4OUFA

Crystal structure of cbp bromodomain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
114
structure length
114
Chain Sequence
b'KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Binding of the histone chaperone ASF1 to the CBP bromodomain promotes histone acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4oufA00
4HXSA 1X0JA 4WHWA 3U5OA 5I83A 2GRCA 4KV1A 5F3AA 2DATA 4QSSA 4OGJA 4A9KA 5A83A 1E6IA 4HXPA 4IOOA 4YY6A 3MB4A 4E96A 5DFCA 5F1LA 4QZSA 5DYXA 4IR6A 5CFWA 5FH7A 5E0RA 3U5NA 5KTWA 5BT4A 5H85A 4RVRA 5ETDA 5D3NA 5A5OA 4O78A 5EVAA 3UW9A 5DFBA 3QZTA 5H1UA 4C67A 5KO4A 4O70A 3MULA 5D3LA 4AKNA 5FFYA 2MJVB 2L5EA 4QEWA 4QSXA 4OUFA 5ENFA 5F61A 3JVMA 4A9NA 3HMHA 5LJ2A 3U5JA 4FLPA 5EPSA 4YYMA 4NR8A 4YATA 2YEMA 3MUKA 5ACYA 3IU5A 4O7EA 4CUUA 5IBNA 5CU8A 5F2PA 3U5MA 5I89A 3QZSA 4CFLA 5EV9A 4YC9A 4CURA 5HENA 3HMFA 5FE2A 4YYHA 4NR4A 4HXRA 4LRGA 5IGNA 2L85A 3GG3A 5FE0A 5EWHA 5FH6A 2YEKA 4QYDA 3U5KA 4O7BA 5ENCA 4QEUA 5C7NA 5CQAA 5ENBA 5FFVA 3JVJA 4F3IA 4N4HA 3S92A 4NR6A 5I7XA 5HRWA 5CRMA 4YAXA 4TT4A 4TU6A 5I29A 1JSPB 4IORA 5D3TA 4QY4A 4BHWA 4XY9A 4CUQA 5CQ7A 3SVHA 4OGIA 4LZRA 4J3IA 4J1PA 5KHMA 5FE3A 5CQ8A 5H1VA 5JI8A 4HXMA 5CQTA 4QR5A 4MEPA 4MR6A 4IR5A 5CUBA 2E7OA 4PCIA 4UIYA 4Z93A 5F60A 3O37A 4PCEA 5CGPA 4A9JA 5EP7A 5CQ6A 5I88A 4QNSA 1ZS5A 5CUGA 4ALHA 2RO1A 5F62A 5FE7A 2G4AA 3MQMA 5L8TA 2LSPB 3NXBA 3G0LA 4PY6A 4LYIA 5FG6A 4TTEA 5C85A 4MENA 5FE9A 5AD2A 4QR3A 4Q0OA 5E9IA 4BJXA 2R10A 5D26A 4NS5A 3JVLA 5FE8A 4HXNA 4BW4A 5L8UA 4TZ2A 5A5QA 4QSPA 3UV4A 4IR3A 5D3RA 5LVRA 3JVKA 4XYAA 3LJWA 5AMEA 5E73A 5ENIA 3D7CA 5CPEA 5E9LA 3QZVA 4YYIA 4A9OA 5EWVA 4UITA 5E7DA 5FG5A 4KV4A 5HQ7A 2DVRA 5ETBA 4PKLA 5CQ4A 4N4FA 4NYVA 5FBXA 4PS5A 4O71A 4MR5A 4LR6A 4LYSA 4ALGA 5ENEA 3UV2A 4NRBA 4NXJA 4UYHA 2D82A 5HQ5A 4TU4A 5ENHA 4NYWA 5LVQA 4NR7A 4QC3A 5CQ3A 5DW2A 4TT2A 3ZYUA 5CUDA 4TZ8A 5DKHA 5HFRA 5E3GA 4QUTA 2F6NA 5A7CA 2OO1A 5ENGA 4UYDA 5CRZA 5LJ0A 5DKDA 5EGUA 5TB6A 5CZGA 4A9HA 5LKTA 4YK0A 4UIWA 4UYFB 5HELA 5EPBA 3SVFA 4Y03A 3UVYA 1N72A 5I1QA 5A5RA 4NYXA 4YABA 4C66A 5DKCA 4HBXA 3AADA 5HQ6A 4DONA 5C4QA 5KTUA 5F63A 3O33A 4NUCA 5CUAA 4O75A 5LKUA 5LUUA 2DKWA 5DYAA 5ENJA 5A5PA 5JWMA 4Z6IA 5HLSA 2R0VA 5G4SA 5D3JA 3LXJA 2DVSA 4NR5A 5DFDA 4A9IA 4QSWA 4QB3A 2YELA 4YBTA 2RNXA 4N3WA 4QSVA 4YYJA 5HM0A 5HFQA 5EWDA 2RFJA 4CLBA 2DVQA 4CUPA 5AMFA 5DY7A 2DVVA 5DX4A 3MB3A 4XY8A 3MXFA 5F25A 5D3PA 4YADA 5IGLA 3UVDA 3RCWA 4QSUA 5EICA 4QUUA 4XUBA 5DYCA 5K29A 4A9LA 4UIZA 4A9EA 4CUSA 4CUTA 4IOQA 4CL9A 5IG6A 2WP2A 5HRVA 1F68A 2E7NA 5BT3A 5L98A 2I8NA 5F36A 5IIDA 4O7CA 4IR4A 5LJ1A 5D3SA 5EPRA 5LKZA 4A9FA 3U5LA 4TS8A 4HBVA 4NUDA 3O34A 4HXLA 5EM3A 4LYWA 2RS9B 5EI4A 4O74A 3ONIA 5CY9A 3UV5A 5EK9A 5CUCA 5E9MA 5I86A 4Q0NA 3HMEA 5EWWA 5DYUA 2YQDA 5DLXA 5C87A 2OUOA 4LDFA 4WIVA 2I7KA 3O36A 2RI7A 4YYNA 5E9YA 5L99A 4NR9A 5D7XA 3G0JA 5J0DA 5L97A 3TLPA 2YYNA 4QSTA 2H60A 5II1A 2YW5A 4YYDA 4NQMA 5FB0A 5I80A 5CUEA 5TCMA 4MR4A 4MEQA 5BT5A 4A9MA 5E9KA 2D9EA 4KCXA 4YBMA 2RNYA 4ZW1A 4O77A 5L96A 4YY4A 4BW3A 4MR3A 3Q2EA 4LZSA 5C89A 4J0SA 3P1CA 5H1TA 4YYGA 5E74A 4Z6HA 4NRCA 5I7YA 3AQAA 5FG4A 2RNWA 5DW1A 5II2A 4N4GA 4TYLA 4QEVA 1WUMA 5I40A 2F6JA 5A85A 4O72A 4HBWA 3LQIA 5FFWA 5DLZA 4ZC9A 4UIUA 4PTBA 5A5NA 4UYFA 3P1EA 5G4RA 5FE4A 4NRAA 4HXKA 4J0RA 5CP5A 4TQNA 5FB1A 4Z1QA 2OSSA 5FDZA 2WP1A 5HRXA 4HBYA 3UVWA 1JM4B 2R0SA 2N9GA 4N4IA 4WHUA 3P1FA 5KU3A 5CTLA 5A82A 5LKXA 4BW1A 5FE5A 3IU6A 5D3HA 3S91A 4NQNA 4UIVA 5EISA 5AD3A 4X2IA 5D25A 4QSQA 4YYKA 3DAIA 5EU1A 3FKMX 5E3DA 3SVGA 5CS8A 5IGKA 4UYGA 5DBMA 4YBSA 4XUAA 5A81A 2L84A 4GPJA 4O7FA 3LQHA 1WUGA 5EWCA 3DWYA 5C8GA 4Z1SA 3O35A 5A5SA 3P5OA 5HJCA 4YH4A 4TT6A 5FE1A 2E3KA 4MEOA 5E9VA 4QSRA 5IGMA 5COIA 2YDWA 3UVXA 4QC1A 4LC2A 3I3JA 5HEMA 4HXOA 2NXBA 4O76A 5EQ1A 5KTXA 3U5PA 4QR4A 5F1HA 3LQJA 2KTBB 2R0YA 5D0CA 3Q2FA 3P1DA 5D24A 4LZ2A 4ZQLA 4O7AA 2FSAA 5F5ZA 5HCLA 4NUEA 4QYLA 5CQ5A 4BW2A 2DWWA 4UIXA 3K2JA 4CFKA 4QBMA 4YH3A 5EA1A 5FE6A 5FH8A 1EQFA 4UYEA
