4OUFA

Crystal structure of cbp bromodomain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
114
structure length
114
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Binding of the histone chaperone ASF1 to the CBP bromodomain promotes histone acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4oufA00
3GG3A 3Q2EA 5FG6A 4ZW1A 5HFQA 5CZGA 4IORA 3U5KA 5FE7A 4HXOA 5ENGA 2I8NA 5I40A 3JVKA 4UITA 4NUDA 3JVLA 4LZSA 2I7KA 5FFYA 5CPEA 5FDZA 5L8TA 3O37A 4ALHA 3U5NA 5A5QA 2OSSA 4A9IA 3DAIA 5HRXA 5ENCA 4TU6A 5A5RA 5CQ4A 5TCMA 5CRMA 4N3WA 5I7YA 5G4RA 5CQ8A 4KCXA 5A81A 4NRCA 4CUSA 4QSRA 4O7EA 5A5OA 2E7NA 3O34A 4NRBA 4PTBA 2NXBA 2D82A 5II1A 4HBYA 4O76A 5FE3A 5FE4A 3ONIA 5DYUA 5EICA 5CGPA 4UYFB 5EI4A 5F61A 2RFJA 3DWYA 4IOOA 5E9KA 5EWWA 5IGMA 3SVFA 4UIUA 2RNXA 4YK0A 5AMEA 4QZSA 4MR5A 4QSPA 5CUGA 5KU3A 4PKLA 4NS5A 5L96A 4YH4A 2YYNA 4QSWA 4E96A 5A5NA 5DLXA 5FFWA 4HBWA 5FB0A 4QSVA 1F68A 2DVVA 4MEPA 5ETDA 5EA1A 4UYHA 2YQDA 4X2IA 2RNYA 4BW3A 3G0LA 2R10A 4QEUA 5KTUA 4QYLA 3UVDA 5E7DA 3P1CA 5D3LA 2D9EA 5EVAA 4CUTA 4UYEA 4TU4A 3MQMA 3I3JA 4MR4A 5AD2A 4N4FA 4XY9A 5LJ2A 5D3NA 4YAXA 3U5JA 5D24A 4A9KA 4YY4A 5HFRA 4BW2A 5KTXA 5ENJA 2YDWA 4NYVA 4UIZA 4ALGA 5DX4A 5KO4A 4TYLA 2GRCA 4YYIA 4TT4A 5HQ5A 3FKMX 5F2PA 4TQNA 5HEMA 4IR5A 4QSTA 4MR6A 4QR4A 2L84A 4OGJA 5I29A 3MULA 5D3TA 5D0CA 5I88A 4NR4A 4CUPA 4LZ2A 4IR4A 5A85A 4LC2A 5DYXA 5LKXA 5DKDA 5D3SA 4BJXA 5FH6A 5E73A 4NR6A 3TLPA 4YH3A 5EWDA 5CQ6A 4N4HA 2YELA 2KTBB 5CUAA 5A5SA 5CU8A 4Z6HA 5D3RA 4UIXA 5LUUA 3UW9A 2DKWA 5COIA 2R0YA 2DVQA 4YBSA 5HQ6A 5CQ5A 5L98A 5A83A 4J0RA 5D25A 4MEOA 4XUBA 5ETBA 5LKZA 3D7CA 4YYMA 3O35A 5DW2A 3QZTA 4GPJA 3P1DA 4YYHA 5H85A 5C89A 3LQHA 3IU5A 4HBXA 4O7CA 4HXMA 4CLBA 4YC9A 5ENEA 4A9NA 2DVSA 5EISA 3U5OA 4PS5A 2E7OA 4QEVA 2RNWA 5G4SA 4A9HA 4YYGA 5H1VA 5A82A 5L99A 5EGUA 3P1FA 4NRAA 3UVXA 4WHWA 5CQAA 5IGNA 5HJCA 5DW1A 5FE1A 4NUEA 4YYKA 5IBNA 5EWVA 4LYIA 3S91A 3JVJA 5ENFA 4NYWA 4MR3A 5DKCA 3MUKA 4QB3A 3LQJA 2YEMA 4YY6A 5DY7A 4O70A 4NXJA 5ENIA 4QNSA 3UV5A 5E74A 2L5EA 4QSSA 5HENA 4QY4A 5LVQA 4QBMA 4NR8A 4MEQA 2F6JA 4XYAA 5JWMA 5LJ1A 3U5LA 5BT5A 5CY9A 4QR5A 4HXNA 5F36A 2YEKA 5HQ7A 5CUCA 5TB6A 2N9GA 4QSUA 4BHWA 5C4QA 5KHMA 4O78A 5CTLA 2YW5A 4A9OA 5HM0A 2R0SA 3S92A 4YBTA 4YADA 1ZS5A 5FE2A 4A9LA 4QC1A 5JI8A 2FSAA 5I83A 5D3PA 3MB4A 2OUOA 4QC3A 5CFWA 5CUDA 4HBVA 4QUTA 3P1EA 5FBXA 5E9VA 1N72A 5HRVA 4NR5A 1X0JA 3UV2A 5CQ3A 5FE0A 5F63A 5EWHA 5C7NA 3G0JA 4LRGA 2RO1A 4J0SA 4QSQA 5EV9A 4O7FA 5BT4A 5FH7A 5D3HA 4A9FA 4NYXA 5AD3A 3AADA 2E3KA 5FFVA 3HMHA 3UVYA 4A9MA 2RS9B 3Q2FA 5CUEA 4BW4A 5L8UA 4O75A 3O33A 5EWCA 4Z6IA 5E9MA 3AQAA 4LZRA 5EPBA 2WP1A 4YABA 5D26A 4UIWA 5L97A 5A5PA 2DWWA 4O71A 3LXJA 5DBMA 3U5PA 5J0DA 5I86A 4KV1A 5E9IA 5HRWA 4Z93A 4OUFA 2R0VA 2WP2A 4UIVA 5F1HA 4QR3A 4OGIA 5DFBA 4PY6A 5EPRA 3MB3A 4A9EA 5DKHA 5IIDA 4NQMA 5I7XA 5FE9A 4HXLA 5FB1A 5EP7A 5IGKA 4CFKA 5CUBA 4YYNA 3JVMA 4CUQA 5LVRA 3HMEA 5I89A 2LSPB 3NXBA 4UYFA 4QYDA 4O74A 4RVRA 2H60A 4Z1QA 5LKUA 3QZVA 2OO1A 5FG4A 4LYSA 4J1PA 5H1TA 5LJ0A 4YYDA 5K29A 3IU6A 1WUGA 5FE8A 4QUUA 5EU1A 5HELA 5F62A 4PCEA 4C66A 4ZC9A 5F3AA 3UVWA 5HLSA 5I1QA 4BW1A 4DONA 3QZSA 3SVGA 5ENBA 2DVRA 2DATA 4HXRA 4ZQLA 4O72A 5A7CA 5BT3A 5I80A 2G4AA 4A9JA 4CUUA 5F5ZA 5CRZA 5FG5A 3ZYUA 5IGLA 4UYDA 4YATA 2L85A 4LR6A 4N4GA 5HCLA 1JM4B 4XUAA 5C87A 5E3GA 4HXSA 4FLPA 4TS8A 5LKTA 5DLZA 4O7AA 4IOQA 2RI7A 4NUCA 4IR3A 5C85A 3LQIA 4F3IA 5DFCA 2MJVB 4Y03A 3MXFA 4O7BA 4WIVA 5E9YA 4TZ2A 5CQ7A 4TT6A 5EQ1A 4YYJA 4CURA 5EPSA 4C67A 5E9LA 5EM3A 4J3IA 4XY8A 5F60A 4TT2A 5FE6A 1JSPB 5F25A 4QSXA 5H1UA 4IR6A 5D3JA 5ENHA 4KV4A 4LYWA 4O77A 5CS8A 5IG6A 4NR9A 5CQTA 3SVHA 3HMFA 4WHUA 5C8GA 5KTWA 3LJWA 3UV4A 3K2JA 5FE5A 5II2A 3P5OA 4NQNA 3U5MA 4N4IA 4Q0OA 4TTEA 1E6IA 1WUMA 4TZ8A 5E0RA 5CP5A 4YBMA 2F6NA 5DFDA 3RCWA 4HXKA 4AKNA 4CFLA 5DYAA 4HXPA 4Z1SA 5EK9A 3O36A 5F1LA 4PCIA 5DYCA 4LDFA 4QEWA 4NR7A 4UYGA 4Q0NA 5ACYA 4MENA 4UIYA 5E3DA 4CL9A 5D7XA 5FH8A 5AMFA 1EQFA
