4OTXL

Structure of the anti-francisella tularensis o-antigen antibody n203 fab fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
211
Chain Sequence
QIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEAPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N203 light chain
publication title Functional and Structural Characterization of Francisella tularensis O-Antigen Antibodies at the Low End of Antigen Reactivity.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 211
sequence length 218
chains with identical sequence M
ec nomenclature
pdb deposition date 2014-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4otxL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4otxL01
2RGSA 1J05B 3GI9H 1OARL 4J3WA 4L4VD 4XZUB 2JLLA 1YEHH 1NGWB 4OZGA 3H3BC 4RAHA 4XPTH 5C0DB 1OGTA 5GGSY 4F2MB 5FM5M 3VCLB 3MLWL 2P1YA 3KYMA 4BUHA 2YD1A 5BW7C 4M5YH 3LV3A 5CD3B 4X0KB 5DS8B 2ORBL 5IJKC 2HFFA 4JKLA 4FQLH 2DBLL 1JWUB 3ZKMD 5GXBB 3GNML 3HLAA 2FBJL 4IIQB 3T0AA 4JQIH 3QDGB 5FYJU 3VGEA 2JE8A 1S7XB 5D1QC 4F7TA 1BGXL 5AG8A 4PJAF 4OZHB 1MVFA 2Z91B 1F97A 4NQCA 5D70L 4I0PB 5DEFB 3B9KA 1MCOL 1EFXB 1JTPA 2D31B 3OWEA 2YPLB 3BHBB 1G7QB 1N7MH 1ZT4A 4PGZA 2NNAA 3UTQA 5GS0C 5KVMC 4ODXA 5KOMC 3UPRA 1DBJH 4X4MA 1U8KA 3IDMB 2E27H 5E5RB 1ZXQA 1CLCA 3IFNH 2Y7QB 1BF8A 4F15B 3MREB 5SX5H 4X9GA 1KTDA 1U8HB 4OKDA 4JKKA 4HEPG 1B6UA 3UAJD 4R8WH 4I3RH 1E4WH 4PRHA 1U95B 4WI2A 2A2QT 4F9LA 1GGBL 3HZKB 3G5XB 3IGAB 4P23B 3GKWL 3V5DB 5BOZG 4GKSA 2RQ8A 3Q5OA 1R3JB 1ZHNA 3MTRA 5HI3D 5FKAA 2V7HA 4XPAH 1R5WB 4X6CE 1NLDL 3Q1SH 4TTDD 4V1DA 4F7EA 4HWNA 4RAVA 2AI0H 1P53A 1HXMB 2A38A 4Q9BA 2B1HL 3KG5A 5I1JL 4N8CH 3QRGL 4U0QB 4WHTA 4WUKL 5E1AA 1NMAL 5BS0D 3P4OA 4CJ1A 3TT1H 3TBYB 2YUXA 3DX8A 3MLUL 3S6CA 2DDQH 3I50L 5AD0A 1MFEL 5CCKH 3RKDC 2IPKA 3IETA 4K7PL 4KDTA 1RZ7L 4JFDB 5LXGH 1L0QA 2ZCHH 3BPCA 4JB9H 2R1WA 4D0DB 1YZZA 1NSNL 2R0ZL 2YBRA 4NCC2 4Y19D 3DX7B 3OXSA 3QFJE 3TJEH 5DD5H 3VFRA 3O2DA 4ZAKA 5JXEC 4JANA 2AJXH 4U1GB 3M1BA 1MREH 4DKFH 1P69B 3QI9B 4M6MH 1RUMH 2A9ML 1QSED 3CLFH 2HFEA 1NJ9B 5JXAL 4LCUB 4JE4B 3UTZA 1BPVA 4FQPA 4NPYB 5C71A 2F8VA 4XNZC 1WISA 2AJUL 1A7QH 1ZA3A 4CL7A 1AY1H 5D2LA 4ZS7H 2AQ3A 3W0WD 5J11C 3QDMB 2FX9H 1W72L 2J1KA 1X9QA 4PP1C 2AJSH 3OKEB 4DQOL 5F6HI 5F8QC 5EBWB 5JOFB 3MGOB 4K9EC 4QXTA 4KQ3L 3ZT6A 4WO4D 3STBA 4X6CB 4YNYA 1CDJA 3AROA 4ODTL 4JR9H 2Z35A 3HR5B 1J87A 3MLPA 1F6AA 4MWFA 2X9YA 3BVNB 1KXTB 3D9AH 2W91A 3MFFA 3X13B 1EZVY 2NLJA 4MNQE 3IXTA 1H9VA 4XCFL 2KZ1B 4UU9B 3VD3A 2PCPB 1NBYB 3EOBA 3OKOA 5T3XL 4G43B 1XGUB 1IZJA 1NGPH 2E7MA 1FYTE 5SWQA 1TTGA 2D3VA 4K7PY 4KQ4L 1IAIH 1SY6A 1NC2B 1UA6H 1VDGA 2ZUWA 3KNBB 5KTEL 5DJCA 5BXFB 3CSGA 3LKNA 3HE7D 3DETD 2RCSL 4X8JA 1ETZB 4QRRE 4TNWF 4L9LA 5K9KB 3QFJB 4L3EE 2QKIB 5E08L 3U7WL 1INDH 3ULUL 3DMMD 4YBHA 1BZ9B 4OB5L 3LSOB 3U9UA 1AO7D 2CIIA 3G6DL 4UIMB 4R3SA 1UWEL 1RZIA 5CP3A 1TDQA 2F54E 5EUOF 3ESUF 1UT9A 2ITCA 1CGYA 1FIGL 1VENA 5E8NA 5TH2B 4DK3A 3VA2C 2WK2A 1F00I 4KFZC 5DJ0B 1T03H 5EOCL 2IPTL 1B9ZA 3IJYA 3LKPA 2PO6A 3TM6A 1BLNA 3MJ7A 3CZJA 4M1CC 3F58H 3FMGL 6CGTA 1NAMA 2EDRA 2YA2A 2LU4A 2EXWD 5GGQL 3BPLB 4KGJA 2H3NB 4W70A 4DEPB 5EZIH 2P8LB 3PWPD 4U2ZA 4G5ZH 5L0QC 5D7JC 5E6IA 3SDCA 1I8LC 1KN2L 1XF3A 3CDFA 5FM4A 5HDQH 1FYTB 3V6OE 4QRSA 2G75A 3L3IB 1GGIH 1WIUA 2R0KH 2OQJA 4NZUL 2VTFA 1N4XL 1ES0B 5C0NC 4N90D 2FEDC 5TDOB 4ZFZB 4UQ2B 3GMMB 4JG0L 1FVDA 1MAKA 4MJIB 2QR0B 2FHCA 1IARB 4JRYE 3UC0H 3GMOB 1L6ZA 2DJ4A 3O6KH 3GRWA 3HI6H 1OTSC 3VWJA 4JM2D 5DQDH 2DWEB 1FNEB 3TBWB 3DJ9A 2F54B 3ARQA 5I1DA 1KB9J 1FO0H 2OR9L 4Y16D 1NPUA 4M7KH 2R9HD 5SWSD 1IKFH 1FZMB 3KPQB 2NXZD 4GMSH 2M8XA 4LHUB 1EJOL 3VE0A 1MWAH 3MRKA 5DRXA 3P11H 4LLAA 1T21B 1NCCL 4RWHA 1H3UA 5AEAA 4DGIH 1MHPL 1P4BH 4EZMA 3MXWH 5I8CB 1ZGLB 4YO0A 4HBCL 4RWYL 5I1LB 1AR2A 2B8OT 3GGWA 4YDVB 4QRQA 1JNNH 3KPPB 4YXLL 2YPVH 5IKCA 5IQ7L 2ZOLA 1JYVA 4YHKH 1MCNA 1F45A 1CICA 2CPCA 2GJJA 4JLRB 4XWOD 1V7NL 3V4VH 3V0VB 5C2BH 3PP4L 3QZWB 4WUUA 2B5IB 3TN0D 3WFDH 4GMTH 1LE5A 5HPMB 4K55A 3UBXI 2HKFH 5D5MB 1P7HL 2F9BT 2VISB 3OQ3B 1DQDH 5I19L 3RVTC 1SVZA 4UNUA 5BVJA 1B0RA 1JUFB 1D6EA 3QIWB 4NNXA 1ACZA 4BFGA 4P59H 4N8VG 3RWJA 5GGSA 2BXYA 3OJDB 1DEEB 2H9GB 4RIRA 5EC2A 5MI0B 2XOTA 2D0FA 4DTGH 1VERA 4EIZC 4LPVA 3MRNA 3CFCH 3V8OA 2DQDH 4JRYB 3E1F1 4YUEL 3UDWA 2EEAA 4MJ5A 4MX7B 1ZS8B 1MF2H 1OAYL 1TQCB 2E7HA 3WMSA 4BKLA 4P9HL 2HFTA 1FRGH 3PWVA 2QADD 1AXSA 4QWWC 4OGAD 1DZBA 3IKCB 1IEBA 1FIEA 4M4RA 4U05A 4Q7DA 3ARXA 1LO4H 4P4RA 4NM8L 3ROLB 4QHKJ 4FQ1L 3DSFH 4Y4FB 3HAEH 4CN4A 2ED9A 3TYGL 4BZ2L 1T4KB 3RGVD 1T66D 5H94A 2NZ9D 4N0RA 3HE6C 2VNCA 5IMLB 1DVFA 5F9AC 1J12A 4Y5XA 3PJSA 4CDGC 1MFCH 4FFZL 2GTZA 2NY4C 5CZVL 4LRIC 3WNNA 2VJXA 4R0LC 1S7UA 5D9SB 3T3PE 1NAKH 5ALBH 3T2NL 5LWYL 3O9WD 4WFHE 4ZS6C 4H1LB 3BD3A 3O11A 4MXWH 3QWQB 4TUJA 4B7LA 3N0PB 3OKKA 1FL3B 3AREA 4DGYL 3PDGA 1PQZB 4TVPD 4XMLL 1WZ1L 1BEYH 2GSGB 2OJEA 4L8CA 2CXGA 1T0MB 2EDQA 3CFKA 4X7EC 5E4EC 1UB6A 3CGTA 4ZPTB 4Z0BL 4X7TA 1F3JB 1JVKA 1J86A 2BZDA 1VADB 3GJEB 1VSCA 1MRCL 4Y4KD 3FO2A 1A8JH 4O2EA 1ZTXL 4PJ5A 1WCBA 3VXMD 3J7HA 3T1WA 4G7VL 1T2QH 3JSSA 4U6HB 