD 5HI4C 3VW3H 1BQSA 1JYXA 1L4IA 3GK8L 4GRMA 3JTTB 4L4TD 5TGBB 4KJWC 1BIHA 4G8EA 1G7JA 2GY5A 4YBQC 1IGCL 1LO5A 4H5SB 3E6FA 5IMLB 2FHCA 1N64L 3DHJA 2R56H 4LPWA 2D31B 3UTZA 3SDXA 5C0JB 3QUKA 4JFPA 1T1YB 1DUYA 1K8IA 2QV2A 2C3WA 4X98B 4M6AA 4CDGC 4HDIB 3C5ZD 3ARBB 3ARGA 2XZAH 3RGVB 2FB4L 4JKLA 2DQTH 5DZLA 1EMTL 2QLVB 4MX7A 4IJ3C 1MPAH 3DROA 2HRPL 3KPPB 3MV8B 3PQYD 3V5HA 3ZTJH 3FB5A 4W6YB 3IYLW 4ZS7L 4LLQA 1FL5B 2P8PA 3BDYH 4OLZH 5EPMA 5JPNB 2EICA 3JWDH 4KJQD 5C0FB 3L9RB 5GRWA 2XI9A 1M4KA 5I1DA 1DJSA 4UDUB 4MCZA 3KG5A 5HHME 3EYOA 5IB2A 3EYVA 3INUH 4G43A 4XTRC 5E1AA 1NEZB 2Q7NA 5KS9F 2JJSA 1AXTH 1MH5A 3PWNA 1RZKL 4PG9A 3QJFA 3SE8H 5BQ7A 4XP6H 2ERJC 5MEOB 1BJ8A 4HIHB 2EE3A 4YXKL 3GK8H 1GZQB 4NRYA 4KTDL 2XQBL 1IGCH 1PQZB 1U8OA 3QDJB 3W0WB 4PRIB 1N64H 3L95A 4JAMA 4M61A 4HUVA 3LRHA 3WN5A 4RAUB 4EUPG 1HH9A 2M8XA 1A47A 2IPKB 3FL7A 4Y19E 4ELMF 4Y4HB 4XCFL 2FB4H 1EMTH 5DQDL 2HRPH 5DHXB 3RVXD 4QRTA 1U91B 3WUWA 2YZ8A 1K2DA 3GMOB 2IBGA 4ZS7H 1I1YB 5A2IH 1T5XA 3HG1A 4X4YB 4NQSA 2WAHA 2HKHL 2ZOLA 2HVKB 3DX7B 4UQ2A 5KAQF 1KB5A 1JYVA 3Q1SL 3T65A 4G9DA 4K71C 4RFOH 1X5JA 2AXGB 4YPGA 4NDMB 1MCWW 3GSWA 3VRJA 4LVNC 3HZMB 2X4RB 3IS1X 4NCC2 1WAAE 5D1QA 4CU6A 1N5AB 1RZKH 1AR1D 1MEXL 2J7LA 1DBKH 1JGUL 5C6WH 1MFNA 4PPTA 2NX5A 4YXKH 1O0VA 1T20A 4KTDH 2XQBH 4GAFB 2O61A 4U2YA 3WFDL 2EKJA 4QRUB 5HVFB 4ZUUB 4G80B 2EDJA 3SQBA 3RVVD 1HEZB 4MWFA 3QWOB 1NCBL 3L3IA 4LSVH 4PJHA 5F1IB 3VWKB 1VENA 4OZFH 1NDGA 3O3BA 1H5BB 4G8IA 4XCFH 4ZTPL 1ZGLA 5FO7B 3TZVD 1ZA3B 5CEZE 4YHOL 4PRPD 4XCNB 2EE2A 5BO1L 4G8GB 5ERWA 1A2YA 1XMWA 1MQKL 3IETB 2DL9A 2Z8WC 2VXSL 4DCQB 3B2UC 4L4VA 4LF3A 3SCMB 2HKHH 3Q1SH 3DECA 4E5XB 1K9TA 1JPFB 4PJFB 1YEJL 3DUHA 2Q6WA 4ZOBA 3G6JA 1DQDL 1RIUL 3WXWL 4Z7OF 3OSKA 4EXKA 3CFJA 5F8QC 2XTJC 3CFKA 3ULUL 3RIFK 3HNVL 1JGUH 4Y2OA 2NCMA 4NZUL 2EDQA 3C09B 5J6GB 1IZJA 3V0AC 4DUWA 3VGHA 3EJZC 5KJRL 3WFDH 4FRWA 5DRNB 3QULA 1GVIA 3RL1A 2E27L 1NCBH 4LCWD 5GRUH 1WWCA 1CBVL 4X7FC 4R4BB 1CFSA 4ZTPH 4UOW0 4YHOH 3F7PC 4LEXL 5IF0A 2NW3B 2CJUL 3GI8L 2A77L 1TCRA 2YRPA 1MQKH 5A40E 2VXSH 5C6TL 2GAZA 2ESVD 1UXWA 4IJ3B 1D5MB 4LCYB 1TVHA 1OGAB 5HYJB 5CLWA 3I75A 4JO3H 5ID1B 1QR1A 4LPTA 2D0HA 5HGBB 4NSKB 1P69B 3R4DA 4XP4L 3SKUD 8FABB 1YEJH 5FHAL 1DUZA 2OTUB 3VRIA 2FH6A 1DQDH 3QNZB 1RIUH 4PJAA 3WXWH 2J6EH 5DQ9A 3BIKB 