chains in the Genus database with same CATH superfamily
4HXSA 1X0JA 4WHWA 3U5OA 5I83A 2GRCA 4KV1A 5F3AA 2DATA 4QSSA 4OGJA 4A9KA 5A83A 1E6IA 4HXPA 4IOOA 4YY6A 4AKGA 3MB4A 4E96A 5DFCA 5F1LA 4QZSA 5DYXA 4IR6A 5CFWA 5FH7A 5E0RA 3U5NA 5KTWA 5BT4A 5H85A 4RVRA 5ETDA 5D3NA 5A5OA 4O78A 5EVAA 3UW9A 5DFBA 3QZTA 5H1UA 3D1BA 4C67A 5KO4A 4O70A 3MULA 5D3LA 4AKNA 5FFYA 2MJVB 2L5EA 4QEWA 4QSXA 4OUFA 5ENFA 5F61A 3JVMA 4A9NA 3HMHA 5LJ2A 3U5JA 4FLPA 5EPSA 4YYMA 4NR8A 4YATA 2YEMA 3MUKA 5ACYA 3IU5A 4AI6A 4O7EA 4CUUA 5IBNA 5CU8A 5F2PA 3U5MA 5I89A 3QZSA 4CFLA 5EV9A 4YC9A 4CURA 5HENA 3HMFA 5FE2A 4YYHA 4NR4A 4HXRA 4LRGA 5IGNA 2EJNA 2L85A 3GG3A 5FE0A 4AKIA 5EWHA 5FH6A 2YEKA 4QYDA 3U5KA 4O7BA 5ENCA 4QEUA 5C7NA 5CQAA 5ENBA 5FFVA 3JVJA 4F3IA 1ZKRA 4N4HA 3S92A 4NR6A 5I7XA 5HRWA 5CRMA 4YAXA 4TT4A 4TU6A 5I29A 1JSPB 4IORA 5D3TA 4QY4A 4BHWA 4XY9A 4CUQA 5CQ7A 3SVHA 4OGIA 4LZRA 4J3IA 4J1PA 5KHMA 5FE3A 5CQ8A 5H1VA 5JI8A 4HXMA 5CQTA 4QR5A 4MEPA 4MR6A 4IR5A 5CUBA 2E7OA 4PCIA 4UIYA 4Z93A 5F60A 3O37A 4PCEA 5CGPA 4A9JA 5EP7A 5CQ6A 5I88A 4QNSA 1ZS5A 5CUGA 4ALHA 2RO1A 5F62A 5FE7A 2G4AA 3MQMA 5L8TA 2LSPB 3NXBA 3G0LA 4PY6A 4LYIA 5FG6A 4TTEA 5C85A 4MENA 5FE9A 5AD2A 4QR3A 4Q0OA 5E9IA 4BJXA 2R10A 5D26A 4NS5A 3JVLA 5FE8A 4HXNA 4BW4A 5L8UA 4TZ2A 5A5QA 4QSPA 3UV4A 4IR3A 5D3RA 5LVRA 4AKHA 3JVKA 4XYAA 3LJWA 5AMEA 5E73A 5ENIA 3D7CA 5CPEA 5E9LA 3QZVA 4YYIA 4A9OA 5EWVA 4UITA 5E7DA 5FG5A 4KV4A 5HQ7A 2DVRA 5ETBA 4PKLA 1PUOA 5CQ4A 4N4FA 4NYVA 5FBXA 4PS5A 4O71A 4MR5A 4LR6A 4LYSA 4ALGA 5ENEA 3UV2A 4NRBA 4NXJA 4UYHA 2D82A 5HQ5A 4TU4A 5ENHA 4NYWA 5LVQA 4NR7A 4QC3A 5CQ3A 5DW2A 4TT2A 3ZYUA 5CUDA 4TZ8A 5DKHA 5HFRA 5E3GA 4QUTA 2F6NA 5A7CA 2OO1A 5ENGA 4UYDA 5CRZA 5LJ0A 5DKDA 5EGUA 5TB6A 5CZGA 4A9HA 5LKTA 4YK0A 4UIWA 4UYFB 5HELA 5EPBA 3SVFA 4Y03A 3UVYA 1N72A 5I1QA 5A5RA 4NYXA 4YABA 4C66A 5DKCA 4HBXA 3AADA 5HQ6A 4DONA 5C4QA 5KTUA 5F63A 3O33A 4NUCA 5CUAA 4O75A 5LKUA 5LUUA 2DKWA 5DYAA 5ENJA 5A5PA 5JWMA 4Z6IA 5HLSA 2R0VA 3ERRA 5D3JA 5G4SA 3LXJA 2DVSA 4NR5A 5DFDA 4A9IA 4QSWA 4QB3A 2YELA 4YBTA 2RNXA 4N3WA 4QSVA 4YYJA 5HM0A 5HFQA 5EWDA 2RFJA 4CLBA 2DVQA 4CUPA 5AMFA 5DY7A 2DVVA 5DX4A 3MB3A 4XY8A 3MXFA 5F25A 5D3PA 4YADA 5IGLA 3UVDA 3RCWA 4QSUA 5EICA 4QUUA 4XUBA 5DYCA 5K29A 4A9LA 4UIZA 4A9EA 4CUSA 4CUTA 4IOQA 4CL9A 5IG6A 2WP2A 5HRVA 1F68A 2E7NA 5BT3A 5L98A 2I8NA 5F36A 5IIDA 4O7CA 4IR4A 5LJ1A 5D3SA 5EPRA 5LKZA 4A9FA 3U5LA 4TS8A 4HBVA 4NUDA 3O34A 4HXLA 5EM3A 4LYWA 2RS9B 5EI4A 4O74A 3ONIA 5CY9A 3UV5A 5EK9A 3VKHA 5CUCA 5E9MA 5I86A 4Q0NA 3HMEA 5EWWA 5DYUA 2YQDA 5DLXA 5C87A 2OUOA 4LDFA 4WIVA 2I7KA 3O36A 2RI7A 4YYNA 5E9YA 5L99A 4NR9A 5D7XA 3G0JA 5J0DA 5L97A 3TLPA 2YYNA 4QSTA 2H60A 5II1A 2YW5A 4YYDA 4NQMA 5FB0A 5I80A 5CUEA 5TCMA 4MR4A 3D1DA 4MEQA 5BT5A 4A9MA 5E9KA 3VKGA 2D9EA 4KCXA 4YBMA 2RNYA 4ZW1A 4O77A 5L96A 4YY4A 4BW3A 4MR3A 3Q2EA 4LZSA 5C89A 4J0SA 3P1CA 5H1TA 4YYGA 5E74A 4Z6HA 4NRCA 5I7YA 3AQAA 5FG4A 2RNWA 5DW1A 5II2A 4N4GA 4TYLA 4QEVA 1WUMA 5I40A 2F6JA 5A85A 4O72A 4HBWA 3LQIA 5FFWA 5DLZA 4ZC9A 4UIUA 4PTBA 5A5NA 4UYFA 3P1EA 