3VFMB 2E6QA 1MCPL 1BQUA 3LRGA 5JR1L 4X6FB 5C8JA 2QQKL 4UTBH 1M7DA 3PIQA 1TNMA 3S37H 4HUVB 2NY1C 2F74B 1ZSDB 4FNLL 2C4FU 3SGKC 3PL6D 5DRZA 3AVEA 4WFEE 1JZ2A 5I76A 3KWWA 1KCRH 4QOKA 2W9EH 2XG5A 4PJXF 5E4IA 4LOUC 4XNXL 2ZUQB 4ISVA 1MCBA 5I18H 5FECB 3NIDE 3PGFL 1IKNA 3IXAB 3SDXA 4Z8FH 4J2XA 1IQWL 1KIPA 1IC1A 2HMID 5HJ3B 3STLA 2ZUSA 4J4PD 3VXUE 2BK8A 4PGDA 2J5LB 1JF1B 2CSPA 4ONOA 2RB8A 3G9AB 4O2CB 1K5NB 3QUYC 2D0HA 5FO8A 5HVGB 1U36A 2VE6B 3MLXH 4OGZA 1FORH 1MCCA 1CBVH 4MAYD 2J88L 4PJBA 5HD8C 3EOTH 3D2UD 5GGVH 1RVFH 5MEOB 5C0IA 3SE9H 2OXGA 1LO2H 1B0WA 1U8IA 5D7IB 3T0EE 3G5VA 5DEGB 4HJJL 3FT4B 4HUXB 3C8DA 3C8KA 1N6QL 4YWGH 5ETUB 3VMNA 4KJPD 4D0BA 3QIBB 4XVJL 2UVFA 4LLDA 4Y5YB 1V7MH 2XN9D 4HKZB 1HHIB 3RL2B 4JZOA 4NHCH 3F62A 2XRAL 4ODUA 2ZCLH 2HKHH 3QWOB 1EXUA 5KOVC 1T5XA 3WO4B 4P5KA 4PJ9A 1I7RB 3P4NB 1ZVYA 3O2VH 4OIBA 5EU4B 1I1YB 4Y89A 4A6YH 3UZQA 4E5XB 4CMMA 2VXSH 1YN7B 5CILL 4G6FB 4MVBD 3MUJA 5DJ8B 5EOTB 1KCKA 3ABZA 2YOCA 4OCYL 3TBTA 1MHEA 5FO7B 3MRIB 2FH6A 2R2EA 1CE6A 2ADGB 4IRJC 3RFZC 5I0ZA 5FOBB 4UQ3B 4MGXA 3UJIH 2AS5M 3QHTC 3T0BA 1PG7H 1XEDA 5HHVH 1WK0A 4JN2A 2QSQA 1KTLA 2XPGB 3ET9F 4LF3A 2VYRE 3NFPB 5F44A 5L6YL 4OV5A 3VXUB 4G9FA 4KKNA 2JB5H 3RJQB 5T1MB 1XIWB 3C9NB 1HXYA 2P8PA 4G3YL 5F7EL 5E1HB 4X5WB 4XAKD 4XH2B 4PJIA 3BIAX 2YUZA 3C6SB 1W72A 1JZ6A 1KFAH 1WEJL 1RJZB 1A1OB 5B3JF 4P23D 3FTGB 3QJFA 3SO5A 1LO3H 3TH2T 1WBZA 3HMXL 4S10A 5KSUB 3HZVA 2H32H 1QG3A 2FD6H 3NCMA 1YEGL 2FO4A 4U1SB 3I6LE 1YMHB 1HILA 3AUVA 1T0PB 3SDDB 1DBBH 1A9EB 1GJIA 4CVXA 4R7NA 1KGCE 1HOCB 4KVCL 2R29H 4YIQB 4J3TA 5JIHA 2HG5A 2CD0A 3BWUC 3QQ3B 4K07A 4JY5H 5T1LA 1F4XH 1Q9KB 5I2IB 5LGHL 1QSFA 4PJ7E 1SM3H 5IROA 5CJOL 1I1CA 4L1HA 1TZGL 5EU6D 2H1PH 5DFWH 3LEYL 2OTUA 5DMGC 4ELMF 2PNDA 3WSQH 1V3JA 5HHXL 1IC4H 2CGRL 1JHKL 5KVFH 2EE3A 3X3FL 1FJ1B 4LGRB 4K23H 3UZEA 1UB5B 3VFPA 3OSKA 3D1MC 1DSFH 1BWWA 4NO0A 4KK6C 5CMAA 5EU5B 4PD4J 2CK0L 2Q87A 4NBYB 3PXJA 4N0FB 1T0NB 4HKBB 3WKML 3ARGB 2V17L 3MGTB 3VG9C 2NY3B 4KI5C 1ZKAA 5FGBC 5I1GH 5DHVA 4M9PA 2R23A 1DQML 4IRSB 4LDEB 5BV7L 4RGNB 1AFVL 4M8QB 3TO4C 3QDMD 1DUZA 1BBDL 1GSMA 5IJVA 2XI9A 3IRZA 3I3EA 1DBAL 3JTTB 4G6AD 4N5EC 1KNOA 4X4YA 1N3NA 1P2CB 4QLRA 4UBDC 3NZ8B 4P3CL 1NCBL 4BH7B 5E5UB 1T1ZB 2AJ3A 1CIDA 1KPUA 1J1PL 5DK2A 1GGCL 1TCRB 3KLHD 3F7PC 4NQXB 4LKCA 4IS6A 4YPGB 5KSVB 1BD2E 3MRCA 4K3DH 1RJCA 1E28B 1OM3L 3PGDA 4YHNB 5K9OB 1W0YT 4K2UH 5FYKD 4GKOA 1KXQE 4MDIB 1UWGL 5DQJA 1J88A 4PJ7B 5DK0A 1N59A 1JHTB 4J1UB 1RZ8A 3ZHLA 5DJ2B 4UTAH 2YN5A 4XCYB 2UUDK 4DN3L 5K9QI 1N8ZA 3ARSA 3GIVB 3HKFA 2CUIA 1GAFL 2C3WA 3LQZA 2ZG2A 4N8VA 4DVRH 3I3BA 4D94A 2BVYA 1E6JL 2R1XB 2NYYD 3HNSL 1RQ5A 4Z7QE 5AAWA 1A7RL 5KVEH 2Z31C 3UX9B 4NZJA 4OZIA 1U3HA 1JYWA 4WGWB 4QXUH 3WN5C 1LWRA 1QKZL 2P5ED 1K2DB 1CFVH 4DN4H 3RL1A 2ZKHL 3VD5A 3THML 4NKIH 3TIDA 3NCJH 1U3JA 2XG4A 2FJFA 4ZYKB 3QO1B 1U8OB 2ZSVB 4ONFH 4PLKC 4FZ8H 5E5MA 5MERA 5DJYA 4IOIA 3KPLB 2YPKA 4K9EL 1CG9B 4QTHA 4YZFF 3MLYH 1BBJB 2C4XA 4BQ9A 2DL9A 2APBA 4XX1G 1Y6NR 3BO8A 5DR5H 3SJVE 3OPZL 2W0FA 2RHEA 3ZTNL 3WHXB 5E99L 4U3HA 1RUKL 2Y36H 4PJ8A 4JGMA 4HCRA 3PABB 1E4XH 1JV5B 5FCSH 5L7XL 1UCTA 25C8H 4PV8A 2GSIA 2JJUA 4KHXL 1CD9B 2GFBB 2Q7YB 4CMHC 4JJHA 2VDMH 4YH6A 3GHEH 2DS4A 1GXEA 3BAEL 4FN0A 3UTSD 1DN2A 3HHRB 3UTTB 4C54A 4QTIL 3E2HB 5B22A 3RX7A 2DQEL 3LQMA 4UT7H 1FLRL 2LQRA 3NPSC 2BVQA 3F6LA 4MJID 1DLFH 2M1KA 5DD6B 5ICYB 5D1QD 2AVGA 4PRDB 2CRYA 4U6XA 1WT5C 3TFKD 1E27A 3MLVH 1CD1B 2UWEA 3RBSA 4R7DB 5F21B 3FCTB 4KUCF 1V05A 1RIUH 3PDDA 4MJ6A 4LLQA 3KXFE 3N1MC 4I48A 1LEIA 3TWCL 3FB8A 1K6QL 5GS0D 1MFAH 1I9IH 4EJ1C 4KHTH 4XGZA 3MX0A 2VXQH 4NP4L 2VDKH 3QXVA 4K8RL 2I9TA 4PRIE 4HKJA 2WANA 2DMBA 4DCQA 3V5HA 4HZLB 5EO1B 3CFJB 3E6HA 4FQQB 4PJHF 4HX1A 1NGZA 5B8CC 1F02I 1CFSA 3PWNA 3RWDB 1S7VB 4EI5A 4MQTB 3QFDB 2E9IA 2GK0A 1NCAL 5I6XB 4M93B 3BXNB 3RY6A 1QLEH 3OTTA 3SOBL 3HNTL 2Y25A 1TQBB 3WYRA 3EW3B 4KJYB 1G6RH 6FABL 4MXVF 3MRQA 4HIEA 1FL6B 3HZYA 3STZA 4JG1H 3TCLB 5SX4H 2P4AB 4MA1B 2VLJE 4QRUA 1JGDB 1U2CA 4YDIH 2VLRD 4D9LL 2AP2A 4PR5B 2SEBB 4JPVL 5DWUH 4NN5C 2BVEA 3ARBA 4NQCE 4NKOA 2Z0BA 3ZDZF 5DZOA 2PR4H 3MRLA 3IFOA 1OB1B 4EBQH 2AJZB 5JOPD 1S8DA 2R4SL 3S35L 5CP7B 3LAFA 2DQCL 2X4OB 2BOCB 3MRFB 4JDZB 4Y2DB 5KAQG 2R8SH 5JW4Q 1RIHL 4X4ME 4AIZA 1SYSA 2FGZA 2G60L 4PB0H 4L3CA 2EYRB 5IHUL 3KXFB 4WVRA 2H26A 3RIFK 2WQ8A 4X7CC 4I18A 2Z8RA 4PJAB 2YN3A 4XNQB 1MJ8L 3BUTA 2CLZB 1YQVH 4NQDA 4PRIB 1LD9A 1FG2A 3DVNA 3QWRA 4G6JL 2R69H 3GMQB 1EGJH 2DKMA 4YXKL 3RWFB 1VPOH 4OM1L 3MJ8A 4U1NA 4FOMA 4V1DE 3B4NA 2CLRA 3CMOH 4PP1D 3MRPB 3FT3B 4LRNL 2P24B 2F5BL 2X4RA 4Y1AB 4R97C 3LS5H 1PKQE 4X83A 3OKLB 3PP3H 1P5VA 4LVOC 4Y4HC 3AB0B 3SKOB 4ZO7A 4TSCH 2DIBA 3FQWB 2AV1A 1K4DB 4JFHD 3C2AH 1SMOA 2VZUA 4AY0A 2VLJB 2BRRL 1PVHA 1MRFL 3CFBB 4WRLA 2VLLA 1R5VB 1BM3L 3VXOB 3FQUA 1LEGB 4XMPH 12E8L 1KF9B 3OHXB 2YA0A 4NNPL 1KYOJ 4QNPF 3EGSA 5J8OA 2NZIA 5IIEB 2OL3B 4NZTH 3S34H 4P2OB 2Y5TB 1JZ7A 4S0SD 5F7UA 1KB5L 4QYOA 4UB0H 2C1PA 3I75A 5ICXA 3CX5K 3BH8B 3RZCA 1B4JH 4DW2H 3BT2L 3VW3L 3DIFB 3FRPG 4YR6B 1MCEA 5FUZL 4FQ2L 3HMWH 4P3DA 1WZKA 1MLBB 2VDOH 4K71B 1NKRA 1D5IL 3T3MF 1G9MH 