5EU7C 1IEAB 4UV7H 3L7FA 1GJIA 1LD9B 1DTUA 4AY0A 3DGCR 2VDML 1LMKA 3ULUH 5KVFL 3HNVH 5E2WH 3OKNB 5EOQL 4BYHA 1T22A 4ACPA 1E6JL 1I8LC 4Q6IC 3SDCC 1CVRA 1NC4D 4NO0D 5KJRH 3UTPD 1Q9OB 2E27H 4UILL 1OTUC 2ERJB 2JB6B 3T0BA 1IKNC 3SKOB 1JYWA 5D1XD 5FYJD 4JY5L 1CBVH 4P2YA 3SGJC 2R0LL 1SMOA 2W9DL 5KSAD 1FIGH 4JRXB 5KN5A 5E6ID 4LEXH 1FIEA 4OF0A 2CJUH 3GI8H 5EG6C 1S7QB 2OYPA 3O3DA 2A77H 3S8WA 1KCVL 1PKOA 4RIRB 2R2BA 4ZAKA 5C6TH 3WNNA 4X6CF 5J9PA 2R0KL 3MRMA 5F7FA 3GKZA 3ARDD 3TBYB 4X7TA 4NUJB 1N2RA 1P4IL 2BMKA 3B9VA 4J3UA 3NIDF 1SEQL 4UBDD 4GT7A 1SEBB 5BV7C 3CFEB 4XP4H 1LDPH 4XT1C 3WIIL 2FSEA 5FHAH 3U7WH 3CPLA 1WBXA 4HMDA 2NW2A 3FQXA 4URTB 3MOAL 3CCHB 4NC1E 1U93B 4TTDC 4HJ0D 2VUOA 4WW1B 2Q76A 5IHBA 3GIVB 3RWCB 2H2PC 5ETUA 3AS3A 4K71B 5KVFH 5IG7A 5EOQH 1W72B 5FA3A 3P11L 2C3GA 5JIHA 4PJ9A 1I1AA 1E6JH 1G9NC 5FOBA 4LVNB 4P57B 2ZOKB 4X7EC 5HHOD 1JGDA 3V4VL 1NGWB 4UILH 4J23A 1RZ8A 3VXUE 4JY5H 3BP5B 2HJKB 5D1ZC 1KCRL 2P5EE 5KSBA 2R0LH 2W9DH 3UPAA 4WTZA 3UDWA 4PGBB 3KVQA 2OL3B 2JIXA 1NFDF 3VXPB 1FZJB 4RGMC 2W59A 5DMYA 1J8KA 1S78D 3HZVB 1KCVH 1ZT4B 3VXQA 1EXUB 5DMKA 3MREA 1TZIA 1HIML 5E03A 4K8RD 3PGCB 4QRSB 3FOLA 1P4IH 4RMQA 1G9MC 3RWIA 2EDTA 3I3DA 4NHUB 1NGQL 1F4HA 1BEYH 4OZIB 5F6HJ 5FB8B 3QUMA 5HJ3B 2IPUK 3JWNC 4EDXB 1G7HB 4D9RE 5I74C 1QEWA 4ISVA 4EQ2A 1R3HA 2BSED 3D18B 5FGCE 2VLJE 3P11H 4JANA 4LHQB 1KTKE 5INCB 2BXZA 5CGYD 1DBBL 5DHVH 4YX2L 5SWZA 1V5JA 2EDEA 5ITBL 1P4BL 2XTJB 3V4VH 3EHBD 4WU5B 3AB0C 4DGVL 1ZLVH 4LHUG 1X5HA 2VLKD 5F7HA 1OGTB 1JPGB 4D2NA 2EKSB 3JV6A 3DJ9A 4WFEE 1KCRH 3VFPB 1GHFL 1WWWX 3CC5A 1WIPA 4Q2ZA 1TXKA 4KUZL 4JPWL 3WO3B 2P43B 4G7YL 1ZGLP 3TO4D 4MHHG 2F58L 2J88L 5DUBB 3GJFH 3MLUL 5ISZB 4LIQL 1KGCD 4XNUL 4XPHL 2QQQA 5BVPL 5IEKA 1W72L 4RNRA 1IAOB 1MELA 5TGBA 3T0ED 1BVLB 4OLEA 2XKNB 1NGQH 1F45A 1ZLWH 4HV8B 2GJ6A 3SKJL 4JDZB 2D31A 1AI1H 5F7UA 1MCNA 4N0CC 3EO9L 4P3DA 1T1YA 3VRLF 3LS4L 2EDKA 2AGJH 3BHBA 2MQ3A 5D5ME 1GXEA 3MXWL 3VFNA 4KUCF 4CAGA 1VESA 1UZ8A 1FZMA 2E6QA 3MODH 2OL3L 3E8UH 1TVBB 3KPPA 4YX2H 1DBBH 1KOAA 4NM4L 1KLUA 5SV3A 5ITBH 1P4BH 2QKIA 1A7QL 1J11A 3QIUD 5EIIB 4DGVH 1J7VR 1EFQA 1XAUA 2B8OT 4BQ9A 1U9KA 5IW6A 1TCMA 2DBLL 5JPNA 1OT1A 1C08A 3RUGA 5A43C 4K3JL 3L9RA 4BFEA 1MLBA 1GHFH 2YBRA 1B0RA 3SDCB 3CSGA 3O6KL 1Y18A 3TCLA 1GSMA 5L8LB 4KUZH 3VMOA 1QFHA 