chains in the Genus database with same CATH superfamily
3GG3A 4AKHA 3Q2EA 5FG6A 4ZW1A 5HFQA 5CZGA 4IORA 3U5KA 5FE7A 4HXOA 5ENGA 2I8NA 5I40A 3JVKA 4UITA 4NUDA 3JVLA 4LZSA 2I7KA 5FFYA 5CPEA 5FDZA 5L8TA 3O37A 4ALHA 3U5NA 5A5QA 2OSSA 4A9IA 3DAIA 5HRXA 5ENCA 4TU6A 5A5RA 5CQ4A 5TCMA 5CRMA 4N3WA 5I7YA 5G4RA 5CQ8A 4KCXA 5A81A 4NRCA 4CUSA 4QSRA 4O7EA 5A5OA 2E7NA 3O34A 4NRBA 4PTBA 2NXBA 2D82A 5II1A 4HBYA 4O76A 5FE3A 5FE4A 3ONIA 5DYUA 5EICA 5CGPA 4UYFB 5EI4A 5F61A 2RFJA 3DWYA 4IOOA 5E9KA 5EWWA 5IGMA 3SVFA 4UIUA 2RNXA 4YK0A 5AMEA 4QZSA 4MR5A 4QSPA 5CUGA 5KU3A 4PKLA 4NS5A 5L96A 4YH4A 2YYNA 4QSWA 4E96A 5A5NA 5DLXA 5FFWA 4HBWA 5FB0A 4QSVA 1F68A 2DVVA 4MEPA 5ETDA 3VKHA 5EA1A 4UYHA 2YQDA 4X2IA 2RNYA 4BW3A 3G0LA 2R10A 4QEUA 5KTUA 4QYLA 3UVDA 5E7DA 3P1CA 5D3LA 2D9EA 5EVAA 4CUTA 4AKGA 4UYEA 4TU4A 3MQMA 3I3JA 4MR4A 5AD2A 4N4FA 4XY9A 5LJ2A 5D3NA 4YAXA 3U5JA 5D24A 4A9KA 4YY4A 5HFRA 4BW2A 5KTXA 5ENJA 2YDWA 4NYVA 4UIZA 4ALGA 5DX4A 5KO4A 4TYLA 2GRCA 4YYIA 4TT4A 5HQ5A 3FKMX 5F2PA 4TQNA 5HEMA 4IR5A 4QSTA 4MR6A 4QR4A 2L84A 4OGJA 5I29A 3MULA 5D3TA 5D0CA 5I88A 4NR4A 4CUPA 4LZ2A 4IR4A 5A85A 4LC2A 5DYXA 5LKXA 5DKDA 5D3SA 4BJXA 5FH6A 5E73A 4NR6A 3TLPA 4YH3A 5EWDA 5CQ6A 4N4HA 2YELA 2KTBB 5CUAA 5A5SA 5CU8A 4Z6HA 5D3RA 4UIXA 5LUUA 3UW9A 2DKWA 5COIA 2R0YA 2DVQA 4YBSA 5HQ6A 5CQ5A 5L98A 5A83A 4J0RA 5D25A 4MEOA 4XUBA 5ETBA 5LKZA 3D7CA 4YYMA 3O35A 5DW2A 3QZTA 4GPJA 3P1DA 4YYHA 5H85A 5C89A 3LQHA 3IU5A 4HBXA 4O7CA 4HXMA 4CLBA 4YC9A 5ENEA 4A9NA 2DVSA 5EISA 3U5OA 4PS5A 2E7OA 4QEVA 2RNWA 5G4SA 4A9HA 4YYGA 5H1VA 5A82A 5L99A 5EGUA 3P1FA 4NRAA 3UVXA 4WHWA 5CQAA 5IGNA 5HJCA 5DW1A 5FE1A 4NUEA 4YYKA 5IBNA 5EWVA 4LYIA 3S91A 3JVJA 5ENFA 4NYWA 4MR3A 5DKCA 3MUKA 4QB3A 3LQJA 2YEMA 4YY6A 5DY7A 4O70A 4NXJA 5ENIA 4QNSA 3UV5A 5E74A 2L5EA 4QSSA 5HENA 4QY4A 5LVQA 4QBMA 4NR8A 4MEQA 2F6JA 4XYAA 5JWMA 5LJ1A 1PUOA 3U5LA 5BT5A 5CY9A 4QR5A 4HXNA 5F36A 2YEKA 5HQ7A 5CUCA 5TB6A 2N9GA 4QSUA 4BHWA 5C4QA 5KHMA 4O78A 5CTLA 2YW5A 4A9OA 5HM0A 2R0SA 3S92A 4YBTA 4YADA 1ZS5A 5FE2A 4A9LA 4QC1A 4AKIA 5JI8A 2FSAA 5I83A 5D3PA 3MB4A 2OUOA 4QC3A 5CFWA 5CUDA 4HBVA 4QUTA 3P1EA 5FBXA 5E9VA 1N72A 5HRVA 4NR5A 1X0JA 3UV2A 5CQ3A 5FE0A 5F63A 5EWHA 5C7NA 3G0JA 4LRGA 2RO1A 4J0SA 4QSQA 5EV9A 4O7FA 5BT4A 5FH7A 5D3HA 4A9FA 4NYXA 5AD3A 2EJNA 3AADA 2E3KA 5FFVA 3VKGA 3HMHA 3UVYA 4A9MA 2RS9B 3Q2FA 5CUEA 4BW4A 5L8UA 4O75A 3O33A 5EWCA 4Z6IA 5E9MA 3AQAA 4LZRA 5EPBA 2WP1A 4YABA 5D26A 4UIWA 5L97A 5A5PA 2DWWA 4O71A 3LXJA 5DBMA 3U5PA 5J0DA 5I86A 4KV1A 5E9IA 5HRWA 4Z93A 4OUFA 2R0VA 2WP2A 4UIVA 5F1HA 4QR3A 4OGIA 5DFBA 4PY6A 5EPRA 3MB3A 4A9EA 5DKHA 5IIDA 4NQMA 5I7XA 5FE9A 4HXLA 5FB1A 5EP7A 5IGKA 4CFKA 5CUBA 4YYNA 3JVMA 4CUQA 5LVRA 3HMEA 5I89A 2LSPB 3NXBA 4UYFA 4QYDA 3D1BA 4O74A 4RVRA 2H60A 4Z1QA 5LKUA 3QZVA 2OO1A 5FG4A 4LYSA 4J1PA 5H1TA 5LJ0A 4YYDA 5K29A 3IU6A 1WUGA 5FE8A 4QUUA 5EU1A 5HELA 5F62A 4PCEA 4C66A 4ZC9A 5F3AA 3UVWA 5HLSA 5I1QA 4BW1A 4DONA 3QZSA 3SVGA 5ENBA 2DVRA 2DATA 1ZKRA 4HXRA 4ZQLA 4O72A 5A7CA 5BT3A 5I80A 2G4AA 4A9JA 4CUUA 5F5ZA 5CRZA 5FG5A 3ZYUA 5IGLA 