5C9JA 3CUPA 3M17B 4X6BA 1A9BA 1QFWI 3PHOA 4WHTB 5F1NB 1PKQB 4R90L 4WFGD 5EUOE 2BSRB 5ANMA 2EICA 3HMXA 5BVPL 3U7YH 3TVMB 1HI6B 2HVJA 2ZZUT 1A7PL 1MJUH 3QIBD 3I6GB 4HC1L 4HXBH 3E8UH 1Y0LA 3HG1A 3BGMA 3FOMB 1MOEA 2ZCKH 2CJUH 2DTML 2GJ6D 1A6AB 3ZTJG 3BYYA 3SQBA 1J8HE 3TPKA 1IGTA 4CNIA 4U0RC 1CDYA 2EH8H 3TH4T 1Q38A 3B83A 4NJ9H 2B2XH 3B43A 5C0ND 4B0MM 2MMXA 4F7MB 3NIFF 3B8YA 1I3RB 1MCWW 1KEGH 5FDWB 4UT6H 2JIXB 3NIGF 5KVGL 4NKMA 2ICEB 3TZVB 3NCFB 2AEPL 3CSPA 1VACB 5C9KA 4I5BB 1JIBA 4YNYB 4HPYH 1OAQH 3C6LB 1REIA 5JHLL 4DEPC 5JHDD 3K2UH 1N64L 1IE5A 1KT2A 4GG6B 4WW2A 5IHZA 5IQ9A 1U2HA 5EUOB 2VXUL 4GW1B 2PYFB 5B4MD 4NQVA 4IDJL 1VFBA 3U36A 3RTQA 4TNWK 3MNZB 3P9LB 3ULSB 2VABA 1UYWH 2XKNB 4U1HA 3L7FB 3SDDD 3LKNB 3GSVA 5C09A 1Q9LB 2QHRH 4RFEB 4XPGL 4FA8A 4GQ9H 4DGVH 3UYPA 1YEKH 2FECL 1J8HB 1BMGA 3DUSB 3RVTD 1CLOH 1EMTH 1FAIH 3FRUA 1K8IA 4X7DC 2VLME 5FA3B 3PQYE 4NC2B 4YDJA 2X40A 1G0DA 1W0WA 3SBWC 1L7IH 4H25B 3CC5A 3HC3L 4WW2F 3U1SH 3GK8H 2KZWA 1F8TH 1MSPA 2X4QA 5HGDA 1MCQA 2W0LA 5F1IA 1TZHB 2QEJA 4KTEL 5HY9A 3ULVL 4LBEB 1ZEAL 2HJFA 2ITDA 3VXRA 2WV3A 5FEBA 1RD6A 1I1AA 3ILPB 2GCYB 1A21A 1G9MC 1IGML 2ZG3A 3INUL 1G7IA 4GG8B 1OP3K 3RU8L 3QRFM 1HHKB 1IGCL 2YR3A 3A67L 1RMFL 4PY8I 5CIPH 3AAZB 2YUWA 3K4ZA 5HDBF 5DT1H 3JWDH 4X99A 2WLYA 1U3YA 4OIIH 4RGND 5CBAB 5TE6L 2WQRA 4JAMB 4HGWA 3TEUA 1CF8L 4RAUB 3BE1H 5EB9A 5KJRH 3VGHA 4WUUE 1A0QL 3V6OC 5IESH 2JELL 5KZCB 2VDLH 2NY4D 1MNUL 2DYPA 2N56A 5AYUL 3G6JA 2DLEA 1MEXH 3VG0H 1IAKA 5J6HB 3L5WA 4ZS6D 4BZ1L 1DEDA 2OP4L 4QRPD 2UZIH 1ZWIB 4F7CB 2BNUB 1JPSH 3MV9A 2XV6B 3WIIH 3WXVL 2NMSA 1YMMD 3GI8H 1YNKL 1ZAGA 4IOSD 4MCYA 3PQYB 3MRGA 4KZDL 3JVGC 4O9HL 4P46C 4FXGA 5BZWB 3QAZB 2XTJE 4PGEA 1CZ8H 1ITBB 1WQVT 3VFWB 4ZUWB 4OCXH 4X4XA 3V4UL 3BUYA 3BZ4B 3SKNA 1S9KC 3AGVA 4W4NA 1KCUH 3EDFA 5FYLL 4N9GA 3EFDL 2GUOA 4EOWL 1NFIB 1H3GA 2OTPA 5BCAA 3GJFH 1G7PB 3W2DL 3H6JA 4QRQB 1WFOA 1V3LA 2DI8A 1I85A 3DPBA 4U6YA 5EZJB 4HF5H 5EG6C 1MUJB 1NEZB 4CVZB 3VFTB 4DAGH 4PJCB 1NCDH 1KELL 2Q1EA 4NNYA 1ZK9A 5F3BA 5JW3L 1IGYA 1RUAH 1DQLL 5J1TC 5LG1A 3F8UB 1DLHB 4PJXE 4WUUB 4NN7C 1S9YB 2GYSA 3QIUC 5CSGA 4M62L 1AD9B 4HLZH 3QEQD 2OYPA 4G8FA 2J7LA 4NWUH 4YK4B 3QUYD 5D6CB 1X6NA 1M05A 2X1WL 4Z7VF 4EI6A 4NNXB 4EQ2A 1XGYH 1H8OA 1MFDH 4E42B 5DHXB 4PJ5E 3VXQB 3KYOA 4U6TA 1DP0A 4DOHE 2D7TH 2C4FT 3WDIA 4XP9H 2XQYG 3BQUB 1GYAA 3MRBA 4NWTH 5CZKA 3TYFA 4NFDA 4P5TA 4QO1A 3D85D 2IH3B 1Q9WB 2X4UA 1PEWA 2RFXB 5DD1H 2FATH 1HINL 5DUBA 3B6SA 4U7MA 5E2UL 4MSWA 5KN5A 3MV7B 4Y5VB 4KZEL 2X10A 1ONQA 4V2BA 15C8H 1J8KA 4KPHH 3UTTD 1RK1A 1R5IA 1IJ9A 4XVTL 1AHWC 3JWDC 3HPJB 1EO7A 5INCB 3SDXE 3WFCL 5ESVB 2JTDA 2D7NA 3OGCA 4KV5F 2ZP0T 2VKXA 1PX4A 5EZLA 1T5WB 1FFNB 2EDWA 3SKMA 4IRJD 1S7UB 2E6PA 1IGIL 1LP9F 4S1QH 1U8JB 5C70A 4KUZH 3QQ4A 5I75B 4PJXB 4PJBE 3E0GA 1KJ2A 5L88L 2HTLC 1XH3A 3ZE2F 2QSTA 4G6MH 5F7YC 1OOAA 3WL9B 4POYA 3FO9A 1OAXL 4GT7A 2P43B 1YPZF 3VXSA 1LQSR 3FL7A 1AD0B 3S4SB 3FRPA 4BSVA 5H35A 5F6IB 4JO1L 1ZHKB 3WJJA 5DEZA 4JQXA 4O51A 2WWMC 1JGLL 2O26U 4WTZG 3KVQA 1F90H 3ARZA 3BIKB 4DOHB 3HPLA 1FNFA 1BIIB 3LB6C 3T0WA 5J57B 3OAYH 5D1XA 2F53D 1DN0B 3ZE0F 4NC0B 5CBEB 1NKOA 3LZFL 3OKNB 1R3KA 5B3JE 2NY2B 1RULH 3QA3B 1R3IH 3CLEH 5KSBF 2YRZA 3FB5B 1OD9A 2WBKA 3BKJH 4PPTA 3RVWC 2PXYC 2EYSB 4MMXC 4ZSOE 1F4WH 3ES6B 5EU7E 5F9OL 4P5MA 4GBXA 1XCTA 1S78C 3STLB 1FNLA 2YXFA 4UMGA 2IMMA 2DIJA 5DMGD 5MP6L 5EWIH 1EHNA 4LCCB 2VAAB 5F7DB 3N50A 5L2KD 2ESVD 5DA4A 5F71A 3RWHA 2JCCA 1KB5A 5IM7B 3QG6A 1EHLH 4L4JA 4ODSH 4JFZH 4KK6D 1A3QA 4YGAB 4OKVB 3T0EC 2Z8SA 2MHAB 2BCKA 4EDXA 4OV6F 4ELME 4F3FA 3MXVL 3ETBF 3SE4C 5I66B 1D9KC 4KRMB 1NCWH 3KPRA 1U41A 4KI5D 3HE6A 1F58H 4P3WA 1KJ3H 1UACH 1UM4L 3D69B 4YHIA 3X14B 1HDMB 3RBGA 4LVNC 5I1KL 4D3CL 3TO4D 2WBJB 2D9CA 4HH9A 4JFOA 4M6OL 4N5ED 4ACPA 3V79C 3SDYL 1NC4B 2ED8A 4OF3A 2BNQA 4MS8C 5BS0A 1O7VA 1I9JL 1FH5L 5IV2A 4WCYL 4L8BA 4XP5H 1QSFE 2YKLH 5EZOH 3MZGB 2JCCF 3O0RL 1A64A 1GL4B 3SHSA 2ATKA 4WY7L 1INEL 3EFFB 1MHEB 1A1MB 4GRMB 8FABB 4Z7WA 1J5OH 3MYJA 2BY3A 2O5XH 4YEEA 3CXDL 1P4IL 3V52L 4K7FA 3LH2H 4NUGH 1I9RH 2GY7B 1CLZH 2NTSP 1C5DA 1R24A 4NGHH 1RUQL 4NT6A 2KDGA 4OZFH 4GAGH 4TULL 1F4HA 4Y19A 4ZSOB 3FN0H 3FB6A 1BVLB 2YZ1A 1XGPB 1Q72H 3AY4C 2EECA 3BPOB 1XGTA 1OP5K 4OI8A 4OLEA 3TBVB 3NAAH 5ILTH 1QSEA 4LGPB 4J3OC 4JO3L 1IEAB 4TPRL 4YHLH 1HNGA 2OSLB 1ZLUK 4YHYC 3QCUH 3IDGB 1GC1H 4UILL 2I60L 2Z31D 5IW6B 4ELMB 3EDDA 4YAQB 2XA8L 2G9HA 1FNGA 4Z7WF 1AH1A 3TH3T 1I8IB 4XMKL 1QBAA 1CXIA 4LSVL 4JFXB 4LCIH 3I9GL 5HGBB 1TZIB 2AXFA 3P30L 3BW9A 4X7SL 4KJQC 3RDTA 1CGXA 2OZ4L 3IU3A 3OV6A 4PLKD 1QRNB 1MCDA 3DUUB 4XPFH 5EU3A 5E8OB 3LRSA 3O2WH 1DQQA 3MODH 4XNYL 2ZPKH 3BJ91 4PRPE 3LD8B 4Y8AA 1FVEA 3NA9L 1NBZB 5B38B 2FZ3B 4OAWB 2MJWA 2IC2A 1KIRB 1RZJC 4PB9L 4YDKL 3HE7A 3G08A 3O6FC 4GRLC 1RZGB 2RR3A 2GY5A 4K3JL 4YZFE 5E7BA 4HZAA 1UJ3A 1H0DB 4TQEL 3OG4B 3B8SA 4AEIL 1W2KT 5HVFB 4XCCH 3D39E 2VZTA 2P7TA 3CMGA 4RISH 3EYSH 2PYEA 4N1CA 4OCRL 3KPSE 4OSUL 4LSPH 4U1LA 3ZKXC 3DROB 3D3VA 1HYSC 1PG7W 2OJZL 2IALA 4HJGA 4JY6A 1XR9B 4JJ5A 3EIFA 4H26A 5SV3A 4PGCA 2VC2H 3U0TA 4OZ4A 4U4BA 3L5IA 3UMTA 4KAQL 3QPXL 7FABL 