3KYOB 4GQ9L 1EA9C 3BH9B 4WFGD 4TNWF 4WTWA 5GGVL 4CVXB 2J88H 3MLUH 3BH8A 4XNUH 5FYKU 4JY6A 4XPHH 5BVPH 4OI7A 1W72H 4KQ4H 5IBUG 1QQDA 3ABZA 4YDKL 1DN0A 2CLZB 3SKJH 3I02A 1M05A 1T1ZB 1KBGL 2J6EA 4GAGH 2J4WL 1UH4A 4I0PA 1EEZB 3L3GA 2C1OB 3EO9H 4W4OA 2PO6C 2XTLA 3LS4H 3M1BB 4XWGL 3VH8G 4Y4KA 4HZLB 2FIKB 3BRDA 2WWMC 3MXWH 1HCFX 1RJCA 3W5NA 5DWUL 5GSRA 4RGND 3VXSA 2OL3H 5IHLB 4NM4H 2R1WB 3BPNC 3M17B 3STZB 1A8JH 3VXRE 1NDMA 1AHWC 2H26B 4XNZC 3TC9A 1A7QH 3GI9L 3PWPA 4ZO8A 3MJ6A 3ZE2E 4JQVA 2DBLH 1CLOH 4X4YA 4K3JH 1ZLVK 4TPRL 2MJWA 4PJBB 3ZTNL 4GKSA 3CLEL 5DC0A 3O6KH 2X4TA 2ATKB 3NA4A 4W70A 5I66A 4K3HA 4EI6A 4LHUD 1PX4A 3RU8L 4Y5YA 1SJXA 3WS6A 3K46A 3DX6B 5D1ZB 4JRYB 5GGVH 1YMMB 4RMUA 4XI5D 3WNMA 3B8YA 2DYPA 1DE4B 2HTKD 1NBZA 1A1NA 3WDJA 1J18A 4RGMB 1A4KA 2IANA 4LU5L 4YDKH 4LARL 1J86A 1KNOB 1YEIL 1JUFB 5DVOA 5ESVA 3TYFA 1Z0MA 2NXYD 1KBGH 4ZUUA 3LKRB 3NOIA 3ZDXF 2BRRL 3S37X 5HGAB 1H0DA 4RFEA 5F1IA 3UTTA 2NY7L 4RISL 3TVMD 2H8PA 4XWGH 3L6FA 4I1NB 3WSQL 4NKIH 3TPUA 1JYNA 4XHJD 5AD0B 4YO0A 4N5UA 3O8XC 3MRCB 3FFDA 2IFFL 5MEPB 3O6FA 3FB6B 4G8GA 5I8OL 4X9GA 2MCG1 3CX5K 5LXGH 5I74B 3KJ4C 3P0VL 4Y8AA 3GI9H 3LRGA 1HHHB 3HFML 4Z7UA 1S5HA 4JFXA 5CZXC 4M7ZC 5CKAA 3CLEH 3QI9A 3P9MB 1PFCA 3C6LA 4LMQE 1MCEA 2P5WB 1JPFA 4PJFA 3AB0B 2K7PA 3RU8H 4YHNA 3MMEA 3GRWL 4KVNL 4GH7B 4N0FB 4PRBA 4RZCA 3V0WL 4LQFL 2X09A 1AGFA 4G9FE 3X14A 4EKXA 1C1EL 3IJHB 1KXTB 4U1LB 4U1KB 1AO7B 4WWKD 3KPLB 3MXVL 4LARH 4ODBD 1YEIH 3GNMH 4TUJB 5DQJB 4EIZC 3MA7A 4H0IA 1BFSA 4OCXL 2BRRH 1P1ZA 3WMSA 4PTTA 3GMLB 3FRUA 2NY7H 4RISH 3RNQA 4R4BA 1SJHA 3TH2T 1MCFA 2XG5A 1G9NL 3WSQH 3TA3C 1U8QB 4MNQB 4BH8B 2HFGL 5DHVA 2IFFH 3IU4L 5I8OH 2UY6A 4BZ1L 2WV3A 3L5HA 4NHCL 2IQAA 5DO2D 3QHFL 3P0VH 5DK0A 4OD3H 4NT6B 2AKRB 1HKLL 3HFMH 4I0CC 1UZ6F 2E7LA 3HE6C 4LCYA 5HYJA 5KS9E 1LEGA 4KGJA 1MFBL 5ID1A 1CFQB 5HGBA 3FQWA 5FYKE 4Y4FC 5EA0L 1O7SA 3LEXA 1RIHL 3Q6FB 4NKMB 1RZ7H 3KPNB 4Q9CA 4S1RH 4L3EA 5B4MC 5HPMB 1WZMA 3GRWH 4KVNH 4JFQA 3GJFA 3SGDI 1LD9A 1QRNB 1WBZA 3FO2A 3V0WH 1G9ML 4KKNA 1A6AA 2ED7A 2Z9TA 3ARWA 2E7HA 5I16B 5D7LB 3QR2A 1C1EH 3OKNA 3MJ8B 4PJHF 1SYSB 5CP3H 2I5YL 1T1XA 3MXVH 4ELME 1KXQE 3DYOA 2AJUL 4YXLH 1KV3A 5DJXB 4MB5A 5TF1L 1SJVA 4OCXH 2JJUA 2JB6A 1UKQA 1Q9WB 1MIEL 4XAKE 3S5LA 3V6OC 4KXZH 1YZZA 4M7LL 5I71C 4IIQC 3TN0D 5I1HL 1G9NH 