4UYDA 4YATA 2L85A 4LR6A 4N4GA 5HCLA 1JM4B 4XUAA 5C87A 5E3GA 4HXSA 4FLPA 4TS8A 5LKTA 5DLZA 4O7AA 4IOQA 2RI7A 3ERRA 4NUCA 4IR3A 5C85A 3LQIA 4F3IA 2MJVB 5DFCA 4Y03A 3MXFA 4O7BA 4WIVA 5E9YA 4TZ2A 5CQ7A 4TT6A 5EQ1A 4YYJA 4CURA 5EPSA 4C67A 5E9LA 5EM3A 4J3IA 4XY8A 5F60A 4TT2A 5FE6A 1JSPB 5F25A 4QSXA 5H1UA 4IR6A 4AI6A 5D3JA 5ENHA 4KV4A 4LYWA 4O77A 5CS8A 5IG6A 4NR9A 5CQTA 3SVHA 3HMFA 4WHUA 5C8GA 5KTWA 3LJWA 3UV4A 3K2JA 5FE5A 5II2A 3P5OA 4NQNA 3U5MA 4N4IA 4Q0OA 4TTEA 1E6IA 1WUMA 4TZ8A 5E0RA 5CP5A 4YBMA 2F6NA 5DFDA 3RCWA 4HXKA 4AKNA 4CFLA 5DYAA 4HXPA 4Z1SA 3D1DA 3O36A 5EK9A 5F1LA 4PCIA 5DYCA 4LDFA 4QEWA 4NR7A 4UYGA 4Q0NA 5ACYA 4MENA 4UIYA 5E3DA 4CL9A 5D7XA 5FH8A 5AMFA 1EQFA
chains in the Genus database with same CATH topology
3GG3A 3Q2EA 5FG6A 4ZW1A 5HFQA 5CZGA 4IORA 3U5KA 5FE7A 4HXOA 5ENGA 2I8NA 5I40A 3JVKA 4UITA 4NUDA 3JVLA 4LZSA 2I7KA 5FFYA 5CPEA 5FDZA 5L8TA 3O37A 4ALHA 3U5NA 5A5QA 2OSSA 4A9IA 3DAIA 5HRXA 5ENCA 4TU6A 5A5RA 5CQ4A 5TCMA 5CRMA 4N3WA 5I7YA 5G4RA 5CQ8A 4KCXA 5A81A 4NRCA 4CUSA 4QSRA 4O7EA 5A5OA 2E7NA 3O34A 4NRBA 4PTBA 2NXBA 2D82A 5II1A 4HBYA 4O76A 5FE3A 5FE4A 3ONIA 5DYUA 5EICA 5CGPA 4UYFB 5EI4A 5F61A 2RFJA 3DWYA 4IOOA 5E9KA 5EWWA 5IGMA 3SVFA 4UIUA 2RNXA 4YK0A 5AMEA 4QZSA 4MR5A 4QSPA 5CUGA 5KU3A 4PKLA 4NS5A 5L96A 4YH4A 2YYNA 4QSWA 4E96A 5A5NA 5DLXA 5FFWA 4HBWA 5FB0A 4QSVA 1F68A 2DVVA 4MEPA 5ETDA 5EA1A 4UYHA 2YQDA 4X2IA 2RNYA 4BW3A 3G0LA 2R10A 4QEUA 5KTUA 4QYLA 3UVDA 5E7DA 3P1CA 5D3LA 2D9EA 5EVAA 4CUTA 4UYEA 4TU4A 3MQMA 3I3JA 4MR4A 5AD2A 4N4FA 4XY9A 5LJ2A 5D3NA 4YAXA 3U5JA 5D24A 4A9KA 4YY4A 5HFRA 4BW2A 5KTXA 5ENJA 2YDWA 4NYVA 4UIZA 4ALGA 5DX4A 5KO4A 4TYLA 2GRCA 4YYIA 4TT4A 5HQ5A 3FKMX 5F2PA 4TQNA 5HEMA 4IR5A 4QSTA 4MR6A 4QR4A 2L84A 4OGJA 5I29A 3MULA 5D3TA 5D0CA 5I88A 4NR4A 4CUPA 4LZ2A 4IR4A 5A85A 4LC2A 5DYXA 5LKXA 5DKDA 5D3SA 4BJXA 5FH6A 5E73A 4NR6A 3TLPA 4YH3A 5EWDA 5CQ6A 4N4HA 2YELA 2KTBB 5CUAA 5A5SA 5CU8A 4Z6HA 5D3RA 4UIXA 5LUUA 3UW9A 2DKWA 5COIA 2R0YA 2DVQA 4YBSA 5HQ6A 5CQ5A 5L98A 5A83A 4J0RA 5D25A 4MEOA 4XUBA 5ETBA 5LKZA 3D7CA 4YYMA 3O35A 5DW2A 3QZTA 4GPJA 3P1DA 4YYHA 5H85A 5C89A 3LQHA 3IU5A 4HBXA 4O7CA 4HXMA 4CLBA 4YC9A 5ENEA 4A9NA 2DVSA 5EISA 3U5OA 4PS5A 2E7OA 4QEVA 2RNWA 5G4SA 4A9HA 4YYGA 5H1VA 5A82A 5L99A 5EGUA 3P1FA 4NRAA 3UVXA 4WHWA 5CQAA 5IGNA 5HJCA 5DW1A 5FE1A 4NUEA 4YYKA 5IBNA 5EWVA 4LYIA 3S91A 3JVJA 5ENFA 4NYWA 4MR3A 5DKCA 3MUKA 4QB3A 3LQJA 2YEMA 4YY6A 5DY7A 4O70A 4NXJA 5ENIA 4QNSA 3UV5A 5E74A 2L5EA 4QSSA 5HENA 4QY4A 5LVQA 4QBMA 4NR8A 4MEQA 2F6JA 4XYAA 5JWMA 5LJ1A 3U5LA 5BT5A 5CY9A 4QR5A 4HXNA 5F36A 2YEKA 5HQ7A 5CUCA 5TB6A 2N9GA 4QSUA 4BHWA 5C4QA 5KHMA 4O78A 5CTLA 2YW5A 4A9OA 5HM0A 2R0SA 3S92A 4YBTA 4YADA 1ZS5A 5FE2A 4A9LA 4QC1A 5JI8A 2FSAA 5I83A 5D3PA 3MB4A 2OUOA 4QC3A 5CFWA 5CUDA 4HBVA 4QUTA 3P1EA 5FBXA 5E9VA 1N72A 5HRVA 4NR5A 1X0JA 3UV2A 5CQ3A 5FE0A 5F63A 5EWHA 5C7NA 3G0JA 4LRGA 2RO1A 4J0SA 4QSQA 5EV9A 4O7FA 5BT4A 5FH7A 5D3HA 4A9FA 4NYXA 5AD3A 3AADA 2E3KA 5FFVA 3HMHA 3UVYA 4A9MA 2RS9B 3Q2FA 5CUEA 4BW4A 5L8UA 4O75A 3O33A 5EWCA 4Z6IA 5E9MA 3AQAA 4LZRA 5EPBA 2WP1A 4YABA 5D26A 4UIWA 5L97A 5A5PA 2DWWA 4O71A 3LXJA 5DBMA 3U5PA 5J0DA 5I86A 4KV1A 5E9IA 5HRWA 4Z93A 4OUFA 2R0VA 2WP2A 4UIVA 5F1HA 4QR3A 4OGIA 5DFBA 4PY6A 5EPRA 3MB3A 4A9EA 5DKHA 5IIDA 4NQMA 5I7XA 5FE9A 4HXLA 5FB1A 5EP7A 5IGKA 4CFKA 5CUBA 4YYNA 3JVMA 4CUQA 5LVRA 3HMEA 5I89A 2LSPB 3NXBA 4UYFA 4QYDA 4O74A 4RVRA 2H60A 4Z1QA 5LKUA 3QZVA 2OO1A 5FG4A 4LYSA 4J1PA 5H1TA 5LJ0A 4YYDA 5K29A 3IU6A 1WUGA 5FE8A 4QUUA 