4OU0A

Crystal structure of rpa32c
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
65
Chain Sequence
b'NGLTVAQNQVLNLIKAPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Replication protein A 32 kDa subunit
publication title Structural Analysis of Replication Protein A Recruitment of the DNA Damage Response Protein SMARCAL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 65
sequence length 66
ec nomenclature
pdb deposition date 2014-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ou0A00
2HOEA 2UXNA 1U78A 3HRTA 2PLYA 2W25A 4MEXF 1BIBA 4A5NA 3ZN1A 3QU6A 3EYIA 3R4KA 1AWCA 2IW5A 2PG4A 5D5VB 3P9KA 2L4AA 4LMYA 2KIUA 1XMKA 1MZBA 1USTA 2BE5F 4ESBA 4A0YA 4AWXB 4O5VA 4XSZF 1QBJA 3WE2A 3RI4A 1U8RA 1P4WA 5E1XA 3LSTA 2HTSA 3KLOA 4A2UA 3ZMZA 1OMIA 5E8IA 3E97A 2RDPA 4G94A 3WTVC 1U5TC 2PEXA 4BNCA 1XN7A 3IRRA 2RGVA 4UVAA 3RPUA 3RYRA 1IRGA 1ZGJA 3JW4A 1QZZA 2XIGA 1I1GA 1Z1DA 1K78A 4HOBA 2ZCWA 1BBYA 3WTTC 1SAXA 1ONVA 3JAMK 1HW5A 3ABUA 3E3VA 4HLYA 3I64A 3E5QA 2VOOA 3ZPLA 3I5UA 4EJTA 1O3QA 1KQ9A 3FZVA 3KEQA 1C0WA 1MDMA 1T2KA 4I01A 4OIRF 2QWWA 1XD7A 3IHUA 4E70A 4ETSA 4FX4A 1KQ8A 1W7PD 1WI9A 3FXRA 3F22A 4I7HA 3FM5A 4L0YB 2FE3A 1V3FA 1MKMA 2V1XA 2UXXA 3R0AA 2BBYA 1DPUA 3HRMA 3DKWA 3WTXC 2M30A 5L3BA 4MNUA 2TDXA 3DF8A 2BYVE 3WU1B 1HSJA 3NQOA 4RB3C 5KK1A 1XCVA 1V4RA 5F1RA 3BROA 1DDNA 2D1VA 3U1DA 3T5XA 4G9YA 2CSOA 2JZYA 3ZP5A 1Z6RA 2Z99A 4OOIA 2ZKZA 5D5UB 3JTHA 1TQMA 1IF1A 2M1BA 1L3LA 2Y0MA 1XCBA 2XASA 3K69A 3SQNA 1ZARA 1G3YA 2AS5F 3L7WA 2PJPA 1GXQA 2PBIA 3CTAA 4EM2A 1MJAA 4I0AA 4ZYGA 4MQ9F 1FSHA 3MZYA 2VBXA 1XSVA 4BXUA 2FQ3A 5ICGA 2A5YB 4OMYA 1K78B 5LGTA 2MLGA 4L9TA 2YX7A 4RS8A 1QNTA 2LDUA 1RI7A 2B0LA 3TOAA 2NNNA 2GA1A 5E1ZB 2R3SA 2O8XA 3DEUA 4KMUX 3WTUC 3FMSA 2VODA 3ZMUA 3ZMSA 4L0ZB 1BI2A 3DPTA 4CO8A 2DQRA 4HQMA 1O7FA 3LFKA 1LDDA 4HX4A 2EFPA 5D4SA 2RC4A 3IKTA 5L3EA 3RKYA 1MDMB 3RPQA 1W7PA 3ZMDA 4M71A 4IHSA 3L2CA 1T39A 5KVRA 2OAZA 4GYIA 1K79A 4JQFA 3GW2A 3REOA 4A12A 3VEPA 5E20A 5LEJA 4DQ2A 1R36A 3IWFA 1FT9A 3KZYA 5LHGA 2V1DA 3ISPA 2J5OA 3ZMVA 3T8TA 1USSA 1DP7P 2EWNA 2WV0A 1GXPA 5CJ9A 2DI3A 4ENJA 1YS7A 4HV5A 3QP5A 4G6DA 1R1TA 1KYWA 3FXQA 1SFEA 4KFCA 3PFIA 1OYWA 1HKQA 4KMFA 4YFKF 5EEHA 3GYHX 4WX9A 4HF2A 1IRFA 2HWVA 5E1WA 3W6JB 4P9UA 2JPCA 5J8CA 1LDKB 2HQNA 3WODF 3TQNA 2Z33A 4M9ZA 2H09A 3FWEA 3QRFF 3GEZA 3BPVA 3E6CC 2HYFA 4RB2C 1JXSA 4UV9A 3H92A 1UHMA 3GFMA 4Y15A 5DYMA 3GVAA 1KA8A 2XAFA 3I58A 2VXZA 3TO9A 3P7NA 2P6SA 3L9FA 4ZH4F 3KCCA 1DUXC 1UCRA 1ZN2A 1EH6A 2VBWA 2FOKA 5K5RA 3KP7A 3ABTA 1IXCA 3BJ6A 1R00A 3TGNA 4LGWA 3ROUA 1WRJA 1FY7A 3GO5A 4UV8A 4PDKA 1D8JA 1T38A 2P5KA 2V6CA 3D0SA 1HKTA 1W7PB 5E18F 2K7LA 3TDZC 1FPQA 4CYDA 1TW3A 1SD7A 2DPUA 3RTRA 2YU3A 4BHPA 4IVNA 3VODA 4GGGA 1SMYF 3M9AA 4ENKA 4G7ZF 4GCVA 2LF8A 5BMZA 1QGPA 1YW9A 3R61A 3DPLC 2YR2A 5CLSA 3I4PA 2A68F 3M8EA 4A0ZA 2F5DA 1ON2A 2F5CA 4JBAA 4ENNA 1LEAA 1BJAA 4M73A 2JTVA 1YTYA 1F5TA 2RKHA 4A5MA 2BEOA 3SZTA 5FLXZ 1YS6A 2CG4A 2Y48A 4XLPF 5H6RA 2G7HA 3M7GA 1W5SA 3HUGA 3V4GA 4R8HA 4OIPF 3HRUA 4WCGA 3EQLF 4LLLA 4B8XA 3EYYA 4OMZA 1WWXA 2QENA 5D8KB 3P9CA 3HOTA 2ISYA 3BP8A 4Z2YA 2K4JA 4IHTA 3TO6A 5CVVA 3J81Z 2LSOA 4HW0A 3ULQB 3R6SA 1WSUA 2XRNA 4O6JA 1CF7A 2ELHA 5BQTA 5ICCA 1T98A 3JSOA 5DUKA 4RAZA 3VFZA 3BOQA 4IF4A 1XSDA 4WXDA 3GX4X 1MJBA 5D5XB 3E6BA 3FMQA 3K0LA 3WG9A 4BHCA 1J2XA 2A61A 2DT5A 4K2EA 4MEYF 4TV7A 1PUEE 4A0XA 4I0BA 4CZZA 2DU9A 3LAJA 3KP2A 4D0PA 4MTEA 2DW4A 3I54A 1RUNA 3BDDA 3IKVA 4HLXA 4EM0B 4L9VA 1EH7A 2O0YA 3HOSA 2GIVA 5HS9A 5FFZA 5HLIA 1AOYA 1CGPA 2RQPA 4NB5A 4YIIA 3WGIA 1OR7A 2OBPA 4LG0A 1KU7A 2XHKA 4UVCA 4ON0A 4HF0A 2WC2A 2OQGA 2JRTA 1FBUA 3G3ZA 4OINF 3GFIA 2MA3A 3ELKA 3H3UA 3NRVA 4M6XA 2QBYA 4KN4X 5FB2A 3QP6A 2EFOA 4EVIA 3GZ5A 3V8LA 3KP4A 4N0BA 3WTZA 1IN8A 2EK5A 4PGGA 1QO0D 3GWZA 1F1ZA 2VC1A 3F72A 3GFJA 2H6CA 2IPQX 2VBZA 1FP1D 3I53A 4LD5A 4R79A 1FBQA 1D3YA 1JHFA 3F6OA 2EV0A 4LJZF 3L09A 1HXDA 1PDNC 3CJNA 1S7OA 2EFQA 4HQEA 1CF7B 1UB9A 3BWGA 2HFHA 2STWA 4ZYDA 2XAGA 2EA2A 1BOAA 5IT9Z 1IXSB 2P6TA 3GF2A 2GQQA 1P4XA 1EV7A 1TNTA 2M8EA 5AIQA 3DFGA 5AONA 1B4AA 1O3RA 5HVQC 4KA4A 1FOKA 5D8LB 5FLXK 4WK8F 1F4KA 4G7OF 1TBXA 1SFXA 2PN6A 1P2FA 1T0FA 3CO6C 2E7XA 3F23A 2E1NA 1YW7A 2BGCA 2XUBA 2G9WA 5LBQA 4KIGA 2OD5A 1VTNC 3D5LA 1W5TA 2MC3A 2Z9OA 1H0MA 3TOBA 4P5OA 5ED4A 3J81K 1Q1HA 4LG0B 1IW7F 2K27A 2P5LC 1J7KA 1S8NA 4L9NA 3DQVC 4ASNA 4GYGA 1E2XA 3IRQA 3H3ZA 5JVTA 1ON1A 2ZXJA 5L3GA 2DK5A 2QBYB 1YIOA 3IWZA 2VC0A 2DPDA 1ZGAA 3V7SA 4M6YA 2ETHA 5LRSA 4ENMA 4HX8A 3HSFA 1H9GA 3EETA 5IT3A 3MEXA 1L0OC 2IRFG 1TQIA 1G3TA 1KU3A 2XROA 1DPRA 4OU0A 3KLNA 5D5WB 2NS0A 3TO7A 1PP7U 5DD4A 4IRGA 1R22A 1B59A 3J80Z 1Z7UA 1YLFA 1O7LA 5BS6A 1RZ4A 2GAUA 6PAXA 3JSPA 4JK1X 5DV5A 2GA2A 5K1YA 4ZZDA 3RKWA 1KYZA 4RGUA 3PQJA 1B9NA 2HGCA 4KICA 4CICA 3O3KA 3E5UA 2UWMA 3LQRA 4AIKA 3P9IA 2F2EA 5TJJA 1J59A 1XDUA 2IVMA 4KN7X 1ZRFA 2P4WA 3Q5FA 4YFNF 3K1NA 4U0YA 1OKRA 3FM3A 2ZNZA 5LRRA 2XAJA 5DDGA 2M5WA 2NAZA 1LVAA 5CVJA 3ZN0A 2QM3A 1SMTA 1ZRCA 1FLIA 4U88A 2RV8A 3RYPA 1ZLKA 2QUFA 2X0LA 3K9TA 2EJRA 4PCQA 5J6XA 5D6EA 1D5VA 2V1UA 1LDJA 4AVPA 4EV0A 1BC8C 1SD4A 4ZYEA 4S04A 4CGZA 1JHHA 2VN2A 3NEUA 1R5HA 1XGSA 4XSXF 3V8JA 5IT9K 1FX7A 1KU2A 2STTA 4IRHA 1G6NA 2F5FA 4ZYHA 1R1UA 3QPTA 1T6SA 2L54A 4FHTA 4ESJA 4Q4ZF 4Y17A 3V7RA 1LQ1A 3K1PA 1R58A 5BPIA 3OV8A 1J5YA 3HIFA 2AXLA 3T8RA 5CVUA 5LEKA 4XBFA 4RAYA 3F3XA 5HDGA 5ILSA 3HRSA 4RB0A 1S7AA 3FXUA 5DD8A 4Q48A 2QZ8A 1S3JA 2RNJA 1IAWA 4I98B 3MFKA 4UHTA 4LB5A 5HDKA 3V7CA 4S05A 4G8XA 5A2QZ 4I09A 4F7ZA 3LA2A 1TQPA 1G3SA 3EDPA 1S6LA 1Z6TA 2O3FA 4EGZA 2VE8A 3HHGA 3HTUA 4BAYA 5H20A 1FWZA 1TW2A 5DEQA 1I5ZA 1LEBA 4QWQA 1K6OA 5K5QA 1F9NA 3PQKA 1I1SA 1OPCA 4BH9A 1O57A 1WQ2A 2P7CB 3L00A 3FMRA 3J80K 1ZG1A 3C3WA 1MD0A 2F5EA 4YFXF 4R1HA 1TLHB 3IC7A 2Y75A 4M72A 2JT1A 2HR3A 1PP8F 5BPDA 3Q9SA 1B1BA 4H0EA 2VBYA 5JHUA 4AD9A 3CUQA 3WTWC 4FX0A 3DXJF 4ZZLA 2HKOA 4MHGA 1I27A 3U2RA 3GUDA 4EJWA 2EV5A 2OZUA 4CHUA 2D45A 2A6EF 2RN7A 2VT2A 3BJAA 3BPXA 1HBXG 1FBSA 1ZHFA 3SFZA 3CUOA 5F6FA 5HS7A 4I02A 3M8FA 2FXAA 3SZPA 4AIJA 4KDPA 3LAPA 4Y13A 1B9MA 1W4MA 2CO5A 1FYLA 2XKOA 4AIHA 3J7AO 3WE3A 2XKPA 1KU9A 1UFMA 5CVIA 3RKXA 3ECOA 2J5PA 2JSCA 3KEOA 1ZRDA 4G6QA 1LB2A 4IRIA 4M9SA 2CFXA 5CYVA 1J0RA 3F6VA 3Q9VA 5JI6A 4FT8A 4EJOA 2FBIA 2ZNYA 4UXNA 4ESFA 1QPMA 2L01A 1XGMA 4XLNF 2CQKA 4LB6B 4LLNA 2ISZA 2Q0OA 3LQQA 3WTSC 3CO7C 2EV6A 4WXCA 1RIOH 3T1BA 3EUHA 3LWFA 2LF7A 2YPRA 2PMUA 4M74A 2CGPA 3FHZA 2KIMA 1ULYA 1HSTA 2OQRA 2FSWA 4UNOA 1BN5A 3E6MA 4U7BA 4YG2F 3C18A 1B6AA 1MJ9A 2IJLA 3CUQB 3KE2A 1J9IA 3ERED 5HOOA 4HDUA 1UHWA 5A2QK 3HSRA 2MLKA 3I0TA 2W24A 1Z91A 2FRHA 3ML6A 5ERIA 4BQAA 4LK1F 1FP2A 5DCFA 3IL2A 1BC7C 3MCZA 3DV8A 3F8MA 2IT0A 2M45A 2Q2EA 3F8NA 4A6EA 1STZA 2GXBA 2OU2A 1EH8A 3O6BB 2R7FA 2ADUA 3GXOA 3O2PE 5L3CA 1IUYA 2XVCA 5HLHA 2CYYA 2CWEA 4HA8A 4CXFA 1FC3A 1ZAOA 3HHHA 2DTRA 5HDNA 2QQ9A 5LHIA 2LKPA 5E17F 1FSEA 2P5VA 3FF5A 1YW8A 4KNYA 1HW2A 2IA1A 2ZO4A 1P92A 4HZFA 4Q47A 1GHCA 1LNWA 4HF1A 2W85A 4RGRA 2DBBA 1YFHA 3F8FA 2OA4A 4NQWA 2DO7A 1TNSA 2UZKA 2D2WA 4KIBA 3ZQ7A 1R1VA 3WGHA 4UVBA 3HSEA 3N4MA 4MQVA 1R5GA 2R7DA 1QQIA 1Y0UA 5D4RA 1H9TA 2QYOA 4KUMA 2PQ8A 3C1DA 4WF2A 4CDGA 1QZYA 2HZTA 2HS5A 2D1HA 2XAHA 3CDHA 5TRDA 4EQQA 1IZ1A 5HLGA 4MGRA 2FF4A 5FD5A 1XGNA 2OZ6A 2V9VA 2GWRA 2P8TA 3BJOA 3BZ6A 4BYYA 2K02A 1ZYRF 1TTYA 2HDCA 1ZLJA 1XGOA 1K7AA 1U5TA 4NHJA 1O3TA 3CLOA 1E17A 2DFIA 5ILUA 1A04A 3V8KA 4HX7A 4RGSA 2EB7A 2IP2A 3AAFA 3S2WA 1O3SA 2NYXA 2MH9A 4B09A 5ICEA 5LGUA 1FYKA 1U6GA 2Z5UA 3G73A 3N97A 2HTJA 1IN6A 1IN7A 4WWCA 3B73A 2ESHA 3GFLA 2CW0F 4N9HA 2XV4S 3RDIA 2FBHA 1YQAA 4UUVA 2DQLA 4M9XA 3MAJA 2XGXA 2M87A 5FO5A 4P55A 2KJCA 2ZMEA 2PFBA 2O61A 2A3SA 2PMHA 2QQAA 4LFUA 1ZREA 4OIQF 5J8FA 2HQRA 4U7DA 3U9GA 4PGHA 1SFUA 3KP3A 1SD6A 2MH2A 2QQBA 1G3WA 2IA0A 1YYVA 5DUIA 2IA2A 4DNCA 4QLCU 3KFWX 4KT5C 2DAOA 2RVCA 2E7WA 2A6HF 5D6FA 4I2OA 3BY6A 1GVJA 2BV6A 1WKMA 4WXHA 2COMA 4L9JA 2FNPA 2MD5A 3B02A 5DCMA 1FZPB 1YG2A 2MBFA 1R7JA 3OOPA 2EFNA 2Z3YA 1U5TB 4XRFA 4IXAA 2ESNA 3HTSB 2VONA 1ZG3A 2ZFWA 1BM9A 4EGYA 2PI0A 1HQCA 4L18B 4KIFA 2O03A 5FD6A 4HV6A 2DK8A 1Z05A 4A6DA 2VE9A 1XDSA 3CUQC 2L4MA 2FEZA 5FFXA 1KQ0A 5F64A 3MQ0A 3LA7A 2NNYA 1XSXA 3E5XA 3KP5A 2EFWA 3QPHA 5L3DA 4KYWA 1LJ9A 1IN4A 3DP7A 3LA3A 4RB1A 4HYEA 5EEGA 3QOPA 1XB4A 2ZMEB 2X4HA 2QLZA 2W84A 4IPAA 1J75A 3ZMTA 4N9IA 2K86A 2A07F 2VOPA 3KZZA 1ODDA 2WTEA 2HKXA 3MWMA 2FBKA 2GZWA 3KP6A 1RUOA 2A69F 2VT3A 5ICFA 4RGXA 2WWYA 4EJVA 2O6GE 3K2ZA 1BIAA 5CVRA 1OYYA 2KRFA 4OIOF 5JR3A 2P7VB 5E8GA 1XMAA 3WGGA 2L3DA 4HBLA 3I59A 4G7HF 2H94A 4LLGF 1ZG5A 2E1CA 3GZ6A 1BI1A 3C7JA 1OYIA 1ZH5A 1X3UA 2DLLA 5FGMA 2FNAA 3COAC 2JPBA 1SD5A 5DCMB 3WU0A 2GXGA 5LGNA 4EJUA 2FA5A 1U3EM 1D8KA 1IXRC 2QVOA 3SXYA 1I6XA 5LHHA 1JGSA 2KJBA 1IN5A 4U0VA 3R60A 1U2WA 3FX3A 1HKSA 1JE8A 2HYGD 3VOEA 4GXOA 4BHBA 3TKYA 3VB2A 3JAMZ 3KETA 4HAMA 5AIPA 1HW1A 3I71A 1Z9CA 1P4AA 4P96A 2YSRA 4LK0F 3E6DA 3T0YA 4O3MA 5K5OA 3JTGA 1R23A 5JFRA 4PZJA 4L5JA 2NRAC 2KIFA 5HS8A 2H6BA 4IJAA 4HDVA 1BI0A 1BI3A 4P9FA 3ECHA 3SHFA 1RNLA 2ZBKA 5L3FA 1P6RA 2G7UA 2HEOA 4GO1A 1FYMA 1S29A 4MTDA 3HYIA 3MZHA 2ZJ2A 1G4DA 3QAHA 5LLQA 1MGTA 2FMYA 2KKOA 3M1EA 4L5IA 2FMLA 4Q5SF 5BOXA 2YX4A 1KGSA 2FU4A 2ACJA 3W6KB 3RJPA 2Q8KA 1NHAA 4EMSA 3K1MA 3F8CA 1REPC 3GLXA 3F21A 2H27A 3R0JA 2V79A 2W57A 3TDUC 4YIFA 3I59B 5H6QA 3QU3A 2L02A 2XAQA 1FNNA 5ILVA 2C6YA 2K4BA 4U0WA 3F8BA 4EM1A 2LNBA 3RIRA 3WTYC 1YO5C 2EA4A
chains in the Genus database with same CATH superfamily
1JT6A 2HOEA 2UXNA 1BL0A 1U78A 3H0DA 3HRTA 3VDXA 5EG0B 5EGOB 1T0FC 2PLYA 2W25A 1SFKA 2E19A 4MEXF 1BIBA 3HKZA 3S1MJ 4A5NA 3ZN1A 3QU6A 2WB1A 3EYIA 4BXXJ 3R4KA 1AWCA 2IW5A 2PG4A 4E7SA 5D5VB 2JQ7A 3W2WA 3P9KA 2L4AA 2DA6A 4LMYA 3FIWA 1APLC 2KIUA 1XMKA 1MZBA 3FHNA 1USTA 2BE5F 1SVOA 4ESBA 2XPWA 1WPKA 2CUJA 4A0YA 3WU2C 1R49A 2WAEA 3S3NA 3HC7A 4AC0A 4AWXB 4W97A 1UELB 1EJ9A 2V9KA 4A93J 4O5VA 4XSZF 1Y39A 2ID3A 1QBJA 3WE2A 3RI4A 1NG7A 2HNHA 1U8RA 1P4WA 1R71A 3K6GA 2K3FA 3LSTA 5E1XA 2HTSA 4XLFA 1RKWA 2K9LA 4CCLA 1B72A 3KLOA 4A2UA 3OYNA 3SDBA 3ZMZA 1OMIA 5DM6F 3PIPF 5E8IA 3E97A 2RDPA 3CJQB 4G94A 3ASNH 1U5TC 4MFEA 3WTVC 2PEXA 2YUSA 4Y33A 4BNCA 5KCMA 1BW5A 4PJ0C 5C44J 1XN7A 2RGVA 3IRRA 4F91B 4UVAA 3M07A 1XG1A 3RPUA 3RYRA 1IRGA 1D1AA 1ZGJA 2IGOA 3S93A 4AYBA 4E7HA 3JW4A 1VQMI 1M1EB 1Q1VA 2CJJA 2CV1A 2MW8A 5M5XJ 1QZZA 2XIGA 3H9QA 1I1GA 1I3QJ 1Z1DA 2E1OA 3HGGA 1TWAJ 2L0KA 3H5AA 4BDZA 4HRIA 3BC8A 1MH4A 3OS1A 2QA4I 3KYLA 1LFUP 2DOFA 1K78A 2F4OB 4RA2A 3V42A 4HOBA 3MD2A 4XORA 5F0CA 2ZCWA 1BBYA 3OYKA 1VNDA 2QEXI 2R5YA 3WTTC 1SAXA 2XGDA 1ONVA 4B4CA 3JAMK 1HW5A 2Q1ZB 3ABUA 3E3VA 4HLYA 3FKJA 3I64A 1WI3A 1OLTA 2CRGA 5M5WJ 1VQLI 2XB0X 3E5QA 2Y9ZA 3DKYA 2VOOA 3ZPLA 3OYIA 5LFAA 2QF7A 3I5UA 1FMVA 5M3FJ 4EJTA 1O3QA 4BS9A 2ZMEC 1KQ9A 4MFDA 3IAM2 2YU9J 2L9SA 3FZVA 3KEQA 1C0WA 4HNUA 3BR1A 1T2KA 1MDMA 4I01A 4OIRF 3HPGA 2QWWA 1XD7A 3HG9A 3IHUA 3K4JA 4E70A 4ETSA 4FX4A 5FKKA 1KQ8A 1W7PD 1WI9A 3ZXSA 3FXRA 3K7AJ 3F22A 2DA5A 2B63J 5CQGA 4I7HA 1A36A 3FM5A 2BW3B 4L0YB 2FE3A 2LMDA 2Y31A 5KAIC 1V3FA 1MKMA 2DA1A 2CU7A 2V1XA 2KZGA 3A01A 3GTQJ 2UXXA 4D9JA 2LR8A 3R0AA 4XKWA 3W2VA 3LSPA 4J01A 3MN2A 2BBYA 1DPUA 2X1DA 3HRMA 1MIJA 3DKWA 5LD2C 3WTXC 3JRDA 2M30A 5L3BA 3SZGA 4MNUA 2MC4A 2TDXA 3DF8A 2BYVE 5K7FA 3CLQA 3WU1B 2JA5J 1F43A 1HSJA 3NQOA 3FKIJ 3CCLI 4RB3C 2BZTA 5KK1A 1I39A 1XCVA 3BG3A 4JYKA 1V4RA 4CA0A 3BTCA 1U9NA 5F1RA 3BROA 1HLVA 1DDNA 2D1VA 3U1DA 3T5XA 1WJEA 4G9YA 2CSOA 2HPMA 2JZYA 2Y9YA 3ZP5A 1Z6RA 2Y2ZA 4AU7A 2Z99A 4NBQA 2VPRA 3OL3A 4OOIA 2Y30A 2ZKZA 5D5UB 2EBIA 2NXNB 2QKLB 1TQMA 3JTHA 1IF1A 2M1BA 1L3LA 1TT0A 5F04A 2DA7A 2Y0MA 1XCBA 3BR5A 1MMNA 