5F9JB 3PL6C 1FVDA 3NA9L 4QHUB 2HFGH 3HS0B 4OZFG 3CFBA 5E00B 3IU4H 3L3KA 4XVUC 1PKQE 2PO6B 4BZ1H 4PGDA 4NHCH 4MDIB 3L3JA 5LBSH 3FQRA 3FAWA 3FT3B 1HKLH 5FO9A 1NGZB 1OP3H 3AS0A 4HFUL 2L7UA 5H2BA 3G6JF 1KJVB 4JFFB 1MFBH 2GUOB 4NO5B 3BPNB 1JK8B 1MFEL 2MNUA 2X4PB 4QWWC 5EA0H 1AHWB 4XNZB 3QNXA 5C07B 1TZGL 1RIHH 3O81A 1F4YH 4IEFB 1U3ZA 1P53A 4X9BA 5BXFA 5CHNA 1SY6A 3QIBD 4G6ML 5AAMA 1TFHA 2BP3A 3B9KD 3GIVA 4JM4L 5DUPL 2W38A 3RWCA 3T4YB 4YJZL 1R5IA 2C1PA 2BVOA 4KI1A 4BH7B 2I5YH 2R9HC 3DUSB 4OGZA 1B0GA 4P57A 1B4JL 2AJUH 1G0YR 3CH8A 2VE6B 3VXTB 5TF1H 1MIEH 3F7RA 4G42A 4X4XA 1QSEE 3L7EB 4M7LH 1XF5A 5E4IA 2W0FB 3JZ7A 4NFBA 5I1HH 3VU2A 5J56B 1MFCL 5I8EA 4JKWA 1XIWC 3NA9H 1WTLA 1OF2B 2PCPB 2WP3O 4QOKE 5DD5L 4J3XA 1CXEA 1UADC 3DTXA 4Z7VA 5GZOC 5LWYL 3CX5J 1ZT4A 4QHLB 3QG6B 5JHLL 1N0LA 1OLLA 1JTOA 2W65A 4X6DA 2GK2A 3O8XB 4JFDA 4Z7OE 4PJAF 4KVCL 1NEZG 5ESAA 2YPLE 1MFEH 2R23A 3KJ4B 3BJLA 1D6VL 1XGPB 4ORGB 1G0DA 5J1TC 4OF7A 1TZGH 5FOJA 5A2FA 1CVSC 3CUPB 5DI8B 5HJ3A 1NGPL 4J4PA 2R2EB 4G6MH 4M7ZB 1QFWL 3OX8A 4OLVL 3IXAA 2IPUG 4JM4H 5DUPH 3D18A 4XWOD 3QDGE 5IMOB 4GUPA 5KVEL 1B4JH 2YOCA 4LLYB 3E1F1 3F5WA 2R69L 3BPLC 1OGTA 4FP8L 4D0CA 2IAMD 2ITCA 1Y6KR 2BNUB 1MFCH 4G6JL 5GRVL 2ADIA 2HG5B 5DD5H 3TBVB 4LEOA 2A74B 4M1CD 5LWYH 1WZLA 1DQJB 5GS0C 4S1SL 4F8TA 3QIWA 1K3ZA 1IAMA 4YPJA 5ISZA 3TA3B 3DVGA 3SE9L 1MIML 2D7NA 2P44B 1OP3K 4ALAL 2G60L 4KVCH 3A0OA 1BFOA 3UYPA 1ROWA 1ZV5A 1MY7A 1FO0A 2Y4SA 1CE6B 1NBYA 2CXKA 1D6VH 4IMKA 5F88B 4X0KB 4NUGH 1XR9B 4RQQB 4CN6A 3HE6B 2DIBA 1QFWH 4PG2C 4OLVH 3D39A 1CL7L 1RPQA 3C2SA 2JJVA 3QJHB 4WUUA 4HJGA 5HHQA 4J1UA 4Y4FB 1ZT7B 4X4ME 5GGUB 2FD6L 1KCLA 1R3JB 4OF5A 2Z92A 2OX5A 3A6CL 3EFFA 5KVEH 1J0ZA 2NY4D 1IGJB 1PZ5B 5HI3D 1CDGA 4NZDA 2A6JB 4M7KL 3NZ8A 1BX2B 4GOSA 3D6GA 3T1FB 4X9HA 3NIGF 5D7JC 4ODSH 2R69H 4WJ5B 4FP8H 3ARBD 5I17B 1I8LA 3BD5A 5JZ7C 3BD3A 3RGVD 3DURA 4X6CE 4G6JH 5BS0B 1KB9K 1FFNB 5DTFB 1NGXA 3MV8D 1KLFA 1BD2A 4MD0A 5FUCE 4FMFA 3F7QA 1XZ0B 5FKAA 3MRRB 2XICA 1XF2B 2QJDA 3ZHDA 3IKCA 5I71B 5KVGH 4IIQB 1U8LB 2A0LC 3PL6B 3V9FA 2EDBA 5T1DL 3SE9H 4ALAH 3H9SE 1ZLSL 3DV4B 1TJIL 1I75A 1KJ2B 2W9EL 1JRHI 2R2HB 2G60H 2Z31A 1J8HE 3RAJH 2CKBB 4FXLA 3MCKB 4JN2A 4C83B 2BHZA 4MSWB 1EEZA 1U3JA 3LKOB 4PLNC 4KGLA 1CL7H 1NGYB 4HXBL 4HZLA 1JF1B 2FIKA 2P8LB 3KPQA 4OIIL 