5G4RA 5FE4A 4NRAA 4HXKA 4J0RA 5CP5A 4TQNA 5FB1A 4Z1QA 2OSSA 5FDZA 2WP1A 5HRXA 4HBYA 3UVWA 1JM4B 2R0SA 2N9GA 4N4IA 4WHUA 3P1FA 5KU3A 5CTLA 5A82A 5LKXA 4BW1A 5FE5A 3IU6A 5D3HA 3S91A 4NQNA 4UIVA 5EISA 5AD3A 4X2IA 5D25A 4QSQA 4YYKA 3DAIA 5EU1A 3FKMX 5E3DA 3SVGA 5CS8A 5IGKA 4UYGA 5DBMA 4YBSA 4XUAA 5A81A 2L84A 4GPJA 4O7FA 3LQHA 1WUGA 5EWCA 3DWYA 5C8GA 4Z1SA 3O35A 5A5SA 3P5OA 5HJCA 4YH4A 4TT6A 5FE1A 2E3KA 4MEOA 5E9VA 4QSRA 5IGMA 5COIA 2YDWA 3UVXA 4QC1A 4LC2A 3I3JA 5HEMA 4HXOA 2NXBA 4O76A 5EQ1A 5KTXA 3U5PA 4QR4A 5F1HA 3LQJA 2KTBB 2R0YA 5D0CA 3Q2FA 3P1DA 5D24A 4LZ2A 4ZQLA 4O7AA 2FSAA 5F5ZA 5HCLA 4NUEA 4QYLA 5CQ5A 4BW2A 2DWWA 4UIXA 3K2JA 4CFKA 4QBMA 4YH3A 5EA1A 5FE6A 5FH8A 1EQFA 4UYEA
chains in the Genus database with same CATH topology
4HXSA 1X0JA 4WHWA 3U5OA 5I83A 2GRCA 4KV1A 5F3AA 2DATA 4QSSA 4OGJA 4A9KA 5A83A 1E6IA 4HXPA 4IOOA 4YY6A 3MB4A 4E96A 5DFCA 5F1LA 4QZSA 5DYXA 4IR6A 5CFWA 5FH7A 5E0RA 3U5NA 5KTWA 5BT4A 5H85A 4RVRA 5ETDA 5D3NA 5A5OA 4O78A 5EVAA 3UW9A 5DFBA 3QZTA 5H1UA 4C67A 5KO4A 4O70A 3MULA 5D3LA 4AKNA 5FFYA 2MJVB 2L5EA 4QEWA 4QSXA 4OUFA 5ENFA 5F61A 3JVMA 4A9NA 3HMHA 5LJ2A 3U5JA 4FLPA 5EPSA 4YYMA 4NR8A 4YATA 2YEMA 3MUKA 5ACYA 3IU5A 4O7EA 4CUUA 5IBNA 5CU8A 5F2PA 3U5MA 5I89A 3QZSA 4CFLA 5EV9A 4YC9A 4CURA 5HENA 3HMFA 5FE2A 4YYHA 4NR4A 4HXRA 4LRGA 5IGNA 2L85A 3GG3A 5FE0A 5EWHA 5FH6A 2YEKA 4QYDA 3U5KA 4O7BA 5ENCA 4QEUA 5C7NA 5CQAA 5ENBA 5FFVA 3JVJA 4F3IA 4N4HA 3S92A 4NR6A 5I7XA 5HRWA 5CRMA 4YAXA 4TT4A 4TU6A 5I29A 1JSPB 4IORA 5D3TA 4QY4A 4BHWA 4XY9A 4CUQA 5CQ7A 3SVHA 4OGIA 4LZRA 4J3IA 4J1PA 5KHMA 5FE3A 5CQ8A 5H1VA 5JI8A 4HXMA 5CQTA 4QR5A 4MEPA 4MR6A 4IR5A 5CUBA 2E7OA 4PCIA 4UIYA 4Z93A 5F60A 3O37A 4PCEA 5CGPA 4A9JA 5EP7A 5CQ6A 5I88A 4QNSA 1ZS5A 5CUGA 4ALHA 2RO1A 5F62A 5FE7A 2G4AA 3MQMA 5L8TA 2LSPB 3NXBA 3G0LA 4PY6A 4LYIA 5FG6A 4TTEA 5C85A 4MENA 5FE9A 5AD2A 4QR3A 4Q0OA 5E9IA 4BJXA 2R10A 5D26A 4NS5A 3JVLA 5FE8A 4HXNA 4BW4A 5L8UA 4TZ2A 5A5QA 4QSPA 3UV4A 4IR3A 5D3RA 5LVRA 3JVKA 4XYAA 3LJWA 5AMEA 5E73A 5ENIA 3D7CA 5CPEA 5E9LA 3QZVA 4YYIA 4A9OA 5EWVA 4UITA 5E7DA 5FG5A 4KV4A 5HQ7A 2DVRA 5ETBA 4PKLA 5CQ4A 4N4FA 4NYVA 5FBXA 4PS5A 4O71A 4MR5A 4LR6A 4LYSA 4ALGA 5ENEA 3UV2A 4NRBA 4NXJA 4UYHA 2D82A 5HQ5A 4TU4A 5ENHA 4NYWA 5LVQA 4NR7A 4QC3A 5CQ3A 5DW2A 4TT2A 3ZYUA 5CUDA 4TZ8A 5DKHA 5HFRA 5E3GA 4QUTA 2F6NA 5A7CA 2OO1A 5ENGA 4UYDA 5CRZA 5LJ0A 5DKDA 5EGUA 5TB6A 5CZGA 4A9HA 5LKTA 4YK0A 4UIWA 4UYFB 5HELA 5EPBA 3SVFA 4Y03A 3UVYA 1N72A 5I1QA 5A5RA 4NYXA 4YABA 4C66A 5DKCA 4HBXA 3AADA 5HQ6A 4DONA 5C4QA 5KTUA 5F63A 3O33A 4NUCA 5CUAA 4O75A 5LKUA 5LUUA 2DKWA 5DYAA 5ENJA 5A5PA 5JWMA 4Z6IA 5HLSA 2R0VA 5G4SA 5D3JA 3LXJA 2DVSA 4NR5A 5DFDA 4A9IA 4QSWA 4QB3A 2YELA 4YBTA 2RNXA 4N3WA 4QSVA 4YYJA 5HM0A 5HFQA 5EWDA 2RFJA 4CLBA 2DVQA 4CUPA 5AMFA 5DY7A 2DVVA 5DX4A 3MB3A 4XY8A 3MXFA 5F25A 5D3PA 4YADA 5IGLA 3UVDA 3RCWA 4QSUA 5EICA 4QUUA 4XUBA 5DYCA 5K29A 4A9LA 4UIZA 4A9EA 4CUSA 4CUTA 4IOQA 4CL9A 5IG6A 2WP2A 5HRVA 1F68A 2E7NA 5BT3A 5L98A 2I8NA 5F36A 5IIDA 4O7CA 4IR4A 5LJ1A 5D3SA 5EPRA 5LKZA 4A9FA 3U5LA 4TS8A 4HBVA 4NUDA 3O34A 4HXLA 5EM3A 4LYWA 2RS9B 5EI4A 4O74A 3ONIA 5CY9A 3UV5A 5EK9A 5CUCA 5E9MA 5I86A 4Q0NA 3HMEA 5EWWA 5DYUA 2YQDA 5DLXA 5C87A 2OUOA 4LDFA 4WIVA 2I7KA 3O36A 2RI7A 4YYNA 5E9YA 5L99A 4NR9A 5D7XA 3G0JA 5J0DA 5L97A 3TLPA 2YYNA 4QSTA 2H60A 5II1A 2YW5A 4YYDA 4NQMA 5FB0A 5I80A 5CUEA 5TCMA 4MR4A 4MEQA 5BT5A 4A9MA 5E9KA 2D9EA 4KCXA 4YBMA 2RNYA 4ZW1A 4O77A 5L96A 4YY4A 4BW3A 4MR3A 3Q2EA 4LZSA 5C89A 4J0SA 3P1CA 5H1TA 