5EU1A 5HELA 5F62A 4PCEA 4C66A 4ZC9A 5F3AA 3UVWA 5HLSA 5I1QA 4BW1A 4DONA 3QZSA 3SVGA 5ENBA 2DVRA 2DATA 4HXRA 4ZQLA 4O72A 5A7CA 5BT3A 5I80A 2G4AA 4A9JA 4CUUA 5F5ZA 5CRZA 5FG5A 3ZYUA 5IGLA 4UYDA 4YATA 2L85A 4LR6A 4N4GA 5HCLA 1JM4B 4XUAA 5C87A 5E3GA 4HXSA 4FLPA 4TS8A 5LKTA 5DLZA 4O7AA 4IOQA 2RI7A 4NUCA 4IR3A 5C85A 3LQIA 4F3IA 5DFCA 2MJVB 4Y03A 3MXFA 4O7BA 4WIVA 5E9YA 4TZ2A 5CQ7A 4TT6A 5EQ1A 4YYJA 4CURA 5EPSA 4C67A 5E9LA 5EM3A 4J3IA 4XY8A 5F60A 4TT2A 5FE6A 1JSPB 5F25A 4QSXA 5H1UA 4IR6A 5D3JA 5ENHA 4KV4A 4LYWA 4O77A 5CS8A 5IG6A 4NR9A 5CQTA 3SVHA 3HMFA 4WHUA 5C8GA 5KTWA 3LJWA 3UV4A 3K2JA 5FE5A 5II2A 3P5OA 4NQNA 3U5MA 4N4IA 4Q0OA 4TTEA 1E6IA 1WUMA 4TZ8A 5E0RA 5CP5A 4YBMA 2F6NA 5DFDA 3RCWA 4HXKA 4AKNA 4CFLA 5DYAA 4HXPA 4Z1SA 5EK9A 3O36A 5F1LA 4PCIA 5DYCA 4LDFA 4QEWA 4NR7A 4UYGA 4Q0NA 5ACYA 4MENA 4UIYA 5E3DA 4CL9A 5D7XA 5FH8A 5AMFA 1EQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GG3 A;  3Q2E A;  5FG6 A;  4ZW1 A;  5HFQ A;  5CZG A;  4IOR A;  3U5K A;  5FE7 A;  4HXO A;  5ENG A;  2I8N A;  5I40 A;  3JVK A;  4UIT A;  4NUD A;  3JVL A;  4LZS A;  2I7K A;  5FFY A;  5CPE A;  5FDZ A;  5L8T A;  3O37 A;  4ALH A;  3U5N A;  5A5Q A;  2OSS A;  4A9I A;  3DAI A;  5HRX A;  5ENC A;  4TU6 A;  5A5R A;  5CQ4 A;  5TCM A;  5CRM A;  4N3W A;  5I7Y A;  5G4R A;  5CQ8 A;  4KCX A;  5A81 A;  4NRC A;  4CUS A;  4QSR A;  4O7E A;  5A5O A;  2E7N A;  3O34 A;  4NRB A;  4PTB A;  2NXB A;  2D82 A;  5II1 A;  4HBY A;  4O76 A;  5FE3 A;  5FE4 A;  3ONI A;  5DYU A;  5EIC A;  5CGP A;  4UYF B;  5EI4 A;  5F61 A;  2RFJ A;  3DWY A;  4IOO A;  5E9K A;  5EWW A;  5IGM A;  3SVF A;  4UIU A;  2RNX A;  4YK0 A;  5AME A;  4QZS A;  4MR5 A;  4QSP A;  5CUG A;  5KU3 A;  4PKL A;  4NS5 A;  5L96 A;  4YH4 A;  2YYN A;  4QSW A;  4E96 A;  5A5N A;  5DLX A;  5FFW A;  4HBW A;  5FB0 A;  4QSV A;  1F68 A;  2DVV A;  4MEP A;  5ETD A;  5EA1 A;  4UYH A;  2YQD A;  4X2I A;  2RNY A;  4BW3 A;  3G0L A;  2R10 A;  4QEU A;  5KTU A;  4QYL A;  3UVD A;  5E7D A;  3P1C A;  5D3L A;  2D9E A;  5EVA A;  4CUT A;  4UYE A;  4TU4 A;  3MQM A;  3I3J A;  4MR4 A;  5AD2 A;  4N4F A;  4XY9 A;  5LJ2 A;  5D3N A;  4YAX A;  3U5J A;  5D24 A;  4A9K A;  4YY4 A;  5HFR A;  4BW2 A;  5KTX A;  5ENJ A;  2YDW A;  4NYV A;  4UIZ A;  4ALG A;  5DX4 A;  5KO4 A;  4TYL A;  2GRC A;  4YYI A;  4TT4 A;  5HQ5 A;  3FKM X;  5F2P A;  4TQN A;  5HEM A;  4IR5 A;  4QST A;  4MR6 A;  4QR4 A;  2L84 A;  4OGJ A;  5I29 A;  3MUL A;  5D3T A;  5D0C A;  5I88 A;  4NR4 A;  4CUP A;  4LZ2 A;  4IR4 A;  5A85 A;  4LC2 A;  5DYX A;  5LKX A;  5DKD A;  5D3S A;  4BJX A;  5FH6 A;  5E73 A;  4NR6 A;  3TLP A;  4YH3 A;  5EWD A;  5CQ6 A;  4N4H A;  2YEL A;  2KTB B;  5CUA A;  5A5S A;  5CU8 A;  4Z6H A;  5D3R A;  4UIX A;  5LUU A;  3UW9 A;  2DKW A;  5COI A;  2R0Y A;  2DVQ A;  4YBS A;  5HQ6 A;  5CQ5 A;  5L98 A;  5A83 A;  4J0R A;  5D25 A;  4MEO A;  4XUB A;  5ETB A;  5LKZ A;  3D7C A;  4YYM A;  3O35 A;  5DW2 A;  3QZT A;  4GPJ A;  3P1D A;  4YYH A;  5H85 A;  5C89 A;  3LQH A;  3IU5 A;  4HBX A;  4O7C A;  4HXM A;  4CLB A;  4YC9 A;  5ENE A;  4A9N A;  2DVS A;  5EIS A;  3U5O A;  4PS5 A;  2E7O A;  4QEV A;  2RNW A;  5G4S A;  4A9H A;  4YYG A;  5H1V A;  5A82 A;  5L99 A;  5EGU A;  3P1F A;  4NRA A;  3UVX A;  4WHW A;  5CQA A;  5IGN A;  5HJC A;  5DW1 A;  5FE1 A;  4NUE A;  4YYK A;  5IBN A;  5EWV A;  4LYI A;  3S91 A;  3JVJ A;  5ENF A;  4NYW A;  4MR3 A;  5DKC A;  3MUK A;  4QB3 A;  3LQJ A;  2YEM A;  4YY6 A;  5DY7 A;  4O70 A;  4NXJ A;  5ENI A;  4QNS A;  3UV5 A;  5E74 A;  2L5E A;  