5CEYA 4ZFGL 3OZ9L 2EXWC 5JW5A 3OKMA 4ESKA 3IS0X 5CP3A 1D5ZB 2Y1VA 4EQ3A 2R1WA 4M6NL 3QH3A 3M17A 3QDJD 3W0WD 4PRID 4HK3J 2H26A 3VE0A 4M7KH 4NOFA 3BSZL 4AIOA 1NFDE 5GRZA 3RL2B 3QZWG 1UM4H 3PV6A 4Y4HD 2QQNL 5ESQB 2P24B 4BQ6A 1TTGA 2ATKA 2HLFC 1LO0L 5KANG 1VPOL 2KL6A 3HB3C 2NR6C 4F9LC 3O4LD 1YN7A 3R0NA 4QRPB 1C12A 2EC9T 3H9YA 3F7VA 3P73A 4MLSA 5H35A 5BRZB 4PGEA 2OQJB 3RFZC 4KZEL 5HYSB 4OGAC 2V9RA 5T1DH 1K85A 4KJYA 5B3JF 1ZLSH 9CGTA 1TJIH 4LSRL 2X4QB 3P30H 3F7YB 5C08E 1MJUL 5C70A 3RX5A 1X4XA 3STLB 1UA6L 3P77B 4HX1A 1XF3A 1J05B 3HPLB 5DC4B 5EBMB 3LKRA 4QY8B 3X17A 5HGAA 4XNYL 4XXDB 3SGKC 4D3CL 3GMMB 1S5IL 4OIIH 4ZFGH 3OZ9H 5D72L 4NRXB 5MHSE 5HY9B 3MRCA 1IEBA 3RUGF 5MEPA 4O02L 4M6NH 5EC1B 4PB0L 3BVNA 4NPYA 3U2SB 1BWWA 3QDMB 1CGXA 3BSZH 3D3VB 4HS6A 5BVJA 3TO2A 4PJ7A 4YR6B 1DBJL 2QQNH 3H7BA 1LO0H 2CKBL 3BGAA 2P5WA 5GRVK 2R1YA 5LAXB 4HKXA 2BHYA 5F1SA 3BPLB 3FZUC 1LP9B 3PGFL 2Y23A 1T1WB 3U0WL 3DMMC 4WFFD 1HXMA 3PDDA 3RIAK 4LSRH 1IQWL 4U6YB 1QSFE 2VH5L 4UUJB 4JM2A 3SCMD 3VRLE 1S9XB 1MJUH 1IARB 1UA6H 4KMTL 2D03L 4S2SA 4X99B 3ULUF 2DTSA 4JFEB 1F97A 3C08L 2FJGB 2EZ0C 5I1KL 4PJDA 4YDJA 4XNYH 2FZ3B 1I8KB 4D3CH 3PHQB 5F7WC 4P5TC 4HWEL 1OAXL 2KPNA 2F53B 2F54E 3D9AL 5D72H 4F7PA 4CVUA 1MRFL 1AD0B 3VGFA 4O02H 4PB0H 1E4WL 2V2WA 2BNQE 1VA9A 1T83A 1U3HD 4NT6A 2AKRA 2FL5A 3NFNA 5HI4D 1HHIA 2QSTA 4AM0A 3FN0L 5DA0B 4YFDB 4KJWD 2DWEA 1CFQA 3X13A 5I30L 1WT5C 4K7PL 5HD8C 2CKBH 1KB9J 3ULSA 3GSQB 3G5XA 2NY3C 2J5LC 4OD2A 5D7JB 3QUZC 1YQVL 3DVFA 3FFCA 5F71A 2VLKE 3PGFH 2NPLX 4XB7A 5IJKC 2MWCA 3MUHL 3HC0A 3U0WH 1K4DB 2YSSB 3BUTA 3BQUC 5D7LA 1OGAD 1XGTB 1IQWH 3ETBF 2VH5H 4F8QA 2H9GB 5FM5M 3ZKMC 5DUML 5T1KB 1P9MC 2D03H 5IR1B 1S7UB 1OW0C 3JSSA 4P2QB 3C08H 1KELH 3MLZL 5I1KH 1H8OA 4BK4A 2F15A 2ZKHL 2WWKT 3EOYG 3RA7L 1JPSL 1OAXH 3VDAA 3D25B 2BNRE 3D9AH 4M5YL 3VDBA 1P7KB 4XTRD 1MRFH 1NBQA 3MV7A 3ZYZA 1INQB 5E00A 4E42A 1EEYB 3KXFE 3KDMB 4HGWA 1E4WH 3CXDH 1S3KL 2P4AB 5C09B 3MRIB 5FHBH 3WFBL 1NGZA 4PJFF 3FQNB 3DI2B 3FN0H 1BIIA 2EDXA 4BKLB 4MLIA 5MEQB 3IJYA 1WWBX 4P2OD 5I30H 1JK8A 4PJCB 4Y5VA 1AHWA 4JRXD 4K7PH 4UNTA 1S7VB 1T7YA 5GS0L 2BOBB 3DVNB 2OM5A 4X9FA 3SDXE 1U8MA 5DJ0B 1YQVH 4KI5D 2O5YL 1E0OB 3PWJB 2MQ0A 3G5VB 3RWFB 4NQCB 2E3VA 3BO8A 3UTQB 4QCIA 5ICXB 1RIVL 2GJJA 3LKPA 5I1LB 2UZXB 5C9JB 1QLRB 2AP2A 4BH7A 