4OTZA

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with cystein
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with cystein
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
total genus 137
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4otzA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4otzA01
3HEBA 2HQBA 2KYRA 3JVDA 3TB6A 5BRAA 2WRZA 3C3KA 3FFTA 4KNYA 2NZUG 3LUCA 3GL9A 1FFSA 1NXXA 3LKVA 1I3CA 1XWWA 3I45A 3FMVA 3FDFA 2FTKE 4GPAA 4D6XA 5TQ2A 2F8SA 3KS9A 2HQRA 3R0JA 4LZLA 1FSPA 4D74A 1AB6A 4KFCA 1H9CA 1DRKA 1WETA 2QR3A 2RJNA 3QEMA 3VNAA 7ABPA 1U0SY 3CU5A 4P1ZA 2MYTA 4IF4A 2F8TA 1SD5A 4H60A 1PUXA 4JP1A 1M5TA 1USGA 4G0OA 4JB0A 2FMIA 2N9UA 3KTOA 3N53A 1SXGA 1F51E 5DCLA 5KQGA 4MLDA 2FLWA 2JVKA 2IOYA 3RVRA 4YV7A 5BR1A 1USKA 2GKGA 5CHYA 1PEAA 4L85A 1RZRD 4RK0A 3O1IC 3H75A 3TMYA 2RDMA 1BDJA 3C3MA 3HUTA 1RXEA 4G0MA 2NT3A 3RVJA 1HEYA 3N8IA 1NXWA 3DZDA 4KQ9A 5CNKA 5HQJA 3RVOA 5IBQA 4M88A 3KHTA 3N6VA 4N03A 4NICA 2L2QA 4RSMA 1JL3A 3O2JA 3QLUC 1RNLA 3IP9A 5GOTA 4KRFA 1VLZA 1UDRA 5GQSA 4RXTA 3K4HA 2A9OA 3LUHA 3MF4A 5KQPA 1YK1A 5TPWA 2FN9A 3ROFA 1M2FA 3F73A 4B09A 2QXYA 1A04A 4KK4A 3Q9SA 2A9PA 3M6MD 1SXHA 2JCGA 3H5LA 2ZWMA 3GV0A 3ROTA 4KPYA 1DRJA 2HPHA 3HSYA 2E4UA 4G0QA 1MB0A 1JDNA 5EWLA 2FW0A 4PZ0A 1Z18A 2YHAA 3Q7RA 3KSMA 3EULA 4MR9B 4WZZA 1YMUA 3LUAA 4ETIA 1FFWA 4QYMA 2ID7A 3N75A 3OLXA 5HM6A 3ILHA 5FWXA 2LUOA 5HKOA 4W5NA 4EYOA 3EAFA 2L17A 4FE4A 3OQOA 3Q7TA 2FVYA 3Q15C 4N0QA 1LK0A 4ETMA 3KCNA 3O1HB 1YMVA 4LDZA 5FBHA 1DCMA 5HSGA 1QP7A 3HXMA 2PUAA 3QX9A 2PUBA 4Y9TA 2E4YA 1PNRA 2FEWB 2CHEA 4KMRA 1CYEA 3CRNA 1VRVA 4N76A 3MA0A 1AB5A 9ABPA 4JA2A 3RVLA 5KQMA 2JBAA 3LUGA 1IIBA 2PLNA 2QSJA 3QELB 4MR7A 5EWJA 5JNRA 2R48A 1U8TA 2CD7A 3C97A 4WUTA 3T6KA 3HVRA 3E3MA 4MS1A 1BVHA 1TVMA 3T38A 4H3KB 4W5QA 2QV0A 3I42A 2QVGA 2E4VA 5C5EA 3LMKA 3MQ4A 4LE2A 1ISSA 1D1QA 1Y1LA 1QQBA 1SXIA 5CNJA 3SY8A 4RK6A 2RJOA 4ZMRA 1APBA 1QP0A 1S8NA 3G85A 4RK7A 1QP4A 1L5YA 5JS1A 2H3HA 3OM1A 3NNSA 2JVIA 3OLZA 3CZ5A 3HUUA 1SRRA 3EGCA 1ZITA 4OG2A 3O21A 5IX8A 3SQNA 3LTEA 1NXSA 1ABFA 1JHZA 4DADA 4MQFB 4ZMSA 4RDCA 5JNWA 1ABEA 1JYEA 2L18A 3JPYA 4O5AA 4MYRA 4RXMA 4WWHA 2B4AA 3HK2A 3LUDA 2WWVD 1EWTA 3T95A 5D2CA 1K66A 3KG2A 2WMYA 3OMWA 1NXPA 2V0NA 4RS3A 1Z12A 2TMYA 4YWHA 5C5CA 3EJWA 2QZJA 1RPJA 1DP4A 4TMYA 4RV5A 5KWSA 1FFGA 4PYRA 2WY2D 3CFYA 3SNKA 5EWJB 3UK0A 4E7PA 4Z99A 1QMPA 2AYZA 4G0PA 3HCWA 3O2SB 4H3HB 4PEVA 4MS1B 1Z2EA 1Z16A 3GBVA 4QYWA 2A9RA 3QEMB 2J48A 3KLOA 3GA5A 2E4WA 4EYQA 4EY3A 4Z4CA 1EWVA 5ABPA 4MS3A 3LOPA 2E4XA 3D02A 3KYJB 5B3JA 4OLAA 2R4QA 1EHCA 1ZH2A 2IPAB 3D8UA 5IEJA 2FEPA 2OQRA 3A10A 4NQRA 5TPZD 1DJMA 3OQNA 1D4ZA 1ZVVA 3HO1A 5FWYA 3QLVA 5IUJC 3HS3A 5TQJA 4Z4HA 3IP5A 3RVMA 1ZH4A 2VYCA 3K9CA 3RQIA 5TQ0B 3L6UA 1NATA 4OBBA 5PNTA 3GYBA 4YS6A 1CEYA 1QO0A 4HNQA 1VPWA 3M9WA 1ZY2A 2FKAA 3JS5A 4DN6A 2GBPA 1NY5A 5I4CA 3URMA 5E3JA 1EAYA 2LPMA 1OXBB 1KMIY 1JFTA 3RVSA 4EUKA 5JS2A 4JASB 2HSGA 4Q6WA 3CKMA 3Q7SA 1YS7A 3DBIA 4MGEA 1Z26A 5TPWB 4UHJA 4MRMB 1YIOA 2JRLA 3OLVA 4RK4A 3CS3A 1TM2A 3O75A 1P2FA 4KZKA 3N0WA 4ZJPA 2MSWA 3RH0A 1RZRA 4XFKA 2O20A 5JNUA 4QICA 4RU1A 4HYEA 3FFWA 1BDHA 1CHNA 1J56A 4YRZA 4O1HA 3A0RB 3B2NA 3A3KA 4TN5A 4WXMA 4ZYLA 5T7BA 5KQLA 3KYIB 4MQFA 2QVCA 3RVKA 4XARA 4NCBA 2AYXA 2FSPA 3N0XA 2BGGA 1C4WA 4RWEA 4MRMA 3MIZA 4YCSA 1URPA 3KKEA 3H1GA 4YO7A 5JNVA 1JFVA 1DBPA 4Q6BA 3C6QA 5F64A 4MR8A 3EQZA 1BDIA 4WXEA 5IUKC 3NNNA 1JDPA 1E6MA 3TD9A 2ID9A 3M9XA 3JTEA 3F6PA 4IGAA 4ETNA 5ED4A 3BILA 5DTEA 4Z9BA 2IPLA 3GRCA 1MVOA 1Z17A 4KK3A 3O74A 1LBHA 2FN8A 5DKFA 3QLVC 4OLBA 1K68A 3A0UA 1JH9A 4FB4A 2QU7A 3NNDA 4RY9A 4G97A 1ZN2A 3QK7A 1QNLA 4D6YA 1U2PA 4S04A 4RK5A 3OLWA 2IKSA 1MB3A 4PICA 4TLLB 5EWLB 5IC5A 2CHFA 1P6UA 1P6QA 2P9HA 2VUHB 4LDAA 3W9SA 2CWDA 1ZAYA 2Q5CA 4JOQA 5JNSA 1YVUA 1YTUA 3FGZA 1TJYA 1ISRA 4DQDA 4MS4B 4RK1A 1R8JA 2W42A 1D5WA 4RY0A 1GCAA 2IPNA 1JWLA 4W5OA 3GWGA 2MSKA 5B3JC 2PUFA 1ZESA 1U2QA 2WB4A 4UHKA 1QPZA 3O1JC 3UUGA 4F8JA 4IILA 4MS4A 4IMJB 3QX8A 3F6CA 1DBWA 1JYFA 3KLNA 5T3YA 1D2AA 1NTRA 4LRQA 4N41A 2IPMA 2QW1A 4HNSA 2ZAYA 1XHFA 1EWKA 3GT7A 4JAVC 4XASA 1VKRA 2PUDA 4ZPJA 2FXIA 4L4UA 2OENG 1FQWA 3LUFA 4LX8A 3OM0A 1KRXA 4NCAA 1M5UA 2XDYA 1EFAA 1RXIA 1TLFA 3OMXA 1QQAA 3ILYA 3LUJA 3HJFA 5JNTA 3JPWA 3CZCA 2MSLA 2FMFA 2P4UA 1OXKB 2YHBA 4HNRA 2A9QA 1PEYA 3KJXA 2IDMA 4RXUA 2RGYA 4O1IA 4N47A 1LJUA 1TMYA 4W5RA 1ZDMA 4EGSA 2WJAA 5TE9A 3NHZA 3EDCA 3G1WA 5TQ0A 4KREA 2LP4Y 5TPZA 1DC7A 1NXOA 4F06A 2JB9A 4S05A 2VUIB 1GUBA 5DGCA 5IUNC 1KGSA 1A2OA 2FQXA 3HM9A 1PNTA 2I6FA 5EWMB 1GLGA 2FLKA 1P8AA 1W25A 3CHYA 6ABPA 2GWRA 3HDGA 3IPAA 3LFTA 3MM4A 3H5IA 1NXTA 3T8YA 4EVQA 5KC9A 3I09A 3SM9A 4MQEB 3VNBA 3OO1A 2M1ZA 3CG4A 4MS3B 4QPJC 4IMIB 1JLKA 1MAVA 4RZSA 4KV7A 2GX6A 4MPTA 3I5AA 3LKBA 4WT7A 5BQ3A 1XHEA 4IRXA 3RVPA 4F3TA 2PJUA 1E2BA 3NBMA 5KI6A 1DZ3A 3QLTA 1E6KA 1DC8A 2PUEA 2PE5A 1B00A 2MYPA 2B1JA 1JX6A 4MLCA 3CG0A 4Z4GA 3H5TA 2IYNA 1BAPA 3IDOA 4KVFA 4MQEA 4XLTA 2H0AA 1JFSA 1T34A 2R25B 1JF8A 2JK1A 1DCKA 4FE7A 2PUGA 1Z13A 3DGFC 1JBEA 1L5ZA 3F7NA 