4QSS A;  5HEN A;  4QY4 A;  5LVQ A;  4QBM A;  4NR8 A;  4MEQ A;  2F6J A;  4XYA A;  5JWM A;  5LJ1 A;  3U5L A;  5BT5 A;  5CY9 A;  4QR5 A;  4HXN A;  5F36 A;  2YEK A;  5HQ7 A;  5CUC A;  5TB6 A;  2N9G A;  4QSU A;  4BHW A;  5C4Q A;  5KHM A;  4O78 A;  5CTL A;  2YW5 A;  4A9O A;  5HM0 A;  2R0S A;  3S92 A;  4YBT A;  4YAD A;  1ZS5 A;  5FE2 A;  4A9L A;  4QC1 A;  5JI8 A;  2FSA A;  5I83 A;  5D3P A;  3MB4 A;  2OUO A;  4QC3 A;  5CFW A;  5CUD A;  4HBV A;  4QUT A;  3P1E A;  5FBX A;  5E9V A;  1N72 A;  5HRV A;  4NR5 A;  1X0J A;  3UV2 A;  5CQ3 A;  5FE0 A;  5F63 A;  5EWH A;  5C7N A;  3G0J A;  4LRG A;  2RO1 A;  4J0S A;  4QSQ A;  5EV9 A;  4O7F A;  5BT4 A;  5FH7 A;  5D3H A;  4A9F A;  4NYX A;  5AD3 A;  3AAD A;  2E3K A;  5FFV A;  3HMH A;  3UVY A;  4A9M A;  2RS9 B;  3Q2F A;  5CUE A;  4BW4 A;  5L8U A;  4O75 A;  3O33 A;  5EWC A;  4Z6I A;  5E9M A;  3AQA A;  4LZR A;  5EPB A;  2WP1 A;  4YAB A;  5D26 A;  4UIW A;  5L97 A;  5A5P A;  2DWW A;  4O71 A;  3LXJ A;  5DBM A;  3U5P A;  5J0D A;  5I86 A;  4KV1 A;  5E9I A;  5HRW A;  4Z93 A;  4OUF A;  2R0V A;  2WP2 A;  4UIV A;  5F1H A;  4QR3 A;  4OGI A;  5DFB A;  4PY6 A;  5EPR A;  3MB3 A;  4A9E A;  5DKH A;  5IID A;  4NQM A;  5I7X A;  5FE9 A;  4HXL A;  5FB1 A;  5EP7 A;  5IGK A;  4CFK A;  5CUB A;  4YYN A;  3JVM A;  4CUQ A;  5LVR A;  3HME A;  5I89 A;  2LSP B;  3NXB A;  4UYF A;  4QYD A;  4O74 A;  4RVR A;  2H60 A;  4Z1Q A;  5LKU A;  3QZV A;  2OO1 A;  5FG4 A;  4LYS A;  4J1P A;  5H1T A;  5LJ0 A;  4YYD A;  5K29 A;  3IU6 A;  1WUG A;  5FE8 A;  4QUU A;  5EU1 A;  5HEL A;  5F62 A;  4PCE A;  4C66 A;  4ZC9 A;  5F3A A;  3UVW A;  5HLS A;  5I1Q A;  4BW1 A;  4DON A;  3QZS A;  3SVG A;  5ENB A;  2DVR A;  2DAT A;  4HXR A;  4ZQL A;  4O72 A;  5A7C A;  5BT3 A;  5I80 A;  2G4A A;  4A9J A;  4CUU A;  5F5Z A;  5CRZ A;  5FG5 A;  3ZYU A;  5IGL A;  4UYD A;  4YAT A;  2L85 A;  4LR6 A;  4N4G A;  5HCL A;  1JM4 B;  4XUA A;  5C87 A;  5E3G A;  4HXS A;  4FLP A;  4TS8 A;  5LKT A;  5DLZ A;  4O7A A;  4IOQ A;  2RI7 A;  4NUC A;  4IR3 A;  5C85 A;  3LQI A;  4F3I A;  5DFC A;  2MJV B;  4Y03 A;  3MXF A;  4O7B A;  4WIV A;  5E9Y A;  4TZ2 A;  5CQ7 A;  4TT6 A;  5EQ1 A;  4YYJ A;  4CUR A;  5EPS A;  4C67 A;  5E9L A;  5EM3 A;  4J3I A;  4XY8 A;  5F60 A;  4TT2 A;  5FE6 A;  1JSP B;  5F25 A;  4QSX A;  5H1U A;  4IR6 A;  5D3J A;  5ENH A;  4KV4 A;  4LYW A;  4O77 A;  5CS8 A;  5IG6 A;  4NR9 A;  5CQT A;  3SVH A;  3HMF A;  4WHU A;  5C8G A;  5KTW A;  3LJW A;  3UV4 A;  3K2J A;  5FE5 A;  5II2 A;  3P5O A;  4NQN A;  3U5M A;  4N4I A;  4Q0O A;  4TTE A;  1E6I A;  1WUM A;  4TZ8 A;  5E0R A;  5CP5 A;  4YBM A;  2F6N A;  5DFD A;  3RCW A;  4HXK A;  4AKN A;  4CFL A;  5DYA A;  4HXP A;  4Z1S A;  5EK9 A;  3O36 A;  5F1L A;  4PCI A;  5DYC A;  4LDF A;  4QEW A;  4NR7 A;  4UYG A;  4Q0N A;  5ACY A;  4MEN A;  4UIY A;  5E3D A;  4CL9 A;  5D7X A;  5FH8 A;  5AMF A;  1EQF A; 
#chains in the Genus database with same CATH topology
 3GG3 A;  4AKH A;  3Q2E A;  5FG6 A;  4ZW1 A;  5HFQ A;  5CZG A;  4IOR A;  3U5K A;  5FE7 A;  4HXO A;  5ENG A;  2I8N A;  5I40 A;  3JVK A;  4UIT A;  4NUD A;  3JVL A;  4LZS A;  2I7K A;  5FFY A;  5CPE A;  5FDZ A;  5L8T A;  3O37 A;  4ALH A;  3U5N A;  5A5Q A;  2OSS A;  4A9I A;  3DAI A;  5HRX A;  5ENC A;  4TU6 A;  5A5R A;  5CQ4 A;  5TCM A;  5CRM A;  4N3W A;  5I7Y A;  5G4R A;  5CQ8 A;  4KCX A;  5A81 A;  4NRC A;  4CUS A;  4QSR A;  4O7E A;  5A5O A;  2E7N A;  3O34 A;  4NRB A;  4PTB A;  2NXB A;  2D82 A;  5II1 A;  4HBY A;  4O76 A;  5FE3 A;  5FE4 A;  3ONI A;  5DYU