3KPSB 5DUMH 5DJ6A 1QUNA 3WBDA 4F57L 5E24E 3GB7B 2C9AA 4UQ3A 4L9LA 4R90L 4C4KO 4R7DB 1HSBB 4OLXL 4Z77B 1JTTA 2ZKHH 4O51B 3CXHK 4WUKL 5K9QG 3RA7H 1ZHKB 2E9BA 1JPSH 5AZEL 4M5YH 1A6ZB 1IM9D 1OF2A 1GOGA 4U1HB 1VFAA 1Q8MA 2ICWA 1XCQA 1U8HA 5L2KB 3OJ2C 2HT2C 5I15L 1S3KH 3QG6A 4PGCB 4WI9A 2EYSA 4C57C 4PJXB 3LQAC 4PYHA 1AKJA 4MD5A 5FF6B 3KAAA 2VR5A 4WGVB 5IVZB 3VD5A 1A6TB 1TVDA 3IDNA 3AS1A 1P6FA 1XGPA 4ORGA 2X1PA 5GS0H 3BISA 3P4OB 4ZYKA 3CUPA 3L3OB 2O5YH 2R2EA 2L4OA 2MPAH 4MJ5B 3S36L 3D5OF 2VWEE 4XMLL 1RIVH 1N7MH 3QFJB 3GSUB 4P0DA 5ICYB 5IB3A 1SVZA 1REIA 3DX9B 4F57H 3MGOA 3IDMB 1FZKA 1R0AL 3B2UD 3G04B 1E28A 3ARQA 3CDGB 4R90H 4Z7WA 3DMMB 1FNLA 3QEQD 4HAGA 5KOMC 5I1JH 2YK1L 5H37H 1X9QA 1CFNB 1FPTL 4WUKH 3D2UB 3WFZA 3T2NH 4LGRB 1JZ5A 5D6DA 5T3XE 4ZFZA 5AZEH 3SKMA 4P2RD 3DV6B 3C5JB 2A1WH 5IVXB 1UZ6E 3EDKA 1A9EB 4J6RL 5KG9A 1V05A 5LJYH 3F12A 1Z9SA 5EU4B 2A74A 2XTJD 5I15H 2JCCB 1DQJA 2PKDA 4P5TB 4QEGA 1LK3L 4HMEA 2YA1A 5C0AA 2NX5E 4NGHL 5SWSD 2X4SA 2KH2B 4MA3B 3EJZD 2FJHB 3ALXA 1G7QB 4CNIB 4DZBB 1CZ8L 3U9PH 5IIEB 2H2SC 2ZCLL 2B4CC 4PJHE 3T0DA 3HE6A 4D9QE 3B9AA 4ETQA 1BECA 4S1QL 4PJIA 3S36H 5F7NC 3L5IA 1T4KB 5JUEL 4XMLH 1ORQB 3QHZL 1XR8B 1BREA 2J5LB 2NY3B 4HH9A 4MZ3A 1VKXB 3GMPA 1ED3B 3BZ4B 3QUZB 4XMKL 2I9LB 2PNDA 3QUYA 5E9DB 1U3YA 4WI2A 3WIHL 4PRNB 1LVEA 2CUIA 1CGVA 5B21A 4JJHA 4H0GA 1HHKA 3MRPA 4L4VE 4CN4A 2YK1H 4O4YL 3LHPL 1FPTH 4GMTL 5DR5L 3DXAB 4Z7VF 1LILA 1WITA 3EYQC 3T09A 4XCCL 4YR6A 4IRJD 3BD4A 4MA7L 5DTFA 2VDOL 4X6DF 4F15C 3G6JE 3QO1A 4CMHC 1ZWIA 3SJVB 5JQHC 2OMBA 1LK3H 3O3UN 1U8LA 3RNKB 5D2NA 1VADA 2ENSA 2XN9B 4NGHH 2R2HA 2XNAB 1LEKB 2JK5A 5C0BD 3SDCD 1WICA 4MAUL 5J11C 1RFDL 4JHAH 1CZ8H 4EI5C 1F2XK 3MCKA 1OTUD 1U8IB 3IU3A 3U82B 3IGAA 1CK0L 1BVKA 1I8IB 4X6BB 3LKOA 4S1QH 1I8MA 4TYUA 4F37K 3U6RA 5JUEH 3QHZH 3WLBA 3N50A 5TF0A 5GGSY 2COQA 2P7TB 3UJIL 4ZDHB 5DEGA 3BYTA 4XMKH 32C2A 4X7SL 1BJ1J 2BERA 2R39A 3WIHH 4HC1A 4NNXB 5IOPB 2Y5TB 4YIQA 3HN3A 4O4YH 1KCUL 3LHPH 3MNWB 2J1KA 3QNYB 1QD0A 1KIQB 3CXHJ 4GMTH 5ESQA 3TT3L 1BBDL 4K94C 1CF8L 4UDTB 1NCNA 4XCCH 3LKNB 4MA7H 4WO4C 4OZGB 5I75B 2VDOH 4HS3A 1NFIB 4PJEB 3HMXH 4PJAE 4QHNB 4P5MA 3LSOB 1JI2A 1JHTB 3DIFB 4TTDD 3NCFB 2H6PA 2H2PD 1Z3GL 2YD2A 4WIQA 5FDWB 1II4E 2UZIH 4M6ML 4JEGB 5CD3B 2HMIC 5TQ2L 3S98A 5I2IB 1VACA 5TFSL 2J8UA 