4YYGA 5E74A 4Z6HA 4NRCA 5I7YA 3AQAA 5FG4A 2RNWA 5DW1A 5II2A 4N4GA 4TYLA 4QEVA 1WUMA 5I40A 2F6JA 5A85A 4O72A 4HBWA 3LQIA 5FFWA 5DLZA 4ZC9A 4UIUA 4PTBA 5A5NA 4UYFA 3P1EA 5G4RA 5FE4A 4NRAA 4HXKA 4J0RA 5CP5A 4TQNA 5FB1A 4Z1QA 2OSSA 5FDZA 2WP1A 5HRXA 4HBYA 3UVWA 1JM4B 2R0SA 2N9GA 4N4IA 4WHUA 3P1FA 5KU3A 5CTLA 5A82A 5LKXA 4BW1A 5FE5A 3IU6A 5D3HA 3S91A 4NQNA 4UIVA 5EISA 5AD3A 4X2IA 5D25A 4QSQA 4YYKA 3DAIA 5EU1A 3FKMX 5E3DA 3SVGA 5CS8A 5IGKA 4UYGA 5DBMA 4YBSA 4XUAA 5A81A 2L84A 4GPJA 4O7FA 3LQHA 1WUGA 5EWCA 3DWYA 5C8GA 4Z1SA 3O35A 5A5SA 3P5OA 5HJCA 4YH4A 4TT6A 5FE1A 2E3KA 4MEOA 5E9VA 4QSRA 5IGMA 5COIA 2YDWA 3UVXA 4QC1A 4LC2A 3I3JA 5HEMA 4HXOA 2NXBA 4O76A 5EQ1A 5KTXA 3U5PA 4QR4A 5F1HA 3LQJA 2KTBB 2R0YA 5D0CA 3Q2FA 3P1DA 5D24A 4LZ2A 4ZQLA 4O7AA 2FSAA 5F5ZA 5HCLA 4NUEA 4QYLA 5CQ5A 4BW2A 2DWWA 4UIXA 3K2JA 4CFKA 4QBMA 4YH3A 5EA1A 5FE6A 5FH8A 1EQFA 4UYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXS A;  1X0J A;  4WHW A;  3U5O A;  5I83 A;  2GRC A;  4KV1 A;  5F3A A;  2DAT A;  4QSS A;  4OGJ A;  4A9K A;  5A83 A;  1E6I A;  4HXP A;  4IOO A;  4YY6 A;  3MB4 A;  4E96 A;  5DFC A;  5F1L A;  4QZS A;  5DYX A;  4IR6 A;  5CFW A;  5FH7 A;  5E0R A;  3U5N A;  5KTW A;  5BT4 A;  5H85 A;  4RVR A;  5ETD A;  5D3N A;  5A5O A;  4O78 A;  5EVA A;  3UW9 A;  5DFB A;  3QZT A;  5H1U A;  4C67 A;  5KO4 A;  4O70 A;  3MUL A;  5D3L A;  4AKN A;  5FFY A;  2MJV B;  2L5E A;  4QEW A;  4QSX A;  4OUF A;  5ENF A;  5F61 A;  3JVM A;  4A9N A;  3HMH A;  5LJ2 A;  3U5J A;  4FLP A;  5EPS A;  4YYM A;  4NR8 A;  4YAT A;  2YEM A;  3MUK A;  5ACY A;  3IU5 A;  4O7E A;  4CUU A;  5IBN A;  5CU8 A;  5F2P A;  3U5M A;  5I89 A;  3QZS A;  4CFL A;  5EV9 A;  4YC9 A;  4CUR A;  5HEN A;  3HMF A;  5FE2 A;  4YYH A;  4NR4 A;  4HXR A;  4LRG A;  5IGN A;  2L85 A;  3GG3 A;  5FE0 A;  5EWH A;  5FH6 A;  2YEK A;  4QYD A;  3U5K A;  4O7B A;  5ENC A;  4QEU A;  5C7N A;  5CQA A;  5ENB A;  5FFV A;  3JVJ A;  4F3I A;  4N4H A;  3S92 A;  4NR6 A;  5I7X A;  5HRW A;  5CRM A;  4YAX A;  4TT4 A;  4TU6 A;  5I29 A;  1JSP B;  4IOR A;  5D3T A;  4QY4 A;  4BHW A;  4XY9 A;  4CUQ A;  5CQ7 A;  3SVH A;  4OGI A;  4LZR A;  4J3I A;  4J1P A;  5KHM A;  5FE3 A;  5CQ8 A;  5H1V A;  5JI8 A;  4HXM A;  5CQT A;  4QR5 A;  4MEP A;  4MR6 A;  4IR5 A;  5CUB A;  2E7O A;  4PCI A;  4UIY A;  4Z93 A;  5F60 A;  3O37 A;  4PCE A;  5CGP A;  4A9J A;  5EP7 A;  5CQ6 A;  5I88 A;  4QNS A;  1ZS5 A;  5CUG A;  4ALH A;  2RO1 A;  5F62 A;  5FE7 A;  2G4A A;  3MQM A;  5L8T A;  2LSP B;  3NXB A;  3G0L A;  4PY6 A;  4LYI A;  5FG6 A;  4TTE A;  5C85 A;  4MEN A;  5FE9 A;  5AD2 A;  4QR3 A;  4Q0O A;  5E9I A;  4BJX A;  2R10 A;  5D26 A;  4NS5 A;  3JVL A;  5FE8 A;  4HXN A;  4BW4 A;  5L8U A;  4TZ2 A;  5A5Q A;  4QSP A;  3UV4 A;  4IR3 A;  5D3R A;  5LVR A;  3JVK A;  4XYA A;  3LJW A;  5AME A;  5E73 A;  5ENI A;  3D7C A;  5CPE A;  5E9L A;  3QZV A;  4YYI A;  4A9O A;  5EWV A;  4UIT A;  5E7D A;  5FG5 A;  4KV4 A;  5HQ7 A;  2DVR A;  5ETB A;  4PKL A;  5CQ4 A;  4N4F A;  4NYV A;  5FBX A;  4PS5 A;  4O71 A;  4MR5 A;  4LR6 A;  4LYS A;  4ALG A;  5ENE A;  3UV2 A;  4NRB A;  4NXJ A;  4UYH A;  2D82 A;  5HQ5 A;  4TU4 A;  5ENH A;  4NYW A;  5LVQ A;  4NR7 A;  4QC3 A;  5CQ3 A;  5DW2 A;  4TT2 A;  3ZYU A;  5CUD A;  4TZ8 A;  5DKH A;  5HFR A;  5E3G A;  4QUT A;  2F6N A;  5A7C A;  2OO1 A;  5ENG A;  4UYD A;  5CRZ A;  5LJ0 A;  5DKD A;  5EGU A;  5TB6 A;  5CZG A;  4A9H A;  5LKT A;  4YK0 A;  4UIW A;  4UYF B;  5HEL A;  5EPB A;  3SVF A;  4Y03 A;  3UVY A;  1N72 A;  5I1Q A;  5A5R A;  