3DTEA 3H36A 1OCZH 3BQYA 2BVMA 2XASA 3K69A 1B72B 1IRXA 1WZ2A 2H8WA 3GTPJ 5EYRA 2JA8J 1IDYA 1UZCA 2L7KA 3KPHA 3SQNA 4E7LA 1ZARA 1G3YA 2AS5F 1QU3A 1B8IA 3BCAA 3L7WA 3IV5A 2PJPA 1GXQA 2PBIA 3CTAA 4EM2A 3PO2J 3HZJA 4QIWN 2CUEA 1MJAA 4I0AA 2RREA 4HPQA 4ZYGA 5J1RA 2R7UA 4MQ9F 1MMSA 2LP0A 2HXIA 2L9VA 2W1OA 1FSHA 3K10A 3MZYA 2JJ7A 1X2MA 3VYTB 2VBXA 1XSVA 4BXUA 4BE0A 1A5JA 2FQ3A 1TP4A 5ICGA 2F48A 2A5YB 2L9NA 2OCEA 2DN0A 2K3PA 3OYEA 2MG4A 4OMYA 2LKXA 1K78B 5LGTA 2MLGA 2NOGA 2JWTA 4IQ4A 4DBQA 4L9TA 3OYAA 2YX7A 4RS8A 1QNTA 2ZSIB 2LDUA 1RI7A 2B0LA 2R7QA 3TOAA 2NNNA 2R5YB 2GA1A 2WY8Q 5E1ZB 1H89C 2R3SA 2O8XA 3FISA 1ITYA 3JCUC 3VSLA 3DEUA 4IOAF 4KMUX 5GP9A 3WTUC 3FMSA 1TWHJ 5GADJ 2VODA 2KRCA 3ZMUA 4C30A 3ZMSA 1W36D 4L0ZB 1BI2A 3DPTA 4CO8A 2DQRA 4HQMA 1O7FA 3RQ4A 3LFKA 4IZZA 1LDDA 4HX4A 2EFPA 5D4SA 2RC4A 3IKTA 5L3EA 5IP9J 4RM3A 2GIZA 4BACA 3RKYA 1MDMB 3RPQA 1W7PA 1YJNI 3RSNA 3ZMDA 4M71A 3A02A 4IHSA 3L2CA 1T39A 3DLLF 3PSFA 5EJCA 5KVRA 2VQGA 2OAZA 2LRDA 1OCOH 4GYIA 1K79A 1ZELA 4JQFA 1JTXA 3GW2A 4XOPA 3REOA 1K4SA 4A12A 2VQCA 2IGMA 1XX5A 3BLYA 3VEPA 5E20A 3A03A 5LEJA 4DQ2A 1R36A 2HI3A 1JUPA 1LE8A 3JRHA 1P9QC 3IWFA 5M3MJ 3D5SC 1FT9A 2EIMH 4LIUA 3BG9A 3KZYA 4DYRA 2V1DA 5LHGA 3ISPA 2J5OA 1A31A 3ZMVA 3T8TA 1USSA 1DP7P 2CQQA 2EWNA 2WV0A 1GXPA 5M5YJ 5CJ9A 1WHUA 2KLOA 2RQQA 3G2BA 5B3SH 2GLOA 2DI3A 4XONA 4BU2A 3E7LA 4ENJA 1YS7A 2MD0A 2CV0A 2X6YA 3QP5A 3QYEA 4HV5A 5GAEJ 1WVRA 4G6DA 4A3EJ 2AQEA 1R1TA 4B43A 1OCRH 3AG3H 1A6QA 1KYWA 3FXQA 4RLQA 1SFEA 3CZ6A 4KFCA 1NTCA 2A05A 3JREA 2MSYA 1Z7LA 3PFIA 2A6TA 4XOTA 1OYWA 1HKQA 4KMFA 4RAFA 2DDBA 4YFKF 5EEHA 4JP0A 2M8GX 3GYHX 4WX9A 4HF2A 3EUAA 1IRFA 2HWVA 3ZRGA 5E1WA 3W6JB 4J19A 4P9UA 2JPCA 5J8CA 4C2UA 1LDKB 2HQNA 3IH2A 3WODF 3TQNA 2Z33A 1YX5A 3LMMA 4M9ZA 1V5EA 2H09A 3FWEA 3GEZA 3QRFF 3BPVA 3E6CC 2HYFA 4RB2C 1JXSA 2W7NA 3RQIA 4UV9A 1V54H 3OYJA 3H92A 2KIQA 2F4IA 4E6KG 4ABZA 1B8IB 1UHMA 4BQOA 3ESWB 3OOUA 3GFMA 4Y15A 3OWTA 5DYMA 3ABKH 3GVAA 1KA8A 4UUSA 3CF2A 2XAFA 1VF9A 3I58A 2VXZA 2V1NA 4QSHA 1DGWY 3A4CA 1G59A 1UJ8A 2WAQN 1IDZA 2H1KA 2CS3A 3TO9A 3P7NA 2Z1DA 2P6SA 4BDYA 3S3MA 1FTZA 3CP2A 2WAFA 3FK6A 1ZR4A 3L9FA 2XPUA 4NUBA 4ZH4F 5B1AH 3OYBA 2HPIA 1N75A 3CCYA 3FXOA 5TGTA 3CC4I 3KCCA 1DUXC 1UCRA 1ZN2A 1EH6A 2VBWA 2BY2A 2EZLA 2FOKA 2Y0SN 5K5RA 3KP7A 2VB6A 3ABTA 1IXCA 3BJ6A 3LSKA 1R00A 3TGNA 1TC3C 4LGWA 3ROUA 1X1CA 1WRJA 1FY7A 3B6AA 3GO5A 4UV8A 1TL8A 4PDKA 4F55A 1D8JA 5FKOA 1T38A 2P5KA 1G8XA 2L7MP 3F0CA 3KYCB 4G6TB 2V6CA 4XN0A 3D0SA 2JA7J 1R4NB 2BXZA 4B3AA 1HKTA 2R7TA 1W7PB 5E18F 2IXSA 2K7LA 2OV7A 3PO3J 3TDZC 2ELJA 1FPQA 2H8RA 4CYDA 1QHHD 3G6EI 1TW3A 1SD7A 1VI0A 5F1JA 2DPUA 3RTRA 4B48A 1LVKA 2YU3A 2DTZA 1IRZA 1OCTC 1IC8A 4BHPA 3CC2I 4IVNA 3RCOA 3PUFA 1J09A 3VODA 4BE2A 1OCCH 3HOXJ 3PNTA 4GGGA 1SMYF 4XR6A 4XN3A 3M9AA 5IP6A 4ENKA 4G7ZF 2R7ZJ 4GCVA 3BTLA 2LF8A 1JKQC 3QPLA 5H2FC 5BMZA 4C3HJ 4XKVA 2VI6A 4DZJA 3I55I 1QGPA 3EUHC 5JLWA 2VJIA 2PMZA 1ZQ3P 4C2TA 1YW9A 3GTLJ 3R61A 2LK2A 1JUMA 3L2QA 3DPLC 5EEAA 2YR2A 5CLSA 3QYBA 3I4PA 3BQZA 2A68F 2GM4A 3H35A 3M8EA 4A0ZA 2DOAA 3G71I 2F5DA 1SFOJ 3OIOA 1ON2A 4MO7A 2F5CA 3M8JA 4JBAA 3H5RA 1MMDA 1X3ZB 2E2IJ 4ENNA 1LEAA 1BJAA 1ERDA 4M73A 1MBGA 3L2WA 4BQNA 2JTVA 1YTYA 1MMAA 1F5TA 5E3LA 2RKHA 4A5MA 2BEOA 3SZTA 3OYHA 5FLXZ 1IJWC 1YS6A 2CG4A 2Y48A 4XLPF 5H6RA 1JUSA 2G7HA 3M7GA 5FKLA 4CCMA 2QGUA 3PJRA 1W5SA 3HUGA 1BOBA 2FX0A 1ETOA 3V4GA 2R7WA 1HA8A 3PNVA 4R8HA 1Y0NA 2M7AA 2XGCA 1S5LC 1X19A 4OIPF 3HRUA 4WCGA 3H9JA 1FTTA 4I76A 3EQLF 2LC2A 4FASD 4LLLA 4B8XA 3EYYA 4OMZA 1Y1WJ 1MBJA 1WWXA 2X6OA 2QENA 4FE4A 5D8KB 3P9CA 3K70C 4Z6YA 3HOTA 2ISYA 1QPIA 3Q0UA 3ONQA 3BP8A 4Z2YA 2LOOA 2K4JA 4IHTA 2VQHA 4GFBA 3TO6A 5CVVA 3J81Z 3H3VK 5IYCJ 2LSOA 1MBEA 4HW0A 3R6SA 3ULQB 3K4LA 1WSUA 1MH3A 2XRNA 3K4BA 2EZHA 4O6JA 2ELHA 5BQTA 5ICCA 3KX2A 1CF7A 1GV2A 1UG2A 1T98A 3JSOA 3IP4B 5DUKA 3B6CA 4RAZA 3JRFA 2DCEA 3VFZA 4A3KJ 3BOQA 2BY0A 3OR2C 4IF4A 4XLCA 1XSDA 4WXDA 3BR3A 3GX4X 1MJBA 5D5XB 3E6BA 3L2VA 2DYRH 1OCPA 3FDYA 3FMQA 2HOSA 1EF4A 3L2UA 2CFOA 3K0LA 3WG9A 4BHCA 1J2XA 2EPFA 2A61A 1HOMA 2DT5A 5F0HA 4K2EA 4M3GA 4PFPA 5F08A 4BXFA 4MEYF 4TV7A 1PUEE 4A0XA 4I0BA 4CZZA 1UG0A 2DU9A 3LAJA 2CUZA 5J3LA 4ZTJA 1RKTA 3C2HA 3KP2A 4D0PA 2K40A 4MTEA 2DW4A 4E7ZA 2LVSA 3I54A 1RUNA 3BDDA 3IKVA 1VQNI 3SYTA 3S3OA 4HLXA 4EM0B 4L9VA 5DS9A 2KDOA 1EH7A 2IS2A 2RNGA 2DFEA 2O0YA 3H5NA 3P5JA 3HOSA 2GIVA 3TEDA 5HS9A 5B1BH 5FFZA 3JR9A 5HLIA 4IHYA 1AOYA 2E71A 3DEEA 1CGPA 2RQPA 4NB5A 4YIIA 1N78A 3K4CA 3WGIA 1OR7A 2OBPA 4LG0A 3FXMA 1KU7A 2XHKA 5E79C 4UVCA 4V2FA 4ON0A 4HF0A 2Y69H 2WC2A 2OQGA 5C3EJ 2JRTA 4B3XA 1FBUA 3BG5A 3G3ZA 2KPMA 2IGNA 4OINF 4AVZA 3GFIA 2MA3A 1GLNA 3ELKA 3H3UA 3NRVA 3AKZA 3Q0VA 4M6XA 2QBYA 3S17J 2M0MA 5F27A 4BJ6C 4DGWB 4IO9F 3EPZA 4KN4X 4FQGA 2FUG2 3QP6A 2EFOA 2X9DA 5FB2A 5K7ZA 3DWLE 1V55H 4EVIA 3GZ5A 3V8LA 1W1WE 3KP4A 2O9LA 4N0BA 3WTZA 1IN8A 3NWSA 4UUTA 2KP6A 1POGA 3CCVI 4ITVA 2EK5A 3HUGB 1F36A 4M3FA 2TRTA 4PGGA 1QO0D 2FD5A 3GWZA 1F1ZA 2VC1A 3F72A 2XAUA 3DBHB 3GFJA 4ANJA 1Z3XA 1U8BA 2H6CA 2IPQX 2VBZA 2QQ8A 1FP1D 1PJRA 3LNQA 3I53A 4LD5A 2K9QA 4R79A 4M3BA 1FBQA 1D3YA 2BVLA 1Z67A 3E0JB 2NVUB 4C3IJ 1Y8QB 1IUFA 1JHFA 3F6OA 2EV0A 4LJZF 3L09A 2ECCA 2CV2A 1QA6A 1S7EA 1HXDA 4XRMA 2VASA 3LSMA 3Q3SA 1PDNC 2QKMB 2LH9A 4AIDA 3CJNA 1S7OA 1SANA 4A3MJ 1R5ID 2EFQA 5IPAA 3CCUI 4HQEA 1CF7B 1UB9A 3BWGA 4A3GJ 2HFHA 4E7JA 2STWA 2B7EA 1YHQI 4OAYA 4ZYDA 4PSWA 3PSIA 2VQLA 1QVTA 2XAGA 2EA2A 4XLAA 1YIJI 1BOAA 5IT9Z 1IXSB 2P6TA 3GF2A 2GQQA 2L7FP 1P4XA 2K9NA 2IGKA 4BUPA 1EV7A 1TNTA 1Y6IA 4M6VA 4QPQA 2M8EA 5AIQA 1MSFC 5GAHJ 3DFGA 5AONA 2XF5A 2EZKA 1B4AA 2E5ZA 1O3RA 5HVQC 2EILH 3W3CA 3I56I 4KA4A 1FOKA 5D8LB 3GTKJ 5FLXK 4WK8F 3PNYA 1A6IA 4RLFA 1AKHA 2DMPA 4XK4A 3PIOF 1F4KA 4BBSJ 3I4MJ 4G7OF 4GRIA 2JVGA 3HOZJ 3ZQCA 2NVTJ 1W0TA 1TBXA 2JSPA 3HXLA 5EF6A 1SFXA 2DDAA 2PN6A 1BA5A 1P2FA 1T0FA 3CO6C 4HSTA 4PFOA 5B5EC 2E7XA 3K4NA 3F23A 2E1NA 4RMNA 1YW7A 2B9SA 2BGCA 2XUBA 1N77A 1HC8A 1U0JA 2G9WA 3TW6A 2R7SA 5LBQA 1X1BA 4KIGA 2OD5A 4LITA 2Z2SB 5HODA 1VTNC 3D5LA 1W5TA 2AQFA 1HDPA 2MC3A 4PJLA 4E7IA 4DYQA 2Z9OA 2HVRA 1H0MA 3TOBA 4P5OA 5ED4A 3J81K 1Q1HA 4LG0B 1IW7F 2K27A 2P5LC 1J7KA 2CQXA 4FETA 1S8NA 2DXIA 4L9NA 3DQVC 1YRNA 4ASNA 1OFCX 2FOWA 4GYGA 1E2XA 3IRQA 3S1NJ 3H3ZA 4D5FA 5JVTA 3C2GA 1ON1A 2ZXJA 5L3GA 2DK5A 2QBYB 2BHYA 1YIOA 3IWZA 3GTGJ 5C4JJ 1WJDA 2VC0A 2DPDA 1YJ9I 2BOLA 3CJRB 1FOXA 1ZGAA 3V7SA 3U21A 3S14J 4M6YA 2ETHA 4X1EA 5LRSA 4LG3A 2R7VA 4ENMA 3UKGA 4HX8A 3HSFA 1H9GA 3EETA 4LOCA 5IT3A 3MEXA 4CH7A 2IS1A 1L0OC 2M4KA 2ZXIA 4BY7J 4XICA 3OIPA 2IRFG 1TQIA 2JUGA 1GDTA 1G3TA 4A3IJ 2LD5A 1KU3A 1I3AA 2XROA 1I50J 2KMUA 1DPRA 4OU0A 4BEHA 3KLNA 2M3AA 2OPTA 5D5WB 2LBFA 2XB5A 1VQ7I 1QRYA 1W5CC 2NS0A 1X1AA 2BXYA 3TO7A 1PP7U 2PJRA 2XF6A 3BT9A 4IRGA 5DD4A 1R22A 5FJ8J 2ICWG 2DOEA 1B59A 1X1DA 3J80Z 1Z7UA 2IS6A 1NH3A 3MKZA 1YLFA 1O7LA 5BS6A 1RZ4A 3GZNB 2IS4A 1BR1A 2IAIA 3CDLA 2GAUA 6PAXA 3HDDA 1SVLA 3JSPA 4JK1X 2X51A 5CPRB 5DV5A 2GA2A 5K1YA 4ZZDA 2K9SA 3RKWA 4HNVA 2QSGX 1KYZA 4RGUA 1VQKI 3HOWJ 3HOYJ 3ZOBA 2R7RA 3OR1C 4QTRA 3PQJA 1B9NA 1JGGA 2UV1A 2HGCA 4KICA 2DFHA 4CICA 3UNGC 2IEKA 4MLOA 2EZIA 3O3KA 1LUJB 4XM3A 4KT6A 1SAUA 4LIVA 5FLMJ 1D5YA 3E5UA 4ZJZA 2UWMA 3LQRA 2HVQA 2ZJRF 4AIKA 1XTAA 3P9IA 1AKHB 2F2EA 5TJJA 1J59A 1XDUA 1W36C 2IVMA 4KN7X 1ZRFA 2P4WA 3Q5FA 3MKLA 4YFNF 3K1NA 5F0FA 4U0YA 3LSRA 1OKRA 3A01B 1ZR2A 3FM3A 4M3DA 2ZNZA 5LRRA 1S9HA 3GTOJ 2XAJA 5DDGA 3IH3A 2M5WA 2NAZA 1LVAA 5CVJA 4ZYAA 3ZN0A 2M0CA 2QM3A 2AO9A 1SMTA 2KDZA 1ZRCA 4A3JJ 1FLIA 4NNJA 2RV8A 4U88A 3U1KA 4IHVA 1IO2A 3RYPA 1BW6A 1ZLKA 1YE9A 3G1OA 2QUFA 4C2MJ 2X0LA 2XRLA 3K9TA 2EJRA 1MMGA 4PCQA 1D0ZA 5D6EA 5J6XA 1D5VA 2V1UA 1LDJA 2CQNA 1TWFJ 4AVPA 4EV0A 1BC8C 1YRNB 1SD4A 4ZYEA 4S04A 4CGZA 1G2HA 3ZQQA 1JHHA 2VN2A 3NEUA 1RR8C 1LPQA 1R5HA 2FQ4A 1XGSA 4XSXF 3NWTA 1GV5A 3V8JA 5IT9K 1FX7A 5K7HA 1KU2A 2LKSA 2R7OA 1PUFA 3CCMI 2DT7B 2STTA 4IRHA 1G6NA 2F5FA 4ZYHA 1R1UA 3QPTA 5EZHA 1T6SA 2L54A 1IV8A 3N05A 4FHTA 1X1PA 4ESJA 4FCYA 1ZKGA 3OY9A 4Q4ZF 2QSHX 1FJLA 3LL7A 2K9MA 4Y17A 3V7RA 1LQ1A 2K5CA 2GOXB 2QSFX 3K1PA 4BEHB 1R58A 4A3DJ 5BPIA 3OV8A 1J5YA 2LY2A 3HIFA 2WA0A 2WBMA 2LY9A 2AXLA 1AU7A 2M4GA 1CQTA 2PJRB 1X2NA 3T8RA 5CVUA 5LEKA 4XBFA 4RAYA 2LFBA 5J1YA 3F3XA 2JN6A 2TCTA 5HDGA 3M4OJ 5ILSA 3HRSA 4RB0A 1FOWA 1K61A 1S7AA 2I10A 5IYBJ 3M3YJ 3FXUA 5DD8A 1R4MB 2CH0A 4Q48A 2QZ8A 3GTJJ 2XDVA 4XRSA 1S3JA 2RNJA 4OAZA 1IAWA 4NC8A 2OJED 1JI8A 4I98B 4E7KA 2EIJH 3G1MA 4W1UA 3LSIA 3MFKA 4UHTA 1VQPI 4LB5A 5HDKA 2JA2A 2ME6A 3IH4A 1SEUA 2LY1A 3V7CA 2JK3A 4S05A 2M2EA 4G8XA 5A2QZ 4I09A 5TISC 4F7ZA 3LA2A 3PUBA 4U87A 1GVDA 1TQPA 2V4JC 1G3SA 1T56A 3EDPA 3CESA 1S6LA 1Z6TA 2O3FA 4II3A 4EGZA 2VE8A 3HHGA 1D0YA 3OSGA 4JX4A 2JA6J 3HTUA 4BAYA 2W82A 5H20A 3S2HJ 1FWZA 1TW2A 5DEQA 1I5ZA 1LEBA 4QWQA 4PK4A 3BTJA 1LE8B 1P7JA 1K6OA 5K5QA 1F9NA 5HNFA 3SEZA 3PQKA 4BQQA 1XC5A 3EUKL 2VKEA 4ZTFA 1I1SA 2WAQA 3DBRB 1OPCA 4BH9A 1O57A 1WQ2A 2P7CB 4X0GA 3L00A 2GBYA 3FMRA 3J80K 1ZG1A 3C3WA 1MD0A 1W0UA 3S2DJ 4HG2A 2E2HJ 2F5EA 1WJ5A 4YFXF 3CCRI 4R1HA 1YITI 1JTYA 1TLHB 3IC7A 2VPLA 2Y75A 4M72A 2E5NA 2LG4A 2Y0SA 2JT1A 2HR3A 1PP8F 3CMYA 5BPDA 1DU0A 4ZC3A 4ZDPA 3DLAA 3Q9SA 4CYCA 1B1BA 4H0EA 2VBYA 4DYCA 5JHUA 4AD9A 3CUQA 1UMQA 3MKYB 3WTWC 1PUFB 4FX0A 4YIRX 3DXJF 3HJEA 4ZZLA 2KRHA 1HDDC 3DTKA 2HKOA 4MHGA 1X3WB 3ABLH 2DMUA 1I27A 3U2RA 2N8GA 3GUDA 2XSDC 4EJWA 1GT0C 1PVEA 2EV5A 2OZUA 4CHUA 2D45A 2A6EF 2RN7A 4DBRA 1T08B 2VT2A 4C3JJ 3CCSI 3BJAA 1OR7C 4C9YA 1Z0XA 9ANTA 3BPXA 1HBXG 4UUSB 1FBSA 1ZHFA 3SFZA 3CUOA 4PSXA 4BGDA 5F6FA 1RPWA 4DJAA 5HS7A 3UR3C 2DA2A 4A3FJ 1LKXA 4I02A 2HDDA 3M8FA 1VQ9I 3RZOJ 2FXAA 4I6ZA 2LTPA 3SZPA 4IX7A 4BY1J 3SJMA 4AIJA 1VQ8I 4KDPA 1WH5A 1OJLA 3KZIC 3LAPA 4Y13A 1B9MA 1W4MA 3AFHA 1FOYA 2CO5A 1FYLA 4DIQA 2MGQA 2XKOA 3D5RC 4AIHA 3HOVJ 3J7AO 1K4TA 3WE3A 2XKPA 1FEXA 4NC7A 1KU9A 3O8HA 4BJTA 3HB9A 1UFMA 5CVIA 3RKXA 3ECOA 1T33A 2ELKA 2L7ZA 2J5PA 2JSCA 3KEOA 3VWBA 1ZRDA 4G6QA 2XC7A 2BY1A 1LB2A 5GTHC 4IRIA 4M9SA 1Y56A 2CFXA 5CYVA 3JRBA 2R0QC 3HKZN 1J0RA 2VKDA 3F6VA 3H9GA 1ORKA 3Q9VA 2WB1N 5E3NA 5JI6A 2M7BA 4FT8A 4CCNA 5FKMA 4EJOA 2FBIA 3L2RA 4BL0B 1VFCA 1WJAA 4H4KC 1D1CA 2ZNYA 3HPHA 4UXNA 4ESFA 2OF7A 1QPMA 2L01A 1XGMA 3BZKA 4KITB 4XLNF 2CQKA 4LB6B 4UB6C 4LLNA 2ISZA 1WCMJ 5KNLA 3W6VA 3GLLA 3NAUA 2Q0OA 2ZJPF 3BG7A 3J7YJ 3LQQA 3A1YA 1YOVB 3WTSC 3L1PA 3CO7C 3CMMA 3FBNB 2EV6A 4WXCA 2F5VA 4ZDOA 3PFYA 4X6AJ 5HNHA 3BR0A 3OL4A 4UB8C 1RIOH 3T1BA 3EUHA 3LWFA 2LF7A 2YPRA 3RKQA 1EKEA 3KEYA 1I6HJ 3G1LA 2DJIA 2PMUA 4M74A 2V7FA 5B66C 2ME0A 4FTHA 2CGPA 3FHZA 2KIMA 1ULYA 3BCBA 1HSTA 2MYSA 2OQRA 2FSWA 4AYBN 4UNOA 2CMPA 4J00A 4NC6A 3HOUJ 1MNEA 1BN5A 3E6MA 4U7BA 4YG2F 3C18A 1B6AA 1MJ9A 1RRJA 4CYCB 2IJLA 1WJFA 1D1BA 4D7NA 5DM7F 3CUQB 4JOMA 3CCQI 3KE2A 2KHMA 1J9IA 4XLEA 3CP8A 3ERED 4EEFG 5HOOA 5E3MA 4HDUA 2E1MB 1UHWA 5A2QK 2V6EA 3HSRA 2MLKA 3TBIA 3I0TA 5IYDJ 2W24A 1Z91A 2FRHA 2COBA 1YI2I 3ML6A 3VSKA 5ERIA 1V5GA 4BQAA 4LK1F 5KAFC 2JMWA 3CF5F 3BR6A 1FIPA 3KIOA 5GAGJ 4B47A 1FP2A 5DCFA 3IL2A 1BC7C 2M9HA 2XSJC 3MCZA 1S72I 4PJMA 3HL2A 1DP3A 3DV8A 3F8MA 3LSGA 2IT0A 3OYGA 2HXOA 2M45A 2Q2EA 3F8NA 4A6EA 2OTLI 3Q0WA 1STZA 4HSRA 4A3BJ 2CUFA 1IV6A 4Y52J 3A2KA 2GXAA 2GXBA 2OU2A 2LLKA 1EH8A 3O6BB 2R7FA 2ADUA 2HZDA 3GXOA 2HYJA 3FBIB 1VQ6I 1ETYA 3O2PE 2X48A 5L3CA 2R4GA 1BJZA 1SVMA 1IUYA 2XVCA 3OS2A 1MW7A 5HLHA 4F92B 2VIXA 2CYYA 2CWEA 4HA8A 1WJBA 3ZQGA 1FC3A 4CXFA 1FIAA 3CMEI 1ZAOA 3HHHA 2ZXHA 2DTRA 5HDNA 2WADA 3K4KA 2QQ9A 3K2AA 2ECBA 3ZQIA 4XKBA 3VYSB 5LHIA 2LKPA 5E17F 3H1CA 4HEA2 4S0HB 1FSEA 2P5VA 3FF5A 1YW8A 4KNYA 1HW2A 3TP3A 2IA1A 2ZO4A 3FXKA 1VQOI 3J7ZI 1P92A 3AL0B 4HZFA 2HQAA 