2IBZY 5IROA 3OGCB 5I1EL 1S7WA 4MAUH 4XP5L 1RFDH 2AJ3B 5SX5H 2V2TB 5TDOA 1J05A 1B90A 2X7LA 5BOZG 3VCLB 2IADA 1LE5A 1CK0H 5D1ZD 1YMMD 4XCYA 3GMMA 2CR6A 2MHAB 1U42A 4DVBB 3AMKA 4NRXA 5DMGC 1CIDA 3UJIH 5EUOA 1LWRA 5DFVC 5EU6A 5HY9A 2NY0C 1QSVA 1NC2B 4X7SH 5EC1A 3FTGA 4JFHE 2ICCA 1RJYA 4PLKD 4BZYA 2BY3A 3QSKB 3QDMA 2UZYB 4JFYB 4FZ8L 3D87B 1BFVH 1G1CA 1KCUH 4FQCL 2LFGA 3TT3H 1BBDH 3W82A 5JO5A 1K3IA 1CF8H 2Z8VC 5MENA 4ZOAA 2FX7H 2GSGA 4B53A 5LAXA 2Y7QA 2VABB 2PYFB 2Y6SC 4OCSL 5CBAA 1N3NB 4TSCL 1TTUA 1PEZA 1FL6A 2WQ8A 2E6PA 4RRPG 1Z3GH 4WFHE 4XBGA 5BZDB 1CQKA 4YK4C 4CW1A 2VXTL 3CZJA 5TQ2H 4MDJB 5TFSH 1LEIB 2UUDH 5GJTL 5K9KB 3FRPG 5I1EH 4PBVC 5I1IL 3OV6A 5BZWB 4X99A 3EFDL 4HHAB 3UBXB 3LV3B 2FECI 5DSCA 4F58L 3RHWK 4Y2DB 1CYGA 3VFUB 2B0SL 1IBGH 4JO1L 4EXPX 5F1NB 5KSBE 1U8NA 3PHQA 4ONHB 1I3RA 3TJHC 1I7TB 2F53A 5SWQA 1BBJA 2XFXB 5EBGA 3NIGE 2WBJC 1AO7D 1X6LA 3O0RL 4TNVK 1AD0A 4GXUN 2DOCA 2JJTC 4PJBF 3MBEA 1AIFB 4GAYB 3DETC 4AT6A 1UQSB 4OFPA 4FZ8H 4KRLB 4S0TD 3WNPA 4MVBC 5IB1A 4OBSA 4JHWL 1YPZB 1N0XH 1CL7I 4MNQD 4TRPL 4ZNEA 3KPRB 4DKAA 2E9IA 4LHJB 4TSCH 1G9EA 3LQAL 4F7TB 2ICWI 3P4MB 2WINA 4R2GC 1UG9A 1MSPA 4HPOL 2V5MA 3UX9B 1RJZB 2VXTH 4FFYL 5I19L 2VDNL 1R24B 4F15B 5GJTH 3AC0A 5SWZE 3MRGB 3O3EB 3T04D 5T1KA 4CMHB 5I1IH 4ODXA 1F90L 3OAUH 3EFDH 1R5VA 1UJ3A 3MV9A 5SX5K 4F58H 3IFNL 4C56B 3OKEB 1V3KA 5BCAA 1GZPB 3EYSL 1ZVSA 5JW4R 1ONQB 4JCLA 3D25A 5J11B 2YD6A 5T1MB 1OT2A 1GIGL 1T6WA 3O0RH 4BSVA 1IQDA 3T1WA 1CU4L 3LB6D 1INQA 1ITCA 2VO5A 3HZKB 4NQEB 3QEGL 1EEYA 4PJ7F 1ZKAA 3VFSB 2EDYA 2ZG3A 2AJZB 3HG1D 4EBQL 3KWWA 1EGJA 1FQ9C 4IOSD 4HEME 2Z93B 1QO3B 5BJTA 1JNHA 4JHWH 1MJ8L 2DAVA 4FQXA 2EIDA 2OR8A 5F96L 3I50L 4TRPH 4KJPC 5B3JE 1FC1A 4NO3A 3O2DL 5CS7A 1ACZA 2PO6D 3LQAH 5DURD 3RJDA 1ZSDB 4N1CA 3PWJA 1BZ7B 2DL2A 3BXNA 3G5VA 3S35L 2DB8A 5IESL 3VXMB 4HPOH 5T1LA 4EJ1C 2BXYA 3CU7A 1V3MA 4WO4B 4IHOA 5I1LA 1MUJB 1AGCA 2VDNH 4PJDF 4JFFD 3MV8E 4EOWL 3QUXC 2UUDK 1S7SA 2B4CL 1H15B 5J89A 3T0XA 2IMNA 1F90H 3RJQB 1FLTX 1MHHB 2RR3A 2IALA 2GW5A 3IFNH 4I9WE 4TSAL 3TEUA 3V0VB 4APQC 5CIPA 1HSBA 3RUGE 3HE7A 5IBTL 3T8XA 4XNQB 3EYSH 2X4UB 1ZHKA 2EDHA 1ZMYA 3IVKA 1B6UA 1MJ7L 1GIGH 1T6VN 5L2KA 3AM8C 3FB7A 3UYRL 1FN4B 3QEGH 3S3SA 2X9YA 4HUMB 5CSZA 4EBQH 4LAQL 5C0GB 5D2LB 4Z5RA 1HXYB 4G6AD 5EU3B 3RWJA 43CAB 