4NYX A;  4YAB A;  4C66 A;  5DKC A;  4HBX A;  3AAD A;  5HQ6 A;  4DON A;  5C4Q A;  5KTU A;  5F63 A;  3O33 A;  4NUC A;  5CUA A;  4O75 A;  5LKU A;  5LUU A;  2DKW A;  5DYA A;  5ENJ A;  5A5P A;  5JWM A;  4Z6I A;  5HLS A;  2R0V A;  5G4S A;  5D3J A;  3LXJ A;  2DVS A;  4NR5 A;  5DFD A;  4A9I A;  4QSW A;  4QB3 A;  2YEL A;  4YBT A;  2RNX A;  4N3W A;  4QSV A;  4YYJ A;  5HM0 A;  5HFQ A;  5EWD A;  2RFJ A;  4CLB A;  2DVQ A;  4CUP A;  5AMF A;  5DY7 A;  2DVV A;  5DX4 A;  3MB3 A;  4XY8 A;  3MXF A;  5F25 A;  5D3P A;  4YAD A;  5IGL A;  3UVD A;  3RCW A;  4QSU A;  5EIC A;  4QUU A;  4XUB A;  5DYC A;  5K29 A;  4A9L A;  4UIZ A;  4A9E A;  4CUS A;  4CUT A;  4IOQ A;  4CL9 A;  5IG6 A;  2WP2 A;  5HRV A;  1F68 A;  2E7N A;  5BT3 A;  5L98 A;  2I8N A;  5F36 A;  5IID A;  4O7C A;  4IR4 A;  5LJ1 A;  5D3S A;  5EPR A;  5LKZ A;  4A9F A;  3U5L A;  4TS8 A;  4HBV A;  4NUD A;  3O34 A;  4HXL A;  5EM3 A;  4LYW A;  2RS9 B;  5EI4 A;  4O74 A;  3ONI A;  5CY9 A;  3UV5 A;  5EK9 A;  5CUC A;  5E9M A;  5I86 A;  4Q0N A;  3HME A;  5EWW A;  5DYU A;  2YQD A;  5DLX A;  5C87 A;  2OUO A;  4LDF A;  4WIV A;  2I7K A;  3O36 A;  2RI7 A;  4YYN A;  5E9Y A;  5L99 A;  4NR9 A;  5D7X A;  3G0J A;  5J0D A;  5L97 A;  3TLP A;  2YYN A;  4QST A;  2H60 A;  5II1 A;  2YW5 A;  4YYD A;  4NQM A;  5FB0 A;  5I80 A;  5CUE A;  5TCM A;  4MR4 A;  4MEQ A;  5BT5 A;  4A9M A;  5E9K A;  2D9E A;  4KCX A;  4YBM A;  2RNY A;  4ZW1 A;  4O77 A;  5L96 A;  4YY4 A;  4BW3 A;  4MR3 A;  3Q2E A;  4LZS A;  5C89 A;  4J0S A;  3P1C A;  5H1T A;  4YYG A;  5E74 A;  4Z6H A;  4NRC A;  5I7Y A;  3AQA A;  5FG4 A;  2RNW A;  5DW1 A;  5II2 A;  4N4G A;  4TYL A;  4QEV A;  1WUM A;  5I40 A;  2F6J A;  5A85 A;  4O72 A;  4HBW A;  3LQI A;  5FFW A;  5DLZ A;  4ZC9 A;  4UIU A;  4PTB A;  5A5N A;  4UYF A;  3P1E A;  5G4R A;  5FE4 A;  4NRA A;  4HXK A;  4J0R A;  5CP5 A;  4TQN A;  5FB1 A;  4Z1Q A;  2OSS A;  5FDZ A;  2WP1 A;  5HRX A;  4HBY A;  3UVW A;  1JM4 B;  2R0S A;  2N9G A;  4N4I A;  4WHU A;  3P1F A;  5KU3 A;  5CTL A;  5A82 A;  5LKX A;  4BW1 A;  5FE5 A;  3IU6 A;  5D3H A;  3S91 A;  4NQN A;  4UIV A;  5EIS A;  5AD3 A;  4X2I A;  5D25 A;  4QSQ A;  4YYK A;  3DAI A;  5EU1 A;  3FKM X;  5E3D A;  3SVG A;  5CS8 A;  5IGK A;  4UYG A;  5DBM A;  4YBS A;  4XUA A;  5A81 A;  2L84 A;  4GPJ A;  4O7F A;  3LQH A;  1WUG A;  5EWC A;  3DWY A;  5C8G A;  4Z1S A;  3O35 A;  5A5S A;  3P5O A;  5HJC A;  4YH4 A;  4TT6 A;  5FE1 A;  2E3K A;  4MEO A;  5E9V A;  4QSR A;  5IGM A;  5COI A;  2YDW A;  3UVX A;  4QC1 A;  4LC2 A;  3I3J A;  5HEM A;  4HXO A;  2NXB A;  4O76 A;  5EQ1 A;  5KTX A;  3U5P A;  4QR4 A;  5F1H A;  3LQJ A;  2KTB B;  2R0Y A;  5D0C A;  3Q2F A;  3P1D A;  5D24 A;  4LZ2 A;  4ZQL A;  4O7A A;  2FSA A;  5F5Z A;  5HCL A;  4NUE A;  4QYL A;  5CQ5 A;  4BW2 A;  2DWW A;  4UIX A;  3K2J A;  4CFK A;  4QBM A;  4YH3 A;  5EA1 A;  5FE6 A;  5FH8 A;  1EQF A;  4UYE A; 
#chains in the Genus database with same CATH topology
 4HXS A;  1X0J A;  4WHW A;  3U5O A;  5I83 A;  2GRC A;  4KV1 A;  5F3A A;  2DAT A;  4QSS A;  4OGJ A;  4A9K A;  5A83 A;  1E6I A;  4HXP A;  4IOO A;  4YY6 A;  4AKG A;  3MB4 A;  4E96 A;  5DFC A;  5F1L A;  4QZS A;  5DYX A;  4IR6 A;  5CFW A;  5FH7 A;  5E0R A;  3U5N A;  5KTW A;  5BT4 A;  5H85 A;  4RVR A;  5ETD A;  5D3N A;  5A5O A;  4O78 A;  5EVA A;  3UW9 A;  5DFB A;  3QZT A;  5H1U A;  3D1B A;  4C67 A;  5KO4 A;  4O70 A;  3MUL A;  5D3L A;  4AKN A;  5FFY A;  2MJV B;  2L5E A;  4QEW A;  4QSX A;  4OUF A;  5ENF A;  5F61 A;  3JVM A;  4A9N A;  3HMH A;  5LJ2 A;  