A;  5EIC A;  5CGP A;  4UYF B;  5EI4 A;  5F61 A;  2RFJ A;  3DWY A;  4IOO A;  5E9K A;  5EWW A;  5IGM A;  3SVF A;  4UIU A;  2RNX A;  4YK0 A;  5AME A;  4QZS A;  4MR5 A;  4QSP A;  5CUG A;  5KU3 A;  4PKL A;  4NS5 A;  5L96 A;  4YH4 A;  2YYN A;  4QSW A;  4E96 A;  5A5N A;  5DLX A;  5FFW A;  4HBW A;  5FB0 A;  4QSV A;  1F68 A;  2DVV A;  4MEP A;  5ETD A;  3VKH A;  5EA1 A;  4UYH A;  2YQD A;  4X2I A;  2RNY A;  4BW3 A;  3G0L A;  2R10 A;  4QEU A;  5KTU A;  4QYL A;  3UVD A;  5E7D A;  3P1C A;  5D3L A;  2D9E A;  5EVA A;  4CUT A;  4AKG A;  4UYE A;  4TU4 A;  3MQM A;  3I3J A;  4MR4 A;  5AD2 A;  4N4F A;  4XY9 A;  5LJ2 A;  5D3N A;  4YAX A;  3U5J A;  5D24 A;  4A9K A;  4YY4 A;  5HFR A;  4BW2 A;  5KTX A;  5ENJ A;  2YDW A;  4NYV A;  4UIZ A;  4ALG A;  5DX4 A;  5KO4 A;  4TYL A;  2GRC A;  4YYI A;  4TT4 A;  5HQ5 A;  3FKM X;  5F2P A;  4TQN A;  5HEM A;  4IR5 A;  4QST A;  4MR6 A;  4QR4 A;  2L84 A;  4OGJ A;  5I29 A;  3MUL A;  5D3T A;  5D0C A;  5I88 A;  4NR4 A;  4CUP A;  4LZ2 A;  4IR4 A;  5A85 A;  4LC2 A;  5DYX A;  5LKX A;  5DKD A;  5D3S A;  4BJX A;  5FH6 A;  5E73 A;  4NR6 A;  3TLP A;  4YH3 A;  5EWD A;  5CQ6 A;  4N4H A;  2YEL A;  2KTB B;  5CUA A;  5A5S A;  5CU8 A;  4Z6H A;  5D3R A;  4UIX A;  5LUU A;  3UW9 A;  2DKW A;  5COI A;  2R0Y A;  2DVQ A;  4YBS A;  5HQ6 A;  5CQ5 A;  5L98 A;  5A83 A;  4J0R A;  5D25 A;  4MEO A;  4XUB A;  5ETB A;  5LKZ A;  3D7C A;  4YYM A;  3O35 A;  5DW2 A;  3QZT A;  4GPJ A;  3P1D A;  4YYH A;  5H85 A;  5C89 A;  3LQH A;  3IU5 A;  4HBX A;  4O7C A;  4HXM A;  4CLB A;  4YC9 A;  5ENE A;  4A9N A;  2DVS A;  5EIS A;  3U5O A;  4PS5 A;  2E7O A;  4QEV A;  2RNW A;  5G4S A;  4A9H A;  4YYG A;  5H1V A;  5A82 A;  5L99 A;  5EGU A;  3P1F A;  4NRA A;  3UVX A;  4WHW A;  5CQA A;  5IGN A;  5HJC A;  5DW1 A;  5FE1 A;  4NUE A;  4YYK A;  5IBN A;  5EWV A;  4LYI A;  3S91 A;  3JVJ A;  5ENF A;  4NYW A;  4MR3 A;  5DKC A;  3MUK A;  4QB3 A;  3LQJ A;  2YEM A;  4YY6 A;  5DY7 A;  4O70 A;  4NXJ A;  5ENI A;  4QNS A;  3UV5 A;  5E74 A;  2L5E A;  4QSS A;  5HEN A;  4QY4 A;  5LVQ A;  4QBM A;  4NR8 A;  4MEQ A;  2F6J A;  4XYA A;  5JWM A;  5LJ1 A;  1PUO A;  3U5L A;  5BT5 A;  5CY9 A;  4QR5 A;  4HXN A;  5F36 A;  2YEK A;  5HQ7 A;  5CUC A;  5TB6 A;  2N9G A;  4QSU A;  4BHW A;  5C4Q A;  5KHM A;  4O78 A;  5CTL A;  2YW5 A;  4A9O A;  5HM0 A;  2R0S A;  3S92 A;  4YBT A;  4YAD A;  1ZS5 A;  5FE2 A;  4A9L A;  4QC1 A;  4AKI A;  5JI8 A;  2FSA A;  5I83 A;  5D3P A;  3MB4 A;  2OUO A;  4QC3 A;  5CFW A;  5CUD A;  4HBV A;  4QUT A;  3P1E A;  5FBX A;  5E9V A;  1N72 A;  5HRV A;  4NR5 A;  1X0J A;  3UV2 A;  5CQ3 A;  5FE0 A;  5F63 A;  5EWH A;  5C7N A;  3G0J A;  4LRG A;  2RO1 A;  4J0S A;  4QSQ A;  5EV9 A;  4O7F A;  5BT4 A;  5FH7 A;  5D3H A;  4A9F A;  4NYX A;  5AD3 A;  2EJN A;  3AAD A;  2E3K A;  5FFV A;  3VKG A;  3HMH A;  3UVY A;  4A9M A;  2RS9 B;  3Q2F A;  5CUE A;  4BW4 A;  5L8U A;  4O75 A;  3O33 A;  5EWC A;  4Z6I A;  5E9M A;  3AQA A;  4LZR A;  5EPB A;  2WP1 A;  4YAB A;  5D26 A;  4UIW A;  5L97 A;  5A5P A;  2DWW A;  4O71 A;  3LXJ A;  5DBM A;  3U5P A;  5J0D A;  5I86 A;  4KV1 A;  5E9I A;  5HRW A;  4Z93 A;  4OUF A;  2R0V A;  2WP2 A;  4UIV A;  5F1H A;  4QR3 A;  4OGI A;  5DFB A;  4PY6 A;  5EPR A;  3MB3 A;  4A9E A;  5DKH A;  5IID A;  4NQM A;  5I7X A;  5FE9 A;  4HXL A;  5FB1 A;  5EP7 A;  5IGK A;  4CFK A;  5CUB A;  4YYN A;  3JVM A;  4CUQ A;  5LVR A;  3HME A;  5I89 A;  2LSP B;  3NXB A;  4UYF A;  4QYD A;  3D1B A;  4O74 A;  4RVR A;  2H60 A;  4Z1Q A;  5LKU A;  3QZV A;  2OO1 A;  5FG4 