3P0VH 4ODVL 1K85A 1T20B 4GW4B 2L7UA 2IAMC 2J8OA 3IFPA 2EKSB 2ZUUA 4EDWL 4GAYB 3IB4A 5DXWA 5GS1C 43CAB 3GMRA 3QUZB 4NCDA 3C6LD 5C7XH 3DX6B 5JA8B 1GCFA 1UGNA 3TNNA 5J13C 5TQ0L 4PYHA 3Q6GL 4A2MA 1NDGB 3REVB 1A47A 3J8F7 4PUBH 1CDCA 5DQJB 4PRPB 5ID0A 3G5YB 3TV3L 5MHSE 4AH2B 1FNHA 3E6FB 4H20L 3NFNB 4ZUTB 2HH0H 5JPNB 1GGTA 3VFUB 5IB2B 4ZQKB 3HR6A 5HYJD 2V7NB 4FHBD 1H15A 4JZJC 1MIEL 3BH9B 2XQBH 3DRTB 4LKXA 5IB4A 5HHQB 2HN7B 1CQKA 3D39B 4PJHE 1R3HA 3KPSB 2YMXL 4ZNEA 1GC1C 4EVNA 1C5CH 1JF6A 4JM2A 3PGCA 1JK8B 2GT9B 4OD3L 4N0UE 1CR9H 4ORGA 3T1FA 2H2PC 3CVHB 3LMJH 3MV01 4MXVE 4UOJA 1U6AH 1D7FA 2VXTH 3NFSL 4Q6IB 1UM5H 3QUXC 4UDUA 2HFGL 4UV4L 3LEXB 3BEWA 4XXDA 2HA1A 4CBPA 4WJ5B 3N06B 1UM6H 2F58H 3H9SD 3L9RA 3BMVA 3ZDZE 3V7AE 1HH6B 5DD0H 4I4WA 5FXCH 2G5RA 4HWBH 4LCWE 4XNMA 4ZXBB 5HGHA 5C08D 3WD5L 3S88H 1A5FH 4JFEE 1CFBA 2DLTA 1KB9K 2AEWA 1F3DJ 4M93C 4BQBA 4XNUL 5IMOA 4J23A 4NYLB 4JM2F 4EN3B 2GAZA 5LBSL 1BIHA 3TN0A 5C07D 4BM7A 1GPOL 3OJ2C 1S7TA 4Q9QL 4OCWL 5KZCD 3BZEB 4YFEA 1ZGLM 3TF7C 2BVPA 1MHCA 3G6AA 4XP6H 3O6MH 5IBLC 1AP2B 4FFWC 4LCYA 4YX2L 3SDAD 3RI5F 2EDHA 4HKXA 3UBXB 4LSUH 5FUOL 2EH7L 3PNWB 2W60B 2BXZA 1AGEB 5FFLA 4L4TB 2ZJSH 4TTGA 2BY0A 4I0KA 5D6DC 4ZFGL 4PJHB 5IGXL 3AU1A 4WTZA 3LRHA 4J8RA 4MNHB 4JM4L 3MBXL 3OR7B 4HFUL 1AKJA 4P2RA 2AV7B 4MHHG 1R0AL 4PREB 2IBZY 4KI1A 3CFEA 4R9HA 4N0UB 3GSRA 3S5LB 4MXQC 3CK0L 2A83A 4HWZA 4X8XA 2QSCL 2C3VA 1OY3B 4GO6B 4G9DA 4FQXA 2FBOJ 3O2DH 3EZ8A 5D1ZC 3GSWB 4XCEB 3C60C 2I07B 2X89D 3H7BB 2BHZA 4J12A 1ORSB 5DRWB 3FO1B 3TBSA 3P0GB 1IC7L 1MH5B 5A16A 2CK2A 4KVNH 3O45A 4X9HA 5TPWL 1T80A 1BFVL 5IB5B 4LCWB 5DHYA 2P5WE 3GMNB 4JO4L 5J0BA 1A7BA 2ADIA 2YC1A 4OLZH 4JFEB 2QSVA 3O9WA 4KDVA 4QNPE 3V0WL 3KYKL 2A1WH 4MJ2A 2AEQL 4FQJL 4KDWA 5HHOA 4P2CG 5D96C 1S9XB 3PF2A 3KJ4C 3VJ6A 3MA7A 3V6ZA 3I2CH 2XWBA 4GLRI 3SKJH 3LN5B 5C0AE 4Y4KA 5CINH 1K3IA 5J9PB 5LGJB 3G5ZB 1FDLL 3B9KC 3K80A 2VLKA 1A4KA 1KBGL 2ZOKA 3WIHL 4A2LA 3O3BA 1SJVA 2W9DH 2XWJB 4GXUN 4HPOH 5ICZA 3BQUD 4CW1B 1JPTL 3EO1B 1SY6H 3DTXA 4YBLC 2NW3A 3MROB 4ESKA 1HSBB 3NN8A 3T3ME 3IJSA 1IEHA 2APWA 2FX7L 3JV4B 3CZFA 2A73A 1NMCC 1A2YA 3QO0A 4XBEL 4LHUG 3BGFC 4JRXB 3MV7D 4LLMA 4DUXA 5T1KB 1KPVA 1CDBA 3DRQB 4F9LC 1M6OA 2BFVL 4I18B 3VRJA 5CSZB 4OD1H 1J11A 4IRZL 4WEMB 5CP3H 3MLSL 5IF0B 5EORL 4MA8L 3V4PL 2C1OA 3C5SB 1I1FA 4F7PB 2P5WB 1NLBH 3VGAC 1U58B 4BJLA 5C3LD 4K71C 4U1KB 3DNKA 3TT3L 3VD9A 1A7OL 5GJSH 4TSAH 4JPKH 3IU4L 3QZWG 3ARDB 3O4LD 5ESAB 1JWSA 3GO1H 1L0YA 3NIFE 5GRXG 3D2UA 35C8H 1NAMH 3OJMB 1HWGB 2A6IB 1J05A 4LEXH 4M6NH 4XZUA 5E6YA 5C0AB 4MB5A 1NGWA 2VWEC 4KDTC 1F4AA 2IQAB 5C0DA 3DO7B 2NY6B 4Z7UB 3QEUB 5HVHB 4F2MA 3VCLA 4P4KB 1ZLSH 1NL0L 5J89A 4HQQH 5A1AA 5CD3A 2WMPA 4Q58C 4X0KA 2Q20A 3HTLX 5DS8A 5E95B 3ZZ1A 3A0OA 5B39B 5CHNB 5DJDB 1TTFA 1JWUA 3NOIA 4G7YL 1RK0B 3S37X 3B5GA 5F7NC 4QRRD 4IIQA 2FEEL 3QDGA 3K2MC 1BFOB 4JO2H 1S7XA 3CVIL 2RBLA 2R0LH 1QBLL 3CPLB 4MQXC 2NQCA 5FKPB 2MTPA 5FCUH 4OZHA 3IDUA 4I77H 2Z91A 3ZT7A 3GRWH 4I0PA 5JOEA 5DEFA 2LVEA 1EFXA 1WC7B 1MI5D 1UH4A 2YPLA 3BHBA 4UNTA 3DOSA 1G7QA 1YY8B 4ZO6A 2B0SL 1C8PA 2FGWH 3IDMA 3WFHB 1G7LB 1A3LL 1PSKH 2I5YL 1P7QB 4L5FH 1EEQA 2Y7QA 4FTVE 4H1LG 3O3UN 5AZ2H 2OS7A 3MREA 2J8UB 1U8HA 1Z5LB 1CK0H 1U95A 4KROC 1I9EA 1KCVH 4OQTL 3HZKA 4NM4H 3IGAA 5C0RH 2ERJC 4P23A 3V5DA 3W39B 1IGJB 5IG7B 1VGEH 3RY5A 1IT9H 1FPTL 2MKWA 3S96B 4APQB 1R3JA 4OZHF 1R5WA 2BNRD 1CIUA 4M43L 4XP4L 4WI8A 4FQIL 4NDMB 1S3KL 5DJ6B 4NQED 1T89A 3C09B 4GRWH 4L9LC 2OZ4A 1HXMA 4ZFOB 2AXJA 5C09E 1QD0A 3PV6B 5D2NA 4S1RL 2Q86B 1NC4D 1AJ7L 5T3ZE 1U8MB 3MBEB 5HDBE 1UKTA 2UZYB 5GJTH 3QISA 5ADPL 5MEND 3TBYA 1T1YB 3QPQD 1QFWH 2G5BB 5C0FB 5TDNB 4LLWB 5CUSL 4ZFFB 1TJHH 4YHMH 1ZV5A 4ALAH 3ZLQC 4JFDA 5C92A 3MZTA 2C7UB 4KWUA 4OLUH 3ZKNC 5CSBA 4D0DA 4LL9A 4NO2B 1KLFA 3DX7A 1PG7X 2PO6C 4XPHL 5CJXA 1QPXA 3IF1B 4FFYL 5MEPB 5IFHH 3QI9A 4FTVB 1CXLA 1OT1A 2DQFB 3DX9A 4MD0B 1NJ9A 4LCUA 3IJHB 4NPYA 2VL5B 5FA4B 1DBMH 1JJUA 5E6IC 4U7SA 1I1RA 3LHPH 3QDMA 4PTUB 3SDCC 3X17A 3BESR 3OKEA 3P77B 5EBWA 5JOFA 3MGOA 5I8KH 5IT2L 4GAJH 1QP1A 4JKPL 4YQXL 2HAZA 3HRZB 4PD4K 1LDPL 4UV7H 5LCVH 3HR5A 3BVNA 3X13A 2DQHH 5ALCL 1OARH 2ZWLT 4RDQF 3MV9E 3QIUD 4UU9A 1OW0A 3QDJD 3VWKB 3RX8A 3VWJC 3I6KB 1NBYA 3AM8C 3MLWH 4KK8C 4G43A 1XGUA 1QOKA 1R3LB 2ZUTA 1C16B 4L9DA 3U46B 1NC2A 3KNBA 2ORBH 3ZYOA 1QA9B 3GB7B 2DBLH 5BXFA 3TA3B 5EBLB 3GNMH 2FBJH 1ETZA 4ORZC 4YDLB 5HXMA 4Z7VE 4M4PA 3RWCB 5K9KA 3QFJA 5KSAB 2QKIA 3LSOA 2KPNA 4WFFD 2OXHA 3HC0B 5D70H 3U9PL 3MR9B 4UIMA 1MCOH 3SCMB 4UDTB 4MAUL 1X5FA 4TUOB 1KXVC 3N85L 5C6PB 2P49B 4XTRC 5TH2A 4OFPA 1M71B 5DJ0A 3LKQB 3TJHC 3E3QE 3ISWA 1EO5A 4F9PA 2E7CA 1KG0B 3F12B 1QSZA 1WBXB 5ISZB 4X9IA 4WI7A 4PJGB 2PF6A 4AL8L 1GGBH 4LP4A 3SKUD 5D72L 3GKWH 4KV5E 5B21A 2H3NA 2C5DC 1PX3A 5CGTA 1CLYL 2HTLD 3UDWC 3C5ZB 1NLDH 4LVEA 1LP9E 2Y06L 2NTFB 4WI5A 1C1EL 3GM8A 4J7RA 5LGKA 3JBG7 3BN3B 2XTJC 3RVVC 2A77L 2B1HH 5I8EB 2R2CA 4CU7A 1FYTA 5I1JH 3ZSSA 5IWLA 4IHOB 1S9VB 2WWMD 3L3IA 9CGTA 3ZE2E 3QRGH 1BF2A 4WUKH 1NMAH 4U3CA 1YPZE 1ES0A 3LY6A 3LB6D 5TDOA 2D0GA 4ZFZA 3MLUH 4Z7VB 4UQ2A 3GMMA 1M7XA 1RZJL 4C83B 