3MMNA 4GNRA 4YP9A 2R47A 1LBIA 4PE5B 3N0RA 4CBVA 4LE0A 4EYKA 8ABPA 3HZHA 3EQ2A 2MYUA 4Z4FA 4JB2A 1U04A 3BRSA 2PAFA 1D1PA 4KQCA 1ZHHA 1QO0D 1DCFA 3H1EA 3Q41A 4F12A 3O2QB 4Z9AA 1MIHA 2NT4A 3JVIA 5CNMA 1E6LA 1USIA 4Z0NA 4MR9A 5KC8A 2FEKA 4XAQA 2FMKA 2HJ9A 3E61A 4RKQA 4G0ZA 5FWXB 4G0YA 1Z15A 1F4VA 2LIVA 1DG9A 1LJLA 1QKKA 5FBKA 4EVRA 2HQOA 2NZVG 3C3WA 3H5VA 4OTZA 4RY8A 3DGEC 2JVJA 2MYNA 3LUKA 4RKRA 3H1FA 4YR7A 2DRIA 3MYYA 4P98A 5CNIA 1PHRA 3EODA 5DLEA 3RVNA 4G86A 2FQWA 3H6HA 3FFXA 3NHMA 4YLEA 5IEBA 3BREA 1NXVA 3H5OA 4TLMB 2JBAB 1YK0A 3OQMA 4Z4IA 4MR8B 1C0EA 3CNBA 3BRQA 2PL9A 4EYGA 1A0OA 3BBLA 5TQ2B 6CHYA 5FWYB 2LBPA 2X7XA 5EWMA 2PMCA 2VK2A 3H5WA 1M2EA 4W5TA 3RVQA 5BRJA 2GI4A 2NUBA 1YS6A 1DBQA 2WJWA 3HDVA 4LE1A 3UKJA 1KRWA 3L49A 4Z4EA 4YGXB 3SG0A 2PUCA 4ML3A 3IP7A 3P9YA 4N0PA 1Z25A 3GBPA 3CTPA 3QLUA 4OATA 3TX6A 3SAJA 1W9HA 1ZGGA 2FMHA 5IULC 1GUDA 4NV3A 4G0XA 3DLHA 1GCGA 4MAAA 4E7OA 3QELA 3CLKA 4MR7B 3S99A 3DLBA 2PL1A 3HV2A 2L19A 2E4ZA 3OO0A 3IPCA 1BA2A 3IP6A 3QEKA 4Q7EA 2FQYA 4XXHA 3TO5A 2M98A 1ZGZA 3H6GA 2PKXA 1Z2DA 3OLYA 4EVSA 3JY6A 4F11A
chains in the Genus database with same CATH superfamily
4P5DA 1IQUA 2ONYA 4NG4A 2XR1A 3IOEA 4PGAA 4TS4A 4BGVA 3GVCA 4M7OA 1V47A 3ZX4A 1A3CA 1KI8A 5L53A 2OO7A 3U4QA 3GO4A 2NADA 3IGFA 3A37A 3CE6A 1PV4A 4WE3A 1OYVA 2C1ZA 4XSVA 4Y6RA 1AUXA 1UMDA 3I45A 5BV8A 5C7LO 4GPAA 3JYOA 2DUUA 4NNOA 4UBMA 4UMEA 3ZIAA 1ZJJA 2D5AA 3TTTA 4D3ZA 1GUYA 1N2EA 3PYLA 3ADKA 2A7XA 2WFZA 4IVNA 1EP1B 3DMPA 2ZG6A 1AHNA 1N9ZA 4O4JB 4NJOA 2E21A 2ISSD 4W1SA 2QY6A 3H2KA 1PNVA 2FY8A 3H65A 3ZBTA 3HBFA 4RTLA 2IHNA 2P1DA 2DUWA 1EJ6A 1TIBA 4RH0A 4EO9A 4IIYA 3N8KA 4XVHA 3IEUA 4DXAA 3AM1A 3GYGA 1H2AS 4Y2UA 2JVKA 4PO3X 3G8AA 3SIXA 4Y2VA 5JH7F 2Z6UA 2C3YA 4NBKA 5IYZF 2XCRB 3WQQA 5AUNB 1I5OA 1YULA 1I3MA 1BOFA 2EZ9A 2QRZA 3SR0A 1OX4B 3OEED 2Y68A 3ESXA 3ONDA 1LPSA 2C4VA 1WXHA 3Q0EA 1SG6A 1FK8A 2CHUA 2W2OA 3BX1A 3OIUA 2V59A 4NKRA 5LMNB 1VG0B 5BWNA 5JS7A 3E22A 3DFFA 1ZD9A 2WQZA 4MGKR 1N6LA 6ADHA 2GYVA 2VZEA 3VZCA 3L46A 4TTSA 5E3HA 4AP9A 5CFMA 4D46A 3BJEA 1B8UA 2XW6A 3ZE0B 1BDMA 4DV7B 2JLWA 2VK8A 4HF7A 2FX5A 1G5RA 4FOTA 5D3MA 3HRHA 4O6VA 1EAMA 1NQVA 2EAUA 1T36B 4M38A 4LRYA 2I2BA 1VPEA 2HJWA 1KWKA 2GDJA 4QLBA 2HKIA 3F8WA 4AJ1A 1SCQA 4Y1GA 5CDYA 1G3QA 4OBXA 3OZVA 4V0ME 4PLYA 4BUJA 5LL6P 1USVA 4C7VA 3GGOA 3P4UA 1E2MA 4XIIA 4D9BA 1A04A 1M6VA 1QIHA 3HJGA 4QARA 2A9PA 4QYIB 5CEEA 3AHCA 1T6ZA 3GFOA 4LXXA 1ONPA 4GEGA 1VOTA 1SPBS 5IXSA 5FWAA 2QRKA 4ZDWA 3SEAA 2BKLA 1EESA 4EG5A 2XCQA 3DO5A 2GERA 4XR9A 2D3TA 2GF0A 5JQGF 4KNWA 2IE8A 3IERA 1VB5A 4QYMA 4BO2A 1JN0A 2H0QA 5EYPB 5G4KA 3ZKWB 4B5LA 4C4AA 3ZJUA 4ZTUB 3CKLA 3HP7A 4I5GA 4E13A 2D0PB 3BZWA 2QYTA 1DV2A 4IDPA 3PL1A 1HC7A 5LBUA 2AXEA 5IASA 4NU0A 1HYEA 4JLBA 3R4CA 3L05A 5CM2Z 1TCBA 1OKKA 3T3IA 2AVNA 3OECA 5B6IA 2PUAA 3BMNA 4CF7A 5AJVB 4A7PA 4YRAA 2JAWA 2OKCA 3IQHX 4N5DA 4MV7A 2C96A 4CLRB 2FJ0A 2CHEA 4KMRA 2HSJA 4URYR 1YT5A 4KI0A 4XW2A 3HU5A 4MHSA 1VC2A 2OHVA 4BCCA 3G2IA 4L7VA 3B3AA 4MEBA 1P44A 4QPPA 3MC1A 4A23A 3VR2D 2ODNA 4OI4A 5KQMA 1DBVO 1GVNB 1SVMA 2CK3D 3KKPA 3R76A 3WSTA 2OGZA 1ZH0A 3Q5GA 4L51A 5KNBH 3H9CA 1CKEA 5IP5A 4ENRA 3AFIA 3UMFA 2J3JA 3GMDA 4RL6A 3V4OA 5HRUA 3PEVA 2QT9A 3VSEA 3ZBPA 4L8GA 2OBNA 4H16A 1M34A 3G2LA 3R3XA 3KFXA 4WERA 2G9QA 2YCBA 1TJPB 2ZRPA 4BLWA 1YBAA 1AK1A 1EGQA 2BW0A 2WFLA 3IUBA 3QUCA 4LE2A 3EC2A 2X8WA 3GG9A 4FFMA 2PRIA 3R6WA 4MWCA 4PG6A 1WQ1R 3AG5A 1FDRA 5TF0A 1YQ9A 1JMYA 1Z8HA 1NVTA 2AFRA 2YJ3A 3GPCA 4RMGA 5KYUB 1RHUA 3K2QA 4ZZIA 1QO7A 6NULA 1WU8A 2BM8A 2H3HA 3KKNA 4IXTA 3ZCVA 1SVNA 2GBLC 4J03A 3CUYA 1NE2A 4IKOA 5E1BA 1NXSA 3VHRA 3EQ8A 1CK4A 3MT9A 4BLRA 1QG4A 1P19A 2PSFA 3GLFB 4PTLA 3DONA 4JBIA 5IJ9A 3KQWA 1XDUA 3HYCA 1UC8A 1S1CA 4ONEA 1OBVA 4Z49A 4EY5A 5K8TA 3VYTB 1N32B 1TMGE 5AKEA 5ALIA 2PDAA 4ZRMA 4BLPA 1XU7A 5AW7A 3R4VA 3UMYA 1TJ3A 1V95A 1SOMA 2CNWA 5KHAA 4IQFA 1MW8X 1FLAA 2GPAA 4U9IS 4KX3A 1PT8A 3F9IA 1O6BA 4MB0A 4K28A 4DCPA 3KKMA 5JD5A 2RHOA 3DH0A 5JD3A 4ARZB 5JQGA 5EMNA 1IEVA 1LBQA 2YS6A 1DJQA 3KSDO 1A8PA 2GLUA 1TKAA 4WZAB 4JI6B 1Z5ZA 1KTIA 2EFDB 2VJPA 3HCWA 4H7PA 1S2DA 2ZYRA 3R7WA 1U9IC 1ZI6A 2ZSJA 1JE0A 1Z2EA 3Q4GA 3QU9A 4YJ2A 5ETJA 3F6BX 2PX5A 3A58B 1MJGA 3CUKA 2QYOA 1CQXA 1AHIA 4AIRA 2BEJA 1FJHA 2AR9A 4B7ZA 4QYXA 2IF2A 2ZTMA 2QRUA 4MKZA 4Z4CA 1B6RA 3G1UA 3BWCA 1GGVA 4FEAA 2P4SA 5B3JA 2HWKA 3D02A 3I0MA 2FQ1A 1KVRA 3KYJB 1QZ3A 2CMHA 2C5HA 4KXMA 4XWOA 4K7JA 3I1JA 1ZM7A 5HF8A 1H5UA 2C0QA 3DJYA 3IHTA 5DXAA 3AUSA 2J07A 5BPHA 2JJMA 3HS3A 4WY2A 4M2LA 4PZDA 1R0SA 2LVBA 2WUGA 3PD1A 1PR1A 4OHXA 2JJ1A 4Q7KA 4R1PA 4PIVA 1DEAA 4F6CA 1I4LD 2BDEA 1L7EA 2PSDA 3C3YA 5I01A 4LYYA 4OLFA 1CR2A 5C7OO 5H9WA 3WI7A 5B1EA 4OYLA 2Y9PB 5I4CA 2C97A 4RMHA 1OZGA 4ZCMA 1M8GA 2GFIA 4M54A 1E0JA 1E1QD 2GN9A 2ZJYA 1U3TA 2YN0A 2ZRKA 2EFYA 4L72A 4I46A 3B3FA 1MG5A 1T35A 2X86A 3LUPA 6YASA 2AUNA 1N5OX 3M3HA 2GEKA 3UXHA 4C89A 1D0SA 1PQWA 2EZTA 2PMWB 3K32A 3F2VA 1R4AA 4B79A 3OLVA 2VTEA 2PR7A 4YP6A 4Z9XA 4ARZA 5GZ3A 5EZ6B 1ID1A 2OORC 1RM5A 3K0HA 1V3TA 4IJQA 4C4SA 3B6EA 3BT7A 1WUYA 