A;  4LYS A;  4J1P A;  5H1T A;  5LJ0 A;  4YYD A;  5K29 A;  3IU6 A;  1WUG A;  5FE8 A;  4QUU A;  5EU1 A;  5HEL A;  5F62 A;  4PCE A;  4C66 A;  4ZC9 A;  5F3A A;  3UVW A;  5HLS A;  5I1Q A;  4BW1 A;  4DON A;  3QZS A;  3SVG A;  5ENB A;  2DVR A;  2DAT A;  1ZKR A;  4HXR A;  4ZQL A;  4O72 A;  5A7C A;  5BT3 A;  5I80 A;  2G4A A;  4A9J A;  4CUU A;  5F5Z A;  5CRZ A;  5FG5 A;  3ZYU A;  5IGL A;  4UYD A;  4YAT A;  2L85 A;  4LR6 A;  4N4G A;  5HCL A;  1JM4 B;  4XUA A;  5C87 A;  5E3G A;  4HXS A;  4FLP A;  4TS8 A;  5LKT A;  5DLZ A;  4O7A A;  4IOQ A;  2RI7 A;  3ERR A;  4NUC A;  4IR3 A;  5C85 A;  3LQI A;  4F3I A;  2MJV B;  5DFC A;  4Y03 A;  3MXF A;  4O7B A;  4WIV A;  5E9Y A;  4TZ2 A;  5CQ7 A;  4TT6 A;  5EQ1 A;  4YYJ A;  4CUR A;  5EPS A;  4C67 A;  5E9L A;  5EM3 A;  4J3I A;  4XY8 A;  5F60 A;  4TT2 A;  5FE6 A;  1JSP B;  5F25 A;  4QSX A;  5H1U A;  4IR6 A;  4AI6 A;  5D3J A;  5ENH A;  4KV4 A;  4LYW A;  4O77 A;  5CS8 A;  5IG6 A;  4NR9 A;  5CQT A;  3SVH A;  3HMF A;  4WHU A;  5C8G A;  5KTW A;  3LJW A;  3UV4 A;  3K2J A;  5FE5 A;  5II2 A;  3P5O A;  4NQN A;  3U5M A;  4N4I A;  4Q0O A;  4TTE A;  1E6I A;  1WUM A;  4TZ8 A;  5E0R A;  5CP5 A;  4YBM A;  2F6N A;  5DFD A;  3RCW A;  4HXK A;  4AKN A;  4CFL A;  5DYA A;  4HXP A;  4Z1S A;  3D1D A;  3O36 A;  5EK9 A;  5F1L A;  4PCI A;  5DYC A;  4LDF A;  4QEW A;  4NR7 A;  4UYG A;  4Q0N A;  5ACY A;  4MEN A;  4UIY A;  5E3D A;  4CL9 A;  5D7X A;  5FH8 A;  5AMF A;  1EQF A; 
#chains in the Genus database with same CATH homology
 3GG3 A;  3Q2E A;  5FG6 A;  4ZW1 A;  5HFQ A;  5CZG A;  4IOR A;  3U5K A;  5FE7 A;  4HXO A;  5ENG A;  2I8N A;  5I40 A;  3JVK A;  4UIT A;  4NUD A;  3JVL A;  4LZS A;  2I7K A;  5FFY A;  5CPE A;  5FDZ A;  5L8T A;  3O37 A;  4ALH A;  3U5N A;  5A5Q A;  2OSS A;  4A9I A;  3DAI A;  5HRX A;  5ENC A;  4TU6 A;  5A5R A;  5CQ4 A;  5TCM A;  5CRM A;  4N3W A;  5I7Y A;  5G4R A;  5CQ8 A;  4KCX A;  5A81 A;  4NRC A;  4CUS A;  4QSR A;  4O7E A;  5A5O A;  2E7N A;  3O34 A;  4NRB A;  4PTB A;  2NXB A;  2D82 A;  5II1 A;  4HBY A;  4O76 A;  5FE3 A;  5FE4 A;  3ONI A;  5DYU A;  5EIC A;  5CGP A;  4UYF B;  5EI4 A;  5F61 A;  2RFJ A;  3DWY A;  4IOO A;  5E9K A;  5EWW A;  5IGM A;  3SVF A;  4UIU A;  2RNX A;  4YK0 A;  5AME A;  4QZS A;  4MR5 A;  4QSP A;  5CUG A;  5KU3 A;  4PKL A;  4NS5 A;  5L96 A;  4YH4 A;  2YYN A;  4QSW A;  4E96 A;  5A5N A;  5DLX A;  5FFW A;  4HBW A;  5FB0 A;  4QSV A;  1F68 A;  2DVV A;  4MEP A;  5ETD A;  5EA1 A;  4UYH A;  2YQD A;  4X2I A;  2RNY A;  4BW3 A;  3G0L A;  2R10 A;  4QEU A;  5KTU A;  4QYL A;  3UVD A;  5E7D A;  3P1C A;  5D3L A;  2D9E A;  5EVA A;  4CUT A;  4UYE A;  4TU4 A;  3MQM A;  3I3J A;  4MR4 A;  5AD2 A;  4N4F A;  4XY9 A;  5LJ2 A;  5D3N A;  4YAX A;  3U5J A;  5D24 A;  4A9K A;  4YY4 A;  5HFR A;  4BW2 A;  5KTX A;  5ENJ A;  2YDW A;  4NYV A;  4UIZ A;  4ALG A;  5DX4 A;  5KO4 A;  4TYL A;  2GRC A;  4YYI A;  4TT4 A;  5HQ5 A;  3FKM X;  5F2P A;  4TQN A;  5HEM A;  4IR5 A;  4QST A;  4MR6 A;  4QR4 A;  2L84 A;  4OGJ A;  5I29 A;  3MUL A;  5D3T A;  5D0C A;  5I88 A;  4NR4 A;  4CUP A;  4LZ2 A;  4IR4 A;  5A85 A;  4LC2 A;  5DYX A;  5LKX A;  5DKD A;  5D3S A;  4BJX A;  5FH6 A;  5E73 A;  4NR6 A;  3TLP A;  4YH3 A;  5EWD A;  5CQ6 A;  4N4H A;  2YEL A;  2KTB B;  5CUA A;  5A5S A;  5CU8 A;  4Z6H A;  5D3R A;  4UIX A;  5LUU A;  3UW9 A;  2DKW A;  5COI A;  2R0Y A;  2DVQ A;  4YBS A;  5HQ6 A;  5CQ5 A;  5L98 A;  5A83 A;  4J0R A;  5D25 A;  4MEO A;  4XUB A;  5ETB A;  5LKZ A;  3D7C A;  4YYM A;  3O35 A;  5DW2 A;  