3U5J A;  4FLP A;  5EPS A;  4YYM A;  4NR8 A;  4YAT A;  2YEM A;  3MUK A;  5ACY A;  3IU5 A;  4AI6 A;  4O7E A;  4CUU A;  5IBN A;  5CU8 A;  5F2P A;  3U5M A;  5I89 A;  3QZS A;  4CFL A;  5EV9 A;  4YC9 A;  4CUR A;  5HEN A;  3HMF A;  5FE2 A;  4YYH A;  4NR4 A;  4HXR A;  4LRG A;  5IGN A;  2EJN A;  2L85 A;  3GG3 A;  5FE0 A;  4AKI A;  5EWH A;  5FH6 A;  2YEK A;  4QYD A;  3U5K A;  4O7B A;  5ENC A;  4QEU A;  5C7N A;  5CQA A;  5ENB A;  5FFV A;  3JVJ A;  4F3I A;  1ZKR A;  4N4H A;  3S92 A;  4NR6 A;  5I7X A;  5HRW A;  5CRM A;  4YAX A;  4TT4 A;  4TU6 A;  5I29 A;  1JSP B;  4IOR A;  5D3T A;  4QY4 A;  4BHW A;  4XY9 A;  4CUQ A;  5CQ7 A;  3SVH A;  4OGI A;  4LZR A;  4J3I A;  4J1P A;  5KHM A;  5FE3 A;  5CQ8 A;  5H1V A;  5JI8 A;  4HXM A;  5CQT A;  4QR5 A;  4MEP A;  4MR6 A;  4IR5 A;  5CUB A;  2E7O A;  4PCI A;  4UIY A;  4Z93 A;  5F60 A;  3O37 A;  4PCE A;  5CGP A;  4A9J A;  5EP7 A;  5CQ6 A;  5I88 A;  4QNS A;  1ZS5 A;  5CUG A;  4ALH A;  2RO1 A;  5F62 A;  5FE7 A;  2G4A A;  3MQM A;  5L8T A;  2LSP B;  3NXB A;  3G0L A;  4PY6 A;  4LYI A;  5FG6 A;  4TTE A;  5C85 A;  4MEN A;  5FE9 A;  5AD2 A;  4QR3 A;  4Q0O A;  5E9I A;  4BJX A;  2R10 A;  5D26 A;  4NS5 A;  3JVL A;  5FE8 A;  4HXN A;  4BW4 A;  5L8U A;  4TZ2 A;  5A5Q A;  4QSP A;  3UV4 A;  4IR3 A;  5D3R A;  5LVR A;  4AKH A;  3JVK A;  4XYA A;  3LJW A;  5AME A;  5E73 A;  5ENI A;  3D7C A;  5CPE A;  5E9L A;  3QZV A;  4YYI A;  4A9O A;  5EWV A;  4UIT A;  5E7D A;  5FG5 A;  4KV4 A;  5HQ7 A;  2DVR A;  5ETB A;  4PKL A;  1PUO A;  5CQ4 A;  4N4F A;  4NYV A;  5FBX A;  4PS5 A;  4O71 A;  4MR5 A;  4LR6 A;  4LYS A;  4ALG A;  5ENE A;  3UV2 A;  4NRB A;  4NXJ A;  4UYH A;  2D82 A;  5HQ5 A;  4TU4 A;  5ENH A;  4NYW A;  5LVQ A;  4NR7 A;  4QC3 A;  5CQ3 A;  5DW2 A;  4TT2 A;  3ZYU A;  5CUD A;  4TZ8 A;  5DKH A;  5HFR A;  5E3G A;  4QUT A;  2F6N A;  5A7C A;  2OO1 A;  5ENG A;  4UYD A;  5CRZ A;  5LJ0 A;  5DKD A;  5EGU A;  5TB6 A;  5CZG A;  4A9H A;  5LKT A;  4YK0 A;  4UIW A;  4UYF B;  5HEL A;  5EPB A;  3SVF A;  4Y03 A;  3UVY A;  1N72 A;  5I1Q A;  5A5R A;  4NYX A;  4YAB A;  4C66 A;  5DKC A;  4HBX A;  3AAD A;  5HQ6 A;  4DON A;  5C4Q A;  5KTU A;  5F63 A;  3O33 A;  4NUC A;  5CUA A;  4O75 A;  5LKU A;  5LUU A;  2DKW A;  5DYA A;  5ENJ A;  5A5P A;  5JWM A;  4Z6I A;  5HLS A;  2R0V A;  3ERR A;  5D3J A;  5G4S A;  3LXJ A;  2DVS A;  4NR5 A;  5DFD A;  4A9I A;  4QSW A;  4QB3 A;  2YEL A;  4YBT A;  2RNX A;  4N3W A;  4QSV A;  4YYJ A;  5HM0 A;  5HFQ A;  5EWD A;  2RFJ A;  4CLB A;  2DVQ A;  4CUP A;  5AMF A;  5DY7 A;  2DVV A;  5DX4 A;  3MB3 A;  4XY8 A;  3MXF A;  5F25 A;  5D3P A;  4YAD A;  5IGL A;  3UVD A;  3RCW A;  4QSU A;  5EIC A;  4QUU A;  4XUB A;  5DYC A;  5K29 A;  4A9L A;  4UIZ A;  4A9E A;  4CUS A;  4CUT A;  4IOQ A;  4CL9 A;  5IG6 A;  2WP2 A;  5HRV A;  1F68 A;  2E7N A;  5BT3 A;  5L98 A;  2I8N A;  5F36 A;  5IID A;  4O7C A;  4IR4 A;  5LJ1 A;  5D3S A;  5EPR A;  5LKZ A;  4A9F A;  3U5L A;  4TS8 A;  4HBV A;  4NUD A;  3O34 A;  4HXL A;  5EM3 A;  4LYW A;  2RS9 B;  5EI4 A;  4O74 A;  3ONI A;  5CY9 A;  3UV5 A;  5EK9 A;  3VKH A;  5CUC A;  5E9M A;  5I86 A;  4Q0N A;  3HME A;  5EWW A;  5DYU A;  2YQD A;  5DLX A;  5C87 A;  2OUO A;  4LDF A;  4WIV A;  2I7K A;  3O36 A;  2RI7 A;  4YYN A;  5E9Y A;  5L99 A;  4NR9 A;  5D7X A;  3G0J A;  5J0D A;  5L97 A;  3TLP A;  2YYN A;  4QST A;  2H60 A;  5II1 A;  2YW5 A;  4YYD A;  4NQM A;  5FB0 A;  5I80 A;  5CUE A;  5TCM A;  4MR4 A;  3D1D A;  4MEQ A;  5BT5 A;  4A9M A;  5E9K A;  3VKG A;  2D9E A;  4KCX A;  4YBM A;  