3DYBA 4QECA 2NNLD 1LLCA 1C9MA 4IV5A 4ENQA 5KOYA 3NMUF 4DV1B 3FFWA 3H8WA 4NZOA 3JARB 3VVCA 3C2QA 2OBBA 2ZVPX 2YXNA 3HXOA 4TN5A 3TFQA 4PNZA 1W35A 5CDGA 3S29A 4FJ0A 5LOVB 2AYXA 4L27A 5A9TA 2QX6A 4P54A 4RZ3A 4F96A 4MJ3A 3SEFA 4M49A 2WABA 3LYHA 1U2RA 1ZI9A 2UAGA 3CUWA 3H1GA 5JBQA 2GJKA 5JSFA 2MWMA 4BDSA 5KYUA 3QTBA 4JQYA 1M6WA 3UJ3X 4F6RB 3ZEIA 3NNNA 4P81A 4YROA 4JUBA 2JNWA 4DEXA 3BGSA 1MNAA 1Y80A 2DETA 1E32A 5CB4B 5JYBA 1CZRA 2WP0A 4RL4A 2QL9A 2HDWA 5IH7A 5ED4A 1E8MA 1KZ6A 2D1YA 3FF1A 3O2NA 4PXSA 5HQTA 3QLVC 2DBZA 1JH9A 1JYSA 4CCYA 2SKCA 3AF0A 3RC1A 2VN8A 1M6VB 3TPFA 2BMFA 4CIXA 2XA2A 4S04A 3V3TA 4X6XA 4RZHA 3VC2A 1IAVA 4F91B 5L6LB 1VHQA 4PICA 4JJAA 3A1NA 4WXPA 5F33A 1P6UA 1CY7A 1F1JA 4GXTA 1TCVA 4MJXA 3MLEA 3NETA 4R2LA 4C29A 4DV2B 1Y37A 3ACDA 1VLQA 3GARA 4MS4B 2IPNA 3TLBA 5CPFA 4V2IA 3H4VA 1P2SA 1LC0A 2WB4A 4GO1A 5ENZA 3GXOA 2Q7XA 2WSBA 4QHTA 3ZK8A 3O1JC 3PR2B 3TPCA 3DP7A 4I4NA 4LRWA 3F6CA 4NONA 3D31A 4Y8VA 2OHIA 3AJDA 4I14A 3SICE 3S7ZA 2P2GA 3DE0X 3WYFA 2G4VA 5REQB 5IKEA 4HNSA 1TZMA 4XM2A 1U0BB 4O4IF 4X62B 4DIDA 3FOCA 3LLSA 3QFFA 3H8VA 1DEOA 2F43A 2HDHA 3MRSA 1CTQA 4IV8A 3SKXA 3BMOB 4BV9A 4RKEA 3I04M 1KOGA 2XDYA 1RAGA 3CYFA 1GRCA 2MT9A 2Q28A 2HA7A 2VWPA 3EXIA 5JNTA 1EUCB 3AVUA 4IDHA 2J0EA 2WAXA 3DEAA 3G68A 1ZRSA 2PWYA 1Q0HA 3JWJA 4QGBA 3O03A 2EVWX 3QIAA 4ABTA 2PT6A 1TMYA 2ZRJA 2Y9MB 3G0IA 4PS1A 1F06A 3OOEA 2XD4A 1WPGA 2WU0A 4PZ9A 3TD2A 2VPPA 2WJ6A 4KREA 5FBVB 4ESHA 2OVBA 3EVFA 3AEZA 4O2AA 4DQUA 2AFVA 5IARA 3T3DA 4HB2A 2IU3A 2B21A 3FBTA 4WCFA 3HU2A 3G89A 2SECE 4ZCQA 4A8HA 3FLAA 4MW4A 1FZTA 3QOXA 2X0RA 1Z82A 3OTIA 5DV9A 2IBTA 3I09A 1MP0A 4MS3B 4FP9A 4ZI7A 2ATCA 2H5LA 4IMIB 1GQFA 5K6TA 5LIRA 2QGZA 1EDZA 1TDJA 3EUEA 1JQDA 1W4CA 3DD1A 4FWBA 4LJ5A 4UXJA 2WYVA 4CF4A 2QLBA 4EQ6B 5DWDA 3KQQA 5SY6A 3U2QA 1W2WB 5AUPB 3RVPA 3IVRA 2VYVD 2QS9A 4XD7A 4CT5A 1VSBA 4RMJA 1K7SN 1D4FA 2V4MA 3MBKA 1OC2A 4ZQHA 5BOSA 4GI5A 2CEAA 5AW1A 4LWPA 2Y93A 2BVNA 2F43B 3MRTA 4K9OA 4IL5A 5B1IA 3M6AA 3SS9X 5DO9A 1ECBA 2IYNA 3ZU4A 5LWQA 4Z4GA 5B1SA 4BXOA 1EUDA 4K9QA 3IDOA 5JASA 3G59A 3O7MA 4IXMA 2GF2A 2P3OA 4RGQA 2VF2A 4X95A 4QU0A 4NG5A 1V8BA 2GXUA 4O8ZA 4H7IA 2IA5A 2X42A 1EFPB 3TCKA 3U7QB 3DC7A 1GPBA 4PLGA 3HNPA 4FBMA 3NJ8A 4H7FA 4R6XA 2KB0A 4XH9B 5FL7D 4CHTA 1MJ5A 3H7IA 4FI3C 4CEIA 1BKDR 1X38A 1XVIA 2QP9X 4LE0A 4M7PA 4LJKA 4Q37A 4AN4A 2ZBFA 1CNEA 4D97A 3R9XB 1ORIA 4JXXA 1QHHB 5DZSA 2NVUA 2IH5A 4YCJA 4WD3A 1ZD3A 4CV2A 4EPYA 2WSLA 4AG3A 1IG0A 4I55A 3BTSA 4ZQIA 3NDIA 4EG6A 3CF6R 2HYDA 4EGQA 4EB0A 5HDQA 3VKUA 2NX2A 3TNLA 1ZZGA 1P2UA 1MV8A 4CIWA 4PN3A 3M7IA 1PL7A 5HXAA 5MN6A 3ADPA 1BFUA 3CO5A 4EKIA 1L4NA 3AVXA 3SZOA 1F4VA 4DR1B 1DG9A 1QKKA 3RD5A 3DTVB 3H5VA 3L0BA 1SXJC 5I9TA 1TZKA 1FXWF 4P93A 1Y63A 3HKDB 1BS1A 3QKSA 3RYHA 1CRPA 4E5SA 5J5VA 2XQJA 4ND3A 2WHYA 2FMUA 4YLEA 1NAHA 4NP6A 2GCPA 1QBKC 4YI3A 1UMKA 3K1AA 2VR1A 3PNMA 1Y82A 1EVYA 2ZBGA 1KJNA 3PJEA 1T1SA 1P45A 4FR2A 4XM1A 3T3GA 3BRQA 3AR8A 1KO4A 2RHBA 3LTNC 2H7VA 3CO0S 1A9TA 4D9HA 1RABA 3RM3A 3CN7A 4MARA 1YB6A 1JAXA 4DIFA 2Q4OA 1JHRA 2UUPA 3KPUA 2VNSA 4I1VA 3TOZA 2GRJA 4DLRA 4RJTA 3T5AA 1N25A 3AEUA 3I92A 3N3AC 2I22A 5C18A 4CEIB 2ZSUA 5JMPA 2HTEA 3TLAA 3IP7A 5FHRA 1R15A 4UNPA 1DS6A 2SNIE 4EA8A 1GDTA 2Y1OA 5HZMA 2FX3A 1UBLS 3ETNA 1YRHA 4M89A 4MO9A 3DV0A 3WP0A 2VDPB 4ENVA 3GUZA 5EQTA 3FVQA 3LKZA 3CEHA 3IVCA 4BX2A 5UKDA 4D44A 4YRKA 4FM9A 3T4EA 3PLNA 2FV8A 3S44A 5T4HA 5LQKA 1I6MA 3NC4A 1XLVA 3H1PA 1W4AA 2ZYUX 3EZXA 4PZCA 3I2IA 2NW6A 2HADA 3HWRA 4HDOB 4ZODA 1OY1A 2UYHA 1EUZA 1V26A 2SHKA 4PYQA 1I7PA 1S3IA 1I1NA 2JGRA 2WW8A 1XP5A 1IWOA 3G7SA 2XKBA 4G4JA 4K8OA 4AK9A 2ZJFA 2Y99A 1MIOA 2M6SA 3PFFA 3DEHA 5EZQA 1YAHA 1GPLA 2BGKA 3H1BA 1BCSB 3RHZA 2AKYA 1Z2DA 1I2BA 2IUSA 2PKXA 2PBFA 5DHPA 5DYYA 4EVSA 5I48A 5TDHA 2HQBA 4JEUA 1DQPA 3BE5A 2GEUA 5IM4A 4JB3A 3TVDA 1M0SA 4HV4A 2O7QA 3WNDA 2KW5A 1YA6A 3PFWO 4U2CA 4CQMD 1UOEA 2YY6A 3E6AA 3FMVA 3HLTA 4ITUA 2FNAA 3GNLA 1Z08A 2MIIA 3DHWC 2YHUA 2AR7A 1OPRA 4HJXA 3WB2A 1SBNE 1YI1A 3ZE1B 3BH0A 1AUQA 1I8TA 3DEKA 4CMIA 5DHRA 2Y0BA 3D0RA 3KSUA 3NYIA 3ZWPA 1E9EA 1OB2A 1NW8A 3ITNA 3OCZA 3T52A 4Q47A 5DM2A 1ZC3A 2Y1CA 3LGXA 3LPAA 2EKPA 3PKJA 2Y27A 2G5TA 4UPVA 3LWNA 2IZOA 4X7RA 1ESMA 1EZZA 2M32A 3ZDYB 5HF5A 4C6TA 5G41A 4GMHA 3G7NA 2YZ7A 3NVAA 4HADA 4RHTA 4D0GA 4Z7JA 1Q1BA 3EGXB 3BFVA 3EIQA 1L5OA 1BXRB 2QRNA 3ML1A 4MMXB 3EEBA 4JJ4A 5LLDA 1U9ZA 2WICA 2H08A 1X9IA 3FH0A 3Q6MA 4BFVA 1J0AA 2Z3ZA 3FWYA 2ECPA 2FW6A 1NW4A 2VQ3A 1K6MA 2JH9A 4CN8A 2OK8A 2FEMA 1Z34A 4BKMA 4RY2A 4B5KA 2FRDA 1ISJA 4M88A 3DOJA 3AV3A 4HNAB 5JXGA 2VSFA 4JKIA 4X65B 3VVBA 3U1BA 4Z3DA 4II7A 1V2HE 4BMZA 4V39A 1TZ2A 2JPDA 5A9SA 3U4GA 1W1IA 1TEHA 2AOUA 5FLXA 3LUHA 1YK1A 3EGIA 3PXUA 2RGBA 3GLSA 1WAMA 5K3BA 2C9CA 1QHFA 2AQIA 3MSXA 4HWOA 3TAXA 2VDUE 3E84A 4CU2A 3FKJA 5FX2A 4FMDB 1P4AA 2OV2A 3B85A 1XZDA 3K31A 1R0WA 4LC9A 3Q7RA 2YHAA 3JVVA 4UATA 4WN9B 5G1PA 4EAAA 4K1LA 5FR2A 1UK9A 2VDOB 2VNJA 3N8HA 2UVDA 2IXBA 3ACCA 4GFDA 3FF4A 3P9IA 1ZEMA 4C7OA 3A1FA 4DG5A 1QH8B 2QGNA 3EFHA 2OFFA 2Q99A 1JRLA 1OFVA 1GPJA 1PWHA 3RRBA 1TT5A 