3QZT A;  4GPJ A;  3P1D A;  4YYH A;  5H85 A;  5C89 A;  3LQH A;  3IU5 A;  4HBX A;  4O7C A;  4HXM A;  4CLB A;  4YC9 A;  5ENE A;  4A9N A;  2DVS A;  5EIS A;  3U5O A;  4PS5 A;  2E7O A;  4QEV A;  2RNW A;  5G4S A;  4A9H A;  4YYG A;  5H1V A;  5A82 A;  5L99 A;  5EGU A;  3P1F A;  4NRA A;  3UVX A;  4WHW A;  5CQA A;  5IGN A;  5HJC A;  5DW1 A;  5FE1 A;  4NUE A;  4YYK A;  5IBN A;  5EWV A;  4LYI A;  3S91 A;  3JVJ A;  5ENF A;  4NYW A;  4MR3 A;  5DKC A;  3MUK A;  4QB3 A;  3LQJ A;  2YEM A;  4YY6 A;  5DY7 A;  4O70 A;  4NXJ A;  5ENI A;  4QNS A;  3UV5 A;  5E74 A;  2L5E A;  4QSS A;  5HEN A;  4QY4 A;  5LVQ A;  4QBM A;  4NR8 A;  4MEQ A;  2F6J A;  4XYA A;  5JWM A;  5LJ1 A;  3U5L A;  5BT5 A;  5CY9 A;  4QR5 A;  4HXN A;  5F36 A;  2YEK A;  5HQ7 A;  5CUC A;  5TB6 A;  2N9G A;  4QSU A;  4BHW A;  5C4Q A;  5KHM A;  4O78 A;  5CTL A;  2YW5 A;  4A9O A;  5HM0 A;  2R0S A;  3S92 A;  4YBT A;  4YAD A;  1ZS5 A;  5FE2 A;  4A9L A;  4QC1 A;  5JI8 A;  2FSA A;  5I83 A;  5D3P A;  3MB4 A;  2OUO A;  4QC3 A;  5CFW A;  5CUD A;  4HBV A;  4QUT A;  3P1E A;  5FBX A;  5E9V A;  1N72 A;  5HRV A;  4NR5 A;  1X0J A;  3UV2 A;  5CQ3 A;  5FE0 A;  5F63 A;  5EWH A;  5C7N A;  3G0J A;  4LRG A;  2RO1 A;  4J0S A;  4QSQ A;  5EV9 A;  4O7F A;  5BT4 A;  5FH7 A;  5D3H A;  4A9F A;  4NYX A;  5AD3 A;  3AAD A;  2E3K A;  5FFV A;  3HMH A;  3UVY A;  4A9M A;  2RS9 B;  3Q2F A;  5CUE A;  4BW4 A;  5L8U A;  4O75 A;  3O33 A;  5EWC A;  4Z6I A;  5E9M A;  3AQA A;  4LZR A;  5EPB A;  2WP1 A;  4YAB A;  5D26 A;  4UIW A;  5L97 A;  5A5P A;  2DWW A;  4O71 A;  3LXJ A;  5DBM A;  3U5P A;  5J0D A;  5I86 A;  4KV1 A;  5E9I A;  5HRW A;  4Z93 A;  4OUF A;  2R0V A;  2WP2 A;  4UIV A;  5F1H A;  4QR3 A;  4OGI A;  5DFB A;  4PY6 A;  5EPR A;  3MB3 A;  4A9E A;  5DKH A;  5IID A;  4NQM A;  5I7X A;  5FE9 A;  4HXL A;  5FB1 A;  5EP7 A;  5IGK A;  4CFK A;  5CUB A;  4YYN A;  3JVM A;  4CUQ A;  5LVR A;  3HME A;  5I89 A;  2LSP B;  3NXB A;  4UYF A;  4QYD A;  4O74 A;  4RVR A;  2H60 A;  4Z1Q A;  5LKU A;  3QZV A;  2OO1 A;  5FG4 A;  4LYS A;  4J1P A;  5H1T A;  5LJ0 A;  4YYD A;  5K29 A;  3IU6 A;  1WUG A;  5FE8 A;  4QUU A;  5EU1 A;  5HEL A;  5F62 A;  4PCE A;  4C66 A;  4ZC9 A;  5F3A A;  3UVW A;  5HLS A;  5I1Q A;  4BW1 A;  4DON A;  3QZS A;  3SVG A;  5ENB A;  2DVR A;  2DAT A;  4HXR A;  4ZQL A;  4O72 A;  5A7C A;  5BT3 A;  5I80 A;  2G4A A;  4A9J A;  4CUU A;  5F5Z A;  5CRZ A;  5FG5 A;  3ZYU A;  5IGL A;  4UYD A;  4YAT A;  2L85 A;  4LR6 A;  4N4G A;  5HCL A;  1JM4 B;  4XUA A;  5C87 A;  5E3G A;  4HXS A;  4FLP A;  4TS8 A;  5LKT A;  5DLZ A;  4O7A A;  4IOQ A;  2RI7 A;  4NUC A;  4IR3 A;  5C85 A;  3LQI A;  4F3I A;  5DFC A;  2MJV B;  4Y03 A;  3MXF A;  4O7B A;  4WIV A;  5E9Y A;  4TZ2 A;  5CQ7 A;  4TT6 A;  5EQ1 A;  4YYJ A;  4CUR A;  5EPS A;  4C67 A;  5E9L A;  5EM3 A;  4J3I A;  4XY8 A;  5F60 A;  4TT2 A;  5FE6 A;  1JSP B;  5F25 A;  4QSX A;  5H1U A;  4IR6 A;  5D3J A;  5ENH A;  4KV4 A;  4LYW A;  4O77 A;  5CS8 A;  5IG6 A;  4NR9 A;  5CQT A;  3SVH A;  3HMF A;  4WHU A;  5C8G A;  5KTW A;  3LJW A;  3UV4 A;  3K2J A;  5FE5 A;  5II2 A;  3P5O A;  4NQN A;  3U5M A;  4N4I A;  4Q0O A;  4TTE A;  1E6I A;  1WUM A;  4TZ8 A;  5E0R A;  5CP5 A;  4YBM A;  2F6N A;  5DFD A;  3RCW A;  4HXK A;  4AKN A;  4CFL A;  5DYA A;  4HXP A;  4Z1S A;  5EK9 A;  3O36 A;  5F1L A;  4PCI A;  5DYC A;  4LDF A;  4QEW A;  4NR7 A;  4UYG A;  4Q0N A;  5ACY A;  4MEN A;  4UIY A;  5E3D A;  4CL9 A;  5D7X A;  5FH8 A;  5AMF A;  1EQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...