5CQEA 4Q47A 3F9KA 1GHCA 1LNWA 2HVSA 3CCJI 4HF1A 5FRNA 3RZDJ 1JJ6C 1JKOC 2WV1A 2W85A 5J1UA 4RGRA 2DBBA 1YFHA 1MNDA 3F8FA 2OA4A 4NQWA 2DO7A 1OISA 1TNSA 2P0WA 2UZKA 2D2WA 4PUSA 4KIBA 4IHXA 3ZQ7A 1R1VA 3LSJA 1Z3YA 2F4MB 2DT6A 3IUOA 4F52A 3S1QJ 3WGHA 2E36A 4UVBA 2I5UA 2X6WA 3DKXA 2ZFUA 4OWRB 3S15J 3HSEA 3N4MA 4MQVA 2E2JJ 1R5GA 4L5EA 3D1NI 3DEWA 2XGEA 2R7DA 2ZSHB 4DW6A 1QQIA 1Y0UA 5C4XJ 1E3OC 4XIDA 5D4RA 2QYOA 1H9TA 4KUMA 2PQ8A 3C1DA 4WF2A 4CDGA 3OYFA 1QZYA 3HEFA 1AHDP 2G0EA 4A3CJ 2HZTA 2HS5A 2D1HA 2NVYJ 2XAHA 3CDHA 2HOTA 1NK2P 3TP0A 1WGXA 4EQQA 1IZ1A 4F93B 5J47A 5TRDA 4XRSG 5HLGA 3FK7A 2O7OA 2EQRA 3FXLA 4MGRA 2FF4A 5FD5A 1XGNA 4EATA 2OZ6A 4AM3A 2V9VA 5JVGF 4XNFA 4XLHA 2GWRA 2P8TA 4D5CA 3BJOA 2DMQA 3IAS2 2VLAA 2HOAA 3BZ6A 4BYYA 2K02A 3JRGA 1ZYRF 1TTYA 2LYCA 2ZB9A 2CW8A 2R7XA 5GPCA 2HDCA 1ZLJA 1XGOA 1K7AA 1U5TA 4NHJA 3CD6I 1O3TA 1VQ4I 3CLOA 1E17A 2DFIA 4JX6A 4BBRJ 5ILUA 2DODA 1A04A 1FMWA 3NARA 3V8KA 2Q2EB 2YS9A 4HX7A 1GUUA 3DPUA 4RGSA 2EB7A 2IP2A 3DCFA 4P1WA 3AAFA 3S2WA 1O3SA 2BY3A 2NYXA 2MH9A 4B09A 5ICEA 5LGUA 3DU5A 3ABMH 1FYKA 1U6GA 2Z5UA 3G73A 2DA3A 1JKPC 3N97A 2HTJA 1IN6A 3VYRB 1IN7A 4WWCA 2JVHA 4RBOA 3B73A 2ESHA 3GFLA 2CW0F 5FKNA 1BR2A 4N9HA 2XV4S 2JRMA 3DU6A 3RDIA 5EZGA 3QODA 4KJZA 2XPVA 2VJ5A 2FBHA 1YQAA 2ZJQF 4XL9A 3GTMJ 3ZQLA 4UUVA 1DQUA 2DQLA 4M9XA 3MAJA 2X1CA 2XGXA 1MBHA 3BTIA 2M87A 3CQZJ 5FO5A 4P55A 2KJCA 2M34A 2ZMEA 2PFBA 2HU9A 2NS8A 5GPAA 5JHFA 3S16J 2O61A 1RETA 5IOZA 1RC9A 3CDIA 2A3SA 1ETXA 2VJJA 2PMHA 2X85A 1MBFA 5JLXA 3CCEI 4V19K 2QQAA 3QWLA 3M1CA 4LFUA 3WHCA 1ZREA 3GCMA 2R93J 2ZC2A 1LFPA 4OIQF 3I3LA 4NQWB 1O4XA 2W00A 5J8FA 4RAGA 2HQRA 3I4NJ 4U7DA 3JRAA 2DMNA 3U9GA 1XPXA 3OS0A 4PGHA 1SFUA 1N25A 4A69C 2XF7A 3ZQFA 1HF0A 4ZDLA 2NVXJ 2W48A 3KP3A 1SD6A 2MH2A 2QQBA 2R5ZA 2UUZA 3LOCA 3X2QH 5HLTA 1G3WA 2IA0A 2GOMA 2VL8A 1YYVA 1ETQA 1UAAA 5DUIA 2IA2A 4DNCA 4QLCU 5GTIC 3KFWX 2EH3A 4KT5C 3SEQA 1E3PA 1XMXA 2DAOA 3WHBA 2RVCA 2E7WA 2A6HF 5CKTA 5D6FA 4I2OA 3BY6A 3CJTB 1GVJA 4IEJA 2BV6A 1WKMA 4KISA 1K83J 4WXHA 2VJ4A 4IL6C 4QPOA 2COMA 4L9JA 2FNPA 2MD5A 3SDGA 1Z21A 3B02A 3C2BA 3W2AA 5DCMA 2NVQJ 1FZPB 4D7MA 1MBKA 1PYVA 3VYUB 2DYSH 1YG2A 4MIMA 2MBFA 1R7JA 3OOPA 1TZLA 2EFNA 2V9PA 2Z3YA 3BR2A 1U5TB 2W4SA 4XRFA 4IXAA 4CCKA 2OCCH 2ESNA 3TL4X 2H1LA 3OYLA 1U9OA 3HTSB 2VONA 1A35A 1ZG3A 2ZFWA 1BM9A 2BHZA 4B44A 1HQCA 4EGYA 1H8AC 2PI0A 4L18B 1AA7A 2OC6A 2VUMJ 4KIFA 2O03A 5FD6A 2KQRA 4HV6A 1VQ5I 4E4HA 2DK8A 2I8DA 3QOEA 4UY8I 1Z05A 2ZXWH 2LBFB 4A6DA 1QZEA 2VE9A 1H88C 2D5VA 3LSHA 1XDSA 3CUQC 4PJNA 2L4MA 1V5FA 1UHSA 2FEZA 5FLVA 2DA4A 3E1SA 5FFXA 1KZHA 3S8PA 1KQ0A 5F64A 3MQ0A 4BE1A 2E1MC 2KT0A 3LA7A 4IQJA 2NNYA 1E3HA 3J7AY 1XSXA 2JUCA 3E5XA 3KP5A 3OSFA 2RAEA 2EFWA 1ETWA 3QPHA 1R6RA 1ENHA 2HDWA 5L3DA 4CUGA 2NOJB 1JJ8C 4KYWA 1LJ9A 1IN4A 1JKRC 2ID6A 3DP7A 3LA3A 4RB1A 1ETKA 4YEJA 3JRCA 4HYEA 3KYDB 5IOYA 4Y4RA 5EEGA 3OYCA 2K85A 2P81A 3OMYA 3QOPA 1XB4A 2ZMEB 2X4HA 4CCJA 4N4NB 2QLZA 2AHQA 2W84A 4IPAA 2EINH 2NS7A 2KISA 2PMZN 4JX5A 1J75A 3ZMTA 4N9IA 2K86A 2A07F 1YX3A 3S1RJ 2DMTA 4D1QA 3BZCA 2VOPA 2DFFA 3KZZA 3QQAA 2KFDA 1ODDA 3JRIA 2WTEA 1ZTRA 4Y3OA 2HKXA 5J4YA 4AUXA 2L5QA 3MWMA 1TT5B 3FXJA 2FBKA 2GZWA 4RDUA 4GDFA 3KP6A 3MVPA 1RUOA 2A69F 2FJ1A 2MABA 1EA3A 2VT3A 1HCRA 5EDNA 4G12A 4B1RA 3A0BC 3QPSA 2R92J 3HM5A 5ICFA 4CZCA 4RGXA 2WWYA 3AG4H 4CCOA 4EJVA 2O6GE 3S32A 3K2ZA 1BIAA 3HGYA 1OYYA 5CVRA 3VPRA 4HNTA 2KRFA 3MMYB 4OIOF 5JR3A 1NK3P 3ERMA 2R5ZB 5IY5H 2P7VB 5E8GA 4F3QA 1DGRM 1XMAA 3WGGA 4BJ5C 1TWCJ 3AL0C 2L3DA 1QHGA 4HBLA 3I59A 2H94A 4G7HF 3I9V2 4LLGF 2VKHA 1ZG5A 2OTJI 1ZK8A 3SFIA 2E1CA 3GZ6A 1BI1A 5BNGA 3C7JA 1OYIA 2CW7A 1ZH5A 1E0EA 1X3UA 2DLLA 5FGMA 2FNAA 3COAC 1WH7A 2JPBA 3G4SI 2CQ7A 2E60A 4V2GA 3ZR8X 1MNMC 1SD5A 5DCMB 3WU0A 2GXGA 5LGNA 4EJUA 2FA5A 1D0XA 1U3EM 1D8KA 3H0GJ 1IXRC 2QVOA 3SXYA 5EG0A 1I6XA 5LHHA 1JGSA 4XQFA 5EGOA 1ZGWA 4YRVA 1SC7A 2KJBA 1IN5A 5J4VA 4U0VA 3R60A 2O8KA 4XKCA 1U2WA 2A5WA 3FX3A 1HKSA 2KL4A 3A0HC 1JE8A 1Z77A 2HYGD 3VOEA 4Y7NJ 4GXOA 4BHBA 2L9RA 3ZQHA 2Z16A 5FRMA 1OQYA 3TKYA 1RR7A 1Y1VJ 3VB2A 2KZVA 3JAMZ 3KETA 4DOZA 2E34A 4M3EA 4HAMA 5AIPA 1HW1A 2VXDA 2O5RA 3I71A 4NDLA 3BG6A 3OYMA 1Z9CA 1P4AA 1X4PA 2YSRA 4P96A 4LK0F 4N4OB 1P7IA 3CMAI 3E6DA 3T0YA 2OUMA 4O3MA 5K5OA 3JTGA 1R23A 2E35A 1JT0A 1ETVA 2QCOA 5JFRA 4IKFA 2DJNA 1Y8RB 4PZJA 3K70D 3ASOH 1YJWI 4L5JA 4IHWA 4FE7A 1XS9A 5FROA 2NRAC 2KIFA 5HS8A 5KHDA 1KONA 2H6BA 4RM2A 2L2OA 4CSWA 4IJAA 3OYDA 2X6XA 2AXTC 4HDVA 1BI0A 3CC7I 1BI3A 4P9FA 3ECHA 3SHFA 1MSEC 1RNLA 3ZGKA 5J40A 4BKXA 2ZBKA 1IGNA 5L3FA 1P6RA 2G7UA 2HEOA 3RPUD 3TW7A 3TMOA 4DZPA 3GMEA 4GO1A 3LFUA 1NG6A 3DBLB 1FYMA 3WG7H 1S29A 4FISA 4MTDA 3K4MA 3HYIA 3MZHA 2ZJ2A 1G4DA 3O8GA 1WJCA 3DTIA 2LREA 3QAHA 5DTDA 5LLQA 3PL8A 5E3OA 1MGTA 2FMYA 1K6YA 2KKOA 3M1EA 4L5IA 2FMLA 4IOCF 4Q5SF 2F6CA 5BOXA 2YX4A 1KGSA 2X1EA 2FU4A 1WFXA 3AG1H 2ACJA 3GBGA 1T8IA 2IBDA 3RJPA 4PJJA 3W6KB 1QVUA 4I99C 1DU6A 2PX9A 2HQ5A 1X4OA 2Q8KA 1NHAA 3HBLA 1X58A 4XMYA 4EMSA 3K1MA 4YELA 3AG2H 3F8CA 1REPC 3GLXA 3F21A 1VZ0A 2H27A 3R0JA 1R9TJ 3OIQA 2V79A 2W57A 2EIKH 3TDUC 2MFZA 4YIFA 3I59B 5H6QA 3PM1A 2WY7Q 3MKWB 3QU3A 2L02A 2XAQA 1FNNA 4II2A 5ILVA 1T95A 2C6YA 1IG7A 1ACIA 2BW3A 2K4BA 4U0WA 5IP7J 3F8BA 3MZ8A 3ZCOA 1BR4A 1TWGJ 2LNBA 2VKVA 3RIRA 4EM1A 4A3LJ 3QYFA 3WTYC 1YO5C 1RESA 2EA4A 2V26A 1LFBA
chains in the Genus database with same CATH topology
2HOEA 2UXNA 1U78A 3HRTA 2PLYA 2W25A 4MEXF 1BIBA 4A5NA 3ZN1A 3QU6A 3EYIA 3R4KA 1AWCA 2IW5A 2PG4A 5D5VB 3P9KA 2L4AA 4LMYA 2KIUA 1XMKA 1MZBA 1USTA 2BE5F 4ESBA 4A0YA 4AWXB 4O5VA 4XSZF 1QBJA 3WE2A 3RI4A 1U8RA 1P4WA 5E1XA 3LSTA 2HTSA 3KLOA 4A2UA 3ZMZA 1OMIA 5E8IA 3E97A 2RDPA 4G94A 3WTVC 1U5TC 2PEXA 4BNCA 1XN7A 3IRRA 2RGVA 4UVAA 3RPUA 3RYRA 1IRGA 1ZGJA 3JW4A 1QZZA 2XIGA 1I1GA 1Z1DA 1K78A 4HOBA 2ZCWA 1BBYA 3WTTC 1SAXA 1ONVA 3JAMK 1HW5A 3ABUA 3E3VA 4HLYA 3I64A 3E5QA 2VOOA 3ZPLA 3I5UA 4EJTA 1O3QA 1KQ9A 3FZVA 3KEQA 1C0WA 1MDMA 1T2KA 4I01A 4OIRF 2QWWA 1XD7A 3IHUA 4E70A 4ETSA 4FX4A 1KQ8A 1W7PD 1WI9A 3FXRA 3F22A 4I7HA 3FM5A 4L0YB 2FE3A 1V3FA 1MKMA 2V1XA 2UXXA 3R0AA 2BBYA 1DPUA 3HRMA 3DKWA 3WTXC 2M30A 5L3BA 4MNUA 2TDXA 3DF8A 2BYVE 3WU1B 1HSJA 3NQOA 4RB3C 5KK1A 1XCVA 1V4RA 5F1RA 3BROA 1DDNA 2D1VA 3U1DA 3T5XA 4G9YA 2CSOA 2JZYA 3ZP5A 1Z6RA 2Z99A 4OOIA 2ZKZA 5D5UB 3JTHA 1TQMA 1IF1A 2M1BA 1L3LA 2Y0MA 1XCBA 2XASA 3K69A 3SQNA 1ZARA 1G3YA 2AS5F 3L7WA 2PJPA 1GXQA 2PBIA 3CTAA 4EM2A 1MJAA 4I0AA 4ZYGA 4MQ9F 1FSHA 3MZYA 2VBXA 1XSVA 4BXUA 2FQ3A 5ICGA 2A5YB 4OMYA 1K78B 5LGTA 2MLGA 4L9TA 2YX7A 4RS8A 1QNTA 2LDUA 1RI7A 2B0LA 3TOAA 2NNNA 2GA1A 5E1ZB 2R3SA 2O8XA 3DEUA 4KMUX 3WTUC 3FMSA 2VODA 3ZMUA 3ZMSA 4L0ZB 1BI2A 3DPTA 4CO8A 2DQRA 4HQMA 1O7FA 3LFKA 1LDDA 4HX4A 2EFPA 5D4SA 2RC4A 3IKTA 5L3EA 3RKYA 1MDMB 3RPQA 1W7PA 3ZMDA 4M71A 4IHSA 3L2CA 1T39A 5KVRA 2OAZA 4GYIA 1K79A 4JQFA 3GW2A 3REOA 4A12A 3VEPA 5E20A 5LEJA 4DQ2A 1R36A 3IWFA 1FT9A 3KZYA 5LHGA 2V1DA 3ISPA 2J5OA 3ZMVA 3T8TA 1USSA 1DP7P 2EWNA 2WV0A 1GXPA 5CJ9A 2DI3A 4ENJA 1YS7A 4HV5A 3QP5A 4G6DA 1R1TA 1KYWA 3FXQA 1SFEA 4KFCA 3PFIA 1OYWA 1HKQA 4KMFA 4YFKF 5EEHA 3GYHX 4WX9A 4HF2A 1IRFA 2HWVA 5E1WA 3W6JB 4P9UA 2JPCA 5J8CA 1LDKB 2HQNA 3WODF 3TQNA 2Z33A 4M9ZA 2H09A 3FWEA 3QRFF 3GEZA 3BPVA 3E6CC 2HYFA 4RB2C 1JXSA 4UV9A 3H92A 1UHMA 3GFMA 4Y15A 5DYMA 3GVAA 1KA8A 2XAFA 3I58A 2VXZA 3TO9A 3P7NA 2P6SA 3L9FA 4ZH4F 3KCCA 1DUXC 1UCRA 1ZN2A 1EH6A 2VBWA 2FOKA 5K5RA 3KP7A 3ABTA 1IXCA 3BJ6A 1R00A 3TGNA 4LGWA 3ROUA 1WRJA 1FY7A 3GO5A 4UV8A 4PDKA 1D8JA 1T38A 2P5KA 2V6CA 3D0SA 1HKTA 1W7PB 5E18F 2K7LA 3TDZC 1FPQA 4CYDA 1TW3A 1SD7A 2DPUA 3RTRA 2YU3A 4BHPA 4IVNA 3VODA 4GGGA 1SMYF 3M9AA 4ENKA 4G7ZF 4GCVA 2LF8A 5BMZA 1QGPA 1YW9A 3R61A 3DPLC 2YR2A 5CLSA 3I4PA 2A68F 3M8EA 4A0ZA 2F5DA 1ON2A 2F5CA 4JBAA 4ENNA 1LEAA 1BJAA 4M73A 2JTVA 1YTYA 1F5TA 2RKHA 4A5MA 2BEOA 3SZTA 5FLXZ 1YS6A 2CG4A 2Y48A 4XLPF 5H6RA 2G7HA 3M7GA 1W5SA 3HUGA 3V4GA 4R8HA 4OIPF 3HRUA 4WCGA 3EQLF 4LLLA 4B8XA 3EYYA 4OMZA 1WWXA 2QENA 5D8KB 3P9CA 3HOTA 2ISYA 3BP8A 4Z2YA 2K4JA 4IHTA 3TO6A 5CVVA 3J81Z 2LSOA 4HW0A 3ULQB 3R6SA 1WSUA 2XRNA 4O6JA 1CF7A 2ELHA 5BQTA 5ICCA 1T98A 3JSOA 5DUKA 4RAZA 3VFZA 3BOQA 4IF4A 1XSDA 4WXDA 3GX4X 1MJBA 5D5XB 3E6BA 3FMQA 3K0LA 3WG9A 4BHCA 1J2XA 2A61A 2DT5A 4K2EA 4MEYF 4TV7A 1PUEE 4A0XA 4I0BA 4CZZA 2DU9A 3LAJA 3KP2A 4D0PA 4MTEA 2DW4A 3I54A 1RUNA 3BDDA 3IKVA 4HLXA 4EM0B 4L9VA 1EH7A 2O0YA 3HOSA 2GIVA 5HS9A 5FFZA 5HLIA 1AOYA 1CGPA 2RQPA 4NB5A 4YIIA 3WGIA 1OR7A 2OBPA 4LG0A 1KU7A 2XHKA 4UVCA 4ON0A 4HF0A 2WC2A 2OQGA 2JRTA 1FBUA 3G3ZA 4OINF 3GFIA 2MA3A 3ELKA 3H3UA 3NRVA 4M6XA 2QBYA 4KN4X 5FB2A 3QP6A 2EFOA 4EVIA 3GZ5A 3V8LA 3KP4A 4N0BA 3WTZA 1IN8A 2EK5A 4PGGA 1QO0D 3GWZA 1F1ZA 2VC1A 3F72A 3GFJA 2H6CA 2IPQX 2VBZA 1FP1D 3I53A 4LD5A 4R79A 1FBQA 1D3YA 1JHFA 3F6OA 2EV0A 4LJZF 3L09A 1HXDA 1PDNC 3CJNA 1S7OA 2EFQA 4HQEA 1CF7B 1UB9A 3BWGA 2HFHA 2STWA 4ZYDA 2XAGA 2EA2A 1BOAA 5IT9Z 1IXSB 2P6TA 3GF2A 2GQQA 1P4XA 1EV7A 1TNTA 2M8EA 5AIQA 3DFGA 5AONA 1B4AA 1O3RA 5HVQC 4KA4A 1FOKA 5D8LB 5FLXK 4WK8F 1F4KA 4G7OF 1TBXA 1SFXA 2PN6A 1P2FA 1T0FA 3CO6C 2E7XA 3F23A 2E1NA 1YW7A 2BGCA 2XUBA 2G9WA 5LBQA 4KIGA 2OD5A 1VTNC 3D5LA 1W5TA 2MC3A 2Z9OA 1H0MA 3TOBA 4P5OA 5ED4A 3J81K 1Q1HA 4LG0B 1IW7F 2K27A 2P5LC 1J7KA 1S8NA 4L9NA 3DQVC 4ASNA 4GYGA 1E2XA 3IRQA 3H3ZA 5JVTA 1ON1A 2ZXJA 5L3GA 2DK5A 2QBYB 1YIOA 3IWZA 2VC0A 2DPDA 1ZGAA 3V7SA 4M6YA 2ETHA 5LRSA 4ENMA 4HX8A 3HSFA 1H9GA 3EETA 5IT3A 3MEXA 1L0OC 2IRFG 1TQIA 1G3TA 1KU3A 2XROA 1DPRA 4OU0A 3KLNA 5D5WB 2NS0A 3TO7A 1PP7U 5DD4A 4IRGA 1R22A 1B59A 3J80Z 1Z7UA 1YLFA 1O7LA 5BS6A 1RZ4A 2GAUA 6PAXA 3JSPA 4JK1X 5DV5A 2GA2A 5K1YA 4ZZDA 3RKWA 1KYZA 4RGUA 3PQJA 1B9NA 2HGCA 4KICA 4CICA 3O3KA 3E5UA 2UWMA 3LQRA 4AIKA 3P9IA 2F2EA 5TJJA 1J59A 1XDUA 2IVMA 4KN7X 1ZRFA 2P4WA 3Q5FA 4YFNF 3K1NA 4U0YA 1OKRA 3FM3A 2ZNZA 5LRRA 2XAJA 5DDGA 2M5WA 2NAZA 1LVAA 5CVJA 3ZN0A 2QM3A 1SMTA 1ZRCA 1FLIA 4U88A 2RV8A 3RYPA 1ZLKA 2QUFA 2X0LA 3K9TA 2EJRA 4PCQA 5J6XA 5D6EA 1D5VA 2V1UA 1LDJA 4AVPA 4EV0A 1BC8C 1SD4A 4ZYEA 4S04A 4CGZA 1JHHA 2VN2A 3NEUA 1R5HA 1XGSA 4XSXF 3V8JA 5IT9K 1FX7A 1KU2A 2STTA 4IRHA 1G6NA 2F5FA 4ZYHA 1R1UA 3QPTA 1T6SA 2L54A 4FHTA 4ESJA 4Q4ZF 4Y17A 3V7RA 1LQ1A 3K1PA 1R58A 5BPIA 3OV8A 1J5YA 3HIFA 2AXLA 3T8RA 5CVUA 5LEKA 4XBFA 4RAYA 3F3XA 5HDGA 5ILSA 3HRSA 4RB0A 1S7AA 3FXUA 5DD8A 4Q48A 2QZ8A 1S3JA 2RNJA 1IAWA 4I98B 3MFKA 4UHTA 4LB5A 5HDKA 3V7CA 4S05A 4G8XA 5A2QZ 4I09A 4F7ZA 3LA2A 1TQPA 1G3SA 3EDPA 1S6LA 1Z6TA 2O3FA 4EGZA 2VE8A 3HHGA 3HTUA 4BAYA 5H20A 1FWZA 1TW2A 5DEQA 1I5ZA 1LEBA 4QWQA 1K6OA 5K5QA 1F9NA 3PQKA 1I1SA 1OPCA 4BH9A 1O57A 1WQ2A 2P7CB 3L00A 3FMRA 3J80K 1ZG1A 3C3WA 1MD0A 2F5EA 4YFXF 4R1HA 1TLHB 3IC7A 2Y75A 4M72A 2JT1A 2HR3A 1PP8F 5BPDA 3Q9SA 1B1BA 4H0EA 2VBYA 5JHUA 4AD9A 3CUQA 3WTWC 4FX0A 3DXJF 4ZZLA 2HKOA 4MHGA 1I27A 3U2RA 3GUDA 4EJWA 2EV5A 2OZUA 4CHUA 2D45A 2A6EF 2RN7A 2VT2A 3BJAA 3BPXA 1HBXG 1FBSA 1ZHFA 3SFZA 3CUOA 5F6FA 5HS7A 4I02A 3M8FA 2FXAA 3SZPA 4AIJA 4KDPA 3LAPA 4Y13A 1B9MA 1W4MA 2CO5A 1FYLA 2XKOA 4AIHA 3J7AO 3WE3A 2XKPA 1KU9A 1UFMA 5CVIA 3RKXA 3ECOA 2J5PA 2JSCA 3KEOA 1ZRDA 4G6QA 1LB2A 4IRIA 4M9SA 2CFXA 5CYVA 1J0RA 3F6VA 3Q9VA 5JI6A 4FT8A 4EJOA 2FBIA 2ZNYA 4UXNA 4ESFA 1QPMA 2L01A 1XGMA 4XLNF 2CQKA 4LB6B 4LLNA 2ISZA 2Q0OA 3LQQA 3WTSC 3CO7C 2EV6A 4WXCA 1RIOH 3T1BA 3EUHA 3LWFA 2LF7A 2YPRA 2PMUA 4M74A 2CGPA 3FHZA 2KIMA 1ULYA 1HSTA 2OQRA 2FSWA 4UNOA 1BN5A 3E6MA 4U7BA 4YG2F 3C18A 1B6AA 1MJ9A 2IJLA 3CUQB 3KE2A 1J9IA 3ERED 5HOOA 4HDUA 1UHWA 5A2QK 3HSRA 2MLKA 3I0TA 2W24A 1Z91A 2FRHA 3ML6A 5ERIA 4BQAA 4LK1F 1FP2A 5DCFA 3IL2A 1BC7C 3MCZA 3DV8A 3F8MA 2IT0A 2M45A 2Q2EA 3F8NA 4A6EA 1STZA 2GXBA 2OU2A 1EH8A 3O6BB 2R7FA 2ADUA 3GXOA 3O2PE 5L3CA 