4W5NA 4HBGA 1DTEA 2VHQA 3JRXA 2BCJQ 3GDWA 1TRHA 2L17A 5KREA 4IWXA 2BYTA 2VNIA 1XBTA 4FGLA 4JBLA 3ICEA 3SJBA 2H17A 4TV9B 1ADJA 3K94A 5JMOA 1KVTA 3E23A 3ZD7A 4DR3B 3SBOA 1L5LA 4ILKA 3EPKA 1F2VA 3SYLA 1LLQA 1OAOA 3LOQA 3NQ41 3B12A 3PT9A 3RYHB 3ZY4A 4KYVA 1V9LA 1MHTA 3HWSA 1P2BA 2W71A 5K8JB 1YRAA 4KYIB 4IDNA 1WDWB 1ULUA 4G41A 4J9VA 4MPJA 4MTLA 4PNPA 4DYDA 5CEFA 2O57A 4MYSA 4BCDA 3LQ1A 5GTDA 4XWWA 2GPYA 4BU0A 5DCUA 4BLVA 1NW9B 1L8LA 5F1OA 4MS1A 2QK4A 2VAXA 5H7XA 5LNK6 2XRZA 4ZWNA 5I7FA 2ZRHA 4DVJA 5LZ2A 2ZBQA 1YS1X 2BGWA 2B94A 1ZCFA 4QVIA 1G3IA 4YCBA 1UBMS 1YO6A 3I34X 3IV7A 1U3FA 5IF3A 2H57A 4RK6A 1NW6A 3I6QA 3OOSA 5DULA 3DMHA 1GVHA 3UTCA 4JNKA 1S8NA 3UFBA 2XXJA 3HWWA 4AJ2A 1IN7A 2QHXA 3U17A 4IFTA 1QBGA 1UJ4A 4US0R 3B6KA 4F21A 3Q8XB 3RT7A 3KEFA 1N92A 3LTEA 2WJ3A 4DADA 5A4FS 3B6JA 1PYDA 3AHEA 1A7AA 2GEBA 1T1JA 4ZOLB 1UKCA 4HYTA 4DG9A 5FBQB 3CRW1 3WLPA 4NYIR 1P91A 3M6IA 5SYNA 4LHSA 5ALSA 5H70A 1XZKA 3M1YA 3O90A 5FPKA 4UHBA 1GKLA 4KWHA 4YWJA 1EB8A 2VHTA 4B3GA 5EIWA 4M83A 1L4MA 4PONA 3Q3VA 2VHZA 2RCYA 4UTRA 5A0TA 1Q1GA 4LNHA 4ZDIA 4YT2A 1BSVA 4L22A 4HUJA 3VR1A 2XUPA 4H3HB 3PEYA 3UB4A 1H0KA 2BKEA 2J8ZA 2Y6VA 3V3KA 1R0YA 4RLHA 4EWLA 3W5HA 5AHRA 3KLOA 3HKCB 5JO0A 2W37A 5KTKA 2AK2A 4FFNA 2VSNA 2OO3A 3O8DA 1AJEA 4KGVA 2P2YA 3VSBA 2R751 2P30A 1HE4A 3CX8A 3HDTA 3R7FA 3IT3A 3U3RA 3ZK7A 4D7AA 1KMHB 4KUEA 5AVOA 3ROXA 3VU0A 2GESA 3AO0B 2VZLA 2YFHA 5AVUA 5KAMA 3A4IA 4RIIA 4KYTA 2AJTA 3RHSA 1JHYA 3EMVA 1DVRA 5EPOA 1AZSC 3IPXA 2NO4A 3CEAA 1EVLA 3EXHC 3V00A 5FWYA 4HDAA 5ESDA 1ZVVA 1MOSA 2ZPTX 5AD1A 1VIVA 5BVHB 1XA0A 1PJSA 1RJGA 2PRYA 2CNDA 4UHCA 3RB8A 1NJFA 3D7RA 3SS7X 1JQJC 1VBFA 4E03A 2DPGA 4QAQA 1ZY2A 1KFEB 2H9YA 3V1UA 4AS1A 1G0OA 3DXYA 5CLHA 1K5PA 4OY3A 2ZBVA 1X1TA 2QIOA 3F1LA 2P0EA 5IZCA 1NT4A 4NDAA 1OXBB 1KMIY 3PHIA 1B73A 1MQSA 2EL7A 1P2GA 5ESXA 5JS2A 1AURA 1JEJA 1SHTX 3FSGD 4NBTA 4DS3A 1P1CA 2XKJE 2BFEB 3K8ZA 5G0VA 1MC8A 4CQMA 2J9FB 1ECGA 4KIUA 4NAVA 1JILA 1BVRA 1HI9A 1NBHA 2IIPA 4CHGA 3C43A 3K20A 4CMEA 3FTNA 4W7IA 3VJLA 3VHLB 3ZZNA 5C1PA 5LSAA 3U09A 1RZRA 4FXPA 4ND1A 2YW9A 4PYLA 3WC4A 1B8VA 4JGGA 1ONSA 4FEEA 2AX3A 3PQ3A 2AJLI 2Z1DA 4GLLA 4LMBA 3M5CA 3WZ2A 3MPUA 4OMUA 4GS5A 2ORWA 3MMXA 3EIUA 3A3PA 3B2NA 2PZKA 4LXHA 4ZVTA 3OIWA 1FYXA 1YA4A 3W5BA 1GZUA 2HMYB 3ES9A 3ZHTA 2P11A 4NCBA 4Y0AA 1GCUA 3ELUA 1J1IA 4JU8A 5E7JA 3PTAA 4QOIA 5H02A 1QFZA 2GPSA 1VM6A 3B60A 3BMXA 3JQPA 4YCSA 1PE0A 1GL3A 4E21A 2YV1A 4ZYVA 4JS0A 4A36A 5KX5A 1AE1A 3EWIA 3W6PA 2XWBF 4CQLB 9LDTA 1GT6A 3BWYA 4GM0A 1MB4A 4AYWA 1WCWA 1MJHA 3PUZA 5AJWA 2WJJA 3OD1A 2W43A 1MRSA 4ZRDA 3THOA 3VGJA 2XMRA 3C3BA 4D99A 3U5TA 2ID9A 4GOMD 4C07A 1DIRA 2HA6A 4UBLA 3E7FA 4U3JA 3ISTA 2ES4A 2AB0A 4U2GA 3A9UA 1A4UA 2VHJA 4Q15A 5AIAA 3A0UA 5BY2A 3UUWA 1NMSA 2BPOA 2BRUA 5DHTA 3ZHRA 2ZIWB 5H8WA 4BFXA 3C1UA 4QYIA 1KI3A 1T9AA 3JQFA 4RK5A 1PFKA 3EUFA 2X6TA 1J9ZA 1X7WB 4ANFA 2O05A 2AZTA 4D5GA 5J1TB 2DF8A 1MF7A 4IIHA 3K9GA 1UT5A 2QTZA 4I8DA 1E5XA 3FGZA 7AT1A 2DGDA 3BE8A 1RI5A 2G9VA 4IUBS 3GQVA 4HJRA 3S27A 5C4IA 4JJFA 3HLKA 1UAAA 3P19A 1YFJA 2HA3A 2Y8EA 1W8IA 2JC3A 3NFYA 1UPAA 3KQKA 1A95A 1HL7A 4F4HA 1L5WA 3PVZA 3RPEA 3LBNA 1RWVA 2AG5A 3DAPA 3EOZA 3G9XA 4PQYA 5AK5A 4R0MA 4JC8A 1WSBA 5B53A 3TB4A 2VT3A 5JI2E 2TMGA 3FM9A 1E3DA 1N7JA 2C9BA 3PNLA 3WYEA 5KIAA 2FUG6 1BXKA 4OO3A 3A11A 1SHLA 3LI2A 5I6DA 4O4HF 5ULLA 1NQWA 1XU4A 4BP8A 4LS3A 3SXUA 1WHTA 2EOAA 5ALUA 4PRLA 4B6QA 3E2PA 4FCVA 1UDXA 3ZE8A 1VGVA 5JJ5A 1JLRA 1LUAA 2XOXA 4R40A 2JCVA 1C3OA 4PN7A 3IPRA 1KFJB 1E64A 2GNPA 5KHOC 4KN9S 1PGPA 5FV7A 5ALVA 1B4DA 1ZSVA 1K6EA 2X9VA 3NGMA 1IB6A 1WMFA 1WABA 5HRAA 1LJUA 4O1MA 4AKIA 2WHQA 2PMEA 3IMEA 4R83A 2GHTA 3HP4A 3LDAA 1TEXA 1RSZA 3G1WA 3JQDA 5CYOA 4HX2A 1DC7A 5CH8A 1O03A 4UTOA 3SYNA 5ALYA 2P8SA 3QP9A 3SFTA 2P8JA 4PRYA 3OURA 4ER6A 2Q2WA 1PNTA 3FPGA 4MRNA 1HT1E 1ICIA 3PNKA 3QXGA 5CTJA 2VNKA 1XVAA 3PX2A 4B6EA 4CM1A 3PA6A 2J45A 4TKMA 4QC2A 2Q50A 5I51A 3UHAA 1F0PA 2BTOA 4XSGA 5IABA 1SH7A 1W581 2JAUA 2V7UA 2VDWA 5DIZA 2O4CA 4F4FA 4QPJC 2O0LA 3KKLA 4ZI2A 3PWZA 1W6RA 4ALLA 3N2YA 1EIZA 1D6NA 3RBVA 4CWAA 3JU3A 5CPBA 1FUYB 3R5JA 1PQPA 1W94A 4FR0A 4FDMA 4E46A 2LE0A 1JDBC 1JSLA 3NBMA 5KI6A 2IHYA 3SLKA 4N3NA 1X6VA 2CDCA 4QXRA 3SQOA 3D6NB 4ZI5A 1UXJA 4ALJA 4B4DA 2GZ1A 5BR8B 3SYKA 3E82A 4DLBA 3L01A 1G16A 1QH9A 1T6YA 3BICA 2C4MA 2G8NA 3ED1A 2X19A 3KD3A 4GICA 5KWEA 4M99A 1AA6A 4GZ6A 1UFKA 1YCGA 1OBCA 2R8PA 1DDGA 1ZK1A 2XTJA 4JH0A 3FR8A 4JJEA 2C9YA 2WIBA 3CLSD 3EIHA 4KG7A 5KYWB 2P9QA 3DOEA 4W6QA 1QF6A 4C6SA 1SN7A 3R24A 2O3RA 4AMVA 2ZIXB 4F12A 4F45A 2CKDA 3COPA 4X91A 3L4EA 1E7QA 4G4SP 3FA2A 4IGEA 2PD3A 4HQRA 3AR9A 1LA2A 3E61A 4H7KA 2HA2A 3EMKA 1DE0A 1LY1A 4J1QA 4JJGA 4TUYF 3SZRA 2FFJA 3HP1A 4MV5A 3TEFA 2ECKA 1W30A 3AXSA 3DGEC 4TS1A 3H1FA 2I3ZA 3WL4A 4P98A 1I2DA 2GYYA 2I6SA 3RWBA 5A02A 2WU1A 3AJEA 1H4SA 3DZJA 1HG0A 3EODA 4YJGA 4JT4A 3MS4A 4EJ0A 4UAUA 1QMGA 3IVXA 3EVBA 4AZVA 4AKGA 2AOWA 4P34A 1K8YB 5IPFA 1XNGA 1SKYB 3FSEA 3K9BA 2PL9A 1L3IA 3AUFA 4MUJA 1AN9A 2QMHA 1XMQB 3OHMA 5E8RA 3KZXA 1QCCA 2AE1A 5ECWA 1TD9A 2FR0A 