2RNY A;  4ZW1 A;  4O77 A;  5L96 A;  4YY4 A;  4BW3 A;  4MR3 A;  3Q2E A;  4LZS A;  5C89 A;  4J0S A;  3P1C A;  5H1T A;  4YYG A;  5E74 A;  4Z6H A;  4NRC A;  5I7Y A;  3AQA A;  5FG4 A;  2RNW A;  5DW1 A;  5II2 A;  4N4G A;  4TYL A;  4QEV A;  1WUM A;  5I40 A;  2F6J A;  5A85 A;  4O72 A;  4HBW A;  3LQI A;  5FFW A;  5DLZ A;  4ZC9 A;  4UIU A;  4PTB A;  5A5N A;  4UYF A;  3P1E A;  5G4R A;  5FE4 A;  4NRA A;  4HXK A;  4J0R A;  5CP5 A;  4TQN A;  5FB1 A;  4Z1Q A;  2OSS A;  5FDZ A;  2WP1 A;  5HRX A;  4HBY A;  3UVW A;  1JM4 B;  2R0S A;  2N9G A;  4N4I A;  4WHU A;  3P1F A;  5KU3 A;  5CTL A;  5A82 A;  5LKX A;  4BW1 A;  5FE5 A;  3IU6 A;  5D3H A;  3S91 A;  4NQN A;  4UIV A;  5EIS A;  5AD3 A;  4X2I A;  5D25 A;  4QSQ A;  4YYK A;  3DAI A;  5EU1 A;  3FKM X;  5E3D A;  3SVG A;  5CS8 A;  5IGK A;  4UYG A;  5DBM A;  4YBS A;  4XUA A;  5A81 A;  2L84 A;  4GPJ A;  4O7F A;  3LQH A;  1WUG A;  5EWC A;  3DWY A;  5C8G A;  4Z1S A;  3O35 A;  5A5S A;  3P5O A;  5HJC A;  4YH4 A;  4TT6 A;  5FE1 A;  2E3K A;  4MEO A;  5E9V A;  4QSR A;  5IGM A;  5COI A;  2YDW A;  3UVX A;  4QC1 A;  4LC2 A;  3I3J A;  5HEM A;  4HXO A;  2NXB A;  4O76 A;  5EQ1 A;  5KTX A;  3U5P A;  4QR4 A;  5F1H A;  3LQJ A;  2KTB B;  2R0Y A;  5D0C A;  3Q2F A;  3P1D A;  5D24 A;  4LZ2 A;  4ZQL A;  4O7A A;  2FSA A;  5F5Z A;  5HCL A;  4NUE A;  4QYL A;  5CQ5 A;  4BW2 A;  2DWW A;  4UIX A;  3K2J A;  4CFK A;  4QBM A;  4YH3 A;  5EA1 A;  5FE6 A;  5FH8 A;  1EQF A;  4UYE A; 
#chains in the Genus database with same CATH homology
 4HXS A;  1X0J A;  4WHW A;  3U5O A;  5I83 A;  2GRC A;  4KV1 A;  5F3A A;  2DAT A;  4QSS A;  4OGJ A;  4A9K A;  5A83 A;  1E6I A;  4HXP A;  4IOO A;  4YY6 A;  3MB4 A;  4E96 A;  5DFC A;  5F1L A;  4QZS A;  5DYX A;  4IR6 A;  5CFW A;  5FH7 A;  5E0R A;  3U5N A;  5KTW A;  5BT4 A;  5H85 A;  4RVR A;  5ETD A;  5D3N A;  5A5O A;  4O78 A;  5EVA A;  3UW9 A;  5DFB A;  3QZT A;  5H1U A;  4C67 A;  5KO4 A;  4O70 A;  3MUL A;  5D3L A;  4AKN A;  5FFY A;  2MJV B;  2L5E A;  4QEW A;  4QSX A;  4OUF A;  5ENF A;  5F61 A;  3JVM A;  4A9N A;  3HMH A;  5LJ2 A;  3U5J A;  4FLP A;  5EPS A;  4YYM A;  4NR8 A;  4YAT A;  2YEM A;  3MUK A;  5ACY A;  3IU5 A;  4O7E A;  4CUU A;  5IBN A;  5CU8 A;  5F2P A;  3U5M A;  5I89 A;  3QZS A;  4CFL A;  5EV9 A;  4YC9 A;  4CUR A;  5HEN A;  3HMF A;  5FE2 A;  4YYH A;  4NR4 A;  4HXR A;  4LRG A;  5IGN A;  2L85 A;  3GG3 A;  5FE0 A;  5EWH A;  5FH6 A;  2YEK A;  4QYD A;  3U5K A;  4O7B A;  5ENC A;  4QEU A;  5C7N A;  5CQA A;  5ENB A;  5FFV A;  3JVJ A;  4F3I A;  4N4H A;  3S92 A;  4NR6 A;  5I7X A;  5HRW A;  5CRM A;  4YAX A;  4TT4 A;  4TU6 A;  5I29 A;  1JSP B;  4IOR A;  5D3T A;  4QY4 A;  4BHW A;  4XY9 A;  4CUQ A;  5CQ7 A;  3SVH A;  4OGI A;  4LZR A;  4J3I A;  4J1P A;  5KHM A;  5FE3 A;  5CQ8 A;  5H1V A;  5JI8 A;  4HXM A;  5CQT A;  4QR5 A;  4MEP A;  4MR6 A;  4IR5 A;  5CUB A;  2E7O A;  4PCI A;  4UIY A;  4Z93 A;  5F60 A;  3O37 A;  4PCE A;  5CGP A;  4A9J A;  5EP7 A;  5CQ6 A;  5I88 A;  4QNS A;  1ZS5 A;  5CUG A;  4ALH A;  2RO1 A;  5F62 A;  5FE7 A;  2G4A A;  3MQM A;  5L8T A;  2LSP B;  3NXB A;  3G0L A;  4PY6 A;  4LYI A;  5FG6 A;  4TTE A;  5C85 A;  4MEN A;  5FE9 A;  5AD2 A;  4QR3 A;  4Q0O A;  5E9I A;  4BJX A;  2R10 A;  5D26 A;  4NS5 A;  3JVL A;  5FE8 A;  4HXN A;  4BW4 A;  5L8U A;  4TZ2 A;  5A5Q A;  4QSP A;  3UV4 A;  4IR3 A;  5D3R A;  5LVR A;  3JVK A;  4XYA A;  3LJW A;  5AME A;  5E73 A;  5ENI A;  3D7C A;  5CPE A;  5E9L A;  3QZV A;  4YYI A;  4A9O A;  5EWV A;  4UIT A;  5E7D A;  5FG5 A;  4KV4 