1IUYA 2XVCA 5HLHA 2CYYA 2CWEA 4HA8A 4CXFA 1FC3A 1ZAOA 3HHHA 2DTRA 5HDNA 2QQ9A 5LHIA 2LKPA 5E17F 1FSEA 2P5VA 3FF5A 1YW8A 4KNYA 1HW2A 2IA1A 2ZO4A 1P92A 4HZFA 4Q47A 1GHCA 1LNWA 4HF1A 2W85A 4RGRA 2DBBA 1YFHA 3F8FA 2OA4A 4NQWA 2DO7A 1TNSA 2UZKA 2D2WA 4KIBA 3ZQ7A 1R1VA 3WGHA 4UVBA 3HSEA 3N4MA 4MQVA 1R5GA 2R7DA 1QQIA 1Y0UA 5D4RA 1H9TA 2QYOA 4KUMA 2PQ8A 3C1DA 4WF2A 4CDGA 1QZYA 2HZTA 2HS5A 2D1HA 2XAHA 3CDHA 5TRDA 4EQQA 1IZ1A 5HLGA 4MGRA 2FF4A 5FD5A 1XGNA 2OZ6A 2V9VA 2GWRA 2P8TA 3BJOA 3BZ6A 4BYYA 2K02A 1ZYRF 1TTYA 2HDCA 1ZLJA 1XGOA 1K7AA 1U5TA 4NHJA 1O3TA 3CLOA 1E17A 2DFIA 5ILUA 1A04A 3V8KA 4HX7A 4RGSA 2EB7A 2IP2A 3AAFA 3S2WA 1O3SA 2NYXA 2MH9A 4B09A 5ICEA 5LGUA 1FYKA 1U6GA 2Z5UA 3G73A 3N97A 2HTJA 1IN6A 1IN7A 4WWCA 3B73A 2ESHA 3GFLA 2CW0F 4N9HA 2XV4S 3RDIA 2FBHA 1YQAA 4UUVA 2DQLA 4M9XA 3MAJA 2XGXA 2M87A 5FO5A 4P55A 2KJCA 2ZMEA 2PFBA 2O61A 2A3SA 2PMHA 2QQAA 4LFUA 1ZREA 4OIQF 5J8FA 2HQRA 4U7DA 3U9GA 4PGHA 1SFUA 3KP3A 1SD6A 2MH2A 2QQBA 1G3WA 2IA0A 1YYVA 5DUIA 2IA2A 4DNCA 4QLCU 3KFWX 4KT5C 2DAOA 2RVCA 2E7WA 2A6HF 5D6FA 4I2OA 3BY6A 1GVJA 2BV6A 1WKMA 4WXHA 2COMA 4L9JA 2FNPA 2MD5A 3B02A 5DCMA 1FZPB 1YG2A 2MBFA 1R7JA 3OOPA 2EFNA 2Z3YA 1U5TB 4XRFA 4IXAA 2ESNA 3HTSB 2VONA 1ZG3A 2ZFWA 1BM9A 4EGYA 2PI0A 1HQCA 4L18B 4KIFA 2O03A 5FD6A 4HV6A 2DK8A 1Z05A 4A6DA 2VE9A 1XDSA 3CUQC 2L4MA 2FEZA 5FFXA 1KQ0A 5F64A 3MQ0A 3LA7A 2NNYA 1XSXA 3E5XA 3KP5A 2EFWA 3QPHA 5L3DA 4KYWA 1LJ9A 1IN4A 3DP7A 3LA3A 4RB1A 4HYEA 5EEGA 3QOPA 1XB4A 2ZMEB 2X4HA 2QLZA 2W84A 4IPAA 1J75A 3ZMTA 4N9IA 2K86A 2A07F 2VOPA 3KZZA 1ODDA 2WTEA 2HKXA 3MWMA 2FBKA 2GZWA 3KP6A 1RUOA 2A69F 2VT3A 5ICFA 4RGXA 2WWYA 4EJVA 2O6GE 3K2ZA 1BIAA 5CVRA 1OYYA 2KRFA 4OIOF 5JR3A 2P7VB 5E8GA 1XMAA 3WGGA 2L3DA 4HBLA 3I59A 4G7HF 2H94A 4LLGF 1ZG5A 2E1CA 3GZ6A 1BI1A 3C7JA 1OYIA 1ZH5A 1X3UA 2DLLA 5FGMA 2FNAA 3COAC 2JPBA 1SD5A 5DCMB 3WU0A 2GXGA 5LGNA 4EJUA 2FA5A 1U3EM 1D8KA 1IXRC 2QVOA 3SXYA 1I6XA 5LHHA 1JGSA 2KJBA 1IN5A 4U0VA 3R60A 1U2WA 3FX3A 1HKSA 1JE8A 2HYGD 3VOEA 4GXOA 4BHBA 3TKYA 3VB2A 3JAMZ 3KETA 4HAMA 5AIPA 1HW1A 3I71A 1Z9CA 1P4AA 4P96A 2YSRA 4LK0F 3E6DA 3T0YA 4O3MA 5K5OA 3JTGA 1R23A 5JFRA 4PZJA 4L5JA 2NRAC 2KIFA 5HS8A 2H6BA 4IJAA 4HDVA 1BI0A 1BI3A 4P9FA 3ECHA 3SHFA 1RNLA 2ZBKA 5L3FA 1P6RA 2G7UA 2HEOA 4GO1A 1FYMA 1S29A 4MTDA 3HYIA 3MZHA 2ZJ2A 1G4DA 3QAHA 5LLQA 1MGTA 2FMYA 2KKOA 3M1EA 4L5IA 2FMLA 4Q5SF 5BOXA 2YX4A 1KGSA 2FU4A 2ACJA 3W6KB 3RJPA 2Q8KA 1NHAA 4EMSA 3K1MA 3F8CA 1REPC 3GLXA 3F21A 2H27A 3R0JA 2V79A 2W57A 3TDUC 4YIFA 3I59B 5H6QA 3QU3A 2L02A 2XAQA 1FNNA 5ILVA 2C6YA 2K4BA 4U0WA 3F8BA 4EM1A 2LNBA 3RIRA 3WTYC 1YO5C 2EA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOE A;  2UXN A;  1U78 A;  3HRT A;  2PLY A;  2W25 A;  4MEX F;  1BIB A;  4A5N A;  3ZN1 A;  3QU6 A;  3EYI A;  3R4K A;  1AWC A;  2IW5 A;  2PG4 A;  5D5V B;  3P9K A;  2L4A A;  4LMY A;  2KIU A;  1XMK A;  1MZB A;  1UST A;  2BE5 F;  4ESB A;  4A0Y A;  4AWX B;  4O5V A;  4XSZ F;  1QBJ A;  3WE2 A;  3RI4 A;  1U8R A;  1P4W A;  5E1X A;  3LST A;  2HTS A;  3KLO A;  4A2U A;  3ZMZ A;  1OMI A;  5E8I A;  3E97 A;  2RDP A;  4G94 A;  3WTV C;  1U5T C;  2PEX A;  4BNC A;  1XN7 A;  3IRR A;  2RGV A;  4UVA A;  3RPU A;  3RYR A;  1IRG A;  1ZGJ A;  3JW4 A;  1QZZ A;  2XIG A;  1I1G A;  1Z1D A;  1K78 A;  4HOB A;  2ZCW A;  1BBY A;  3WTT C;  1SAX A;  1ONV A;  3JAM K;  1HW5 A;  3ABU A;  3E3V A;  4HLY A;  3I64 A;  3E5Q A;  2VOO A;  3ZPL A;  3I5U A;  4EJT A;  1O3Q A;  1KQ9 A;  3FZV A;  3KEQ A;  1C0W A;  1MDM A;  1T2K A;  4I01 A;  4OIR F;  2QWW A;  1XD7 A;  3IHU A;  4E70 A;  4ETS A;  4FX4 A;  1KQ8 A;  1W7P D;  1WI9 A;  3FXR A;  3F22 A;  4I7H A;  3FM5 A;  4L0Y B;  2FE3 A;  1V3F A;  1MKM A;  2V1X A;  2UXX A;  3R0A A;  2BBY A;  1DPU A;  3HRM A;  3DKW A;  3WTX C;  2M30 A;  5L3B A;  4MNU A;  2TDX A;  3DF8 A;  2BYV E;  3WU1 B;  1HSJ A;  3NQO A;  4RB3 C;  5KK1 A;  1XCV A;  1V4R A;  5F1R A;  3BRO A;  1DDN A;  2D1V A;  3U1D A;  3T5X A;  4G9Y A;  2CSO A;  2JZY A;  3ZP5 A;  1Z6R A;  2Z99 A;  4OOI A;  2ZKZ A;  5D5U B;  3JTH A;  1TQM A;  1IF1 A;  2M1B A;  1L3L A;  2Y0M A;  1XCB A;  2XAS A;  3K69 A;  3SQN A;  1ZAR A;  1G3Y A;  2AS5 F;  3L7W A;  2PJP A;  1GXQ A;  2PBI A;  3CTA A;  4EM2 A;  1MJA A;  4I0A A;  4ZYG A;  4MQ9 F;  1FSH A;  3MZY A;  2VBX A;  1XSV A;  4BXU A;  2FQ3 A;  5ICG A;  2A5Y B;  4OMY A;  1K78 B;  5LGT A;  2MLG A;  4L9T A;  2YX7 A;  4RS8 A;  1QNT A;  2LDU A;  1RI7 A;  2B0L A;  3TOA A;  2NNN A;  2GA1 A;  5E1Z B;  2R3S A;  2O8X A;  3DEU A;  4KMU X;  3WTU C;  3FMS A;  2VOD A;  3ZMU A;  3ZMS A;  4L0Z B;  1BI2 A;  3DPT A;  4CO8 A;  2DQR A;  4HQM A;  1O7F A;  3LFK A;  1LDD A;  4HX4 A;  2EFP A;  5D4S A;  2RC4 A;  3IKT A;  5L3E A;  3RKY A;  1MDM B;  3RPQ A;  1W7P A;  3ZMD A;  4M71 A;  4IHS A;  3L2C A;  1T39 A;  5KVR A;  2OAZ A;  4GYI A;  1K79 A;  4JQF A;  3GW2 A;  3REO A;  4A12 A;  3VEP A;  5E20 A;  5LEJ A;  4DQ2 A;  1R36 A;  3IWF A;  1FT9 A;  3KZY A;  5LHG A;  2V1D A;  3ISP A;  2J5O A;  3ZMV A;  3T8T A;  1USS A;  1DP7 P;  2EWN A;  2WV0 A;  1GXP A;  5CJ9 A;  2DI3 A;  4ENJ A;  1YS7 A;  4HV5 A;  3QP5 A;  4G6D A;  1R1T A;  1KYW A;  3FXQ A;  1SFE A;  4KFC A;  3PFI A;  1OYW A;  1HKQ A;  4KMF A;  4YFK F;  5EEH A;  3GYH X;  4WX9 A;  4HF2 A;  1IRF A;  2HWV A;  5E1W A;  3W6J B;  4P9U A;  2JPC A;  5J8C A;  1LDK B;  2HQN A;  3WOD F;  3TQN A;  2Z33 A;  4M9Z A;  2H09 A;  3FWE A;  3QRF F;  3GEZ A;  3BPV A;  3E6C C;  2HYF A;  4RB2 C;  1JXS A;  4UV9 A;  3H92 A;  1UHM A;  3GFM A;  4Y15 A;  5DYM A;  3GVA A;  1KA8 A;  2XAF A;  3I58 A;  2VXZ A;  3TO9 A;  3P7N A;  2P6S A;  3L9F A;  4ZH4 F;  3KCC A;  1DUX C;  1UCR A;  1ZN2 A;  1EH6 A;  2VBW A;  2FOK A;  5K5R A;  3KP7 A;  3ABT A;  1IXC A;  3BJ6 A;  1R00 A;  3TGN A;  4LGW A;  3ROU A;  1WRJ A;  1FY7 A;  3GO5 A;  4UV8 A;  4PDK A;  1D8J A;  1T38 A;  2P5K A;  2V6C A;  3D0S A;  1HKT A;  1W7P B;  5E18 F;  2K7L A;  3TDZ C;  1FPQ A;  4CYD A;  1TW3 A;  1SD7 A;  2DPU A;  3RTR A;  2YU3 A;  4BHP A;  4IVN A;  3VOD A;  4GGG A;  1SMY F;  3M9A A;  4ENK A;  4G7Z F;  4GCV A;  2LF8 A;  5BMZ A;  1QGP A;  1YW9 A;  3R61 A;  3DPL C;  2YR2 A;  5CLS A;  3I4P A;  2A68 F;  3M8E A;  4A0Z A;  2F5D A;  1ON2 A;  2F5C A;  4JBA A;  4ENN A;  1LEA A;  1BJA A;  4M73 A;  2JTV A;  1YTY A;  1F5T A;  2RKH A;  4A5M A;  2BEO A;  3SZT A;  5FLX Z;  1YS6 A;  2CG4 A;  2Y48 A;  4XLP F;  5H6R A;  2G7H A;  3M7G A;  1W5S A;  3HUG A;  3V4G A;  4R8H A;  4OIP F;  3HRU A;  4WCG A;  3EQL F;  4LLL A;  4B8X A;  3EYY A;  4OMZ A;  1WWX A;  2QEN A;  5D8K B;  3P9C A;  3HOT A;  2ISY A;  3BP8 A;  4Z2Y A;  2K4J A;  4IHT A;  3TO6 A;  5CVV A;  3J81 Z;  2LSO A;  4HW0 A;  3ULQ B;  3R6S A;  1WSU A;  2XRN A;  4O6J A;  1CF7 A;  2ELH A;  5BQT A;  5ICC A;  1T98 A;  3JSO A;  5DUK A;  4RAZ A;  3VFZ A;  3BOQ A;  4IF4 A;  1XSD A;  4WXD A;  3GX4 X;  1MJB A;  5D5X B;  3E6B A;  3FMQ A;  3K0L A;  3WG9 A;  4BHC A;  1J2X A;  2A61 A;  2DT5 A;  4K2E A;  4MEY F;  4TV7 A;  1PUE E;  4A0X A;  4I0B A;  4CZZ A;  2DU9 A;  3LAJ A;  3KP2 A;  4D0P A;  4MTE A;  2DW4 A;  3I54 A;  1RUN A;  3BDD A;  3IKV A;  4HLX A;  4EM0 B;  4L9V A;  1EH7 A;  2O0Y A;  3HOS A;  2GIV A;  5HS9 A;  5FFZ A;  5HLI A;  1AOY A;  1CGP A;  2RQP A;  4NB5 A;  4YII A;  3WGI A;  1OR7 A;  2OBP A;  4LG0 A;  1KU7 A;  2XHK A;  4UVC A;  4ON0 A;  4HF0 A;  2WC2 A;  2OQG A;  2JRT A;  1FBU A;  3G3Z A;  4OIN F;  3GFI A;  2MA3 A;  3ELK A;  3H3U A;  3NRV A;  4M6X A;  2QBY A;  4KN4 X;  5FB2 A;  3QP6 A;  2EFO A;  4EVI A;  3GZ5 A;  3V8L A;  3KP4 A;  4N0B A;  3WTZ A;  1IN8 A;  2EK5 A;  4PGG A;  1QO0 D;  3GWZ A;  1F1Z A;  2VC1 A;  3F72 A;  3GFJ A;  2H6C A;  2IPQ X;  2VBZ A;  1FP1 D;  3I53 A;  4LD5 A;  4R79 A;  1FBQ A;  1D3Y A;  1JHF A;  3F6O A;  2EV0 A;  4LJZ F;  3L09 A;  1HXD A;  1PDN C;  3CJN A;  1S7O A;  2EFQ A;  4HQE A;  1CF7 B;  1UB9 A;  3BWG A;  2HFH A;  2STW A;  4ZYD A;  2XAG A;  2EA2 A;  1BOA A;  5IT9 Z;  1IXS B;  2P6T A;  3GF2 A;  2GQQ A;  1P4X A;  1EV7 A;  1TNT A;  2M8E A;  5AIQ A;  3DFG A;  5AON A;  1B4A A;  1O3R A;  5HVQ C;  4KA4 A;  1FOK A;  5D8L B;  5FLX K;  4WK8 F;  1F4K A;  4G7O F;  1TBX A;  1SFX A;  2PN6 A;  1P2F A;  1T0F A;  3CO6 C;  2E7X A;  3F23 A;  2E1N A;  1YW7 A;  2BGC A;  2XUB A;  2G9W A;  5LBQ A;  4KIG A;  2OD5 A;  1VTN C;  3D5L A;  1W5T A;  2MC3 A;  2Z9O A;  1H0M A;  3TOB A;  4P5O A;  5ED4 A;  3J81 K;  1Q1H A;  4LG0 B;  1IW7 F;  2K27 A;  2P5L C;  1J7K A;  1S8N A;  4L9N A;  3DQV C;  4ASN A;  4GYG A;  1E2X A;  3IRQ A;  3H3Z A;  5JVT A;  1ON1 A;  2ZXJ A;  5L3G A;  2DK5 A;  2QBY B;  1YIO A;  3IWZ A;  2VC0 A;  2DPD A;  1ZGA A;  3V7S A;  4M6Y A;  2ETH A;  5LRS A;  4ENM A;  4HX8 A;  3HSF A;  1H9G A;  3EET A;  5IT3 A;  3MEX A;  1L0O C;  2IRF G;  1TQI A;  1G3T A;  1KU3 A;  2XRO A;  1DPR A;  4OU0 A;  3KLN A;  5D5W B;  2NS0 A;  3TO7 A;  1PP7 U;  5DD4 A;  4IRG A;  1R22 A;  1B59 A;  3J80 Z;  1Z7U A;  1YLF A;  1O7L A;  5BS6 A;  1RZ4 A;  2GAU A;  6PAX A;  3JSP A;  4JK1 X;  5DV5 A;  2GA2 A;  5K1Y A;  4ZZD A;  3RKW A;  1KYZ A;  4RGU A;  3PQJ A;  1B9N A;  2HGC A;  4KIC A;  4CIC A;  3O3K A;  3E5U A;  2UWM A;  3LQR A;  4AIK A;  3P9I A;  2F2E A;  5TJJ A;  1J59 A;  1XDU A;  2IVM A;  4KN7 X;  1ZRF A;  2P4W A;  3Q5F A;  4YFN F;  3K1N A;  4U0Y A;  1OKR A;  3FM3 A;  2ZNZ A;  5LRR A;  2XAJ A;  5DDG A;  2M5W A;  2NAZ A;  1LVA A;  5CVJ A;  3ZN0 A;  2QM3 A;  1SMT A;  1ZRC A;  1FLI A;  4U88 A;  2RV8 A;  3RYP A;  1ZLK A;  2QUF A;  2X0L A;  3K9T A;  2EJR A;  4PCQ A;  5J6X A;  5D6E A;  1D5V A;  2V1U A;  1LDJ A;  4AVP A;  4EV0 A;  1BC8 C;  1SD4 A;  4ZYE A;  4S04 A;  4CGZ A;  1JHH A;  2VN2 A;  3NEU A;  1R5H A;  1XGS A;  4XSX F;  3V8J A;  5IT9 K;  1FX7 A;  1KU2 A;  2STT A;  4IRH A;  1G6N A;  2F5F A;  4ZYH A;  1R1U A;  3QPT A;  1T6S A;  2L54 A;  4FHT A;  4ESJ A;  4Q4Z F;  4Y17 A;  3V7R A;  1LQ1 A;  3K1P A;  1R58 A;  5BPI A;  3OV8 A;  1J5Y A;  3HIF A;  2AXL A;  3T8R A;  5CVU A;  5LEK A;  4XBF A;  4RAY A;  3F3X A;  5HDG A;  5ILS A;  3HRS A;  4RB0 A;  1S7A A;  3FXU A;  5DD8 A;  4Q48 A;  2QZ8 A;  1S3J A;  2RNJ A;  1IAW A;  4I98 B;  3MFK A;  4UHT A;  4LB5 A;  5HDK A;  3V7C A;  4S05 A;  4G8X A;  5A2Q Z;  4I09 A;  4F7Z A;  3LA2 A;  1TQP A;  1G3S A;  3EDP A;  1S6L A;  1Z6T A;  2O3F A;  4EGZ A;  2VE8 A;  3HHG A;  3HTU A;  4BAY A;  5H20 A;  1FWZ A;  1TW2 A;  5DEQ A;  1I5Z A;  1LEB A;  4QWQ A;  1K6O A;  5K5Q A;  1F9N A;  3PQK A;  1I1S A;  1OPC A;  4BH9 A;  1O57 A;  1WQ2 A;  2P7C B;  3L00 A;  3FMR A;  3J80 K;  1ZG1 A;  3C3W A;  1MD0 A;  2F5E A;  4YFX F;  4R1H A;  1TLH B;  3IC7 A;  2Y75 A;  4M72 A;  2JT1 A;  2HR3 A;  1PP8 F;  5BPD A;  3Q9S A;  1B1B A;  4H0E A;  2VBY A;  5JHU A;  4AD9 A;  3CUQ A;  3WTW C;  4FX0 A;  3DXJ F;  4ZZL A;  2HKO A;  4MHG A;  1I27 A;  3U2R A;  3GUD A;  4EJW A;  2EV5 A;  2OZU A;  4CHU A;  2D45 A;  2A6E F;  2RN7 A;  2VT2 A;  3BJA A;  3BPX A;  1HBX G;  1FBS A;  1ZHF A;  3SFZ A;  3CUO A;  5F6F A;  5HS7 A;  4I02 A;  3M8F A;  2FXA A;  3SZP A;  4AIJ A;  4KDP A;  3LAP A;  4Y13 A;  1B9M A;  1W4M A;  2CO5 A;  1FYL A;  2XKO A;  4AIH A;  3J7A O;  3WE3 A;  2XKP A;  1KU9 A;  1UFM A;  5CVI A;  3RKX A;  3ECO A;  2J5P A;  2JSC A;  3KEO A;  1ZRD A;  4G6Q A;  1LB2 A;  4IRI A;  4M9S A;  2CFX A;  5CYV A;  1J0R A;  3F6V A;  3Q9V A;  5JI6 A;  4FT8 A;  4EJO A;  2FBI A;  2ZNY A;  4UXN A;  4ESF A;  1QPM A;  2L01 A;  1XGM A;  4XLN F;  2CQK A;  4LB6 B;  4LLN A;  2ISZ A;  2Q0O A;  3LQQ A;  3WTS C;  3CO7 C;  2EV6 A;  4WXC A;  1RIO H;  3T1B A;  3EUH A;  3LWF A;  2LF7 A;  2YPR A;  2PMU A;  4M74 A;  2CGP A;  3FHZ A;  2KIM A;  1ULY A;  1HST A;  2OQR A;  2FSW A;  4UNO A;  1BN5 A;  3E6M A;  4U7B