2L0XA 2ZUEA 4HKTA 3NEJA 4DWWA 2W11A 1C7RA 3DWIA 2C1EA 2I66A 5ARBA 1VHLA 1T8RA 2XDWA 2C54A 4KR9A 4GI2A 4KE6A 5JSZA 2WFAA 1ZD4A 4FR5A 1GITA 2LKCA 3A27A 1DAGA 1U0EA 1UFQA 3L49A 8ADHA 4BFLA 3SG0A 4UW9A 3QLJA 1CQJB 1G7TA 2X4DA 1GSHA 1U7ZA 3U4IA 2YDXA 1DXQA 2VZ9A 3QWHA 1XRLA 3GJRA 3UGKA 4EJSA 3D0OA 5DX1A 2W4MA 3STWA 3OM9A 3G79A 1FXUA 4L4RA 3KXIA 2RG1A 2OZKA 4FZ5A 4J1TC 4NEHB 3DFMA 2HMVA 1D6MA 3E9QA 1T2UA 1YL5A 2X5JO 1DPGA 3I6YA 2AZXA 4AXBA 5FLEX 3HDQA 2KQUA 4XVUA 5GZ1A 1Z3IX 3TO5A 4IQ8A 3H6GA 3OUTA 2GN1A 3V8PA 4KQKA 3OLYA 4E0BA 1WUIS 3IEIA 3FPLA 4NU5A 4JVLA 1DKPA 3RF6A 3USCS 1U8EA 5BSTA 4ARSA 2FF7A 2PH7A 4IDFA 1GTSA 2GDZA 1JJ7A 1NC1A 5TNXA 3LZCA 3GL9A 4CM4B 1RQGA 3FTPA 3L18A 4CTNA 3FPHA 3UV3A 1XWWA 1DELA 4UVHA 5DYTA 1ZU5A 3OJWA 2F8SA 1WOMA 1YHZA 3EC1A 1OJLA 1O96A 4RS4A 2HU7A 1T91A 5CXXA 1A9XB 3NJRA 1Y3AA 4C78A 5JJKA 4JNCA 1TZJA 1L8AA 1Z74A 1C7JA 3VNAA 3ZTWA 4HQLA 4JD5A 3UN1A 2CV1A 1W5AA 2IEZA 4NX2A 4HDRA 1IY2A 5H16A 4XYLA 3C3DA 5AVYA 1MAUA 1UXHA 4M60A 1GRVA 1BW9B 3CW9A 3KWFA 1T24A 2X5XA 3N53A 1DQZA 2QX4A 4P7JA 3TIGA 3EASA 4RE5A 1AF4A 1O94C 3C6ZA 2O2XA 3SJUA 5DIFA 2Y3IA 4YP7A 3VOBA 5CHYA 3OKAA 3JR7A 2JGKA 3FB4A 4D5EA 1PEAA 5FF9A 2Y1LA 4NARA 3TMYA 3ZR4B 4EENA 5KYWA 2WKQA 2TSYB 1F0NA 4JQOA 4PBSA 4RQBA 1WG8A 2XEDA 1WMSA 2GWHA 2AMYA 2YJ5A 2OHXA 2OWEA 4A8JC 2B1QA 1RM0A 1NJ5A 1WW3A 2IYPA 2M6RA 2WFMA 4D3XA 4NOMA 5I8WA 1PNOA 4H1VA 1TK3A 1AKQA 4O0MA 4KXWA 3IKTA 3VH4A 4HFMA 4WK6A 4WK0B 5I9SA 1GLNA 5JO9A 3R2JA 5I7UA 1ECJA 1O87A 1QM5A 1K9VF 3KXKA 1EK2A 3UMGA 3ZJ5A 4HLDA 1EVIA 4R16A 4CF5A 4EA7A 4I8XA 2FRVA 4AO7A 1D9ZA 1J2RA 3SC4A 2R8ZA 3GR6A 4INPA 2UXCB 1Z68A 1AU9A 2J0VA 4CMAA 3H13A 4RKWA 2BEVA 2C7GA 4DLKA 6LDHA 1RBZA 3NTVA 1QHXA 2QXYA 3E9RA 5KBYA 1WZCA 3NV7A 2CFTA 4QGGA 5BQOA 3O4FA 3GV0A 2HDOA 3QV2A 3ABOB 1IOLA 3RWOA 4XD7D 3UHOA 5C80A 1YQWA 5JJLA 5DEIA 5A5VA 2QLTA 2HQSA 1C14A 5BN3B 2A88A 3ABIA 3ESRA 3C8MA 3ELDA 4HLQB 3W5SA 5FI5A 1B26A 1PR3A 2ID7A 4BKQA 5CW1A 1YUNA 1N2ZA 2CLSA 2Q5EA 3PJGA 2A92A 5HCNA 1P9NA 4P3PA 1HDZA 3V4PB 2FW7A 4ZN6A 3OQOA 3AUTA 3E9EA 2C5BA 4JBGA 4DKJA 4UTZA 1E7MA 2PJRA 3HUFA 3EDOA 2J4FA 1M8PA 3PQFA 1NFRA 1E3QA 1JP7A 4FNAA 2FSUA 1BKYA 1T4MA 1W5EA 3OEWA 5AOVA 5IAJA 4OHZA 4AJNA 3J81k 4F6LA 3L6EA 3U7QA 2HCBA 2GZMA 1HQYE 3U13A 3ZQJA 3ETCA 4Q48A 3RVLA 4CCAA 3S8EA 1CDDA 3ZDAA 4OA5A 1RE0A 3FOBA 2DP4E 1IIBA 1SK8A 1EFLA 4R8KA 2GFQA 2XGJA 2IOHA 4AIIA 3QI7A 3HI4A 4OHRA 1CHDA 5I9MA 3T7KA 5CVVA 2NXCA 5EQJB 4NCIA 2CLDX 2HC9A 1NFFA 2P90A 2ZCUA 4PGFA 3A04A 5CFOA 5HW0A 4HP8A 1SXPA 1RR6A 3NBUA 4QUGA 1K4MA 2BTQA 1RC8A 2RAFA 5I7SA 3LMKA 1USWA 4J0JA 4NENA 1SCUB 1OXVA 1PR4A 5DVZA 2DFVA 3LY8A 2BF4A 1SO8A 4D8WA 2MDTA 3HB7A 4NY1A 3NGXA 1KEWA 4YC7A 4XWKA 1E8NA 2QD3A 2Z8ZA 3RG8A 4C05A 5GVSA 1KY3A 3IP3A 1ZXBA 4K3UA 3UM9A 2FWJA 2GRAA 2GAAA 1NJSA 1ZNWA 4CLOB 4EB6A 1KO5A 3GFQA 2QQFA 1DAOA 4Y2GA 5AHWA 1Y9DA 2Q4TA 5F73A 4AF8A 2LKDA 4B0PA 4C20A 4E2YA 4CTMA 2ST1A 3U9SA 5KTPA 4CLRA 4O4LA 2EX4A 1W9MA 2C00A 3VR6D 3GVHA 1FYWA 1UKZA 1EWTA 1FNDA 1S9HA 3D6VA 3KU4A 3O0DA 3BQ9A 2G4LA 3KG2A 2HTFA 4PR0A 3THRA 3LHFA 1F4PA 2DECA 3OD5A 2PYZA 2V6JA 1R16A 5ELLA 1IWBB 1B3RA 5L3QA 2CXXA 1LW6E 1KE1A 5IDVA 2B8WA 4P3OA 2WLSA 4XCQA 1J33A 1TFRA 3BK2A 5LKAA 3GD7A 1UFRA 4TSKA 3W78A 4YJHB 3QIVA 3KJFA 1TQ8A 3O2SB 2CZCA 3KSZO 4DPLA 4BVAA 4CPDA 1FFYA 2M1XA 2GH1A 1K2VN 3ZWCA 2ZIEA 4BZQA 2WG1A 1NN3A 3VH3A 4U0KA 2FP4B 3KOOA 1I6WA 3ZGYA 5B2FA 4MZDA 5KEIA 4W82A 3TX2A 4XM0A 1EWVA 1KSJA 1V7ZA 2EATA 3DF9A 1A72A 1YR6A 4PGHA 3TSCA 2K2WA 3ZHYA 4ZO9A 2BFBB 3GZJA 3ZQ6A 4BMSA 3WLIA 2IPAB 1IONA 1ZH8A 2Z4SA 4CM8A 4ESEA 4MVCA 2H5JA 5JCPA 4JUFA 4ZJUA 1MO2A 5DBGA 2O8CA 3DWFA 4AZ3B 3SF8A 4J7XA 4RAOA 3DE1X 3AQ4A 3O93A 5IUJC 4YRDA 4YUVA 1XNHA 3WVNA 4WMLA 4ZYYA 2DCUA 1NUAA 5TQ0B 3TIIA 4CZ2A 2GS9A 2AHRA 2I4LA 4W8OA 2WM2A 1WD5A 1OX4A 1SC9A 4HUQB 1VPWA 3M9WA 2QUJA 4IINA 4MEJA 2IITA 3CCFA 4LC1A 4RA6A 5AM0A 3ULKA 4KXFB 5FBLB 4KO3S 1EAYA 3IKMB 5A5EA 2IS4A 1NRXA 4QKQA 3VGPA 2V7WA 4J76A 2BKAA 3FMGA 4Q21A 1E1RA 2JGFA 3TRFA 2H3EA 4EUKA 4YB8A 4QT4A 2WU4A 1G3UA 1JG4A 3UJBA 3CKMA 2QVYX 3O3NB 4QBFA 4TZTA 2QE6A 1NLUA 3F4LA 4MGEA 3R7WB 1THMA 2YV4A 1L3BA 4UE3S 5DLQC 1U5BB 1E2IA 5TEWA 2IYTA 2ETXA 3EARA 4XE5A 3VM6A 3IRUA 3DUFB 2HK6A 1SVIA 1X7DA 5CXQA 3ADDA 3DBVO 1VKHA 1RIFA 3OIYA 2IODA 3I1IA 4PAGA 1L5GB 2ZIVB 2ZJ0A 3NH9A 2QMUA 4I0WB 2HO5A 4A73A 1E0KA 5GP1A 2K4MA 5CLFA 2B5OA 5BUZA 2IUYA 3P9QA 1P5JA 1BZYA 2AT1A 4OXXA 1C1HA 5HTKA 1ESDA 5KQLA 1LX6A 2H2FA 2I3DA 1TADA 2XODA 4TRNA 3CVXA 4EG7A 3SVZA 2X9NA 5TX7A 3BCSA 5E1OA 2P4QA 4G84A 5TC4A 4FYWA 1SZCA 4D8XA 1DKUA 2DBYA 3JAWA 3W05A 4YR9A 7REQA 3BGWA 3G2PA 4C04A 3NYRA 4ZZ3A 4BUZA 3EQZA 4L7QA 1W88B 2O0HA 1ADFA 4HAYA 3RLIA 3IT1A 1F8YA 2O2HA 5LMUB 3FUCA 3KL2A 4OJQA 1G9TA 3ABZA 2ZTHA 5K8VA 2O48X 2ETVA 1FNCA 1M2GA 1QZXA 1XCBA 3BILA 4QASA 4RBNA 2BFAA 2ORYA 3WK8A 2B7BA 2OC4A 5LUBA 2Q4RA 4I5EA 4I7EA 2PSJA 3NBFA 3PRYA 4OREX 3S70A 4G56A 2WWYA 1EUCA 4QJ5A 2V6BA 4DCOA 4N3BA 1SUCA 2AEMA 3G0GA 1KDTA 3PVCA 5AXDA 3ESQA 1QIGA 4HN2A 4W5JA 4OSOA 2I9PA 1Y81A 2IU0A 2AMVA 3CWQA 4FGWA 