3I50H 4ZDHB 1MFEH 1DVFC 3GMLB 4MJIA 2QR0A 4K7PH 2JJWA 4Y5XC 3GMOA 1RZ7H 2PW2B 1CD8A 3CD4A 4RMSA 3RNQB 1FVCB 1FNEA 5DLML 3TBWA 1NSNH 2R0ZH 2F54A 4H0HB 2FB4L 5DRNB 5DGRA 4X4ZA 3ZE0E 1HK6A 1FZMA 3RVWD 3KPQA 2PXYD 4H0IA 1JP5A 3AREC 4LHUA 3QP3A 3MACL 2A9MH 1T21A 4OJFL 3DXAD 5JXAH 1QFUL 1F5WA 5KSBE 5I8CA 1ZGLA 5IVOA 2AJUH 5I1LA 5TDPB 3JWOC 4OCMC 4YDVA 4L4VE 1HCVA 4Q9CA 4YJZL 3BPNB 1K3ZA 3KPPA 4NO5B 2EE2A 1SEBB 1W72H 1JGVL 4DQOH 3OZ9L 3ARFB 1A22B 1JN6B 3BKML 4KQ3H 3V2AR 4JLRA 3CCHB 1FCGA 5GGUB 4ODTH 1LP9B 1D9KD 3V0VA 1I3GL 4EN3D 3MRMB 3QZWA 3T08A 5GZOC 1GOFA 2FECI 5HPMA 5D5MA 3H0TB 2R2HB 2ATPB 4ETQB 3FQTB 3QIWA 1YPZB 1QRKA 5T3XH 3OJDA 1DEEA 2H9GA 1IKNC 1YEEL 4MS8D 5JNYB 1OP9A 3WIHA 4L4TD 3QJHB 3H3PL 5KW9L 4KQ4H 1M4KA 3WHE0 4AM0B 5KTEH 3DECA 4LSRL 2JF1A 4MX7A 4JHWL 4KKAC 2RCSH 3OMZA 5E08H 3LEVL 3U7WH 4PJDF 3ULUH 1QNZL 4AIXA 4OB5H 3IKCA 4LPXA 2JCCE 3SGJA 3G6DH 3ROLA 3LKOB 4Y4FA 1UWEH 2APXA 4FXKB 4XP1L 1MJ7L 4WHCA 1KJ2B 1T4KA 2W0PA 4XWGL 2CKNA 5KSBB 4GOSA 2Q8AL 5IMLA 1YN6B 1NFDB 3FQXB 4HIHB 1FIGH 4HHAB 4L4VB 5EO0B 5C0EB 3OXRB 1JNLL 1OQOA 2P42B 1S7WB 3FOLB 5D9SA 5EOCH 2IPTH 4JFFD 4UZGA 1U8QB 1RUPL 4JVUA 4HS8L 2C26A 4H1LA 4LFHD 1ZLVH 3TC9A 4PJ9C 3FFCB 3FMGH 1FL3A 1OCWL 1PQZA 5GGQH 5BS0E 4WWKD 3WNOA 1UXWB 2PN5A 1T0MA 3WUWB 2R2BB 4ZPTA 1TPXB 1F3JA 2AK4B 5T1DL 3U0WL 1VADA 3GJEA 1T04B 3T0VA 2ICWJ 1CGSL 1E0OB 5IVXF 1KN2H 4Z7WE 3RA7L 1WWBX 2DICA 4U6HA 2CKBB 1Y6MR 5EU7C 4HK0B 4X6FA 1JYNA 1JNHB 1QBML 1HHHB 3H9YA 4Y19E 1WTGT 2XNAB 4NZUH 1N4XH 4HUVA 3EYOB 2AGJL 2EDTA 2F74A 1ZSDA 5K33A 2A6DB 1AI1L 3WEXA 2X4TB 2IG2L 5H2BB 1UWXK 4JG0H 3VXPB 1NBVL 4ELKB 4HH8A 4GRLD 1QSEE 4NHUB 1PY4A 4Y0GA 4JRXD 4LEOB 4O00A 5C0BD 5HHNB 5E2VL 5FECA 1D5ZB 1RZKL 3CH8A 5BRZD 3W0WE 5A2KH 5BO1L 3UYOD 3IXAA 5E8DL 3U79A 1Q1JL 2OR9H 3CU1A 5HJ3A 1HYSD 4O02L 5FDYA 1TITA 2W92A 1EJOH 1KYOK 1AGDB 1GZQB 1JF1A 3BP6B 1NCCH 3Q6FB 2WNGA 1K5NA 1MHPH 3VFSB 1H8NA 2VE6A 2UZXB 4HBCH 4RWYH 3EJYC 4I3SL 3ARDD 1BQHB 2IAMD 5AWNH 4YXLH 5B3NA 4OQTA 5IQ7H 3ELAT 5MEOA 5IROC 4J3UA 1BD2D 5D7IA 5DEGA 3FT4A 1PEZA 4HUXA 5DMIL 1V7NH 4JDTL 5ETUA 3PP4H 3QIBA 4Y5YA 2X7LB 1QLRB 1QQDB 4MA3B 4HKZA 2L7JA 3MCLL 1HHIA 2FLRT 4RGMB 3OR6B 3RL2A 5I19H 5AUMB 2IJ0C 3QWOA 2IAND 4Y19B 4QHNB 1I7RA 3P4NA 3ROOB 2LU7A 5EU4A 1I1YA 3P4MB 5DFTA 4E5XA 4BFIB 1S7RB 1AO7E 2KQNA 3DVFA 1YN7A 1ROWA 3JV5A 4OCNC 2N4IA 1FQ9C 2OL3L 1JPFB 5DJ8A 3GHBL 3WXWL 1B4RA 4YUEH 4LMQE 5FO7A 3F7YB 3MRIA 4YGVB 3UROR 4CADB 2ADGA 5FOBA 4UQ3A 3S3JA 1OAYH 3W0WB 2CDFB 1C12B 5D7IF 4P9HH 2V2XB 1TVDA 4B7IA 1A6TB 2XZCL 3T2PA 3R1GL 5DVNA 3IDYC 2XPGA 5CLTA 4KMQA 4WO4B 5E9DD 3NFPA 1WITA 1BX2B 4NM8H 1BQLL 3VXUA 2H2PD 5L2JB 4FQ1H 5T1MA 1XIWA 3C9NA 1OPGL 3H7LA 3TYGH 3QUXD 4PS4L 4X5WA 4XBGB 3RNKB 2AQ2A 3CDYA 1TJIL 4XH2A 2HT3C 3C6SA 3PWPE 4FFZH 5FGCE 5CZVH 3LRSB 2I9LB 1FFOB 1RJZA 3TIEB 1A1OA 3W9EB 3T2NH 1TCMA 5LWYH 3FTGA 1NQBA 5KSUA 4APQD 4OT1L 4U1SA 1TFHA 5C0CD 1YMHA 4DGYH 5D7SL 4XMLH 1WZ1H 1DE4B 3SDDA 1A9EA 4OGXL 3QHFL 1HCFX 4N90E 2WWKO 4Z0BH 1HOCA 3LS4L 4YIQA 4DVBB 4DUVA 3QQ3A 4IJ3B 1MRCH 3MBED 1AQDA 2HT4D 1Q9KA 5I2IA 1U3HC 3DMMB 3D25B 1KACB 3VFVB 1Z3GL 1I8MB 2HT2D 5IBLD 4FFWD 1AO7B 1EEZB 1ZTXH 2GTWB 4ZNEE 4G7VH 1MCPH 3GSUB 4GJTB 3BRGC 5JR1H 4YHZL 2QQKH 1IM9B 1JBJA 3O8XB 5IFAL 4ODBD 4O2FB 3L3DB 4FNLH 5GISL 5SWSE 4H5SB 2W0KA 3ZKQD 1FJ1A 3JUZA 1UB5A 3WIFB 1BP3B 4P57B 1OTUD 4MXQD 4M61B 1MPAL 4RX4D 4XNXH 5EU5A 1WUNT 4N0FA 3D0VB 1T0NA 3PGFH 1OT2A 4HKBA 3ARGA 3MGTA 4XAWL 5D1ZD 3C60D 2V9QA 4JPWL 4ZO8A 1IQWH 3QUKB 4EEEA 4PJ8C 4IRSA 3PWPB 3NCEB 4UNVA 4M8QA 3B3IB 3L3JB 1QEWB 3B5TA 4IOFC 5ID0B 4GFTB 1P2CA 3NZ8A 1FFQA 4TNVF 5EO9B 1K8DB 4BH7A 4NKDB 4FMKA 2J88H 1T1ZA 2YD9A 4W6YB 1TCRA 4ONGL 4NQXA 3K46A 4YPGA 5KSVA 4L8DB 1E28A 1DDHB 4HJJH 4ONHB 4NSKB 4FABL 4YHNA 5K9OA 3R06B 4LLVB 2XZQL 1XZ0B 1N6QH 1HHJB 3VWKD 4MDIA 3WS3B 4XVJH 3SE8L 4PJ7A 1D6VL 4RBPH 4P9HC 1JHTA 4JGJA 5MEQB 2XRAH 4J1UA 3B9KD 1PFCA 2EDDA 4XCYA 2EEDA 2J2ZA 4DKEL 4Y16B 3NGBB 1W8NA 1MAML 3GIVA 3HZMB 5SWSB 3HB3C 3NTCL 4EXPX 2NXZB 4MNGE 4N8PA 5CILH 4L29B 2R1XA 2VR4A 1BVZA 4UDUB 1MWAA 1TTUA 1NGQL 1L4IA 3P73B 3PWJB 4OCYH 5IW3A 2OBGA 2R0WL 3HNVL 1X5JA 4QKXB 3BYTA 4I4WB 4PRHD 4YPJA 3FN3A 3UXFA 3RAJL 3SCMD 4OIAA 1I75A 1C5BL 1H3WM 1K2DA 4EI5C 1RI8A 3AFLA 5L6YH 3RY6C 3T4YB 4ZYKA 5I74B 3QO1A 1U8OA 4LQFL 3RI5K 1FL5B 2ZSVA 4G3YH 2CMRL 5F7EH 4TVPE 3MLZL 4OTXL 1C7SA 4LARL 4PJFF 4AJ0A 5ISZD 1CG9A 4AMKL 5H37G 1BBJA 3MRRB 1WEJH 5IK3B 3ARBC 1S5HB 3HMXH 5IEHB 3IAQA 3VXME 5BJTB 1YEGH 1ADQL 3WHXA 3U6RB 1A7NL 1MCKA 4JPIB 2WW8A 3PABA 1JV5A 5JW4R 5ACMA 4C57C 4PP2B 4KVCH 4NOBA 2GFBA 2Q7YA 3NABL 5INDB 1KULA 2AJYL 1TVBB 5D7KD 2VN7A 5IOPB 4I18C 5LGHH 4JFYB 2HYMA 2H6PB 4ZAKD 5JORB 2APTA 4MNGB 5CJOH 3UTTA 2NW2A 1ZE3C 3VH8B 2PTTB 3RGVB 3LEYH 4YC2C 5GSVB 1LEKB 5DD6A 1AC0A 4AT6B 3D18B 4OF6A 5ICYA 2WUBL 3LKRB 4ETYA 3OX8B 2CRMA 5HHXH 2CGRH 3BP4B 4PRDA 1JHKH 3X3FH 2WWKT 4OGYL 2X6MA 1CD1A 2YC1B 3FB7B 4R7DA 3FCTA 2VAJA 4ZNCD 4MYWB 1YNLL 3CH1B 2CK0H 4NCC1 5I71C 3EYQC 1HKFA 3WKMH 4QGTA 2DM2A 5LKNA 2V17H 5FO9B 1D5BB 2VIRB 3S36L 1JTOA 1X4XA 2NY0C 5DJAB 5ERWB 2NR6C 1DQMH 4U6VL 3O4OC 