A;  4YG2 F;  3C18 A;  1B6A A;  1MJ9 A;  2IJL A;  3CUQ B;  3KE2 A;  1J9I A;  3ERE D;  5HOO A;  4HDU A;  1UHW A;  5A2Q K;  3HSR A;  2MLK A;  3I0T A;  2W24 A;  1Z91 A;  2FRH A;  3ML6 A;  5ERI A;  4BQA A;  4LK1 F;  1FP2 A;  5DCF A;  3IL2 A;  1BC7 C;  3MCZ A;  3DV8 A;  3F8M A;  2IT0 A;  2M45 A;  2Q2E A;  3F8N A;  4A6E A;  1STZ A;  2GXB A;  2OU2 A;  1EH8 A;  3O6B B;  2R7F A;  2ADU A;  3GXO A;  3O2P E;  5L3C A;  1IUY A;  2XVC A;  5HLH A;  2CYY A;  2CWE A;  4HA8 A;  4CXF A;  1FC3 A;  1ZAO A;  3HHH A;  2DTR A;  5HDN A;  2QQ9 A;  5LHI A;  2LKP A;  5E17 F;  1FSE A;  2P5V A;  3FF5 A;  1YW8 A;  4KNY A;  1HW2 A;  2IA1 A;  2ZO4 A;  1P92 A;  4HZF A;  4Q47 A;  1GHC A;  1LNW A;  4HF1 A;  2W85 A;  4RGR A;  2DBB A;  1YFH A;  3F8F A;  2OA4 A;  4NQW A;  2DO7 A;  1TNS A;  2UZK A;  2D2W A;  4KIB A;  3ZQ7 A;  1R1V A;  3WGH A;  4UVB A;  3HSE A;  3N4M A;  4MQV A;  1R5G A;  2R7D A;  1QQI A;  1Y0U A;  5D4R A;  1H9T A;  2QYO A;  4KUM A;  2PQ8 A;  3C1D A;  4WF2 A;  4CDG A;  1QZY A;  2HZT A;  2HS5 A;  2D1H A;  2XAH A;  3CDH A;  5TRD A;  4EQQ A;  1IZ1 A;  5HLG A;  4MGR A;  2FF4 A;  5FD5 A;  1XGN A;  2OZ6 A;  2V9V A;  2GWR A;  2P8T A;  3BJO A;  3BZ6 A;  4BYY A;  2K02 A;  1ZYR F;  1TTY A;  2HDC A;  1ZLJ A;  1XGO A;  1K7A A;  1U5T A;  4NHJ A;  1O3T A;  3CLO A;  1E17 A;  2DFI A;  5ILU A;  1A04 A;  3V8K A;  4HX7 A;  4RGS A;  2EB7 A;  2IP2 A;  3AAF A;  3S2W A;  1O3S A;  2NYX A;  2MH9 A;  4B09 A;  5ICE A;  5LGU A;  1FYK A;  1U6G A;  2Z5U A;  3G73 A;  3N97 A;  2HTJ A;  1IN6 A;  1IN7 A;  4WWC A;  3B73 A;  2ESH A;  3GFL A;  2CW0 F;  4N9H A;  2XV4 S;  3RDI A;  2FBH A;  1YQA A;  4UUV A;  2DQL A;  4M9X A;  3MAJ A;  2XGX A;  2M87 A;  5FO5 A;  4P55 A;  2KJC A;  2ZME A;  2PFB A;  2O61 A;  2A3S A;  2PMH A;  2QQA A;  4LFU A;  1ZRE A;  4OIQ F;  5J8F A;  2HQR A;  4U7D A;  3U9G A;  4PGH A;  1SFU A;  3KP3 A;  1SD6 A;  2MH2 A;  2QQB A;  1G3W A;  2IA0 A;  1YYV A;  5DUI A;  2IA2 A;  4DNC A;  4QLC U;  3KFW X;  4KT5 C;  2DAO A;  2RVC A;  2E7W A;  2A6H F;  5D6F A;  4I2O A;  3BY6 A;  1GVJ A;  2BV6 A;  1WKM A;  4WXH A;  2COM A;  4L9J A;  2FNP A;  2MD5 A;  3B02 A;  5DCM A;  1FZP B;  1YG2 A;  2MBF A;  1R7J A;  3OOP A;  2EFN A;  2Z3Y A;  1U5T B;  4XRF A;  4IXA A;  2ESN A;  3HTS B;  2VON A;  1ZG3 A;  2ZFW A;  1BM9 A;  4EGY A;  2PI0 A;  1HQC A;  4L18 B;  4KIF A;  2O03 A;  5FD6 A;  4HV6 A;  2DK8 A;  1Z05 A;  4A6D A;  2VE9 A;  1XDS A;  3CUQ C;  2L4M A;  2FEZ A;  5FFX A;  1KQ0 A;  5F64 A;  3MQ0 A;  3LA7 A;  2NNY A;  1XSX A;  3E5X A;  3KP5 A;  2EFW A;  3QPH A;  5L3D A;  4KYW A;  1LJ9 A;  1IN4 A;  3DP7 A;  3LA3 A;  4RB1 A;  4HYE A;  5EEG A;  3QOP A;  1XB4 A;  2ZME B;  2X4H A;  2QLZ A;  2W84 A;  4IPA A;  1J75 A;  3ZMT A;  4N9I A;  2K86 A;  2A07 F;  2VOP A;  3KZZ A;  1ODD A;  2WTE A;  2HKX A;  3MWM A;  2FBK A;  2GZW A;  3KP6 A;  1RUO A;  2A69 F;  2VT3 A;  5ICF A;  4RGX A;  2WWY A;  4EJV A;  2O6G E;  3K2Z A;  1BIA A;  5CVR A;  1OYY A;  2KRF A;  4OIO F;  5JR3 A;  2P7V B;  5E8G A;  1XMA A;  3WGG A;  2L3D A;  4HBL A;  3I59 A;  4G7H F;  2H94 A;  4LLG F;  1ZG5 A;  2E1C A;  3GZ6 A;  1BI1 A;  3C7J A;  1OYI A;  1ZH5 A;  1X3U A;  2DLL A;  5FGM A;  2FNA A;  3COA C;  2JPB A;  1SD5 A;  5DCM B;  3WU0 A;  2GXG A;  5LGN A;  4EJU A;  2FA5 A;  1U3E M;  1D8K A;  1IXR C;  2QVO A;  3SXY A;  1I6X A;  5LHH A;  1JGS A;  2KJB A;  1IN5 A;  4U0V A;  3R60 A;  1U2W A;  3FX3 A;  1HKS A;  1JE8 A;  2HYG D;  3VOE A;  4GXO A;  4BHB A;  3TKY A;  3VB2 A;  3JAM Z;  3KET A;  4HAM A;  5AIP A;  1HW1 A;  3I71 A;  1Z9C A;  1P4A A;  4P96 A;  2YSR A;  4LK0 F;  3E6D A;  3T0Y A;  4O3M A;  5K5O A;  3JTG A;  1R23 A;  5JFR A;  4PZJ A;  4L5J A;  2NRA C;  2KIF A;  5HS8 A;  2H6B A;  4IJA A;  4HDV A;  1BI0 A;  1BI3 A;  4P9F A;  3ECH A;  3SHF A;  1RNL A;  2ZBK A;  5L3F A;  1P6R A;  2G7U A;  2HEO A;  4GO1 A;  1FYM A;  1S29 A;  4MTD A;  3HYI A;  3MZH A;  2ZJ2 A;  1G4D A;  3QAH A;  5LLQ A;  1MGT A;  2FMY A;  2KKO A;  3M1E A;  4L5I A;  2FML A;  4Q5S F;  5BOX A;  2YX4 A;  1KGS A;  2FU4 A;  2ACJ A;  3W6K B;  3RJP A;  2Q8K A;  1NHA A;  4EMS A;  3K1M A;  3F8C A;  1REP C;  3GLX A;  3F21 A;  2H27 A;  3R0J A;  2V79 A;  2W57 A;  3TDU C;  4YIF A;  3I59 B;  5H6Q A;  3QU3 A;  2L02 A;  2XAQ A;  1FNN A;  5ILV A;  2C6Y A;  2K4B A;  4U0W A;  3F8B A;  4EM1 A;  2LNB A;  3RIR A;  3WTY C;  1YO5 C;  2EA4 A; 
#chains in the Genus database with same CATH topology
 1JT6 A;  2HOE A;  2UXN A;  1BL0 A;  1U78 A;  3H0D A;  3HRT A;  3VDX A;  5EG0 B;  5EGO B;  1T0F C;  2PLY A;  2W25 A;  1SFK A;  2E19 A;  4MEX F;  1BIB A;  3HKZ A;  3S1M J;  4A5N A;  3ZN1 A;  3QU6 A;  2WB1 A;  3EYI A;  4BXX J;  3R4K A;  1AWC A;  2IW5 A;  2PG4 A;  4E7S A;  5D5V B;  2JQ7 A;  3W2W A;  3P9K A;  2L4A A;  2DA6 A;  4LMY A;  3FIW A;  1APL C;  2KIU A;  1XMK A;  1MZB A;  3FHN A;  1UST A;  2BE5 F;  1SVO A;  4ESB A;  2XPW A;  1WPK A;  2CUJ A;  4A0Y A;  3WU2 C;  1R49 A;  2WAE A;  3S3N A;  3HC7 A;  4AC0 A;  4AWX B;  4W97 A;  1UEL B;  1EJ9 A;  2V9K A;  4A93 J;  4O5V A;  4XSZ F;  1Y39 A;  2ID3 A;  1QBJ A;  3WE2 A;  3RI4 A;  1NG7 A;  2HNH A;  1U8R A;  1P4W A;  1R71 A;  3K6G A;  2K3F A;  3LST A;  5E1X A;  2HTS A;  4XLF A;  1RKW A;  2K9L A;  4CCL A;  1B72 A;  3KLO A;  4A2U A;  3OYN A;  3SDB A;  3ZMZ A;  1OMI A;  5DM6 F;  3PIP F;  5E8I A;  3E97 A;  2RDP A;  3CJQ B;  4G94 A;  3ASN H;  1U5T C;  4MFE A;  3WTV C;  2PEX A;  2YUS A;  4Y33 A;  4BNC A;  5KCM A;  1BW5 A;  4PJ0 C;  5C44 J;  1XN7 A;  2RGV A;  3IRR A;  4F91 B;  4UVA A;  3M07 A;  1XG1 A;  3RPU A;  3RYR A;  1IRG A;  1D1A A;  1ZGJ A;  2IGO A;  3S93 A;  4AYB A;  4E7H A;  3JW4 A;  1VQM I;  1M1E B;  1Q1V A;  2CJJ A;  2CV1 A;  2MW8 A;  5M5X J;  1QZZ A;  2XIG A;  3H9Q A;  1I1G A;  1I3Q J;  1Z1D A;  2E1O A;  3HGG A;  1TWA J;  2L0K A;  3H5A A;  4BDZ A;  4HRI A;  3BC8 A;  1MH4 A;  3OS1 A;  2QA4 I;  3KYL A;  1LFU P;  2DOF A;  1K78 A;  2F4O B;  4RA2 A;  3V42 A;  4HOB A;  3MD2 A;  4XOR A;  5F0C A;  2ZCW A;  1BBY A;  3OYK A;  1VND A;  2QEX I;  2R5Y A;  3WTT C;  1SAX A;  2XGD A;  1ONV A;  4B4C A;  3JAM K;  1HW5 A;  2Q1Z B;  3ABU A;  3E3V A;  4HLY A;  3FKJ A;  3I64 A;  1WI3 A;  1OLT A;  2CRG A;  5M5W J;  1VQL I;  2XB0 X;  3E5Q A;  2Y9Z A;  3DKY A;  2VOO A;  3ZPL A;  3OYI A;  5LFA A;  2QF7 A;  3I5U A;  1FMV A;  5M3F J;  4EJT A;  1O3Q A;  4BS9 A;  2ZME C;  1KQ9 A;  4MFD A;  3IAM 2;  2YU9 J;  2L9S A;  3FZV A;  3KEQ A;  1C0W A;  4HNU A;  3BR1 A;  1T2K A;  1MDM A;  4I01 A;  4OIR F;  3HPG A;  2QWW A;  1XD7 A;  3HG9 A;  3IHU A;  3K4J A;  4E70 A;  4ETS A;  4FX4 A;  5FKK A;  1KQ8 A;  1W7P D;  1WI9 A;  3ZXS A;  3FXR A;  3K7A J;  3F22 A;  2DA5 A;  2B63 J;  5CQG A;  4I7H A;  1A36 A;  3FM5 A;  2BW3 B;  4L0Y B;  2FE3 A;  2LMD A;  2Y31 A;  5KAI C;  1V3F A;  1MKM A;  2DA1 A;  2CU7 A;  2V1X A;  2KZG A;  3A01 A;  3GTQ J;  2UXX A;  4D9J A;  2LR8 A;  3R0A A;  4XKW A;  3W2V A;  3LSP A;  4J01 A;  3MN2 A;  2BBY A;  1DPU A;  2X1D A;  3HRM A;  1MIJ A;  3DKW A;  5LD2 C;  3WTX C;  3JRD A;  2M30 A;  5L3B A;  3SZG A;  4MNU A;  2MC4 A;  2TDX A;  3DF8 A;  2BYV E;  5K7F A;  3CLQ A;  3WU1 B;  2JA5 J;  1F43 A;  1HSJ A;  3NQO A;  3FKI J;  3CCL I;  4RB3 C;  2BZT A;  5KK1 A;  1I39 A;  1XCV A;  3BG3 A;  4JYK A;  1V4R A;  4CA0 A;  3BTC A;  1U9N A;  5F1R A;  3BRO A;  1HLV A;  1DDN A;  2D1V A;  3U1D A;  3T5X A;  1WJE A;  4G9Y A;  2CSO A;  2HPM A;  2JZY A;  2Y9Y A;  3ZP5 A;  1Z6R A;  2Y2Z A;  4AU7 A;  2Z99 A;  4NBQ A;  2VPR A;  3OL3 A;  4OOI A;  2Y30 A;  2ZKZ A;  5D5U B;  2EBI A;  2NXN B;  2QKL B;  1TQM A;  3JTH A;  1IF1 A;  2M1B A;  1L3L A;  1TT0 A;  5F04 A;  2DA7 A;  2Y0M A;  1XCB A;  3BR5 A;  1MMN A;  3DTE A;  3H36 A;  1OCZ H;  3BQY A;  2BVM A;  2XAS A;  3K69 A;  1B72 B;  1IRX A;  1WZ2 A;  2H8W A;  3GTP J;  5EYR A;  2JA8 J;  1IDY A;  1UZC A;  2L7K A;  3KPH A;  3SQN A;  4E7L A;  1ZAR A;  1G3Y A;  2AS5 F;  1QU3 A;  1B8I A;  3BCA A;  3L7W A;  3IV5 A;  2PJP A;  1GXQ A;  2PBI A;  3CTA A;  4EM2 A;  3PO2 J;  3HZJ A;  4QIW N;  2CUE A;  1MJA A;  4I0A A;  2RRE A;  4HPQ A;  4ZYG A;  5J1R A;  2R7U A;  4MQ9 F;  1MMS A;  2LP0 A;  2HXI A;  2L9V A;  2W1O A;  1FSH A;  3K10 A;  3MZY A;  2JJ7 A;  1X2M A;  3VYT B;  2VBX A;  1XSV A;  4BXU A;  4BE0 A;  1A5J A;  2FQ3 A;  1TP4 A;  5ICG A;  2F48 A;  2A5Y B;  2L9N A;  2OCE A;  2DN0 A;  2K3P A;  3OYE A;  2MG4 A;  4OMY A;  2LKX A;  1K78 B;  5LGT A;  2MLG A;  2NOG A;  2JWT A;  4IQ4 A;  4DBQ A;  4L9T A;  3OYA A;  2YX7 A;  4RS8 A;  1QNT A;  2ZSI B;  2LDU A;  1RI7 A;  2B0L A;  2R7Q A;  3TOA A;  2NNN A;  2R5Y B;  2GA1 A;  2WY8 Q;  5E1Z B;  1H89 C;  2R3S A;  2O8X A;  3FIS A;  1ITY A;  3JCU C;  3VSL A;  3DEU A;  4IOA F;  4KMU X;  5GP9 A;  3WTU C;  3FMS A;  1TWH J;  5GAD J;  2VOD A;  2KRC A;  3ZMU A;  4C30 A;  3ZMS A;  1W36 D;  4L0Z B;  1BI2 A;  3DPT A;  4CO8 A;  2DQR A;  4HQM A;  1O7F A;  3RQ4 A;  3LFK A;  4IZZ A;  1LDD A;  4HX4 A;  2EFP A;  5D4S A;  2RC4 A;  3IKT A;  5L3E A;  5IP9 J;  4RM3 A;  2GIZ A;  4BAC A;  3RKY A;  1MDM B;  3RPQ A;  1W7P A;  1YJN I;  3RSN A;  3ZMD A;  4M71 A;  3A02 A;  4IHS A;  3L2C A;  1T39 A;  3DLL F;  3PSF A;  5EJC A;  5KVR A;  2VQG A;  2OAZ A;  2LRD A;  1OCO H;  4GYI A;  1K79 A;  1ZEL A;  4JQF A;  1JTX A;  3GW2 A;  4XOP A;  3REO A;  1K4S A;  4A12 A;  2VQC A;  2IGM A;  1XX5 A;  3BLY A;  3VEP A;  5E20 A;  3A03 A;  5LEJ A;  4DQ2 A;  1R36 A;  2HI3 A;  1JUP A;  1LE8 A;  3JRH A;  1P9Q C;  3IWF A;  5M3M J;  3D5S C;  1FT9 A;  2EIM H;  4LIU A;  3BG9 A;  3KZY A;  4DYR A;  2V1D A;  5LHG A;  3ISP A;  2J5O A;  1A31 A;  3ZMV A;  3T8T A;  1USS A;  1DP7 P;  2CQQ A;  2EWN A;  2WV0 A;  1GXP A;  5M5Y J;  5CJ9 A;  1WHU A;  2KLO A;  2RQQ A;  3G2B A;  5B3S H;  2GLO A;  2DI3 A;  4XON A;  4BU2 A;  3E7L A;  4ENJ A;  1YS7 A;  2MD0 A;  2CV0 A;  2X6Y A;  3QP5 A;  3QYE A;  4HV5 A;  5GAE J;  1WVR A;  4G6D A;  4A3E J;  2AQE A;  1R1T A;  4B43 A;  1OCR H;  3AG3 H;  1A6Q A;  1KYW A;  3FXQ A;  4RLQ A;  1SFE A;  3CZ6 A;  4KFC A;  1NTC A;  2A05 A;  3JRE A;  2MSY A;  1Z7L A;  3PFI A;  2A6T A;  4XOT A;  1OYW A;  1HKQ A;  4KMF A;  4RAF A;  2DDB A;  4YFK F;  5EEH A;  4JP0 A;  2M8G X;  3GYH X;  4WX9 A;  4HF2 A;  3EUA A;  1IRF A;  2HWV A;  3ZRG A;  5E1W A;  3W6J B;  4J19 A;  4P9U A;  2JPC A;  5J8C A;  4C2U A;  1LDK B;  2HQN A;  3IH2 A;  3WOD F;  3TQN A;  2Z33 A;  1YX5 A;  3LMM A;  4M9Z A;  1V5E A;  2H09 A;  3FWE A;  3GEZ A;  3QRF F;  3BPV A;  3E6C C;  2HYF A;  4RB2 C;  1JXS A;  2W7N A;  3RQI A;  4UV9 A;  1V54 H;  3OYJ A;  3H92 A;  2KIQ A;  2F4I A;  4E6K G;  4ABZ A;  1B8I B;  1UHM A;  4BQO A;  3ESW B;  3OOU A;  3GFM A;  4Y15 A;  3OWT A;  5DYM A;  3ABK H;  3GVA A;  1KA8 A;  4UUS A;  3CF2 A;  2XAF A;  1VF9 A;  3I58 A;  2VXZ A;  2V1N A;  4QSH A;  1DGW Y;  3A4C A;  1G59 A;  1UJ8 A;  2WAQ N;  1IDZ A;  2H1K A;  2CS3 A;  3TO9 A;  3P7N A;  2Z1D A;  2P6S A;  4BDY A;  3S3M A;  1FTZ A;  3CP2 A;  2WAF A;  3FK6 A;  1ZR4 A;  3L9F A;  2XPU A;  4NUB A;  4ZH4 F;  5B1A H;  3OYB A;  2HPI A;  1N75 A;  3CCY A;  3FXO A;  5TGT A;  3CC4 I;  3KCC A;  1DUX C;  1UCR A;  1ZN2 A;  1EH6 A;  2VBW A;  2BY2 A;  2EZL A;  2FOK A;  2Y0S N;  5K5R A;  3KP7 A;  2VB6 A;  3ABT A;  1IXC A;  3BJ6 A;  3LSK A;  1R00 A;  3TGN A;  1TC3 C;  4LGW A;  3ROU A;  1X1C A;  1WRJ A;  1FY7 A;  3B6A A;  3GO5 A;  4UV8 A;  1TL8 A;  4PDK A;  4F55 A;  1D8J A;  5FKO A;  1T38 A;  2P5K A;  1G8X A;  2L7M P;  3F0C A;  3KYC B;  4G6T B;  2V6C A;  4XN0 A;  3D0S A;  2JA7 J;  1R4N B;  2BXZ A;  4B3A A;  1HKT A;  2R7T A;  1W7P B;  5E18 F;  2IXS A;  2K7L A;  2OV7 A;  3PO3 J;  3TDZ C;  2ELJ A;  1FPQ A;  2H8R A;  4CYD A;  1QHH D;  3G6E I;  1TW3 A;  1SD7 A;  