3TNNA 4MXQC 3TBSB 1MJ8H 2NY0B 3GSVA 4OBRA 5F96H 4LRIA 1WC7B 3I50H 4UI2A 4WU7A 1TMCB 2OZ4L 3ESVF 2VRAA 2PXYA 3HMXA 3KJ6L 1NJ9A 3O2DH 1E4JA 4HJJL 5B39A 1R6VA 3SDAC 3S35H 4MJ5A 4F7CA 5IESH 3ULUE 2PYEB 3C2AL 3BIBX 3O8XD 4AMKH 3GSUA 1A1OB 3VXSE 5ICYA 1GGBL 3T3ME 2B4CH 1WF5A 3H7LA 4LAJH 3SGEI 1A1MA 3IDMA 4I48B 3PWPE 5DMIL 3GEWB 2G2RB 3DVIA 4I3SL 5CZXD 4UT7L 4TSAH 4ZOCA 4YK4B 5IM7B 3GGWA 1YDPB 5IBTH 3R8QA 3T77A 4V2CB 1MJ7H 1F42A 3VGBA 4EZMA 5IVXA 1FL3B 3U1SL 4JZOA 4RAVB 4X5XB 3WE6A 3UYRH 3GMNA 4FTVA 4X6FB 5HGGS 2XZZA 2W1NA 5GZNC 3JVGC 3LKQA 4LAQH 2FHBA 4K94L 2WBJB 4Y1AB 2YN3A 2RBLA 4N8VA 4MA3A 3QEHA 5IFJB 2IANE 2I9TA 2FJHA 15C8H 3OXSA 5GS2H 3X3GL 5HYSG 4RMTA 5J0BA 3KJ6H 3O11B 5IIEA 5EDXA 4HJJH 3UTTE 2XT1B 1IGTB 1O7VA 1X7QB 3R06B 5F9DC 4UB0L 3TA3D 1I1CA 4F9PA 5M7QA 5DJZB 3C2AH 4OLUL 3TNMB 4KQ3L 3C5ZB 1VKXA 4G8GE 1ED3A 1GGBH 4WY7L 3BKJL 3K4ZA 4R2GB 4PJ5D 2MFNA 5DMIH 4I3SH 4UT7H 1IKFH 4DGYL 3AXLB 3V7AG 1NCWL 4ZS6C 3DXAA 5CP7B 4H1LA 5HBBA 3G6AB 2LU3A 4C4KT 3B6SB 4QXTB 1MVUA 1D6EA 4PJFE 5FKPA 5H8DA 4X5LA 3U1SH 5LKNA 1FJ1A 3WLWC 3K4AA 2FEDC 5B4MD 1QFWM 5FA4A 3SDDC 2C4FU 3V5KA 4JJ5A 4GXUM 2NXZD 2C3XA 3G5ZA 4D8PB 1OTSD 1GOFA 1D5BB 3QA3B 4K94H 5F3BA 4NFCA 1IC5L 5HI5C 2Y25A 3IAQA 2HYMA 4UIKH 1CT8B 1YEDB 2VZOA 1LEKA 3G08B 4ZUSA 3VXUA 5BS0D 1OTTC 5DHYA 1AC0A 3VWJA 5I8CB 4X4ZA 5CBEB 2GITB 3N1GC 4JQXA 3UTSA 1VEOA 3BGFC 4Z8FL 3PL6D 4UB0H 5DK2A 5HYQB 4RMWA 1CLYL 1FSKC 4OLUH 4KQ3H 4HKJB 4ZDHA 4XVUD 1INDL 4GW4B 4WY7H 3BKJH 3V5DA 4PD4K 1EV2E 4BFBD 1H3WM 1KTRL 3MNZB 1U8PB 3CDFA 4YFLI 4DGYH 1YNLL 4HCRA 5HYJE 3QUXB 3MNWA 1NCWH 3CH1A 4QWWD 5JW3L 4CJ0A 5GS1C 2VL5B 4NO2B 4UDTA 3HCVB 2GQHA 3WHXB 2DQFA 5H37G 1CG9B 2IG2L 3NCMA 3S4SA 1WLHA 5IB4A 3DIFA 4H25B 4LSPL 4LLWB 2W0LA 1DQQA 3ARFA 4OIAA 2HLAA 3PDOB 1ZA6B 3DX8A 4Q9BA 3WJLC 1IC5H 5LVEA 2XY1A 2R9HD 4PJIF 2FNBA 1U8JB 1X4ZA 1TDQA 2AJ3A 3RZCA 2VXUH 4QRPD 4P46A 4KZDL 1GGCL 4LKXB 1A7BA 3U4AA 4GLRI 4FQPA 1WFNA 4NRZB 4Z8FH 2X70A 5E94A 5KZCB 4YC2C 5I1GL 1XIWD 2YHGA 4AIZA 5JXEC 4YXHH 2VZVA 3D0VA 1INDH 3MRHB 5EN2A 5B38A 5CEXA 4DN4H 5GZOD 4YEFA 4L8DA 2XWTA 4JFYA 2E9JA 1YNLH 3V7MA 3KR3L 2LABA 3LPGA 4HBCL 1Q9LB 4P5KA 3U36A 4PREA 5JMRA 3GHBL 5JW3H 4WV1C 4GW5B 1EK3A 3UROR 2AQ3A 4CU8A 3ROOA 5IW1B 2IG2H 2PYFA 3U4EA 4WHCA 1I7RA 1N3NA 3SPVB 3HA0A 2UYLB 4HIIA 4LSPH