A;  5HQ7 A;  2DVR A;  5ETB A;  4PKL A;  5CQ4 A;  4N4F A;  4NYV A;  5FBX A;  4PS5 A;  4O71 A;  4MR5 A;  4LR6 A;  4LYS A;  4ALG A;  5ENE A;  3UV2 A;  4NRB A;  4NXJ A;  4UYH A;  2D82 A;  5HQ5 A;  4TU4 A;  5ENH A;  4NYW A;  5LVQ A;  4NR7 A;  4QC3 A;  5CQ3 A;  5DW2 A;  4TT2 A;  3ZYU A;  5CUD A;  4TZ8 A;  5DKH A;  5HFR A;  5E3G A;  4QUT A;  2F6N A;  5A7C A;  2OO1 A;  5ENG A;  4UYD A;  5CRZ A;  5LJ0 A;  5DKD A;  5EGU A;  5TB6 A;  5CZG A;  4A9H A;  5LKT A;  4YK0 A;  4UIW A;  4UYF B;  5HEL A;  5EPB A;  3SVF A;  4Y03 A;  3UVY A;  1N72 A;  5I1Q A;  5A5R A;  4NYX A;  4YAB A;  4C66 A;  5DKC A;  4HBX A;  3AAD A;  5HQ6 A;  4DON A;  5C4Q A;  5KTU A;  5F63 A;  3O33 A;  4NUC A;  5CUA A;  4O75 A;  5LKU A;  5LUU A;  2DKW A;  5DYA A;  5ENJ A;  5A5P A;  5JWM A;  4Z6I A;  5HLS A;  2R0V A;  5G4S A;  5D3J A;  3LXJ A;  2DVS A;  4NR5 A;  5DFD A;  4A9I A;  4QSW A;  4QB3 A;  2YEL A;  4YBT A;  2RNX A;  4N3W A;  4QSV A;  4YYJ A;  5HM0 A;  5HFQ A;  5EWD A;  2RFJ A;  4CLB A;  2DVQ A;  4CUP A;  5AMF A;  5DY7 A;  2DVV A;  5DX4 A;  3MB3 A;  4XY8 A;  3MXF A;  5F25 A;  5D3P A;  4YAD A;  5IGL A;  3UVD A;  3RCW A;  4QSU A;  5EIC A;  4QUU A;  4XUB A;  5DYC A;  5K29 A;  4A9L A;  4UIZ A;  4A9E A;  4CUS A;  4CUT A;  4IOQ A;  4CL9 A;  5IG6 A;  2WP2 A;  5HRV A;  1F68 A;  2E7N A;  5BT3 A;  5L98 A;  2I8N A;  5F36 A;  5IID A;  4O7C A;  4IR4 A;  5LJ1 A;  5D3S A;  5EPR A;  5LKZ A;  4A9F A;  3U5L A;  4TS8 A;  4HBV A;  4NUD A;  3O34 A;  4HXL A;  5EM3 A;  4LYW A;  2RS9 B;  5EI4 A;  4O74 A;  3ONI A;  5CY9 A;  3UV5 A;  5EK9 A;  5CUC A;  5E9M A;  5I86 A;  4Q0N A;  3HME A;  5EWW A;  5DYU A;  2YQD A;  5DLX A;  5C87 A;  2OUO A;  4LDF A;  4WIV A;  2I7K A;  3O36 A;  2RI7 A;  4YYN A;  5E9Y A;  5L99 A;  4NR9 A;  5D7X A;  3G0J A;  5J0D A;  5L97 A;  3TLP A;  2YYN A;  4QST A;  2H60 A;  5II1 A;  2YW5 A;  4YYD A;  4NQM A;  5FB0 A;  5I80 A;  5CUE A;  5TCM A;  4MR4 A;  4MEQ A;  5BT5 A;  4A9M A;  5E9K A;  2D9E A;  4KCX A;  4YBM A;  2RNY A;  4ZW1 A;  4O77 A;  5L96 A;  4YY4 A;  4BW3 A;  4MR3 A;  3Q2E A;  4LZS A;  5C89 A;  4J0S A;  3P1C A;  5H1T A;  4YYG A;  5E74 A;  4Z6H A;  4NRC A;  5I7Y A;  3AQA A;  5FG4 A;  2RNW A;  5DW1 A;  5II2 A;  4N4G A;  4TYL A;  4QEV A;  1WUM A;  5I40 A;  2F6J A;  5A85 A;  4O72 A;  4HBW A;  3LQI A;  5FFW A;  5DLZ A;  4ZC9 A;  4UIU A;  4PTB A;  5A5N A;  4UYF A;  3P1E A;  5G4R A;  5FE4 A;  4NRA A;  4HXK A;  4J0R A;  5CP5 A;  4TQN A;  5FB1 A;  4Z1Q A;  2OSS A;  5FDZ A;  2WP1 A;  5HRX A;  4HBY A;  3UVW A;  1JM4 B;  2R0S A;  2N9G A;  4N4I A;  4WHU A;  3P1F A;  5KU3 A;  5CTL A;  5A82 A;  5LKX A;  4BW1 A;  5FE5 A;  3IU6 A;  5D3H A;  3S91 A;  4NQN A;  4UIV A;  5EIS A;  5AD3 A;  4X2I A;  5D25 A;  4QSQ A;  4YYK A;  3DAI A;  5EU1 A;  3FKM X;  5E3D A;  3SVG A;  5CS8 A;  5IGK A;  4UYG A;  5DBM A;  4YBS A;  4XUA A;  5A81 A;  2L84 A;  4GPJ A;  4O7F A;  3LQH A;  1WUG A;  5EWC A;  3DWY A;  5C8G A;  4Z1S A;  3O35 A;  5A5S A;  3P5O A;  5HJC A;  4YH4 A;  4TT6 A;  5FE1 A;  2E3K A;  4MEO A;  5E9V A;  4QSR A;  5IGM A;  5COI A;  2YDW A;  3UVX A;  4QC1 A;  4LC2 A;  3I3J A;  5HEM A;  4HXO A;  2NXB A;  4O76 A;  5EQ1 A;  5KTX A;  3U5P A;  4QR4 A;  5F1H A;  3LQJ A;  2KTB B;  2R0Y A;  5D0C A;  3Q2F A;  3P1D A;  5D24 A;  4LZ2 A;  4ZQL A;  4O7A A;  2FSA A;  5F5Z A;  5HCL A;  4NUE A;  4QYL A;  5CQ5 A;  4BW2 A;  2DWW A;  4UIX A;  3K2J A;  4CFK A;  4QBM A;  4YH3 A;  5EA1 A;  5FE6 A;  5FH8 A;  1EQF A;  4UYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...