1VI0 A;  5F1J A;  2DPU A;  3RTR A;  4B48 A;  1LVK A;  2YU3 A;  2DTZ A;  1IRZ A;  1OCT C;  1IC8 A;  4BHP A;  3CC2 I;  4IVN A;  3RCO A;  3PUF A;  1J09 A;  3VOD A;  4BE2 A;  1OCC H;  3HOX J;  3PNT A;  4GGG A;  1SMY F;  4XR6 A;  4XN3 A;  3M9A A;  5IP6 A;  4ENK A;  4G7Z F;  2R7Z J;  4GCV A;  3BTL A;  2LF8 A;  1JKQ C;  3QPL A;  5H2F C;  5BMZ A;  4C3H J;  4XKV A;  2VI6 A;  4DZJ A;  3I55 I;  1QGP A;  3EUH C;  5JLW A;  2VJI A;  2PMZ A;  1ZQ3 P;  4C2T A;  1YW9 A;  3GTL J;  3R61 A;  2LK2 A;  1JUM A;  3L2Q A;  3DPL C;  5EEA A;  2YR2 A;  5CLS A;  3QYB A;  3I4P A;  3BQZ A;  2A68 F;  2GM4 A;  3H35 A;  3M8E A;  4A0Z A;  2DOA A;  3G71 I;  2F5D A;  1SFO J;  3OIO A;  1ON2 A;  4MO7 A;  2F5C A;  3M8J A;  4JBA A;  3H5R A;  1MMD A;  1X3Z B;  2E2I J;  4ENN A;  1LEA A;  1BJA A;  1ERD A;  4M73 A;  1MBG A;  3L2W A;  4BQN A;  2JTV A;  1YTY A;  1MMA A;  1F5T A;  5E3L A;  2RKH A;  4A5M A;  2BEO A;  3SZT A;  3OYH A;  5FLX Z;  1IJW C;  1YS6 A;  2CG4 A;  2Y48 A;  4XLP F;  5H6R A;  1JUS A;  2G7H A;  3M7G A;  5FKL A;  4CCM A;  2QGU A;  3PJR A;  1W5S A;  3HUG A;  1BOB A;  2FX0 A;  1ETO A;  3V4G A;  2R7W A;  1HA8 A;  3PNV A;  4R8H A;  1Y0N A;  2M7A A;  2XGC A;  1S5L C;  1X19 A;  4OIP F;  3HRU A;  4WCG A;  3H9J A;  1FTT A;  4I76 A;  3EQL F;  2LC2 A;  4FAS D;  4LLL A;  4B8X A;  3EYY A;  4OMZ A;  1Y1W J;  1MBJ A;  1WWX A;  2X6O A;  2QEN A;  4FE4 A;  5D8K B;  3P9C A;  3K70 C;  4Z6Y A;  3HOT A;  2ISY A;  1QPI A;  3Q0U A;  3ONQ A;  3BP8 A;  4Z2Y A;  2LOO A;  2K4J A;  4IHT A;  2VQH A;  4GFB A;  3TO6 A;  5CVV A;  3J81 Z;  3H3V K;  5IYC J;  2LSO A;  1MBE A;  4HW0 A;  3R6S A;  3ULQ B;  3K4L A;  1WSU A;  1MH3 A;  2XRN A;  3K4B A;  2EZH A;  4O6J A;  2ELH A;  5BQT A;  5ICC A;  3KX2 A;  1CF7 A;  1GV2 A;  1UG2 A;  1T98 A;  3JSO A;  3IP4 B;  5DUK A;  3B6C A;  4RAZ A;  3JRF A;  2DCE A;  3VFZ A;  4A3K J;  3BOQ A;  2BY0 A;  3OR2 C;  4IF4 A;  4XLC A;  1XSD A;  4WXD A;  3BR3 A;  3GX4 X;  1MJB A;  5D5X B;  3E6B A;  3L2V A;  2DYR H;  1OCP A;  3FDY A;  3FMQ A;  2HOS A;  1EF4 A;  3L2U A;  2CFO A;  3K0L A;  3WG9 A;  4BHC A;  1J2X A;  2EPF A;  2A61 A;  1HOM A;  2DT5 A;  5F0H A;  4K2E A;  4M3G A;  4PFP A;  5F08 A;  4BXF A;  4MEY F;  4TV7 A;  1PUE E;  4A0X A;  4I0B A;  4CZZ A;  1UG0 A;  2DU9 A;  3LAJ A;  2CUZ A;  5J3L A;  4ZTJ A;  1RKT A;  3C2H A;  3KP2 A;  4D0P A;  2K40 A;  4MTE A;  2DW4 A;  4E7Z A;  2LVS A;  3I54 A;  1RUN A;  3BDD A;  3IKV A;  1VQN I;  3SYT A;  3S3O A;  4HLX A;  4EM0 B;  4L9V A;  5DS9 A;  2KDO A;  1EH7 A;  2IS2 A;  2RNG A;  2DFE A;  2O0Y A;  3H5N A;  3P5J A;  3HOS A;  2GIV A;  3TED A;  5HS9 A;  5B1B H;  5FFZ A;  3JR9 A;  5HLI A;  4IHY A;  1AOY A;  2E71 A;  3DEE A;  1CGP A;  2RQP A;  4NB5 A;  4YII A;  1N78 A;  3K4C A;  3WGI A;  1OR7 A;  2OBP A;  4LG0 A;  3FXM A;  1KU7 A;  2XHK A;  5E79 C;  4UVC A;  4V2F A;  4ON0 A;  4HF0 A;  2Y69 H;  2WC2 A;  2OQG A;  5C3E J;  2JRT A;  4B3X A;  1FBU A;  3BG5 A;  3G3Z A;  2KPM A;  2IGN A;  4OIN F;  4AVZ A;  3GFI A;  2MA3 A;  1GLN A;  3ELK A;  3H3U A;  3NRV A;  3AKZ A;  3Q0V A;  4M6X A;  2QBY A;  3S17 J;  2M0M A;  5F27 A;  4BJ6 C;  4DGW B;  4IO9 F;  3EPZ A;  4KN4 X;  4FQG A;  2FUG 2;  3QP6 A;  2EFO A;  2X9D A;  5FB2 A;  5K7Z A;  3DWL E;  1V55 H;  4EVI A;  3GZ5 A;  3V8L A;  1W1W E;  3KP4 A;  2O9L A;  4N0B A;  3WTZ A;  1IN8 A;  3NWS A;  4UUT A;  2KP6 A;  1POG A;  3CCV I;  4ITV A;  2EK5 A;  3HUG B;  1F36 A;  4M3F A;  2TRT A;  4PGG A;  1QO0 D;  2FD5 A;  3GWZ A;  1F1Z A;  2VC1 A;  3F72 A;  2XAU A;  3DBH B;  3GFJ A;  4ANJ A;  1Z3X A;  1U8B A;  2H6C A;  2IPQ X;  2VBZ A;  2QQ8 A;  1FP1 D;  1PJR A;  3LNQ A;  3I53 A;  4LD5 A;  2K9Q A;  4R79 A;  4M3B A;  1FBQ A;  1D3Y A;  2BVL A;  1Z67 A;  3E0J B;  2NVU B;  4C3I J;  1Y8Q B;  1IUF A;  1JHF A;  3F6O A;  2EV0 A;  4LJZ F;  3L09 A;  2ECC A;  2CV2 A;  1QA6 A;  1S7E A;  1HXD A;  4XRM A;  2VAS A;  3LSM A;  3Q3S A;  1PDN C;  2QKM B;  2LH9 A;  4AID A;  3CJN A;  1S7O A;  1SAN A;  4A3M J;  1R5I D;  2EFQ A;  5IPA A;  3CCU I;  4HQE A;  1CF7 B;  1UB9 A;  3BWG A;  4A3G J;  2HFH A;  4E7J A;  2STW A;  2B7E A;  1YHQ I;  4OAY A;  4ZYD A;  4PSW A;  3PSI A;  2VQL A;  1QVT A;  2XAG A;  2EA2 A;  4XLA A;  1YIJ I;  1BOA A;  5IT9 Z;  1IXS B;  2P6T A;  3GF2 A;  2GQQ A;  2L7F P;  1P4X A;  2K9N A;  2IGK A;  4BUP A;  1EV7 A;  1TNT A;  1Y6I A;  4M6V A;  4QPQ A;  2M8E A;  5AIQ A;  1MSF C;  5GAH J;  3DFG A;  5AON A;  2XF5 A;  2EZK A;  1B4A A;  2E5Z A;  1O3R A;  5HVQ C;  2EIL H;  3W3C A;  3I56 I;  4KA4 A;  1FOK A;  5D8L B;  3GTK J;  5FLX K;  4WK8 F;  3PNY A;  1A6I A;  4RLF A;  1AKH A;  2DMP A;  4XK4 A;  3PIO F;  1F4K A;  4BBS J;  3I4M J;  4G7O F;  4GRI A;  2JVG A;  3HOZ J;  3ZQC A;  2NVT J;  1W0T A;  1TBX A;  2JSP A;  3HXL A;  5EF6 A;  1SFX A;  2DDA A;  2PN6 A;  1BA5 A;  1P2F A;  1T0F A;  3CO6 C;  4HST A;  4PFO A;  5B5E C;  2E7X A;  3K4N A;  3F23 A;  2E1N A;  4RMN A;  1YW7 A;  2B9S A;  2BGC A;  2XUB A;  1N77 A;  1HC8 A;  1U0J A;  2G9W A;  3TW6 A;  2R7S A;  5LBQ A;  1X1B A;  4KIG A;  2OD5 A;  4LIT A;  2Z2S B;  5HOD A;  1VTN C;  3D5L A;  1W5T A;  2AQF A;  1HDP A;  2MC3 A;  4PJL A;  4E7I A;  4DYQ A;  2Z9O A;  2HVR A;  1H0M A;  3TOB A;  4P5O A;  5ED4 A;  3J81 K;  1Q1H A;  4LG0 B;  1IW7 F;  2K27 A;  2P5L C;  1J7K A;  2CQX A;  4FET A;  1S8N A;  2DXI A;  4L9N A;  3DQV C;  1YRN A;  4ASN A;  1OFC X;  2FOW A;  4GYG A;  1E2X A;  3IRQ A;  3S1N J;  3H3Z A;  4D5F A;  5JVT A;  3C2G A;  1ON1 A;  2ZXJ A;  5L3G A;  2DK5 A;  2QBY B;  2BHY A;  1YIO A;  3IWZ A;  3GTG J;  5C4J J;  1WJD A;  2VC0 A;  2DPD A;  1YJ9 I;  2BOL A;  3CJR B;  1FOX A;  1ZGA A;  3V7S A;  3U21 A;  3S14 J;  4M6Y A;  2ETH A;  4X1E A;  5LRS A;  4LG3 A;  2R7V A;  4ENM A;  3UKG A;  4HX8 A;  3HSF A;  1H9G A;  3EET A;  4LOC A;  5IT3 A;  3MEX A;  4CH7 A;  2IS1 A;  1L0O C;  2M4K A;  2ZXI A;  4BY7 J;  4XIC A;  3OIP A;  2IRF G;  1TQI A;  2JUG A;  1GDT A;  1G3T A;  4A3I J;  2LD5 A;  1KU3 A;  1I3A A;  2XRO A;  1I50 J;  2KMU A;  1DPR A;  4OU0 A;  4BEH A;  3KLN A;  2M3A A;  2OPT A;  5D5W B;  2LBF A;  2XB5 A;  1VQ7 I;  1QRY A;  1W5C C;  2NS0 A;  1X1A A;  2BXY A;  3TO7 A;  1PP7 U;  2PJR A;  2XF6 A;  3BT9 A;  4IRG A;  5DD4 A;  1R22 A;  5FJ8 J;  2ICW G;  2DOE A;  1B59 A;  1X1D A;  3J80 Z;  1Z7U A;  2IS6 A;  1NH3 A;  3MKZ A;  1YLF A;  1O7L A;  5BS6 A;  1RZ4 A;  3GZN B;  2IS4 A;  1BR1 A;  2IAI A;  3CDL A;  2GAU A;  6PAX A;  3HDD A;  1SVL A;  3JSP A;  4JK1 X;  2X51 A;  5CPR B;  5DV5 A;  2GA2 A;  5K1Y A;  4ZZD A;  2K9S A;  3RKW A;  4HNV A;  2QSG X;  1KYZ A;  4RGU A;  1VQK I;  3HOW J;  3HOY J;  3ZOB A;  2R7R A;  3OR1 C;  4QTR A;  3PQJ A;  1B9N A;  1JGG A;  2UV1 A;  2HGC A;  4KIC A;  2DFH A;  4CIC A;  3UNG C;  2IEK A;  4MLO A;  2EZI A;  3O3K A;  1LUJ B;  4XM3 A;  4KT6 A;  1SAU A;  4LIV A;  5FLM J;  1D5Y A;  3E5U A;  4ZJZ A;  2UWM A;  3LQR A;  2HVQ A;  2ZJR F;  4AIK A;  1XTA A;  3P9I A;  1AKH B;  2F2E A;  5TJJ A;  1J59 A;  1XDU A;  1W36 C;  2IVM A;  4KN7 X;  1ZRF A;  2P4W A;  3Q5F A;  3MKL A;  4YFN F;  3K1N A;  5F0F A;  4U0Y A;  3LSR A;  1OKR A;  3A01 B;  1ZR2 A;  3FM3 A;  4M3D A;  2ZNZ A;  5LRR A;  1S9H A;  3GTO J;  2XAJ A;  5DDG A;  3IH3 A;  2M5W A;  2NAZ A;  1LVA A;  5CVJ A;  4ZYA A;  3ZN0 A;  2M0C A;  2QM3 A;  2AO9 A;  1SMT A;  2KDZ A;  1ZRC A;  4A3J J;  1FLI A;  4NNJ A;  2RV8 A;  4U88 A;  3U1K A;  4IHV A;  1IO2 A;  3RYP A;  1BW6 A;  1ZLK A;  1YE9 A;  3G1O A;  2QUF A;  4C2M J;  2X0L A;  2XRL A;  3K9T A;  2EJR A;  1MMG A;  4PCQ A;  1D0Z A;  5D6E A;  5J6X A;  1D5V A;  2V1U A;  1LDJ A;  2CQN A;  1TWF J;  4AVP A;  4EV0 A;  1BC8 C;  1YRN B;  1SD4 A;  4ZYE A;  4S04 A;  4CGZ A;  1G2H A;  3ZQQ A;  1JHH A;  2VN2 A;  3NEU A;  1RR8 C;  1LPQ A;  1R5H A;  2FQ4 A;  1XGS A;  4XSX F;  3NWT A;  1GV5 A;  3V8J A;  5IT9 K;  1FX7 A;  5K7H A;  1KU2 A;  2LKS A;  2R7O A;  1PUF A;  3CCM I;  2DT7 B;  2STT A;  4IRH A;  1G6N A;  2F5F A;  4ZYH A;  1R1U A;  3QPT A;  5EZH A;  1T6S A;  2L54 A;  1IV8 A;  3N05 A;  4FHT A;  1X1P A;  4ESJ A;  4FCY A;  1ZKG A;  3OY9 A;  4Q4Z F;  2QSH X;  1FJL A;  3LL7 A;  2K9M A;  4Y17 A;  3V7R A;  1LQ1 A;  2K5C A;  2GOX B;  2QSF X;  3K1P A;  4BEH B;  1R58 A;  4A3D J;  5BPI A;  3OV8 A;  1J5Y A;  2LY2 A;  3HIF A;  2WA0 A;  2WBM A;  2LY9 A;  2AXL A;  1AU7 A;  2M4G A;  1CQT A;  2PJR B;  1X2N A;  3T8R A;  5CVU A;  5LEK A;  4XBF A;  4RAY A;  2LFB A;  5J1Y A;  3F3X A;  2JN6 A;  2TCT A;  5HDG A;  3M4O J;  5ILS A;  3HRS A;  4RB0 A;  1FOW A;  1K61 A;  1S7A A;  2I10 A;  5IYB J;  3M3Y J;  3FXU A;  5DD8 A;  1R4M B;  2CH0 A;  4Q48 A;  2QZ8 A;  3GTJ J;  2XDV A;  4XRS A;  1S3J A;  2RNJ A;  4OAZ A;  1IAW A;  4NC8 A;  2OJE D;  1JI8 A;  4I98 B;  4E7K A;  2EIJ H;  3G1M A;  4W1U A;  3LSI A;  3MFK A;  4UHT A;  1VQP I;  4LB5 A;  5HDK A;  2JA2 A;  2ME6 A;  3IH4 A;  1SEU A;  2LY1 A;  3V7C A;  2JK3 A;  4S05 A;  2M2E A;  4G8X A;  5A2Q Z;  4I09 A;  5TIS C;  4F7Z A;  3LA2 A;  3PUB A;  4U87 A;  1GVD A;  1TQP A;  2V4J C;  1G3S A;  1T56 A;  3EDP A;  3CES A;  1S6L A;  1Z6T A;  2O3F A;  4II3 A;  4EGZ A;  2VE8 A;  3HHG A;  1D0Y A;  3OSG A;  4JX4 A;  2JA6 J;  3HTU A;  4BAY A;  2W82 A;  5H20 A;  3S2H J;  1FWZ A;  1TW2 A;  5DEQ A;  1I5Z A;  1LEB A;  4QWQ A;  4PK4 A;  3BTJ A;  1LE8 B;  1P7J A;  1K6O A;  5K5Q A;  1F9N A;  5HNF A;  3SEZ A;  3PQK A;  4BQQ A;  1XC5 A;  3EUK L;  2VKE A;  4ZTF A;  1I1S A;  2WAQ A;  3DBR B;  1OPC A;  4BH9 A;  1O57 A;  1WQ2 A;  2P7C B;  4X0G A;  3L00 A;  2GBY A;  3FMR A;  3J80 K;  1ZG1 A;  3C3W A;  1MD0 A;  1W0U A;  3S2D J;  4HG2 A;  2E2H J;  2F5E A;  1WJ5 A;  4YFX F;  3CCR I;  4R1H A;  1YIT I;  1JTY A;  1TLH B;  3IC7 A;  2VPL A;  2Y75 A;  4M72 A;  2E5N A;  2LG4 A;  2Y0S A;  2JT1 A;  2HR3 A;  1PP8 F;  3CMY A;  5BPD A;  1DU0 A;  4ZC3 A;  4ZDP A;  3DLA A;  3Q9S A;  4CYC A;  1B1B A;  4H0E A;  2VBY A;  4DYC A;  5JHU A;  4AD9 A;  3CUQ A;  1UMQ A;  3MKY B;  3WTW C;  1PUF B;  4FX0 A;  4YIR X;  3DXJ F;  3HJE A;  4ZZL A;  2KRH A;  1HDD C;  3DTK A;  2HKO A;  4MHG A;  1X3W B;  3ABL H;  2DMU A;  1I27 A;  3U2R A;  2N8G A;  3GUD A;  2XSD C;  4EJW A;  1GT0 C;  1PVE A;  2EV5 A;  2OZU A;  4CHU A;  2D45 A;  2A6E F;  2RN7 A;  4DBR A;  1T08 B;  2VT2 A;  4C3J J;  3CCS I;  3BJA A;  1OR7 C;  4C9Y A;  1Z0X A;  9ANT A;  3BPX A;  1HBX G;  4UUS B;  1FBS A;  1ZHF A;  3SFZ A;  3CUO A;  4PSX A;  4BGD A;  5F6F A;  1RPW A;  4DJA A;  5HS7 A;  3UR3 C;  2DA2 A;  4A3F J;  1LKX A;  4I02 A;  2HDD A;  3M8F A;  1VQ9 I;  3RZO J;  2FXA A;  4I6Z A;  2LTP A;  3SZP A;  4IX7 A;  4BY1 J;  3SJM A;  4AIJ A;  1VQ8 I;  4KDP A;  1WH5 A;  1OJL A;  3KZI C;  3LAP A;  4Y13 A;  1B9M A;  1W4M A;  3AFH A;  1FOY A;  2CO5 A;  1FYL A;  4DIQ A;  2MGQ A;  2XKO A;  3D5R C;  4AIH A;  3HOV J;  3J7A O;  1K4T A;  3WE3 A;  2XKP A;  1FEX A;  4NC7 A;  1KU9 A;  3O8H A;  4BJT A;  3HB9 A;  1UFM A;  5CVI A;  3RKX A;  3ECO A;  1T33 A;  2ELK A;  2L7Z A;  2J5P A;  2JSC A;  3KEO A;  3VWB A;  1ZRD A;  4G6Q A;  2XC7 A;  2BY1 A;  1LB2 A;  5GTH C;  4IRI A;  4M9S A;  1Y56 A;  2CFX A;  5CYV A;  3JRB A;  2R0Q C;  3HKZ N;  1J0R A;  2VKD A;  3F6V A;  3H9G A;  1ORK A;  3Q9V A;  2WB1 N;  5E3N A;  5JI6 A;  2M7B A;  4FT8 A;  4CCN A;  5FKM A;  4EJO A;  2FBI A;  3L2R A;  4BL0 B;  1VFC A;  1WJA A;  4H4K C;  1D1C A;  2ZNY A;  3HPH A;  4UXN A;  4ESF A;  2OF7 A;  1QPM A;  2L01 A;  1XGM A;  3BZK A;  4KIT B;  4XLN F;  2CQK A;  4LB6 B;  4UB6 C;  4LLN A;  2ISZ A;  1WCM J;  5KNL A;  3W6V A;  3GLL A;  3NAU A;  2Q0O A;  2ZJP F;  3BG7 A;  3J7Y J;  3LQQ A;  3A1Y A;  1YOV B;  3WTS C;  3L1P A;  3CO7 C;  3CMM A;  3FBN B;  2EV6 A;  4WXC A;  2F5V A;  4ZDO A;  3PFY A;  4X6A J;  5HNH A;  