5BV7H 1UVQB 1AFVH 2CLVB 2X4SB 1I7UB 4HZLA 4P4KC 1BBDH 5EO1A 1BOYA 3CFJA 4I9WE 4FQQA 1DBAH 1WWAX 4LDOB 4KROD 3UTOA 2VKWA 3OGOE 1YYLL 3RWDA 3VXMB 1S7VA 2XN9E 4Z77B 4P3CH 5DF0A 1NCBH 3QFDA 4WV1B 3I02B 3BXNA 1J1PH 3U7AA 1IFHL 1GGCH 2DD8L 4KJYA 2BVOB 3A6CL 1J18A 3PL6B 1JGEB 1OM3H 4F58L 2G2RB 2OX5A 1FL6A 1S9WB 3TCLA 1WAAA 3M8OL 3B9VA 4CU8A 5CGMA 4U3XA 3G9VA 1JGDA 1UWGH 4MHHI 5M94B 4OZHE 4GLRH 4J6RL 4PR5A 2SEBA 2JB6B 3RZCC 1OB1A 4DN3H 3IDIB 2OR7A 2AJZA 2DQTL 1VKXB 4L3AA 5CP7A 1JRHL 2X4OA 2BOCA 3MRFA 1GAFH 4JDZA 4M9OA 4Y2DA 3UTPD 3EO9L 3BKYL 4G8IB 1NEZG 1E6JH 2H2SC 4HULB 3Q5YA 3HNSH 4UAOC 2EYRA 3L7EB 5E8EB 3KXFA 1A7RH 3MJ6A 1T22B 3KYNB 4MAYB 4XAKE 4Y7MA 3FHAA 4PJAA 5DK3A 1QKZH 4XNQA 4PJEB 1VFUA 2CLZA 2ZKHH 5DZNA 1WAAF 3THMH 5I0DA 3VD4A 1Y6KR 4PRIA 2CIKA 3GMQA 3RWFA 3K4DA 4M7ZC 3JWOL 3KAAA 4MD4B 1H3TA 3SDCD 2XN9B 2KL6A 4Z7OF 3DYOA 3MRPA 1C7TA 1EAJA 1S7SB 3FT3A 2P24A 4K9EH 5D2NE 3FFCD 4KGLA 4WU5B 5ITBL 4Y1AA 2ENYA 3B9AA 3ZT5A 2X44D 3OKLA 2KKQA 3VRIB 3SKOA 3OPZH 5DTFB 1YJDL 2D9QB 3ALWA 4L8SB 5I73B 3FQWA 3ZTNH 2AK4D 5E99H 1K4DA 1RUKH 5EU6E 3DWTA 2VLJA 2Y07L 5L7XH 3CFBA 2VZVA 1R5VA 1OAUL 4JFDE 1MCIA 3VXOA 3VWJD 1V5JA 4KHXH 3GUTB 2R4RH 4KI5F 1LEGA 1ZHLB 4KK8D 1QVOB 1IC5L 3OHXA 1LNUB 4HK3N 4HJ0C 3BAEH 1ULVA 3QEHB 1J0IA 3U4BL 4QTIH 5IIEA 2DQEH 2OL3A 5HI4C 5GHWL 1FLRH 4OI9A 4P2OA 5BV7C 2Y5TA 4WW2C 1KN4L 4CVUA 2UY6A 1AE6L 3MLTB 1XMWA 4PRAB 2MWCA 3QDME 1RURL 1UZ8B 3BH8A 3MJ9L 1VEOA 1LK3L 3DIFA 3S4SG 5IR1B 3RTQC 4YR6A 1CICD 3OG6B 3TWCH 2VDPL 1K6QH 5J12B 3DUHA 2OK0L 3P9MB 4NP4H 3H9ZA 3RUGB 2OMNA 4OF0A 1MLBA 1IL1B 3ALXA 2HTKD 4K8RH 4M7LL 3L5XL 2D2OA 3M17A 2BOBB 5F7LB 5D2NB 5M95B 5FYKE 5F1NA 1PKQA 1AGBB 2Z4QB 2BSRA 5A40E 4DKAA 5JTWA 3D48R 2E8ZA 5J1SC 3UEZA 1L9NA 3TVMA 1HI6A 1YY9C 5EU6B 4N0YL 1ZHBB 1NCAH 4RRPG 4WHYG 1KV3A 1WBYB 3I6GA 3SOBH 3HNTH 1T6WA 3FOMA 2OI9B 3FAXA 1I1AC 6FABH 1A6AA 4JDVA 5GZNC 1EBAA 4G42B 2EKJA 2HWZL 1FAKT 2XTJD 3MNVB 1A4JB 4FFVD 4R4NC 2XFXB 3RVVD 2R56L 3DVGB 3RVXD 4D9LH 3TO2B 5JIPA 2FYYB 4WWID 5KVDL 2DM7A 5D93C 4F7MA 3DX9B 5F7MC 4NZDA 2P5EE 2R4SH 1I3RA 3S35H 1PZ5B 2DQCH 5CZXC 5FDWA 1DVFD 5A2LH 4IM8A 2JIXA 1RIHH 2ICEA 5C6WH 4JRWA 3TZVA 3L3KB 4OLWL 5HVWA 1CYGA 2G60H 2X4PB 1Q8MA 3KR3L 1VACA 3WLBB 1MLCB 4I5BA 4GW5B 3K4AA 3T04D 3C6LA 3JTSB 5F6HJ 1MJ8H 3ARED 2EIZB 1T2XA 4GG6A 4G6JH 3RWEB 4YXKH 5EUOA 5FK9B 4OM1H 1M7IB 1P4LB 4GW1A 3GSNB 2DF3A 2PYFA 2WLZA 4W4OA 4LRNH 1KJVB 2GIYA 4HGKC 2YSSB 1MQKL 1N6UA 3MNZA 2F5BH 3P9LA 3ULSA 2FEEI 2VN4A 2XKNA 2F8XC 3L7FA 1Q9LA 4RFEA 5GZOD 3QCVL 4WU7B 1JI2A 4KRPC 1RHHB 1J8HA 2YK1L 3DUSA 2BRRH 4HMDA 1MRFH 1FFRA 5FM5O 4MJIE 2Z8WC 4QOKD 1MRDL 4PV9B 5FA3A 1I85C 1BM3H 1I3UA 1FBIL 1N6VA 4X6DF 4H25A 5D7LB 4GG6F 3M45A 2P5EB 3HCVB 3OB0H 1IM9D 12E8H 3O8XD 3ZTJH 1TZHA 2NY7L 3WDHA 3MOAL 4NNPH 3LDBB 2ICCA 4GSDL 4ZOAA 4E41B 4LBEA 3R0NA 1P6AB 5DA0B 2OCFD 1OSPL 4XC3L 3ZHKA 3ILPA 4K8RC 2AJVL 2GCYA 1TVHA 4GG8A 1HHKA 4Z18A 5HDOA 4AEHL 1KB5H 3GMPB 5JLZB 4P2QB 2LTQB 5DSCB 1RAMA 1GZPB 3AAZA 1FSKC 2VSDA 3BT2H 3VW3H 3BISA 4B41A 2A0LC 1YEFL 2CR3A 5CBAA 1YNTB 4JAMA 5FF6B 5FUZH 2DN7A 4P5TC 1ZT7B 4FQ2H 4PJDE 4RAUA 1OVZA 3OAZK 2BJML 5EOQL 2FJHB 5L8KB 1RHFA 4Z6AT 4RFOL 2DQUL 3HUJB 1D5IH 4PBXA 5D5ME 1FGNL 5J6HA 4QXWA 4R90H 4JY4B 4XHJD 4X80L 4F7CA 1ZWIA 1B2WL 3GBNL 1CU4L 2VLRE 3UTSB 5BVPH 2BNUA 1V8HA 1ADQA 1A7PH 4HC1H 2AAVA 3HI1B 3PQYA 5JOPE 5JQ6L 2NY5C 2Y72A 3SPVB 5D1QB 3U0PB 3WS6A 2DTMH 4IMKA 3AM8A 5BZWA 1LVEA 1X44A 4E9LA 4RCAA 3VFWA 4ZUWA 4G8GB 2Z92B 1FE8L 3CVHL 1Z0NA 4O58L 3BZ4A 4Q0XL 5T5NF 2X89A 3QUMB 4JVPA 2CO7B 3LOWA 4G9FD 4JREC 4F33B 3T0XA 5HI5C 1Q94B 5D4QA 5IVXE 1QSVA 4XCNB 3U30C 5ECJE 2RJMA 3GSXB 1G7HB 1NFIA 2HRLA 1G7PA 5KVGH 4JVWA 4EUPB 5EH1A 3WJJC 4LHJB 4JQXC 4WEBL 5EZJA 2AEPH 4C56B 1MUJA 1NEZA 2F5AL 3VFTA 4CVZA 3CX2A 4PJCA 1QHOA 5LAXA 5FB8B 3UZVB 1OGAB 5JPMB 1QYGL 3MMEB 4KRNA 2D7TL 4PJDB 5JHLH 5JW5B 4ZUVB 5D1XC 1DLHA 4HCRL 1N64H 5IW1B 1S9YA 2VR9A 1AD9A 4R4FL 2FHBA 4E0RB 2VO5A 4QGYA 1BZQK 5D6CA 2FJGB 3EJYD 5A43C 2VXUH 4JFHE 5FHBL 3SE3A 3ARWA 2VLRB 4KY1L 4E42A 3KLDA 2X2YA 5T3XD 3MRHB 4GS7C 1BVKB 4J3SA 4F8TA 3VXQA 4IDJH 4HUKB 1AIFB 3BQUA 4GBXC 4S1SL 3BOVA 4NUJA 3S98A 4GXVL 2IH3A 1Q9WA 2V2WB 4PJCF 2RFXA 3N1FC 1U8NB 3ALPA 2D4DA 3O6LL 4X5LA 3ULUD 3MUGB 1GHFL 3MV7A 2O61B 4Y5VA 4CU6A 4RGOL 4GQPH 4ZUSB 5IVXB 3HPJA 5INCA 3L1OL 5ESVA 2P47B 4KTEH 1T5WA 4TTDC 1FZJB 1FFNA 3ULVH 3RPIB 1ZEAH 4XNZB 1U93B 1WZLA 1O7SA 5J11B 1IGMH 3RU8H 2YD4A 3INUH 5DJZB 1U8JA 1RZFL 1IGCH 3A67H 5F8RC 1RMFH 2YXMA 3EZJB 2BC4B 4PJXA 5IBUB 1FLTX 4WFGE 1B0GB 3WL9A 3MRDB 2J6EL 3WNLA 5C0JB 1MCLA 5F7FA 5D7IE 1MFBL 3EO0B 1H3PL 1AD0A 5TE6H 3S4SA 4TN9A 3MO1B 1YEIL 2X1XR 3N9GL 1CF8H 4LLYB 3PWLB 1ZHKA 3HFML 4JZNB 2HT3D 1A0QH 5DURD 3SQOL 2JELH 4HIJB 1MNUH 3BIKA 4MA7L 4KXZI 5AYUH 3L95B 2GJ6E 1BIIA 4M7LT 5JZ7D 2F19L 3CFDB 3VXTB 4BZ1H 2NXYC 2OP4H 1XT5A 1VHPA 3WEXB 1DN0A 3WXVH 5CBEA 2CO6B 3OKNA 1XGRB 2BMKB 1YNKH 2ENSA 1OSZB 3QA3A 2QQNL 5HHMD 4NRXB 4RRPA 4YFLI 4LVHC 4KZDH 3F5WB 2XY1A 1U3HD 1XF5B 4O9HH 3SO3C 1HQ4B 3O81A 3FB5A 4BSWB 3OKDB 1D5XB 2V2TB 5EBGA 2OTWB 1EEYB 2EYSA 3RVUC 3V7AG 3V4UH 1INQB 