3U48A 1SNYA 4XEHA 1SUPA 1YUMA 3DB1A 5BV7A 4B7AA 1G6Q1 1Y4ZA 4WJZA 3ZS9A 1DKMA 5TVKA 4YRMA 4MK4A 4V0LA 8OHMA 4DC1A 2J85A 1HFJA 2C61A 2IFTA 4KNVA 4W5OA 4RGVA 3OZGA 1G42A 2FPWA 1I5RA 3QF4A 1MC4A 1PR2A 2AMLA 4OQEA 4Q66C 3HN2A 3D4NA 4TTVA 1H1TA 1PUIA 2DOKA 5AJUA 4C0QC 1VA5A 3ZLUA 4WAUA 1HEUA 1HKUA 2ONZA 4HVAA 3T1OA 1K8RA 3PF9A 2W4QA 1UPBA 3T1TA 5CA0B 1DWQA 1U3UA 1NVFA 4HH4A 1I2MA 1K4KA 5EQFA 5LPNA 3RF7A 1XLUA 3LD9A 2BH2A 3ODGA 4RSGA 2UUBB 3CN9A 2GUGA 3BMCB 3N3BC 1JR2A 3TFWA 5EIHA 4PZPA 2DHEA 3K0FB 4F5ZA 5TJHA 2D8AA 1A8QA 3LUFA 1F38A 5AJZA 5F5NA 2B8NA 5ALXA 5F4ZA 3AVTA 1KRXA 1CJTC 4A0RA 1X3SA 5ALMA 1ODIA 4LJAA 3BS4A 5AW9A 4YN3A 3EPLA 1LF5A 1J39A 1OXKB 3MJRA 4X93A 5L7YA 1BX1A 2EZ8A 2OGWA 1L5KA 3NIFB 2BMJA 3WGZA 2I7XA 3HVIA 1AKEA 1MT3A 4TT8A 3SSNA 5BVHA 1X1BA 2CDNA 1GT91 4YREA 2WJAA 1J8VA 5K0TA 1FFEA 1MH1A 2BMDA 2HPAA 3IEPA 4PU0A 2VPZA 2YYSA 3IQZA 2FG7C 5TR9A 3JQRA 4F84A 1H8HA 1Q15A 2B5VA 4Y2XA 3S2GA 1XLTA 4DSOA 3WLJA 1IOZA 3WIOA 1P8AA 4EUNA 3K5HA 2J08A 4G24A 1GQSA 3S2IA 1NLZA 3L77A 5LP6B 2ZW9A 2J7KA 2BH9A 4P5EA 3DCNA 4FZRA 3HCAA 2BFPA 1E2QA 4OYHA 1YDMA 1R3DA 3EIXA 2VF7A 3LDGA 3GU3A 4L6CA 4RH1A 2QR2A 4B6FA 1QPGA 2W2KA 3DHYA 3GEBA 3M2TA 3QVGB 4QRDA 3NIBA 1KI9A 3QE0A 5EFOA 2QZZA 3FIJA 4MPTA 4B3JA 3GGJA 2Q9CA 3NM4A 5I5GA 3GIDA 4DYHA 1RKXA 5CB4F 5GV7A 1OB5A 2PJUA 3LRPA 4G1UC 5EJIA 5IVDA 1E2BA 3M6VA 1JDTA 1POXA 1GQOA 1NX6A 3GRUA 4EFDA 2GCNA 4EHBA 1B00A 3O47A 3OTHA 3OX3A 4JLNA 3LNTA 4HDRB 4OAOA 1UAYA 3WXBA 1EFCA 4RZIA 3WS7A 1INLA 3HRKA 4TT3A 2J0QA 3HL4A 5F1KA 1R4NA 3BQMB 3K8QA 5KYVA 3Q98A 2I71A 5TQVA 4E5UA 4F0JA 2UXBB 1CR4A 5K8IA 2CL0X 1Q7CA 3PQ4A 3UEOA 3G49A 3U7EB 1KPHA 3U3MA 3OFKA 5JW6A 3HKBA 4FYKA 3IULA 5BPFA 4L0DA 4P3NA 5F51A 4U7GA 1PJ2A 3BA1A 3DVLA 5C1OA 3RBAA 1R6AA 2DFPA 4UD6A 1GPNA 3IAS6 4N54A 1OLXB 4KC0A 1GSIA 4M8NE 1A4XA 4ZARA 4DMCA 4GD3Q 3OC6A 4BRWA 3RASA 1U0TA 2JIMA 2YDYA 3HE3A 1QQ6A 3OIGA 4UXHA 3BEDA 3I39X 2OA0A 1RYMA 3TRIA 5JG7A 2C3OA 4JFRA 4F2DA 1DAKA 4HVLA 1TQDA 4LY3A 1DU4A 3ZKAA 3DYIA 5CXSA 2JD0A 1T6NA 2LIVA 2QE7A 3PGMA 4DNFA 2O8DB 2X58A 2B25A 1MORA 2HQOA 3EZLA 3FI9A 1J2JA 5BMOA 3W90A 2QTWB 3MTIA 3H2BA 4PLCA 3LUKA 1KDOA 1SG9A 5EXXA 4ZTZB 1Q2UA 2WT8A 3N5CA 3OTOB 1VHTA 1L4LA 3H6HA 3L9XA 2B3TA 2CC2A 2POQX 2XUJA 2H9AA 2IXTA 3H5OA 4DLPA 1HDEA 1XCLA 4V0RA 2YC2C 2OAP1 2WIGA 2YUTA 3CR8A 3GIWA 3I23A 2JLVA 4EECA 3DLIA 3ROEA 3MCZA 1ID8A 5ALKA 2GR9A 3ZHXA 3QTTA 3UH1A 1HY3A 2VAPA 5ALGA 4Q02A 2ZUTA 3R7AA 1T9KA 1T10A 1GNVA 1KP9A 3C5EA 3REQA 2X7XA 1MXHA 1UDCA 4MZXA 4TVOA 3SHTA 3FLBA 1GUFA 1OGIA 5INTA 4GL2A 2YXBA 5AM3A 1U2ZA 3KPVA 4DSAA 1FBNA 2NUBA 2O3JA 4V3CA 3ECSA 2XCOA 1GR1A 2WMDA 5CVDA 4C2UA 1LB1B 2R8XA 3SNHA 3TCNA 5JH7A 5JYEA 3B9RA 1YL6A 2GILA 2Q0HA 3DFIA 3R0XA 1L8OA 4KGXA 4ZAVA 5EJ5A 4CT4B 4XI9A 2R6AA 3AY7A 1PJBA 1T1IA 2XVXA 1OT3A 2AG0A 1GZ4A 3H2IA 3KPWA 3LGAA 4OK3A 5AO9A 4A91A 5FORA 3ZVRA 2Y77A 2ZSKA 4ZOBA 3TLCA 3SJZA 1I2AA 4HWTA 3D6MA 4MR7B 4AAYA 4GKKB 2JJ1D 4AWXA 1SIWA 3N1UA 2HF7A 4KGZA 5GINE 2A7QA 5C31A 3CXUA 2ZJ4A 3EXG2 4XIYA 3VAZA 1EFUA 1RI4A 2R8YA 1JA0A 2ADFA 1D2EA 2BMVA 1NSFA 4Q7EA 3SGLA 2FK8A 2VJAA 5EXPA 4YXWA 3VJMA 5K0EA 1FLNA 1WMAA 2QT1A 3O1IC 3PD0A 5J9FA 4WBNB 1A9YA 3KR2A 2YJTD 2AS0A 3IIIA 4IFEA 4ENPA 2PBRA 2Q21A 1UEJA 3UW3A 1X80B 4IPTA 1VG1A 4RGYA 1CY4A 4RDCA 4F4IA 4AECA 4UOQA 3WIDA 1H6AA 3PKZA 2XQKA 4ZYUA 2CNKA 2QZ9A 3A6JA 3KS9A 4YRCA 4N39A 4UBKA 1FIUA 1RKVA 2I03A 3DOHA 4D74A 4GH5A 3WIBA 1DRKA 4JJ6A 4PX2A 4F1WA 1U4OA 2X9QA 2ZSHA 3GT4A 4G8BA 5IVPA 3IPYA 1U7UA 3H8JA 2I4TA 5I7VA 1PUXA 5I45A 3EVNA 2YYZA 1UQTA 1EVJA 1NYRA 4OHCA 3BHIA 2GF9A 5F77A 1HDIA 4RQTA 4KUGA 4MLDA 3NATA 1GKUB 2PYIA 3W2IA 2ZIFA 2UVPB 4FPXA 2RK4A 2WSIA 1GCOA 2YKGA 3MJFA 1GM5A 2O3SA 3E8XA 1Y1KE 4BNTA 1RFGE 1IULA 1YHNA 3AUXA 1ZH6A 3GAZA 2W2XA 1RZRD 3EVAA 4H4DA 3JYHA 1GAEO 1RWXA 4JLUA 4QDTA 2HFJA 2WM3A 3HB4X 4YMSA 5JJIA 4L8LA 4MVJA 5LQDA 1PN3A 1Z6GA 3PL5A 4BLUA 3N8IA 4DJTA 3DZDA 4RPIA 4V24A 4F5YA 1EQUA 3DSRA 3M6WA 2I9KA 1HGXA 3PX3A 4N03A 1RFLA 5JCXA 2QTRA 16PKA 2ZSFA 2JZNA 1J1ZA 5KUTA 2DERA 3UNXA 1FMLA 1GUZA 5DGIA 2D0OB 4RGBA 4BVGA 4FE3A 4IQGA 4ZPXA 5AVKA 5JT1A 1XDDA 5CB6A 4N3CA 5GQSA 1F5NA 4M9ZA 4XVCA 4BXOB 3VTFA 2QXTA 5AXCA 1A98A 1TU4A 4X41A 3GAFA 4YO8A 4I99A 5K20A 5KWVA 5ECGC 3JSXA 1YGPA 1GU1A 3DV0B 1YE5A 4PM4A 2P2DA 5H0IA 3ROTA 2ZLBA 2WU8A 3SBEA 4AW9A 1YVEI 4Y2HA 3VPGA 1A1SA 5CCBA 4B85A 1AXEA 2IVFA 3DL7A 1N0WA 5AMXA 2XE4A 1VHDA 4RA6B 2XNDD 4WW0A 1H42A 1KEKA 1UZNA 3AP3A 3EGEA 5EZ5A 2Q2OA 1PQUA 3WRXC 4QTTB 1E20A 2EBUA 3GCWA 4UNIA 4AJ9A 4DLVA 1YRLA 5A9RA 3KWLA 4JUIA 2XOEA 5CYFA 3DOUA 1C9JA 1LSJA 2RHLA 1RHQA 3W5UA 1MENA 4N0QA 5I4BA 3B51X 4LDZA 1SKAA 4AYXA 4EFMA 3WQHA 4GDFA 3HXMA 3RFFA 1P1FA 2Z0MA 4Y9TA 1ZHFA 3WLAA 2QM8A 1VA4A 5LM3A 1TK2A 2D8MA 1B6GA 1P61B 2LCIA 3DE6X 4IX1A 3RFTA 4BLQA 4OHPA 2I2XB 1ARZA 4L5AA 1UMDB 2QBYA 3NIDB 1AK9A 5EMMA 1QHSA 3VYVA 1I24A 1QAOA 3PC7A 3ZBQA 4M0UA 2YZMA 3ZXUB 2XYQA 1RCTE 4IJUA 1VYUA 4RIEA 5A5FA 5LA6B 3PNQA 4WGFA 5BSHA 3T1NA 1VJ0A 2DY0A 4MTCA 5E6RA 3K92A 4N5MA 4XRRA 2OB2A 2QSJA 3KQOA 1TT7A 4URUR 3FZQA 