3BR0 A;  3OL4 A;  4UB8 C;  1RIO H;  3T1B A;  3EUH A;  3LWF A;  2LF7 A;  2YPR A;  3RKQ A;  1EKE A;  3KEY A;  1I6H J;  3G1L A;  2DJI A;  2PMU A;  4M74 A;  2V7F A;  5B66 C;  2ME0 A;  4FTH A;  2CGP A;  3FHZ A;  2KIM A;  1ULY A;  3BCB A;  1HST A;  2MYS A;  2OQR A;  2FSW A;  4AYB N;  4UNO A;  2CMP A;  4J00 A;  4NC6 A;  3HOU J;  1MNE A;  1BN5 A;  3E6M A;  4U7B A;  4YG2 F;  3C18 A;  1B6A A;  1MJ9 A;  1RRJ A;  4CYC B;  2IJL A;  1WJF A;  1D1B A;  4D7N A;  5DM7 F;  3CUQ B;  4JOM A;  3CCQ I;  3KE2 A;  2KHM A;  1J9I A;  4XLE A;  3CP8 A;  3ERE D;  4EEF G;  5HOO A;  5E3M A;  4HDU A;  2E1M B;  1UHW A;  5A2Q K;  2V6E A;  3HSR A;  2MLK A;  3TBI A;  3I0T A;  5IYD J;  2W24 A;  1Z91 A;  2FRH A;  2COB A;  1YI2 I;  3ML6 A;  3VSK A;  5ERI A;  1V5G A;  4BQA A;  4LK1 F;  5KAF C;  2JMW A;  3CF5 F;  3BR6 A;  1FIP A;  3KIO A;  5GAG J;  4B47 A;  1FP2 A;  5DCF A;  3IL2 A;  1BC7 C;  2M9H A;  2XSJ C;  3MCZ A;  1S72 I;  4PJM A;  3HL2 A;  1DP3 A;  3DV8 A;  3F8M A;  3LSG A;  2IT0 A;  3OYG A;  2HXO A;  2M45 A;  2Q2E A;  3F8N A;  4A6E A;  2OTL I;  3Q0W A;  1STZ A;  4HSR A;  4A3B J;  2CUF A;  1IV6 A;  4Y52 J;  3A2K A;  2GXA A;  2GXB A;  2OU2 A;  2LLK A;  1EH8 A;  3O6B B;  2R7F A;  2ADU A;  2HZD A;  3GXO A;  2HYJ A;  3FBI B;  1VQ6 I;  1ETY A;  3O2P E;  2X48 A;  5L3C A;  2R4G A;  1BJZ A;  1SVM A;  1IUY A;  2XVC A;  3OS2 A;  1MW7 A;  5HLH A;  4F92 B;  2VIX A;  2CYY A;  2CWE A;  4HA8 A;  1WJB A;  3ZQG A;  1FC3 A;  4CXF A;  1FIA A;  3CME I;  1ZAO A;  3HHH A;  2ZXH A;  2DTR A;  5HDN A;  2WAD A;  3K4K A;  2QQ9 A;  3K2A A;  2ECB A;  3ZQI A;  4XKB A;  3VYS B;  5LHI A;  2LKP A;  5E17 F;  3H1C A;  4HEA 2;  4S0H B;  1FSE A;  2P5V A;  3FF5 A;  1YW8 A;  4KNY A;  1HW2 A;  3TP3 A;  2IA1 A;  2ZO4 A;  3FXK A;  1VQO I;  3J7Z I;  1P92 A;  3AL0 B;  4HZF A;  2HQA A;  5CQE A;  4Q47 A;  3F9K A;  1GHC A;  1LNW A;  2HVS A;  3CCJ I;  4HF1 A;  5FRN A;  3RZD J;  1JJ6 C;  1JKO C;  2WV1 A;  2W85 A;  5J1U A;  4RGR A;  2DBB A;  1YFH A;  1MND A;  3F8F A;  2OA4 A;  4NQW A;  2DO7 A;  1OIS A;  1TNS A;  2P0W A;  2UZK A;  2D2W A;  4PUS A;  4KIB A;  4IHX A;  3ZQ7 A;  1R1V A;  3LSJ A;  1Z3Y A;  2F4M B;  2DT6 A;  3IUO A;  4F52 A;  3S1Q J;  3WGH A;  2E36 A;  4UVB A;  2I5U A;  2X6W A;  3DKX A;  2ZFU A;  4OWR B;  3S15 J;  3HSE A;  3N4M A;  4MQV A;  2E2J J;  1R5G A;  4L5E A;  3D1N I;  3DEW A;  2XGE A;  2R7D A;  2ZSH B;  4DW6 A;  1QQI A;  1Y0U A;  5C4X J;  1E3O C;  4XID A;  5D4R A;  2QYO A;  1H9T A;  4KUM A;  2PQ8 A;  3C1D A;  4WF2 A;  4CDG A;  3OYF A;  1QZY A;  3HEF A;  1AHD P;  2G0E A;  4A3C J;  2HZT A;  2HS5 A;  2D1H A;  2NVY J;  2XAH A;  3CDH A;  2HOT A;  1NK2 P;  3TP0 A;  1WGX A;  4EQQ A;  1IZ1 A;  4F93 B;  5J47 A;  5TRD A;  4XRS G;  5HLG A;  3FK7 A;  2O7O A;  2EQR A;  3FXL A;  4MGR A;  2FF4 A;  5FD5 A;  1XGN A;  4EAT A;  2OZ6 A;  4AM3 A;  2V9V A;  5JVG F;  4XNF A;  4XLH A;  2GWR A;  2P8T A;  4D5C A;  3BJO A;  2DMQ A;  3IAS 2;  2VLA A;  2HOA A;  3BZ6 A;  4BYY A;  2K02 A;  3JRG A;  1ZYR F;  1TTY A;  2LYC A;  2ZB9 A;  2CW8 A;  2R7X A;  5GPC A;  2HDC A;  1ZLJ A;  1XGO A;  1K7A A;  1U5T A;  4NHJ A;  3CD6 I;  1O3T A;  1VQ4 I;  3CLO A;  1E17 A;  2DFI A;  4JX6 A;  4BBR J;  5ILU A;  2DOD A;  1A04 A;  1FMW A;  3NAR A;  3V8K A;  2Q2E B;  2YS9 A;  4HX7 A;  1GUU A;  3DPU A;  4RGS A;  2EB7 A;  2IP2 A;  3DCF A;  4P1W A;  3AAF A;  3S2W A;  1O3S A;  2BY3 A;  2NYX A;  2MH9 A;  4B09 A;  5ICE A;  5LGU A;  3DU5 A;  3ABM H;  1FYK A;  1U6G A;  2Z5U A;  3G73 A;  2DA3 A;  1JKP C;  3N97 A;  2HTJ A;  1IN6 A;  3VYR B;  1IN7 A;  4WWC A;  2JVH A;  4RBO A;  3B73 A;  2ESH A;  3GFL A;  2CW0 F;  5FKN A;  1BR2 A;  4N9H A;  2XV4 S;  2JRM A;  3DU6 A;  3RDI A;  5EZG A;  3QOD A;  4KJZ A;  2XPV A;  2VJ5 A;  2FBH A;  1YQA A;  2ZJQ F;  4XL9 A;  3GTM J;  3ZQL A;  4UUV A;  1DQU A;  2DQL A;  4M9X A;  3MAJ A;  2X1C A;  2XGX A;  1MBH A;  3BTI A;  2M87 A;  3CQZ J;  5FO5 A;  4P55 A;  2KJC A;  2M34 A;  2ZME A;  2PFB A;  2HU9 A;  2NS8 A;  5GPA A;  5JHF A;  3S16 J;  2O61 A;  1RET A;  5IOZ A;  1RC9 A;  3CDI A;  2A3S A;  1ETX A;  2VJJ A;  2PMH A;  2X85 A;  1MBF A;  5JLX A;  3CCE I;  4V19 K;  2QQA A;  3QWL A;  3M1C A;  4LFU A;  3WHC A;  1ZRE A;  3GCM A;  2R93 J;  2ZC2 A;  1LFP A;  4OIQ F;  3I3L A;  4NQW B;  1O4X A;  2W00 A;  5J8F A;  4RAG A;  2HQR A;  3I4N J;  4U7D A;  3JRA A;  2DMN A;  3U9G A;  1XPX A;  3OS0 A;  4PGH A;  1SFU A;  1N25 A;  4A69 C;  2XF7 A;  3ZQF A;  1HF0 A;  4ZDL A;  2NVX J;  2W48 A;  3KP3 A;  1SD6 A;  2MH2 A;  2QQB A;  2R5Z A;  2UUZ A;  3LOC A;  3X2Q H;  5HLT A;  1G3W A;  2IA0 A;  2GOM A;  2VL8 A;  1YYV A;  1ETQ A;  1UAA A;  5DUI A;  2IA2 A;  4DNC A;  4QLC U;  5GTI C;  3KFW X;  2EH3 A;  4KT5 C;  3SEQ A;  1E3P A;  1XMX A;  2DAO A;  3WHB A;  2RVC A;  2E7W A;  2A6H F;  5CKT A;  5D6F A;  4I2O A;  3BY6 A;  3CJT B;  1GVJ A;  4IEJ A;  2BV6 A;  1WKM A;  4KIS A;  1K83 J;  4WXH A;  2VJ4 A;  4IL6 C;  4QPO A;  2COM A;  4L9J A;  2FNP A;  2MD5 A;  3SDG A;  1Z21 A;  3B02 A;  3C2B A;  3W2A A;  5DCM A;  2NVQ J;  1FZP B;  4D7M A;  1MBK A;  1PYV A;  3VYU B;  2DYS H;  1YG2 A;  4MIM A;  2MBF A;  1R7J A;  3OOP A;  1TZL A;  2EFN A;  2V9P A;  2Z3Y A;  3BR2 A;  1U5T B;  2W4S A;  4XRF A;  4IXA A;  4CCK A;  2OCC H;  2ESN A;  3TL4 X;  2H1L A;  3OYL A;  1U9O A;  3HTS B;  2VON A;  1A35 A;  1ZG3 A;  2ZFW A;  1BM9 A;  2BHZ A;  4B44 A;  1HQC A;  4EGY A;  1H8A C;  2PI0 A;  4L18 B;  1AA7 A;  2OC6 A;  2VUM J;  4KIF A;  2O03 A;  5FD6 A;  2KQR A;  4HV6 A;  1VQ5 I;  4E4H A;  2DK8 A;  2I8D A;  3QOE A;  4UY8 I;  1Z05 A;  2ZXW H;  2LBF B;  4A6D A;  1QZE A;  2VE9 A;  1H88 C;  2D5V A;  3LSH A;  1XDS A;  3CUQ C;  4PJN A;  2L4M A;  1V5F A;  1UHS A;  2FEZ A;  5FLV A;  2DA4 A;  3E1S A;  5FFX A;  1KZH A;  3S8P A;  1KQ0 A;  5F64 A;  3MQ0 A;  4BE1 A;  2E1M C;  2KT0 A;  3LA7 A;  4IQJ A;  2NNY A;  1E3H A;  3J7A Y;  1XSX A;  2JUC A;  3E5X A;  3KP5 A;  3OSF A;  2RAE A;  2EFW A;  1ETW A;  3QPH A;  1R6R A;  1ENH A;  2HDW A;  5L3D A;  4CUG A;  2NOJ B;  1JJ8 C;  4KYW A;  1LJ9 A;  1IN4 A;  1JKR C;  2ID6 A;  3DP7 A;  3LA3 A;  4RB1 A;  1ETK A;  4YEJ A;  3JRC A;  4HYE A;  3KYD B;  5IOY A;  4Y4R A;  5EEG A;  3OYC A;  2K85 A;  2P81 A;  3OMY A;  3QOP A;  1XB4 A;  2ZME B;  2X4H A;  4CCJ A;  4N4N B;  2QLZ A;  2AHQ A;  2W84 A;  4IPA A;  2EIN H;  2NS7 A;  2KIS A;  2PMZ N;  4JX5 A;  1J75 A;  3ZMT A;  4N9I A;  2K86 A;  2A07 F;  1YX3 A;  3S1R J;  2DMT A;  4D1Q A;  3BZC A;  2VOP A;  2DFF A;  3KZZ A;  3QQA A;  2KFD A;  1ODD A;  3JRI A;  2WTE A;  1ZTR A;  4Y3O A;  2HKX A;  5J4Y A;  4AUX A;  2L5Q A;  3MWM A;  1TT5 B;  3FXJ A;  2FBK A;  2GZW A;  4RDU A;  4GDF A;  3KP6 A;  3MVP A;  1RUO A;  2A69 F;  2FJ1 A;  2MAB A;  1EA3 A;  2VT3 A;  1HCR A;  5EDN A;  4G12 A;  4B1R A;  3A0B C;  3QPS A;  2R92 J;  3HM5 A;  5ICF A;  4CZC A;  4RGX A;  2WWY A;  3AG4 H;  4CCO A;  4EJV A;  2O6G E;  3S32 A;  3K2Z A;  1BIA A;  3HGY A;  1OYY A;  5CVR A;  3VPR A;  4HNT A;  2KRF A;  3MMY B;  4OIO F;  5JR3 A;  1NK3 P;  3ERM A;  2R5Z B;  5IY5 H;  2P7V B;  5E8G A;  4F3Q A;  1DGR M;  1XMA A;  3WGG A;  4BJ5 C;  1TWC J;  3AL0 C;  2L3D A;  1QHG A;  4HBL A;  3I59 A;  2H94 A;  4G7H F;  3I9V 2;  4LLG F;  2VKH A;  1ZG5 A;  2OTJ I;  1ZK8 A;  3SFI A;  2E1C A;  3GZ6 A;  1BI1 A;  5BNG A;  3C7J A;  1OYI A;  2CW7 A;  1ZH5 A;  1E0E A;  1X3U A;  2DLL A;  5FGM A;  2FNA A;  3COA C;  1WH7 A;  2JPB A;  3G4S I;  2CQ7 A;  2E60 A;  4V2G A;  3ZR8 X;  1MNM C;  1SD5 A;  5DCM B;  3WU0 A;  2GXG A;  5LGN A;  4EJU A;  2FA5 A;  1D0X A;  1U3E M;  1D8K A;  3H0G J;  1IXR C;  2QVO A;  3SXY A;  5EG0 A;  1I6X A;  5LHH A;  1JGS A;  4XQF A;  5EGO A;  1ZGW A;  4YRV A;  1SC7 A;  2KJB A;  1IN5 A;  5J4V A;  4U0V A;  3R60 A;  2O8K A;  4XKC A;  1U2W A;  2A5W A;  3FX3 A;  1HKS A;  2KL4 A;  3A0H C;  1JE8 A;  1Z77 A;  2HYG D;  3VOE A;  4Y7N J;  4GXO A;  4BHB A;  2L9R A;  3ZQH A;  2Z16 A;  5FRM A;  1OQY A;  3TKY A;  1RR7 A;  1Y1V J;  3VB2 A;  2KZV A;  3JAM Z;  3KET A;  4DOZ A;  2E34 A;  4M3E A;  4HAM A;  5AIP A;  1HW1 A;  2VXD A;  2O5R A;  3I71 A;  4NDL A;  3BG6 A;  3OYM A;  1Z9C A;  1P4A A;  1X4P A;  2YSR A;  4P96 A;  4LK0 F;  4N4O B;  1P7I A;  3CMA I;  3E6D A;  3T0Y A;  2OUM A;  4O3M A;  5K5O A;  3JTG A;  1R23 A;  2E35 A;  1JT0 A;  1ETV A;  2QCO A;  5JFR A;  4IKF A;  2DJN A;  1Y8R B;  4PZJ A;  3K70 D;  3ASO H;  1YJW I;  4L5J A;  4IHW A;  4FE7 A;  1XS9 A;  5FRO A;  2NRA C;  2KIF A;  5HS8 A;  5KHD A;  1KON A;  2H6B A;  4RM2 A;  2L2O A;  4CSW A;  4IJA A;  3OYD A;  2X6X A;  2AXT C;  4HDV A;  1BI0 A;  3CC7 I;  1BI3 A;  4P9F A;  3ECH A;  3SHF A;  1MSE C;  1RNL A;  3ZGK A;  5J40 A;  4BKX A;  2ZBK A;  1IGN A;  5L3F A;  1P6R A;  2G7U A;  2HEO A;  3RPU D;  3TW7 A;  3TMO A;  4DZP A;  3GME A;  4GO1 A;  3LFU A;  1NG6 A;  3DBL B;  1FYM A;  3WG7 H;  1S29 A;  4FIS A;  4MTD A;  3K4M A;  3HYI A;  3MZH A;  2ZJ2 A;  1G4D A;  3O8G A;  1WJC A;  3DTI A;  2LRE A;  3QAH A;  5DTD A;  5LLQ A;  3PL8 A;  5E3O A;  1MGT A;  2FMY A;  1K6Y A;  2KKO A;  3M1E A;  4L5I A;  2FML A;  4IOC F;  4Q5S F;  2F6C A;  5BOX A;  2YX4 A;  1KGS A;  2X1E A;  2FU4 A;  1WFX A;  3AG1 H;  2ACJ A;  3GBG A;  1T8I A;  2IBD A;  3RJP A;  4PJJ A;  3W6K B;  1QVU A;  4I99 C;  1DU6 A;  2PX9 A;  2HQ5 A;  1X4O A;  2Q8K A;  1NHA A;  3HBL A;  1X58 A;  4XMY A;  4EMS A;  3K1M A;  4YEL A;  3AG2 H;  3F8C A;  1REP C;  3GLX A;  3F21 A;  1VZ0 A;  2H27 A;  3R0J A;  1R9T J;  3OIQ A;  2V79 A;  2W57 A;  2EIK H;  3TDU C;  2MFZ A;  4YIF A;  3I59 B;  5H6Q A;  3PM1 A;  2WY7 Q;  3MKW B;  3QU3 A;  2L02 A;  2XAQ A;  1FNN A;  4II2 A;  5ILV A;  1T95 A;  2C6Y A;  1IG7 A;  1ACI A;  2BW3 A;  2K4B A;  4U0W A;  5IP7 J;  3F8B A;  3MZ8 A;  3ZCO A;  1BR4 A;  1TWG J;  2LNB A;  2VKV A;  3RIR A;  4EM1 A;  4A3L J;  3QYF A;  3WTY C;  1YO5 C;  1RES A;  2EA4 A;  2V26 A;  1LFB A; 
#chains in the Genus database with same CATH homology
 2HOE A;  2UXN A;  1U78 A;  3HRT A;  2PLY A;  2W25 A;  4MEX F;  1BIB A;  4A5N A;  3ZN1 A;  3QU6 A;  3EYI A;  3R4K A;  1AWC A;  2IW5 A;  2PG4 A;  5D5V B;  3P9K A;  2L4A A;  4LMY A;  2KIU A;  1XMK A;  1MZB A;  1UST A;  2BE5 F;  4ESB A;  4A0Y A;  4AWX B;  4O5V A;  4XSZ F;  1QBJ A;  3WE2 A;  3RI4 A;  1U8R A;  1P4W A;  5E1X A;  3LST A;  2HTS A;  3KLO A;  4A2U A;  3ZMZ A;  1OMI A;  5E8I A;  3E97 A;  2RDP A;  4G94 A;  3WTV C;  1U5T C;  2PEX A;  4BNC A;  1XN7 A;  3IRR A;  2RGV A;  4UVA A;  3RPU A;  3RYR A;  1IRG A;  1ZGJ A;  3JW4 A;  1QZZ A;  2XIG A;  1I1G A;  1Z1D A;  1K78 A;  4HOB A;  2ZCW A;  1BBY A;  3WTT C;  1SAX A;  1ONV A;  3JAM K;  1HW5 A;  3ABU A;  3E3V A;  4HLY A;  3I64 A;  3E5Q A;  2VOO A;  3ZPL A;  3I5U A;  4EJT A;  1O3Q A;  1KQ9 A;  3FZV A;  3KEQ A;  1C0W A;  1MDM A;  1T2K A;  4I01 A;  4OIR F;  2QWW A;  1XD7 A;  3IHU A;  4E70 A;  4ETS A;  4FX4 A;  1KQ8 A;  1W7P D;  1WI9 A;  3FXR A;  3F22 A;  4I7H A;  3FM5 A;  4L0Y B;  2FE3 A;  1V3F A;  1MKM A;  2V1X A;  2UXX A;  3R0A A;  2BBY A;  1DPU A;  3HRM A;  3DKW A;  3WTX C;  2M30 A;  5L3B A;  4MNU A;  2TDX A;  3DF8 A;  2BYV E;  3WU1 B;  1HSJ A;  3NQO A;  4RB3 C;  5KK1 A;  1XCV A;  1V4R A;  5F1R A;  3BRO A;  1DDN A;  2D1V A;  3U1D A;  3T5X A;  4G9Y A;  2CSO A;  2JZY A;  3ZP5 A;  1Z6R A;  2Z99 A;  4OOI A;  2ZKZ A;  5D5U B;  3JTH A;  1TQM A;  1IF1 A;  2M1B A;  1L3L A;  2Y0M A;  1XCB A;  2XAS A;  3K69 A;  3SQN A;  1ZAR A;  1G3Y A;  2AS5 F;  3L7W A;  2PJP A;  1GXQ A;  2PBI A;  3CTA A;  4EM2 A;  1MJA A;  4I0A A;  4ZYG A;  4MQ9 F;  1FSH A;  3MZY A;  2VBX A;  1XSV A;  4BXU A;  2FQ3 A;  5ICG A;  2A5Y B;  4OMY A;  1K78 B;  5LGT A;  2MLG A;  4L9T A;  2YX7 A;  4RS8 A;  1QNT A;  2LDU A;  