3ES6A 3I3DA 1T7VA 3BEVB 2A6KB 5FYLH 4LSSL 2GITB 3EFDH 4LCCA 4X5XB 2VAAA 1P9MA 5F7DA 5JHDE 3RDTC 4AENB 5IM7A 4EOWH 4K3HA 5GRWA 1T7ZA 3W2DH 2V9RA 2B4CL 4HWEL 5SX5K 5KS9F 4OKVA 3C08L 3MJ9A 2MHAA 1X5AA 5I66A 4ODHL 5JW4N 3QNXB 1KELH 2J4WL 4D8PB 3BD4A 4S1DC 3R0MA 5JW3H 1DQLH 5IBTL 2DQIL 1KLUB 3D69A 4PJ8D 3HE7C 3X14A 1HDMA 5L0QB 1T3FB 5D7JB 2N7AA 3FO0L 1UJ3C 2WBJA 2GJ6B 3BP7B 1J7VR 3BZFB 1YEJL 4QCIB 3X12B 1DFBL 4IOFD 5HYIA 1NC4A 2DLIA 3VFOB 1RV6X 2MFNA 4Y2OA 3EFFA 1EVUA 3H8NA 1SBSL 1A1MA 3R4DA 4GRMA 2YUVA 8FABA 1DQJB 3QHZL 3ULVC 5EBMB 1MCSA 2JJSA 4ODWB 2H8PB 4M1GL 1HINH 1RFDL 4ZSOA 5E2UH 1C08B 1BVLA 3KYAA 1XGPA 4KZEH 3ARUA 4PYGA 3TBVA 2XYCA 1JFQL 4F57L 4XVTH 4G8EB 5F72S 2DOCA 5JHDB 1IEAA 1ZANL 3WFCH 2OSLA 2EE6A 3FONB 1XF4B 5I1AB 2ARJQ 5EFIB 1ZVSB 3IDGA 4RGNE 1UXSB 1A1NB 5IW6A 4ELMA 3DI3B 3O2WL 1IGIH 4YAQA 2EDKA 4XBPB 3CDGB 5CEZD 1F13A 1I8IA 3DVIA 4EI5D 3EUUA 3ZYJA 2GJZB 4HMEA 4KTYA 5E2TL 1FP5A 4JFXA 5HGBA 5L88H 1TZIA 1PBYA 1OAXH 4LIQL 4QRPE 4ZFOL 1QRNA 4D9QD 3X11A 3DUUA 2EDNA 5A2FA 5E8OA 4JO1H 1AQDB 2FX8L 3QNZB 4HDIB 4JM2C 3LIZL 3MNWB 5E94B 1JGLH 1KTKE 3VXNB 4Z5RB 1E6OL 3MV8B 3NGBC 3ARBD 2D4FA 3K0WA 3K7UA 1NBZA 1OTTC 4LNRB 5B38A 1U8LB 2FZ3A 4OAWA 4KJWD 1LK2B 1KIRA 4PJFE 2V5RA 1RZGA 4NQSB 4S2SB 1H0DA 3EYVB 1SJEB 1G7JB 3LZFH 3K81A 5EC1B 2VDQL 2QV2A 3P0VL 2Z8VC 5C0GB 4LU5L 2EIBA 3V5KB 3H9HB 4J3VA 2W65B 5EIQA 3HRPA 1CFQA 1KLGB 3DROA 4U1IB 1H3VA 1GOHA 5TGBB 5L9DL 5F9OH 1XR9A 3RJDA 5IB3B 4NQDD 1LO5B 4TNVK 3TN0C 2JJVA 5MP6H 5HBBA 5EULV 1T20A 4RNRB 4GW4A 2UVEA 4TOYL 2NY4B 2EKSA 3MC0A 4GAYA 4R0LB 4DJMA 4FQHB 43CAA 1RY7B 3QNYB 4P2YA 1N5AB 3QEQE 1RJYB 4LP5A 3QUZA 3DX6A 5FYJD 1YC7A 5KBNC 2GI7A 3BP5B 3U4EB 3MXVH 4QRPB 1VFAB 1ZT1B 2D7QA 2VDNL 3QULB 5DYOB 2IPUK 1NDGA 5T3ZL 5E4EB 1UM4H 3REVA 1YMMB 1T1WB 2C3GA 1RU9L 5I1KH 4D3CH 2VXVL 4PRPA 3O3EB 3G5YA 2GEEA 2ICES 5A3IC 4AH2A 4M6OH 2QADC 3E6FA 4ZUTA 3NFNA 3SDYH 4O5LL 4FQXC 4KMLB 5HYQB 5JPNA 4UOW0 3VFUA 2QBWA 5DI8B 5IB2A 1FO0B 4ZQKA 1F11B 2V7NA 4PJFB 2A6JB 3RHWF 4Q9RL 1I9JH 1P1ZB 1FH5H 3BH9A 4WCYH 3DRTA 4HIIB 2XACC 3O0RH 1T66C 2NY1B 3UTTE 2V6HA 2NZ9C 5HHQA 2HN7A 1MY5A 1MWAB 3D39A 4G6KL 4WY7H 1INEH 4K3GA 4HMCA 1KUMA 4BYHA 1EDQA 3MQIA 5E24E 1ODAA 3KPSA 4CJ0A 5GS2H 3CXDH 1P4IH 5CGYC 3V52H 5JW4M 3IVKB 1FZOB 1JK8A 2ADFL 2GT9A 5SWZB 1RUQH 3O9WC 3MFGB 2GHWB 5D7LD 3IDNB 4TULH 3F7RA 3AMLA 3RZCD 3CVHA 4N1EA 1YYML 1Z9SA 2CH8A 4R2GC 1HHGB 4Q6IA 1H5BB 4E41D 4CN1A 4X9BA 3A6BL 2IGFL 3LEXA 4JO3H 4QXGL 4TPRH 5LJYH 1PYWB 4JFQB 4WJ5A 2QJDA 2H2SD 3EOAB 4LQ1A 3QEQB 5GIRB 5IVZB 1VFOA 3QUYB 4JCLA 4Y4KC 5BZDA 1HH6A 4OF7A 4P2QD 2I60H 1CGWA 4ZXBA 4KKLC 1ND0B 5TE4L 1AGCB 2E7LA 2XA8H 3VGBA 5I1HL 4XMKH 1QLFB 4NYLA 5K93A 5HYSA 1G9NL 3NZHL 4EN3A 3I9GH 1U9KA 3P30H 4M8VA 1CWVA 3D85B 2JJTA 3HG1D 4X7SH 3BZEA 2OZ4H 1I8KB 4HS3B 2F53E 2DKSA 4XRCA 5F89B 1AP2A 2VZ1A 1P6FA 1EZVX 4LSDA 1FZKB 1WAAE 3UBXA 1N2RB 4KK5C 4XNYH 3PHQB 3PNWA 2W60A 1AGEA 4L4TA 1AC6A 2NW2B 3HAEB 4PJHA 3NA9H 3OL2A 4KMTL 4MNHA 4JFPB 5D8JL 2Y6SC 3W82A 1TMCB 2X1QA 3OR7A 4Z7OE 4MMZC 1G84A 1D3CA 2AV7A 4K7PX 4PB9H 4YDKH 1FYHB 4PREA 4K3JH 4N0UA 3FT2B 3S5LA 1ZA6A 1CGUA 4IRJB 4TQEH 4AEIH 4NN6C 4G8GD 2ESVE 5GPRA 3GSWA 4OCRH 4XCEA 1QFOA 2I07A 3H7BA 4OSUH 3QXAB 4U7KA 1ORSA 4HJ0D 4UIKL 3ZL4L 4PJAE 5DRWA 3FO1A 5CKGA 3KPMB 1GGUA 2OJZH 1MH5A 3CAFA 5HI4D 5JQHC 4HS6B 4KI5E 5IB5A 4LCWA 3GMNA 5FOJA 4KAQH 2HVKB 3QPXH 4JFEA 7FABH 2DQJL 4U1MB 1JWMB 4C56D 2EZ0C 4ODVH 1L7TL 1X7QB 5GRZA 4K3EL 5IB1B 4LSTL 4EDWH 1OWWA 2FO1A 1A14L 3KS0H 1JHLL 5FHAL 1OGAD 1ZGLP 1J1XL 1BECA 3RTQD 2AXHA 1S9XA 4Y1AE 3KPNB 4Q2ZB 2J6EA 4N9OB 4IIQC 1NMBL 3KPOB 1MIML 2DQGL 2F53B 5TQ0H 3Q6GH 4LPUA 3BSZL 3LN5A 2ICWB 3ZYIA 5J9PA 5LGJA 4I0PC 5CEXB 3G5ZA 2B20A 4NQUA 3P3YA 4FZEL 2WZPD 3TV3H 2YHGA 5FAAA 4H20H 4OFYA 4AQ1B 1X5HA 2XWJA 3EYFB 4H88L 4M7JL 3WLWC 4CW1A 3EO1A 3MROA 1HSBA 3MOBL 1KJMB 1MIEH 1X6LA 3RKDD 2C3XA 4HV8B 4QHMB 2NY5L 4F15C 3JV4A 3VXRD 1I1AD 5L2KB 2ESVB 4WI6A 4OUUB 4JRXA 3MRJB 1X5GA 2YMXH 4R4ND 5GGTL 5T1KA 4GKZB 3DRQA 5LQBL 4OD3H 1SJHB 3AXLB 5JXED 4P23C 4XPBL 5CSZA 5D71L 1KJ2L 3IFLL 4I2XE 3PXHA 5IF0A 2Z9TA 3C5SA 3VG9B 3NFSH 4HG4J 4F7PA 2P5WA 2CIKB 1G1CA 3QQNA 1U58A 5CZXD 4ZTPL 2HFGH 1T89C 4UV4H 2EDFA 4U1KA 3TO4B 2W1NA 5D2NC 5CLWA 2BVTA 1G9EA 1JZ3A 3LN4B 1EA9C 2E9BA 3ILQC 4NRYB 1MCHA 1N0XL 2DYPD 2JK5B 3ARDA 5ESAA 1FHGA 3KDMB 1U92B 1JZ8A 1G0YR 3WD5H 1YECL 2YEZB 3U82B 1VGKB 1GIGL 2A6IA 1IGFL 3F6IA 4A6YB 4W68A 2O5ZL 2DTSA 1FFPB 4XNUH 3BDYL 5C0AA 3O41B 1L0XA 4PTTB 5K59F 2IQAA 3DO7A 5LBSH 3MA9L 1B88A 4Z7UA 3QEUA 1GPOH 4P4KA 4Q9QH 4OCWH 2Q76B 4KRLB 1EO8L 2HJKB 3B9EA 2CKBL 4YX2H 4BQ6A 1PDKA 4YE4L 4O4YL 4HUWB 1G0XA 4U1GC 5B39A 5CHNA 5CJXC 5DJDA 2AXGB 5FUOH 2EH7H 3DBXB 5DJXB 3RWIB 3QI9C 1RK0A 1JZ4A 5BMFL 1B3JA 3NMEA 5JDSB 5KG9B 5IGXH 1BFOA 2D7PA 4JM4H 3MBXH 2MSPA 3CPLA 4HFUH 5FKPA 5KANG 4KRPD 1R0AH 32C2B 4JN1L 3KHQA 3CK0H 2QSCH 2Z31B 2OM5A 1QR4A 1WC7A 2VH5L 4I2XB 1EHXA 5I15L 5DVOA 3G04B 3WN5B 1YY8A 1JE6A 4Z7UF 5CS7A 5I30L 3WFHA 1DTUA 1G7LA 2H32B 4ERSL 4DZBB 3KLHC 2VUYA 1P7QA 4NOFA 3KGRA 1FV1B 4RA0C 3UO1L 3JV6B 3QB7C 2J8UA 1IC7H 1Z5LA 1OW0C 