4FHZA 3GJSA 1DAFA 1G9SA 1HMPA 3EMBA 1AMNA 1N0IA 1QLHA 4NVRA 4QQRA 2BBWA 2X0NA 1BVHA 3A26A 4D45A 5E7MA 3TOCA 3P9PA 4Z4QA 2OHJA 2YV2A 2I1VB 2KLBA 5AVRA 3VBEA 4PO1A 4PX3A 3WADA 3DEYX 4D9KA 5DK4A 1APBA 3WTCA 1ZSYA 4RVCA 2ZYGA 2Z8XA 4ZAXA 4F1KA 4GWKA 4CKWB 4S0XA 1NY6A 1V16B 3HMQA 1SQFA 4F7DA 2IL1A 3AETB 2MTBA 1QU2A 1KERA 3FCOA 2K7FA 2VJOA 3I2FA 5AKIA 5DTJA 4LBZA 2QRJA 2WILA 1CEXA 4TXMA 1KOLA 5BMVF 4LDQA 2DULA 3O21A 4ZMSA 3O8RA 3G5TA 4I9UA 5KYYA 3C16C 2EZUA 3TOSA 4UM9D 2O8FA 1YZQA 3WR5A 2WKRA 1JSCA 2IEDA 3WMFA 1U31A 2JIQA 3SIRA 2XYPA 3T95A 2JLZA 3ICVA 3SP1A 3DFUA 3AONB 1SOAA 1QTRA 2Q5JA 2WMYA 5ICFA 5A04A 3TQRA 2CFSA 3M4JA 1LVGA 1Q7GA 1Z12A 3PHGA 4DWVA 1IN5A 2EYQA 1CS4C 2D6FA 1JU4A 4ZKDA 1XVTA 1MUUA 2OV3A 4TMVA 5B1DA 1ZG3A 5SZJA 4MKFA 4WY8A 1FJ2A 2VWQA 4WL0A 1XROA 4Q1AA 1NR1A 3JYQA 1MG0A 5SZHB 3ND6A 3EVTA 4BNVA 1GNQA 2BFEA 2XNJA 4I3HA 2Z5VA 4CQMB 3PQCA 2ABWA 4I3GA 3ZNNA 2Z2IA 3M82A 5KNDH 4OXNA 1AG9A 1QHIA 2V6FA 4EY3A 1DRUA 4GOND 1YQDA 1K92A 4LVNA 4L76A 2BHTA 4R1TA 3OE4A 4KWCA 4JLJA 4UTVA 5IJ0B 3D8UA 1Z0IA 4ZC1A 1CWUA 2FB9A 1W29A 1A7KA 1Q17A 4PAQA 4CG1A 1H2YA 4QOJA 4LZAA 2W6JA 3ZHBA 3V9PA 1ZC4A 4BGIA 5D85A 1U2GA 3L7DA 1V5GA 3UB2A 3GLHE 2I8AA 2H2HA 2JFVA 1KO8A 4Q9HA 1THTA 5DBHX 5CBKA 2B7LA 4KOAA 3IDQA 4OBBA 1GYRA 1WVGA 3PI6A 5KMGB 5AQ1A 5B4VA 1EFTA 1QO0A 3EB9A 4CDNA 1O0BA 3RI3A 4GC9A 2CBXA 2RH5A 5CR9A 2BM1A 5HS6A 2VWGA 2R00A 2O8EA 4XX0B 5C51B 5EYPA 2R6ZA 1X70A 4C6RA 1OYYA 4TTIA 5GONB 3RTDA 1U28C 4GVXA 4ER3A 3V1TC 221PA 1L4GA 3ANYB 3B1VA 4ZEMA 3QKIA 1UBGA 4UHJA 1A5ZA 5TPWB 3USES 1UXGA 5CM9C 1P72A 1T0IA 3CS3A 3UENA 4GDMA 4MMYB 4ETWA 5IKMA 2QQEA 4IJ6A 2AOVA 3N0WA 3QVGA 2C7RA 2PWAA 2WR8A 2BCEA 2BKXA 4DY6A 1MHPA 4ECEA 4PCUA 1VL8A 1AS0A 5JCJA 1KH3A 3RUPA 1EFKA 2B61A 4XJXA 4AZTA 1C8BA 1YQUA 4OAPA 4OQMA 1S89A 5CBPB 4JXZA 3OPXA 4YRZA 1XZLA 3ANNA 5JXIA 3Q7QA 1G20A 3CVVA 4MULA 4HZUA 1O94D 1DWPA 2AR0A 3WYDA 1QK4A 4X7PA 5ILQA 1U2TA 4QOHA 3NXKA 4L4SA 4K3VA 1AQJA 5HS4A 3FYHA 4RWEA 5F21A 2ZREA 4B6SA 4EY6A 2C9ZA 2XNCA 3SM3A 1Z4OA 4J94A 1PEDA 4HNVA 4YUYA 1RYDA 4CIAA 3PZRA 4BVJA 2Q07A 1DSSG 3I6IA 1LK7A 4MR8A 3DBHA 2Z30A 4ZEVA 2P6OA 3T0GA 3EEFA 4TYQA 2Z5FA 4XYBA 3F67A 1Z4KA 1HYQA 1AV6A 1O6FA 2CGEA 4W9RA 3TMAA 3KDAA 5KYNA 1J06A 3K4QA 4ZVPA 4BFCA 1J90A 2VSQA 1QKJA 2C4TA 3H6KA 1XQVA 4LY9A 3K09C 2PGDA 1Z6QA 3NNDA 3WDKA 5FOXA 2DHQA 5DN9A 4BVBA 4E14A 1JU3A 1F60A 1RYEA 3ZI4A 1P1RA 2YY7A 1W19A 3LQ2A 3OLWA 1QZUA 1TTHA 4JLKA 5JPIA 2WAYA 1IN8A 1FS6A 1FSGA 4JC4A 4NLLA 4WKNA 3VR3A 4C0SA 2V7QD 2A14A 2ZEJA 3J7AC 1FQOA 1ISRA 3HC7A 2VTVA 3U44B 1D5WA 5L8VA 4BLSA 1GCAA 1A82A 1N6HA 1PBTA 2ZB2A 4INZA 4XYGA 4KDCA 1RHMA 4KAXA 3BSFA 1TKRA 3C5VA 5K3AA 2PFKA 2FWAA 3S3TA 1ESNA 3V32A 4F56A 3VOSA 2HLDA 3R77A 3K9LA 4OGWA 1YJAA 2W0MA 4OHBA 4FXOA 1UMBA 1A88A 2OOSA 1JG7A 2I67A 1JYFA 3KLNA 5T3YA 4Q3OA 5J4KA 1D2AA 3FRHA 4HDSA 5KJFA 6Q21A 2ODQA 2ODEA 2ZUVA 1Y3BE 2ZAYA 3MAAC 1VYTA 2PIAA 2PUDA 3SOZA 3QLEA 1Q21A 1DO8A 1JGTA 1OFIA 1N2BA 3SDSA 4HQ0A 1GRQA 4R84A 2BAGA 4FQ7A 1F1BA 4C4RA 5AVSA 1LF0A 3OM0A 4IO0A 2QPAA 4KHZA 2YBDA 4KEAA 4NESA 3TQCA 1GR0A 2NQTA 3LUJA 3MWDA 4DMLA 3WJ1A 5KYXB 1A9OA 5FNVF 4DC9A 5DGDA 2YHBA 1YJQA 4U7TB 4ESOA 1N8NA 4G0NA 4RXUA 1UOOA 2O6HA 2VIIA 3B1JA 5CDHA 4DV0B 3RR2A 5JYDA 1I32A 1ZUNB 1OLSA 4A6XA 4YV1A 1DRWA 4M6WB 4C43A 1C8VB 4OJMX 1PFQA 1XLWA 5KMGA 5FPTA 1QH0A 3CKYA 3OF2A 4OOEA 2NVUB 5BR7A 3NP7A 3DTNA 2FQXA 1Y1PA 3PC8A 4D0RA 1L4BA 1XUOA 1WA5A 1R8YA 2BEUA 4JB8A 4MWOA 4G0VA 4GR5A 3N87A 4EG1A 1WB4A 1IVSA 3AY3A 3ZDRA 4NZ9A 2BUAA 2I91A 2IZ0A 1GOTA 3C4QA 2OG1A 2ZVJA 3O8LA 3TH5A 3VXKA 4D9EA 4DDKA 1YV9A 5IBRA 3SFVA 3WYGA 1WKCA 3KSRA 4IMRA 1OAAA 3CGGA 2J5RA 4H59A 4LKOA 4U9UA 4IW3B 4BMPB 3KZVA 1LSUA 1UBJS 2ZKIA 3ODPA 4RZSA 4TS3A 3AUKA 1SQ5A 1W4ZA 4J1SA 4MP6A 5AOBA 1Y6FA 3FPAA 4ZU3A 2G63A 3JQ6A 4FMCF 3HJTA 5CJJA 1XHEA 4F3TA 1N6OA 2YOGA 2WHEA 5M7EA 3D59A 1ZD2P 1L4YA 1MPXA 4RIFA 3AJ8A 4OVKA 5JZMA 1Y98A 3I61A 3MT8A 2BR5A 4NH0A 1KNXA 4N01A 1AGYA 5K3SA 1P1HA 3E53A 1IHDA 3E15A 2ZYSA 4Z3KA 4CODB 4KVFA 3K72B 3G5MA 3BM5A 4LJYA 5C8XA 3TLEA 3G0OA 3K9QO 4F6RA 1IBCA 1Q3KA 1BFKA 3QMWA 4QLOA 3T3OA 1H2ZA 4X6YA 4EQZA 2P40A 1NMQA 4IRMA 2FWMX 1BHJA 1O94A 4KKVA 2RIPA 3LX5A 4EZEA 5E2BA 4NCNA 5DK6A 3M34A 3GD5A 2BDUA 3BIWA 4J7UA 4JMLA 1XQXA 3Q8MA 3F6EX 3DO6A 3H0CA 1GZDA 3GN1A 3WKAA 3T54A 2UYGA 4BMXA 1E2FA 4BEVA 4ASUA 1V8FA 3PUWA 1CR0A 5JCOA 1Z6TA 4W7SA 4UZEA 1T4BA 1YCFA 4LMPA 5IMBA 2V54A 2IX3A 5LDDC 3NVDA 1FVHA 2C5GA 2FMKA 1M8FA 1ZJZA 3GGGA 3SC2B 4RKQA 2R6JA 4KQIA 3GLRA 4EM6A 1F3OA 2QTAA 2XQVA 3Q7PA 4IQ4A 1ZGBA 3WZLA 4OU5A 1ISIA 1UBKS 1DADA 1IBSA 4K2AA 2MYNA 4OQXA 3TGPA 4OB7A 3FETA 5CNIA 4IP0A 1UOQA 1QGDA 2I33A 2GPBA 2ZBUA 3ISVA 1I9CA 4MO2A 4DSUA 3U60B 1NRWA 1IY0A 1QOPB 1WD7A 1Y3CE 1XJ5A 2X2OA 4PFSA 4YA6A 3D2CA 1NIPA 1X92A 1SJ9A 4L9AA 1N9GA 3WWEA 3DDHA 3KPJA 4MR8B 3ELWA 4B4OA 5K45A 1CUGA 1D1TA 1PD1A 2PQMA 2LIPA 3OM8A 3CLTC 3R5HA 2CUZA 5EGSA 4IZHA 3RKUA 3U4QB 1TUBA 4E51A 1EM8A 3LX6A 2Y4OA 2OFXA 3JALB 1GAWA 4M8KA 4WRRA 1U65A 2XH8A 3P2OA 3T9CA 4D42A 1C2YA 3ETGA 4HSEA 4CM4A 1NULA 4ZIRA 