1RI7 A;  2B0L A;  3TOA A;  2NNN A;  2GA1 A;  5E1Z B;  2R3S A;  2O8X A;  3DEU A;  4KMU X;  3WTU C;  3FMS A;  2VOD A;  3ZMU A;  3ZMS A;  4L0Z B;  1BI2 A;  3DPT A;  4CO8 A;  2DQR A;  4HQM A;  1O7F A;  3LFK A;  1LDD A;  4HX4 A;  2EFP A;  5D4S A;  2RC4 A;  3IKT A;  5L3E A;  3RKY A;  1MDM B;  3RPQ A;  1W7P A;  3ZMD A;  4M71 A;  4IHS A;  3L2C A;  1T39 A;  5KVR A;  2OAZ A;  4GYI A;  1K79 A;  4JQF A;  3GW2 A;  3REO A;  4A12 A;  3VEP A;  5E20 A;  5LEJ A;  4DQ2 A;  1R36 A;  3IWF A;  1FT9 A;  3KZY A;  5LHG A;  2V1D A;  3ISP A;  2J5O A;  3ZMV A;  3T8T A;  1USS A;  1DP7 P;  2EWN A;  2WV0 A;  1GXP A;  5CJ9 A;  2DI3 A;  4ENJ A;  1YS7 A;  4HV5 A;  3QP5 A;  4G6D A;  1R1T A;  1KYW A;  3FXQ A;  1SFE A;  4KFC A;  3PFI A;  1OYW A;  1HKQ A;  4KMF A;  4YFK F;  5EEH A;  3GYH X;  4WX9 A;  4HF2 A;  1IRF A;  2HWV A;  5E1W A;  3W6J B;  4P9U A;  2JPC A;  5J8C A;  1LDK B;  2HQN A;  3WOD F;  3TQN A;  2Z33 A;  4M9Z A;  2H09 A;  3FWE A;  3QRF F;  3GEZ A;  3BPV A;  3E6C C;  2HYF A;  4RB2 C;  1JXS A;  4UV9 A;  3H92 A;  1UHM A;  3GFM A;  4Y15 A;  5DYM A;  3GVA A;  1KA8 A;  2XAF A;  3I58 A;  2VXZ A;  3TO9 A;  3P7N A;  2P6S A;  3L9F A;  4ZH4 F;  3KCC A;  1DUX C;  1UCR A;  1ZN2 A;  1EH6 A;  2VBW A;  2FOK A;  5K5R A;  3KP7 A;  3ABT A;  1IXC A;  3BJ6 A;  1R00 A;  3TGN A;  4LGW A;  3ROU A;  1WRJ A;  1FY7 A;  3GO5 A;  4UV8 A;  4PDK A;  1D8J A;  1T38 A;  2P5K A;  2V6C A;  3D0S A;  1HKT A;  1W7P B;  5E18 F;  2K7L A;  3TDZ C;  1FPQ A;  4CYD A;  1TW3 A;  1SD7 A;  2DPU A;  3RTR A;  2YU3 A;  4BHP A;  4IVN A;  3VOD A;  4GGG A;  1SMY F;  3M9A A;  4ENK A;  4G7Z F;  4GCV A;  2LF8 A;  5BMZ A;  1QGP A;  1YW9 A;  3R61 A;  3DPL C;  2YR2 A;  5CLS A;  3I4P A;  2A68 F;  3M8E A;  4A0Z A;  2F5D A;  1ON2 A;  2F5C A;  4JBA A;  4ENN A;  1LEA A;  1BJA A;  4M73 A;  2JTV A;  1YTY A;  1F5T A;  2RKH A;  4A5M A;  2BEO A;  3SZT A;  5FLX Z;  1YS6 A;  2CG4 A;  2Y48 A;  4XLP F;  5H6R A;  2G7H A;  3M7G A;  1W5S A;  3HUG A;  3V4G A;  4R8H A;  4OIP F;  3HRU A;  4WCG A;  3EQL F;  4LLL A;  4B8X A;  3EYY A;  4OMZ A;  1WWX A;  2QEN A;  5D8K B;  3P9C A;  3HOT A;  2ISY A;  3BP8 A;  4Z2Y A;  2K4J A;  4IHT A;  3TO6 A;  5CVV A;  3J81 Z;  2LSO A;  4HW0 A;  3ULQ B;  3R6S A;  1WSU A;  2XRN A;  4O6J A;  1CF7 A;  2ELH A;  5BQT A;  5ICC A;  1T98 A;  3JSO A;  5DUK A;  4RAZ A;  3VFZ A;  3BOQ A;  4IF4 A;  1XSD A;  4WXD A;  3GX4 X;  1MJB A;  5D5X B;  3E6B A;  3FMQ A;  3K0L A;  3WG9 A;  4BHC A;  1J2X A;  2A61 A;  2DT5 A;  4K2E A;  4MEY F;  4TV7 A;  1PUE E;  4A0X A;  4I0B A;  4CZZ A;  2DU9 A;  3LAJ A;  3KP2 A;  4D0P A;  4MTE A;  2DW4 A;  3I54 A;  1RUN A;  3BDD A;  3IKV A;  4HLX A;  4EM0 B;  4L9V A;  1EH7 A;  2O0Y A;  3HOS A;  2GIV A;  5HS9 A;  5FFZ A;  5HLI A;  1AOY A;  1CGP A;  2RQP A;  4NB5 A;  4YII A;  3WGI A;  1OR7 A;  2OBP A;  4LG0 A;  1KU7 A;  2XHK A;  4UVC A;  4ON0 A;  4HF0 A;  2WC2 A;  2OQG A;  2JRT A;  1FBU A;  3G3Z A;  4OIN F;  3GFI A;  2MA3 A;  3ELK A;  3H3U A;  3NRV A;  4M6X A;  2QBY A;  4KN4 X;  5FB2 A;  3QP6 A;  2EFO A;  4EVI A;  3GZ5 A;  3V8L A;  3KP4 A;  4N0B A;  3WTZ A;  1IN8 A;  2EK5 A;  4PGG A;  1QO0 D;  3GWZ A;  1F1Z A;  2VC1 A;  3F72 A;  3GFJ A;  2H6C A;  2IPQ X;  2VBZ A;  1FP1 D;  3I53 A;  4LD5 A;  4R79 A;  1FBQ A;  1D3Y A;  1JHF A;  3F6O A;  2EV0 A;  4LJZ F;  3L09 A;  1HXD A;  1PDN C;  3CJN A;  1S7O A;  2EFQ A;  4HQE A;  1CF7 B;  1UB9 A;  3BWG A;  2HFH A;  2STW A;  4ZYD A;  2XAG A;  2EA2 A;  1BOA A;  5IT9 Z;  1IXS B;  2P6T A;  3GF2 A;  2GQQ A;  1P4X A;  1EV7 A;  1TNT A;  2M8E A;  5AIQ A;  3DFG A;  5AON A;  1B4A A;  1O3R A;  5HVQ C;  4KA4 A;  1FOK A;  5D8L B;  5FLX K;  4WK8 F;  1F4K A;  4G7O F;  1TBX A;  1SFX A;  2PN6 A;  1P2F A;  1T0F A;  3CO6 C;  2E7X A;  3F23 A;  2E1N A;  1YW7 A;  2BGC A;  2XUB A;  2G9W A;  5LBQ A;  4KIG A;  2OD5 A;  1VTN C;  3D5L A;  1W5T A;  2MC3 A;  2Z9O A;  1H0M A;  3TOB A;  4P5O A;  5ED4 A;  3J81 K;  1Q1H A;  4LG0 B;  1IW7 F;  2K27 A;  2P5L C;  1J7K A;  1S8N A;  4L9N A;  3DQV C;  4ASN A;  4GYG A;  1E2X A;  3IRQ A;  3H3Z A;  5JVT A;  1ON1 A;  2ZXJ A;  5L3G A;  2DK5 A;  2QBY B;  1YIO A;  3IWZ A;  2VC0 A;  2DPD A;  1ZGA A;  3V7S A;  4M6Y A;  2ETH A;  5LRS A;  4ENM A;  4HX8 A;  3HSF A;  1H9G A;  3EET A;  5IT3 A;  3MEX A;  1L0O C;  2IRF G;  1TQI A;  1G3T A;  1KU3 A;  2XRO A;  1DPR A;  4OU0 A;  3KLN A;  5D5W B;  2NS0 A;  3TO7 A;  1PP7 U;  5DD4 A;  4IRG A;  1R22 A;  1B59 A;  3J80 Z;  1Z7U A;  1YLF A;  1O7L A;  5BS6 A;  1RZ4 A;  2GAU A;  6PAX A;  3JSP A;  4JK1 X;  5DV5 A;  2GA2 A;  5K1Y A;  4ZZD A;  3RKW A;  1KYZ A;  4RGU A;  3PQJ A;  1B9N A;  2HGC A;  4KIC A;  4CIC A;  3O3K A;  3E5U A;  2UWM A;  3LQR A;  4AIK A;  3P9I A;  2F2E A;  5TJJ A;  1J59 A;  1XDU A;  2IVM A;  4KN7 X;  1ZRF A;  2P4W A;  3Q5F A;  4YFN F;  3K1N A;  4U0Y A;  1OKR A;  3FM3 A;  2ZNZ A;  5LRR A;  2XAJ A;  5DDG A;  2M5W A;  2NAZ A;  1LVA A;  5CVJ A;  3ZN0 A;  2QM3 A;  1SMT A;  1ZRC A;  1FLI A;  4U88 A;  2RV8 A;  3RYP A;  1ZLK A;  2QUF A;  2X0L A;  3K9T A;  2EJR A;  4PCQ A;  5J6X A;  5D6E A;  1D5V A;  2V1U A;  1LDJ A;  4AVP A;  4EV0 A;  1BC8 C;  1SD4 A;  4ZYE A;  4S04 A;  4CGZ A;  1JHH A;  2VN2 A;  3NEU A;  1R5H A;  1XGS A;  4XSX F;  3V8J A;  5IT9 K;  1FX7 A;  1KU2 A;  2STT A;  4IRH A;  1G6N A;  2F5F A;  4ZYH A;  1R1U A;  3QPT A;  1T6S A;  2L54 A;  4FHT A;  4ESJ A;  4Q4Z F;  4Y17 A;  3V7R A;  1LQ1 A;  3K1P A;  1R58 A;  5BPI A;  3OV8 A;  1J5Y A;  3HIF A;  2AXL A;  3T8R A;  5CVU A;  5LEK A;  4XBF A;  4RAY A;  3F3X A;  5HDG A;  5ILS A;  3HRS A;  4RB0 A;  1S7A A;  3FXU A;  5DD8 A;  4Q48 A;  2QZ8 A;  1S3J A;  2RNJ A;  1IAW A;  4I98 B;  3MFK A;  4UHT A;  4LB5 A;  5HDK A;  3V7C A;  4S05 A;  4G8X A;  5A2Q Z;  4I09 A;  4F7Z A;  3LA2 A;  1TQP A;  1G3S A;  3EDP A;  1S6L A;  1Z6T A;  2O3F A;  4EGZ A;  2VE8 A;  3HHG A;  3HTU A;  4BAY A;  5H20 A;  1FWZ A;  1TW2 A;  5DEQ A;  1I5Z A;  1LEB A;  4QWQ A;  1K6O A;  5K5Q A;  1F9N A;  3PQK A;  1I1S A;  1OPC A;  4BH9 A;  1O57 A;  1WQ2 A;  2P7C B;  3L00 A;  3FMR A;  3J80 K;  1ZG1 A;  3C3W A;  1MD0 A;  2F5E A;  4YFX F;  4R1H A;  1TLH B;  3IC7 A;  2Y75 A;  4M72 A;  2JT1 A;  2HR3 A;  1PP8 F;  5BPD A;  3Q9S A;  1B1B A;  4H0E A;  2VBY A;  5JHU A;  4AD9 A;  3CUQ A;  3WTW C;  4FX0 A;  3DXJ F;  4ZZL A;  2HKO A;  4MHG A;  1I27 A;  3U2R A;  3GUD A;  4EJW A;  2EV5 A;  2OZU A;  4CHU A;  2D45 A;  2A6E F;  2RN7 A;  2VT2 A;  3BJA A;  3BPX A;  1HBX G;  1FBS A;  1ZHF A;  3SFZ A;  3CUO A;  5F6F A;  5HS7 A;  4I02 A;  3M8F A;  2FXA A;  3SZP A;  4AIJ A;  4KDP A;  3LAP A;  4Y13 A;  1B9M A;  1W4M A;  2CO5 A;  1FYL A;  2XKO A;  4AIH A;  3J7A O;  3WE3 A;  2XKP A;  1KU9 A;  1UFM A;  5CVI A;  3RKX A;  3ECO A;  2J5P A;  2JSC A;  3KEO A;  1ZRD A;  4G6Q A;  1LB2 A;  4IRI A;  4M9S A;  2CFX A;  5CYV A;  1J0R A;  3F6V A;  3Q9V A;  5JI6 A;  4FT8 A;  4EJO A;  2FBI A;  2ZNY A;  4UXN A;  4ESF A;  1QPM A;  2L01 A;  1XGM A;  4XLN F;  2CQK A;  4LB6 B;  4LLN A;  2ISZ A;  2Q0O A;  3LQQ A;  3WTS C;  3CO7 C;  2EV6 A;  4WXC A;  1RIO H;  3T1B A;  3EUH A;  3LWF A;  2LF7 A;  2YPR A;  2PMU A;  4M74 A;  2CGP A;  3FHZ A;  2KIM A;  1ULY A;  1HST A;  2OQR A;  2FSW A;  4UNO A;  1BN5 A;  3E6M A;  4U7B A;  4YG2 F;  3C18 A;  1B6A A;  1MJ9 A;  2IJL A;  3CUQ B;  3KE2 A;  1J9I A;  3ERE D;  5HOO A;  4HDU A;  1UHW A;  5A2Q K;  3HSR A;  2MLK A;  3I0T A;  2W24 A;  1Z91 A;  2FRH A;  3ML6 A;  5ERI A;  4BQA A;  4LK1 F;  1FP2 A;  5DCF A;  3IL2 A;  1BC7 C;  3MCZ A;  3DV8 A;  3F8M A;  2IT0 A;  2M45 A;  2Q2E A;  3F8N A;  4A6E A;  1STZ A;  2GXB A;  2OU2 A;  1EH8 A;  3O6B B;  2R7F A;  2ADU A;  3GXO A;  3O2P E;  5L3C A;  1IUY A;  2XVC A;  5HLH A;  2CYY A;  2CWE A;  4HA8 A;  4CXF A;  1FC3 A;  1ZAO A;  3HHH A;  2DTR A;  5HDN A;  2QQ9 A;  5LHI A;  2LKP A;  5E17 F;  1FSE A;  2P5V A;  3FF5 A;  1YW8 A;  4KNY A;  1HW2 A;  2IA1 A;  2ZO4 A;  1P92 A;  4HZF A;  4Q47 A;  1GHC A;  1LNW A;  4HF1 A;  2W85 A;  4RGR A;  2DBB A;  1YFH A;  3F8F A;  2OA4 A;  4NQW A;  2DO7 A;  1TNS A;  2UZK A;  2D2W A;  4KIB A;  3ZQ7 A;  1R1V A;  3WGH A;  4UVB A;  3HSE A;  3N4M A;  4MQV A;  1R5G A;  2R7D A;  1QQI A;  1Y0U A;  5D4R A;  1H9T A;  2QYO A;  4KUM A;  2PQ8 A;  3C1D A;  4WF2 A;  4CDG A;  1QZY A;  2HZT A;  2HS5 A;  2D1H A;  2XAH A;  3CDH A;  5TRD A;  4EQQ A;  1IZ1 A;  5HLG A;  4MGR A;  2FF4 A;  5FD5 A;  1XGN A;  2OZ6 A;  2V9V A;  2GWR A;  2P8T A;  3BJO A;  3BZ6 A;  4BYY A;  2K02 A;  1ZYR F;  1TTY A;  2HDC A;  1ZLJ A;  1XGO A;  1K7A A;  1U5T A;  4NHJ A;  1O3T A;  3CLO A;  1E17 A;  2DFI A;  5ILU A;  1A04 A;  3V8K A;  4HX7 A;  4RGS A;  2EB7 A;  2IP2 A;  3AAF A;  3S2W A;  1O3S A;  2NYX A;  2MH9 A;  4B09 A;  5ICE A;  5LGU A;  1FYK A;  1U6G A;  2Z5U A;  3G73 A;  3N97 A;  2HTJ A;  1IN6 A;  1IN7 A;  4WWC A;  3B73 A;  2ESH A;  3GFL A;  2CW0 F;  4N9H A;  2XV4 S;  3RDI A;  2FBH A;  1YQA A;  4UUV A;  2DQL A;  4M9X A;  3MAJ A;  2XGX A;  2M87 A;  5FO5 A;  4P55 A;  2KJC A;  2ZME A;  2PFB A;  2O61 A;  2A3S A;  2PMH A;  2QQA A;  4LFU A;  1ZRE A;  4OIQ F;  5J8F A;  2HQR A;  4U7D A;  3U9G A;  4PGH A;  1SFU A;  3KP3 A;  1SD6 A;  2MH2 A;  2QQB A;  1G3W A;  2IA0 A;  1YYV A;  5DUI A;  2IA2 A;  4DNC A;  4QLC U;  3KFW X;  4KT5 C;  2DAO A;  2RVC A;  2E7W A;  2A6H F;  5D6F A;  4I2O A;  3BY6 A;  1GVJ A;  2BV6 A;  1WKM A;  4WXH A;  2COM A;  4L9J A;  2FNP A;  2MD5 A;  3B02 A;  5DCM A;  1FZP B;  1YG2 A;  2MBF A;  1R7J A;  3OOP A;  2EFN A;  2Z3Y A;  1U5T B;  4XRF A;  4IXA A;  2ESN A;  3HTS B;  2VON A;  1ZG3 A;  2ZFW A;  1BM9 A;  4EGY A;  2PI0 A;  1HQC A;  4L18 B;  4KIF A;  2O03 A;  5FD6 A;  4HV6 A;  2DK8 A;  1Z05 A;  4A6D A;  2VE9 A;  1XDS A;  3CUQ C;  2L4M A;  2FEZ A;  5FFX A;  1KQ0 A;  5F64 A;  3MQ0 A;  3LA7 A;  2NNY A;  1XSX A;  3E5X A;  3KP5 A;  2EFW A;  3QPH A;  5L3D A;  4KYW A;  1LJ9 A;  1IN4 A;  3DP7 A;  3LA3 A;  4RB1 A;  4HYE A;  5EEG A;  3QOP A;  1XB4 A;  2ZME B;  2X4H A;  2QLZ A;  2W84 A;  4IPA A;  1J75 A;  3ZMT A;  4N9I A;  2K86 A;  2A07 F;  2VOP A;  3KZZ A;  1ODD A;  2WTE A;  2HKX A;  3MWM A;  2FBK A;  2GZW A;  3KP6 A;  1RUO A;  2A69 F;  2VT3 A;  5ICF A;  4RGX A;  2WWY A;  4EJV A;  2O6G E;  3K2Z A;  1BIA A;  5CVR A;  1OYY A;  2KRF A;  4OIO F;  5JR3 A;  2P7V B;  5E8G A;  1XMA A;  3WGG A;  2L3D A;  4HBL A;  3I59 A;  4G7H F;  2H94 A;  4LLG F;  1ZG5 A;  2E1C A;  3GZ6 A;  1BI1 A;  3C7J A;  1OYI A;  1ZH5 A;  1X3U A;  2DLL A;  5FGM A;  2FNA A;  3COA C;  2JPB A;  1SD5 A;  5DCM B;  3WU0 A;  2GXG A;  5LGN A;  4EJU A;  2FA5 A;  1U3E M;  1D8K A;  1IXR C;  2QVO A;  3SXY A;  1I6X A;  5LHH A;  1JGS A;  2KJB A;  1IN5 A;  4U0V A;  3R60 A;  1U2W A;  3FX3 A;  1HKS A;  1JE8 A;  2HYG D;  3VOE A;  4GXO A;  4BHB A;  3TKY A;  3VB2 A;  3JAM Z;  3KET A;  4HAM A;  5AIP A;  1HW1 A;  3I71 A;  1Z9C A;  1P4A A;  4P96 A;  2YSR A;  4LK0 F;  3E6D A;  3T0Y A;  4O3M A;  5K5O A;  3JTG A;  1R23 A;  5JFR A;  4PZJ A;  4L5J A;  2NRA C;  2KIF A;  5HS8 A;  2H6B A;  4IJA A;  4HDV A;  1BI0 A;  1BI3 A;  4P9F A;  3ECH A;  3SHF A;  1RNL A;  2ZBK A;  5L3F A;  1P6R A;  2G7U A;  2HEO A;  4GO1 A;  1FYM A;  1S29 A;  4MTD A;  3HYI A;  3MZH A;  2ZJ2 A;  1G4D A;  3QAH A;  5LLQ A;  1MGT A;  2FMY A;  2KKO A;  3M1E A;  4L5I A;  2FML A;  4Q5S F;  5BOX A;  2YX4 A;  1KGS A;  2FU4 A;  2ACJ A;  3W6K B;  3RJP A;  2Q8K A;  1NHA A;  4EMS A;  3K1M A;  3F8C A;  1REP C;  3GLX A;  3F21 A;  2H27 A;  3R0J A;  2V79 A;  2W57 A;  3TDU C;  4YIF A;  3I59 B;  5H6Q A;  3QU3 A;  2L02 A;  2XAQ A;  1FNN A;  5ILV A;  2C6Y A;  2K4B A;  4U0W A;  3F8B A;  4EM1 A;  2LNB A;  3RIR A;  3WTY C;  1YO5 C;  2EA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...