4K8RD 4X6DE 5TPWH 1BFVH 4GG6E 4WW1B 4JO4H 3AMKA 3DHMA 3WUWG 1UH2A 3JZ7A 2R1YB 2VL4A 1IGJA 4M1CD 4P49A 3W39A 5IG7A 3S96A 4APQA 3V0WH 1T1XB 3KYKH 4LASL 5AZEL 2AEQH 1E4KA 4FQJH 4OM0L 4BQCA 2A0LD 3DO3A 1LE9B 4NDMA 4NZRL 5DJ6A 4MCZB 5HYJE 4Z76B 1HKLL 5D7JD 1ORQB 2MOVA 4P5TD 4ZFOA 4JDVB 3PV6A 3C87A 2Q86A 3B5HA 1JCKA 1U8MA 2AK1L 3MBEA 5T5FL 1XR8B 5I1IL 1T1YA 2X42A 3LQAL 3UJTL 2G5BA 2BSTB 1JRHI 2J8UF 5C0FA 1MAJA 1KBGH 3WIHH 3WE6B 5TDNA 4LLWA 2FEDD 2NX5B 1NBQA 4ZFFA 1JPTH 1WWWX 2IFFL 2W59A 1PY9A 3NPSB 2C7UA 2FX7H 4F9PC 2DIAA 1OTSD 4NO2A 1TETL 4RX4A 4XBEH 1PLGL 4PBVC 4ZG1A 3QXUA 4ZD3L 3H9SE 2BFVH 1LDSA 3IF1A 3QCTL 5MEPA 4FTVA 3RKPA 3Q0HA 3BPLC 2DQFA 5CJ8A 3PDOB 4IRZH 3MLSH 4MD0A 5C08E 1IAOB 1QUNA 3IJHA 5EORH 4MA8H 1BQHG 2VL5A 5FA4A 3V4PH 4X6DB 1HYRC 3VXSD 5IUSA 2DRUA 4PTUA 2D03L 1F2XK 3VI4F 3P77A 2VDRL 3I85A 5C07E 3TT3H 1A7OH 5IWLC 1IM3B 1P84K 4H1LH 3NA4A 1L6XA 1HEZB 1HN1A 3IU4H 5B8CB 3HRZA 2A9NL 1QFHA 4YEFA 5ADOL 3GBLA 3QQ9C 1CDUA 5HYJB 4H8WL 3RZWA 5D1XD 4X6EB 3JV0A 3EDKA 5I1EL 2YS4A 3F7QA 3NH7L 3OAUL 3VWKA 2YWZA 3I6KA 2P44B 3TFKC 1R3LA 5DUML 5FYKU 1NL0H 3DGGB 1C16A 3MV8D 4ZODA 3H42L 4CVWA 2CDGB 4NN5B 2WIIA 3U46A 1KENL 1QA9A 3Q3GB 3GB7A 1TJGL 4OZGF 3ZSTA 3TA3A 1HE7A 4G7YH 5EBLA 4GBXD 4AK1A 2DKUA 4F8QA 1HZHL 5ACZB 3V6BR 4JHAL 3RWCA 3CVIH 5KSAA 3L6FB 1QBLH 4C59B 1TVHB 5ENWB 4QF1B 3H9SB 1NGYB 2FL5B 3HC0A 4QWWD 1SEQL 3MR9A 5FIEA 2WUCL 5CEYB 4HWBA 5C08B 3SCMA 4RZCB 4UDTA 4TUOA 4PJCE 2B0SH 1MJJB 3KPRD 4LAQL 4PY8J 3HE6D 2B5IC 3C5JB 1A3LH 3TP4A 2I5YH 1JI1A 1Z6JT 1M71A 5JIKA 3LKQA 5I8OL 1B90A 5C07B 3T77B 2V5TA 1KG0A 3F12A 4Y88A 5JUEL 3QIWC 1WBXA 5ISZA 4PJGA 3SDAB 1E4JA 4FQCL 4OQTH 2BNQD 5MI0C 1AXTL 3NBNA 3CSYB 1PW3A 1FPTH 1RJLB 4R97B 3BI9X 3C5ZA 1NH6A 4LVOB 4M43H 4XP4H 4Y4HB 3L5JA 4FQIH 4CDHA 2NTFA 1S3KH 1TQCC 4WDIB 5F96L 5JDJA 5DD3L 5I8EA 4NJAL 1MQ8A 4S1RH 5TFSL 1N5YL 4IHOA 1S9VA 1WWCA 1AJ7H 1EH9A 4BFEA 3NPZB 3SGJC 5ADPH 2CUHA 4Y8DC 4Y4FC 3MV7E 4PRBB 4Z7VA 2NXYD 1A6WL 4C83A 2NY1D 5CUSH 4ZDHA 4XC1L 1AXIB 1A6VL 2FNBA 1WF5A 3GMLA 1GGYA 4N1HB 4PJGF 4M5ZL 3VFNB 1HQRB 4IBLT 4M3JA 5E2WL 2PW2A 4PGBB 4X98B 3RNQA 4HT1L 4YXHL 1FVCA 4LOUD 2BRQA 5SWZD 4XVSL 4HFWB 5DRNA 4OLXL 1ERNA 1JYXA 4XPHH 5LAXB 4FP8L 4K94L 3X3GL 3RVUD 3RWGB 4FFYH 3O4LE 5EUKB 5GRUL 4Z95L 1RIVL 1ED3B 2CR6A 4BELD 5IEKB 3GKZA 4OLVL 5E00B 1G6RB 5TDPA 2HLAB 3RDTD 3OKMB 2FSEB 4NO5A 1SEBA 1UG9A 3ARFA 5F70A 3WV0A 5HD8D 1JN6A 1UKSA 5IT2H 3CCHA 3GDBA 4JKPH 1PAMA 4YQXH 5GGUA 5CKAA 4YLQT 2HLFC 1M1SA 1LP9A 1LDPH 5D2LF 3MRMA 3CU7A 4NUJB 4S1DD 4ZPVB 4NBZB 4PG9B 5ALCH 3H0TA 4OBSA 2R2HA 5KS9E 4YHPB 4HUNB 4HIXL 3UJJL 2ATPA 4ETQA 2BHUA 4OBRA 2Y1VA 5FGSA 3F65A 3FQTA 3OF6D 2ZUQC 1YPZA 4LAJH 2QHLA 1FG9C 5GRJL 4D9RD 1FGVL 2PYED 3GSQB 5JNYA 2MCPL 3QH3B 3QJHA 4U0RB 4PGJA 5DVLA 3D3VD 1DL7L 1MI5E 4UT9L 4LLUB 4AM0A 2P45B 2J5LC 4DFHA 3PE9A 3ULVD 3ZE1F 4OFDA 1EAPB 2IADB 4KTDL 1CVSC 2HRPL 5GGTA 1OLZA 5EOCJ 3O3AB 3O4LB 3U9PH 2FIKB 3LKOA 4F80A 4QRTB 3WFEL 4FXKA 4MAUH 4PG2A 5KSBA 4TVPL 1HH9B 1S7QB 1YN6A 1NFDA 3FQXA 3N85H 4HIHA 3QEGL 4MNQB 4L4VA 4HHAA 5DC4B 5EO0A 5C0EA 1CXFA 3T65A 3OXRA 3VU2A 3QIBC 3BGAA 4OF8A 1HWHB 1S7WA 4Y5YC 3VA6A 2BNRE 3FOLA 2YD2A 4HSQA 3QXTA 4NRZB 1U8QA 2BY1A 4NQEE 4S11A 2O5YL 2UUDH 1CE1L 3WO4C 3FFCA 4AL8H 1FC2D 2Q3ZA 2YZ8A 5D72H 1UXWA 5MENE 4OUOA 4M1DL 3WUWA 3QYCA 5KS9B 1CLYH 1WZMA 2R2BA 2X09A 4QRRB 3DV4B 2AK4A 2Q8BL 3FZUC 4L3EB 3PP3K 1T04A 2Y06H 1C1EH 1A6ZB 2XZAL 2GQHA 4R96B 3VH8G 2A77H 1NFDF 2CKBA 2K7QA 4JHZA 5EPMB 4HK0A 5ID1A 1JNHA 4LSQL 1MI5B 1HHHA 4FG6C 2XNAA 4MB4A 3EYOA 4OFKA 4KXZH 1OTTD 1S5IL 3Q48A 2A6DA 1XIWC 3ZMRA 2X4TA 2ADJB 5H2BA 3T2QA 1RZJH 3VXPA 4FMFA 2A74B 5DQ9B 5FYLD 3SGDI 4ELKA 4NHUA 4I13B 3W81A 5CWSB 1NDMB 4LEOA 3S3SA 1Q0YL 1ZVHA 3GBML 5T33L 4HK3J 5HHNA 4B5EA 1D5ZA 5DLMH 5AWNL 5SV4A 8CGTA 2FB4H 3WFBL 1AQKL 2K1MA 1F2QA 5B4MC 4TUKL 2X9XA 2MKLC 1MVUA 2BNRB 3MACH 1AGDA 1J9CT 4RQQB 1GZQA 3SDDC 3BP6A 3EJZC 3Q6FA 4M02A 4OJFH 1QFUH 5DDHB 4NQEB 3VFSA 3GM0A 1WCQA 1WICA 3PG2A 2P8MB 4YHOL 1IRAY 2C3HA 1BQHA 3IS0X 1QRNE 2DI7A 4UBDD 3QDJE 1JGVH 3OZ9H 4R26L 5MENB 1KC5L 3BKMH 1J0JA 4M48L 3HS0B 5E56A 1QHPA 3MOQA 5IFJB 1I3GH 3DV6B 1D5MB 1JTTA 2X7LA 1QLRA 1QQDA 1AKJD 3EBAA 4MA3A 4P2RD 3KPTA 3OR6A 2APFA 1DQTA 3GSOB 5AUMA 2VR5A 2WIMA 2XA3A 1SBBA 4QHKI 5A3ID 4P46B 4QHNA 3GIZL 4AG4L 5J6GB 4TSBL 3ROOA 4FQXD 3P4MA 4WFFE 1BAFL 1S7RA 1YEEH 3ARGC 4BFIA 3T8XB 2NY3C 4GUPB 1A6UL 4GRWF 1JPFA 3H3PH 3U2SB 5KW9H 3F7YA 4YGVA 4IRSC 1MHHB 1TLKA 4RGNC 5IHLB 4CADA 3DYPA 3PV7A 4LSRH 4JHWH 3FHQA 4NFCA 3JWNC 3W0WA 2CDFA 3VGDA 5JA9A 2IH1B 5GRVK 1C12A 2V5MA 2V2XA 1BJ1H 3OBAA 2BSSB 2GKIA 5CGYD 2DWDB 1KIQB 1A6TA 1NUGA 3HI5L 3LEVH 4MB3A 3VI3F 1QNZH 4WO4A 1BX2A 3TPUB 1UCBL 3S97C 4EIGB 4NBXB 5CEZL 5L2JA 1KEML 3QXDB 4XP1H 4R2GD 1MJ7H 5HHOD 4XWGH 3P0YL 5TF0A 2Q8AH 4XBGA 3RNKA 1F4YL 2DLFL 3W9DB 5H8DA 4NN7B 1JNLH 1SHMA 3QIUB 3X11B 3QDJB 2I9LA 1FFOA 3TIEA 3W9EA 1DBKL 2ZUVA 1RUPH 4HS8H 4WTWA 1DANU 2VLKD 4KKLD 1HSAB 2BP3A 2UYLB 1JPGB 1OCWH 1AGFB 5DMYA 4U33A 1DE4A 1OLLA 1FN4B 1KCLA 2AKRB 4P9ML 5J4MA 1YUHB 4DVBA 2VITB 3CXHJ 5T1DH 5TE7L 3U0WH 5C6TL 5CJQL 5EDXA