4ZK6A 4UUAA 3OZDA 1AK2A 4FYPA 3DWGA 3RVQA 2GI4A 4G01B 5DCYA 2YXDA 2WJWA 4LYDA 3T5PA 3W6UA 2VJDA 4U00A 5C0OE 2WF6A 2QRGA 3EXHA 3PEEA 2WJYA 3H3JA 3DBLA 2DPMA 2PX3A 1II8A 2GSWA 2QN2A 2J3EA 3ZWVA 3QX3A 1M83A 1YZYA 2O2JA 3UICA 1P6XA 4NV3A 3CRMA 3W3ZB 1ORVA 2BGRA 2P3SA 2HAEA 4QUEA 1Q3TA 2QVLA 3M33A 3WGJA 4CN9A 1TIPA 2NPIA 3AHJA 3GK3A 1PHPA 5GOZA 3OO0A 1J2EA 1Z5UA 4QO7A 1RLJA 3LXUX 5AI0A 3UYKA 2AFIB 2A6PA 1ELOA 1RU3A 3N7UA 5FEMA 1RWOA 3OJCA 4EHDA 2R6R1 3RG2A 5LB2A 2WAMA 5E3IA 4MWZA 1A96A 4BO9A 3TTXA 5K5EA 1P7YA 1I30A 1PFVA 1PZXA 3JVDA 4KO4S 4ZYWA 2ZTSA 1W59A 3EA5A 5A62A 2NZUG 1QVWA 1QNFA 1L7QA 2NTJA 2FPIA 3KLPX 4H1HA 2W6NA 4GOLD 5EFZA 1FUEA 3BTVA 3M3DA 3W8FA 4M1MA 2TECE 2WAAA 2B3DA 3O8NA 3GF4A 4MRSA 2R00C 4TMWA 4BCBA 1U8XX 4MVJE 4CNBA 4DLSA 1KK0A 3AUUA 1DUSA 2YJ4A 3PCTA 5CH3A 3R7BA 4EUHA 3NV9A 5GJVC 1TQHA 3MJSA 3F0TA 3WBFA 1P9LA 3V7YA 2O7RA 1IQ0A 4V03A 2B9VA 5J2UB 1W36C 4M6WA 4DCCA 1W5SA 1QX4A 4IF4A 3PS9A 3GRKA 1HZZA 1CJCA 1E1RD 3DT6A 3K2IA 3JQGA 4HYYA 3RK1A 4E07A 2ACKA 2D1TA 4BQIA 3FGNA 2ZXEA 3WGLA 4IIUA 4F2HA 5KWSA 1G8YA 3ENWA 4G5GA 4ND7A 3N74A 5J4YA 4EHIA 4I6JA 3B48A 4D9FA 4GP6A 1E1MA 4RJJA 3GZTB 2JZOA 3Q9UA 3NT5A 2DM6A 3FWHA 4RK0A 2G28A 4QUKA 4U7JA 1TF2A 2YXPX 4G0UA 5EJAA 1QRTA 3JV7A 5D6NA 4K26A 4LHVA 4TKZA 1KAMA 3H19A 1JHPA 4LX0A 2WSSA 2F48A 3A9CA 3LBFA 4NBLA 4N8DA 3GHYA 3P0FA 1PGJA 3ASZA 1NWCA 3EDYA 1G59A 1AKNA 2PCJA 3BD6A 1SCDA 2OUKA 3W9BA 4JQCA 1W75A 1ADCA 3E9DA 5C53B 4C7KA 1TO2E 3OCVA 5K2MA 5EIBC 3V2HA 3HO6A 3UXYA 3K4HA 4OJYA 5LB4A 3BJRA 4KIGA 1ZISA 3NRBA 2PMBA 1QRRA 3CBGA 3EBLA 5E4TA 2GXQA 4RVNA 3AERA 3AF3A 4TUYB 3RUDA 3MJDA 2R97A 2ZB7A 3CSSA 1XTBA 3JQGB 3NIGB 2ZM5A 4JBWA 3ILVA 4C3ZA 1PU2A 3GVPA 5CYPA 1EFVA 1I2CA 2PGOA 3TQFA 3TTWA 1GZ5A 3BMOA 4BQPA 1VE5A 4QIHA 4TROA 3C48A 2YVUA 3ELBA 3FCYA 5DU2A 1T3TA 3DMNA 2XMDA 4KTTE 5IF9A 1R9MA 4V0NA 2DKNA 2PBLA 3KHKA 1OTYA 3FZNA 5HBGA 4ETMA 4J49A 3AEUB 4NZYA 1F6DA 2IXDA 4Q7MB 3PR1A 1WW8A 3QX9A 4PGMA 1KQFA 3OHSX 4BQOA 5A3SA 5A71A 5C35A 3GEHA 1JEYB 3SHQA 2BOVA 3ZOKA 3QU5A 2BONA 3PQ7A 4EMUA 3W3AH 4XIJA 4IFBA 3TEJA 3VR0A 4EIWA 5LMCA 4YP1A 1Q0ZA 1IXSB 4F3RA 2JLXA 4E22A 3GGDA 1B0UA 2IU6A 2V1XA 4ZAYA 2CE7A 4UNSA 3B7WA 4ENSA 1UP7A 3QELB 2YUIA 4YECA 3WSWA 2ZJZA 2C8KA 2QWXA 1LBSA 3GDGA 4O0LA 2ZAMA 4FYIA 3QBEA 3NBYC 4WBSA 1E94E 1T2CA 2I4IA 3RSHA 1G41A 2Z3VA 4P7FA 3ZW8A 3L7IA 1V25A 3TOVA 1M1UA 4IG9A 2ZE5A 1XHLA 3DZKA 3GLTA 4KQ2A 1O0SA 1A9RA 3ZXSA 5C5IA 1KO7A 3OG9A 5EJ6A 3ICWA 1ZK3A 2FP3A 2NYUA 1G8FA 3GJ8A 2JFZA 2DQZA 2LGJA 2WG2A 4J2OA 2WJVA 2DJ5A 4U2FA 2PKEA 2JLRA 3IV9A 4BYGA 3BZUA 1Z47A 3KB8A 4WASA 4QDJA 5H1YA 5IK2A 3RV3A 4AZ3A 1J9GA 2CD9A 2ZJ8A 4HYQA 3CURA 4X8HA 4G89A 1PBNA 4MYRA 4WACA 1V41E 1XO1A 4A5SA 3EE6A 4L75A 3WRYA 3CX7A 3P94A 4R6WA 4PG4A 1FSSA 1OAKA 4IKEA 4UMVA 4JSRA 2VPYA 2XE6A 4MYHA 1HPLA 4DTIA 1L8QA 4P3KA 2OXCA 4JKYA 1RM3A 5CVTA 2ACEA 4RV5A 4XB1A 4EHAA 1VE9A 4MVYA 1VLLA 2WJIA 2XMGA 2CE2X 3LPDA 3SNKA 3BA6A 2H7XA 3HY4A 4YUXA 4MYDA 2GCGA 4H6PA 3B20A 4N8SA 4WHMA 2BTQB 5F9MA 4W9NC 2GZSA 3C7AA 2I4OA 3RBXA 2O5CA 1IWPB 1LRJA 4OHOA 5L3VA 1G21B 3ZE7A 4D3SA 3AOEC 3KQHA 2LDBA 4N0DA 3H84A 4A8TA 3LOPA 5IFLA 1E3WA 3KB1A 1WDTA 3GY0A 5ADUS 1T5TA 4KCGA 5IEJA 1ZH2A 1KJYA 4A82A 1T8PA 1Z22A 1ZGCA 3Q7IA 4FEYA 4PPFA 4TV9A 4WXRA 5AUOB 3DKPA 5I7RA 3E9ZA 2GN0A 1RQ2A 2QTVB 1MT0A 3KEGA 3HPRA 1EFRA 3K9CA 5B36A 2F7SA 2XBLA 3A4YA 4EYSA 1FDTA 4X7BA 4A3SA 2QLJA 2OCGA 3VDXA 1NATA 3A1EA 3K16A 4B6PA 3OT5A 2WVAA 4XB6B 3TQHA 3EHDA 3ZYZA 4EPRA 4PV7A 1GL7A 1K97A 3UJNA 3UMJA 1C9NA 4DN6A 1ODJA 4UFOA 1UBEA 3PYXA 2YMQA 4TZKA 1YB1A 2PRJA 3ZGNA 3GLGB 3ZD6A 1W49A 4KRYA 4RPKA 4KQXA 1E5LA 1PGNA 1I4TD 1XPOA 1E9VA 1RTTA 4URXR 2WVGA 2BFFB 1F5SA 4L4YA 3IAEA 3STUA 5CFQA 3F3YA 1P0PA 4B40A 1KQPA 5DOVA 4DIMA 3TW0A 3LHKA 5JVDA 4IKPA 4WNCA 3PKIA 1LKZA 1VIMA 2FWNA 3TTUA 1IRIA 1PWZA 1UEIA 3O75A 3DZIA 5C4GB 2JW5A 4Q4JB 2Z95A 2G04A 2AUTA 4LCEA 5KDLA 3WOHA 5A9SB 4G36A 4KR0A 2WIAA 4TYMA 5LLSA 4QTUB 4YDQA 3VO1A 2O20A 3LBYA 1SCNE 2F00A 2H29A 2WWGA 3FYDA 3G02A 3OZ7A 4UM9B 5KJCA 4NCXA 3IKJA 2WAOA 3R6TA 3A0RB 3WSVA 1EGVB 3GJ3A 4P92A 4AQYB 4ZVNA 3T06B 2VYQA 1GSOA 1PIWA 2AF4C 2ECOA 2PGLA 2QUHA 4WVFA 4JEMA 2GK3A 1AKWA 2MINB 3FUVA 2AGVA 4LSWA 3IVGA 1RWNA 3WWZA 5HOEA 2ZM6B 4G85A 3FUUA 4XYEA 1RW4A 4O59O 5FXMA 1GNSA 3V2GA 1UDWA 4CKYA 4K6GA 5JNVA 1YSCA 1XEFA 3FPFA 1H4VB 2QA5A 3TEMA 2JAXA 3JRNA 1CRQA 4P36A 2YNMC 2YXLA 3EZYA 4J16A 4ZEWA 3FYCA 5BSMA 4EJ2A 1BDIA 1G7SA 2NAPA 2W8BA 1OQAA 3WGHA 4HAOA 3ZG6A 2H4YA 3F6PA 4DRXB 2QB5A 4LFAB 1XN1A 3D2AA 4WKGA 2RGCA 3RUCA 1KH2A 1WX1A 3AXTA 2LCQA 5DKFA 2QD4A 4KO8A 5J59A 1HDGO 3L41A 4LCBA 5BQPA 4D56A 4OLBA 7MHTA 2QU7A 2A3NA 3W2EA 2OCLA 4E94A 1BDBA 4KE9A 1FDUA 4FUQA 5ALNA 4UFNA 1MOZA 1YBFA 4M7WA 2IKSA 4F86A 4YV0A 3EAQA 3WQSB 2CHFA 1S3FA 1P6QA 1L9KA 2BP7A 1ADYA 2CWDA 2KM1A 3LM8A 2B1GA 2VOEA 3OE1A 1O6ZA 3Q72A 4X6LA 2NQ2C 2I6XA 1SMKA 1KSHA 3MS7A 1XEXB 4L4ZA 1JPJA 1K7FB 1JWLA 3NHRA 2RHGB 1BU5A 1HYGA 1PYGA 2R1TB 4FS8A 5CAEB 2XBUA 2QJRA 4FFWA 3DB2A 2Y71A 5EI5A 4DILA 4A16A 1C81A 1ODSA 1SC1A 3HDYA 3L8FA 4LOLA