4OUIA

Structure of vibrio cholerae chitin de-n-acetylase in complex with triacetylchitotriose (cto)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
403
structure length
403
Chain Sequence
b'PKGTIYLTFSDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 148
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2014-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ouiA02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4ouiA01
2CC0A 4NZ4A 2IW0A 3S6OA 4NZ3A 3QBUA 2VYOA 4NY2A 1V6TA 1W1A1 2DFAA 2J13A 1NY1A 2NLYA 2W3ZA 4HD5A 4V33A 3CL7A 5BU6A 1XW8A 3VUSA 1W1B1 2QV5A 4F9DA 2C71A 4L1GA 4F9JA 2C1IA 3RXZA 4NYUA 3WX7A 4WCJA 2Y8UA 4LY4A 4NZ5A 4M1BA 3HFTA 3CL6A 1W17A 2E67A 4NYYA 4U10A 5JMUA 4NZ1A 4OUIA 1Z7AA 2C1GA 2XU2A 2I5IA 2C79A 3CL8A
chains in the Genus database with same CATH superfamily
1WKYA 3GNRA 1XIEA 3PAJA 3AZTA 3ZLGA 1CXFA 1W5NA 2X0YA 3TZFA 5LIXX 4L4LA 4M1BA 1A0DA 3MSYA 3A22A 1FWDC 2Q01A 3NZQA 1VF8A 2X1SA 3EYPA 2J4GA 1X96A 4YVXA 4ZB0A 3LMZA 5HNNA 1I45A 2ZCGA 3MA8A 5C0QA 1KM6A 2ACSA 2Q6ZA 3AWOA 4HU3A 1TRIA 3GG8A 1Z41A 2W66A 1FP8A 5AC6A 1TX2A 3T1GA 1YXCA 4J3UA 5A8PA 1EEXA 2CXGA 2CZDA 3ME3A 4GISA 5MF5A 2XIIA 1TJ2A 1WZKA 5MKGA 3WH5A 5A94A 3NPWA 4UMAA 3A3WA 4OT7A 1S1RA 4OJ5A 3VNKA 3ITXA 4Q32A 4AY8A 2VVSA 2GVJA 4DYEA 1B30A 3T55A 3R89A 5D8ZA 6TAAA 1FWAC 4WDTA 4B92A 3W7RA 3N12A 3C2FA 4ZTXA 2PRLA 1LM1A 2O7QA 4FIRA 3R1ZA 4NT0A 3ZVHB 4MYXA 2Y61A 4M8UA 4Q8VA 1CENA 4Z17A 4LUJA 1AA1B 1UR2A 1VFSA 1GVQA 1YNPA 1KFJA 2PRMA 3W87A 3GK0A 2I7GA 1BTCA 3DXIA 5GNXA 3CU2A 1IF2A 4PTNA 5CSRA 3IUIA 3BGJA 1KXTA 1TKKA 4HNNA 1LRTA 3I6RA 3ARYA 3KRBA 3UPBA 1ZENA 3TAOA 5C8BB 4HU0A 1GOKA 3FYYA 3W72A 1EJXC 1GPWA 1R46A 3AMCA 4KEMA 1LJYA 3LNPA 2WHJA 3GM8A 1ECEA 4Q22A 3ERPA 1MW2A 4N02A 1U33A 1YXDA 4AFYA 4O19A 1HJSA 2XIMA 3CLWA 3GRIA 4JTCA 2EPLX 4KCTA 3DHDA 2F61A 5F2GA 1JXKA 4K68A 3THUA 4DHGA 2QDHA 1SZFA 1E0WA 1TVLA 1UD3A 1YW1A 3VNMA 4GGBA 3DCPA 2UWXA 1HKVA 5E1QA 2Y2MA 4JX6A 3UWZA 5LKYA 4QNLA 3VZXA 2QCFA 1WKDA 4F3HA 5I5RA 4GO9A 4FLOA 2Z1KA 1ITUA 5AVHA 1GONA 1V77A 6REQB 1EJRC 3GAYA 2VFIA 3KP0A 2BB0A 3V5FA 5D2VA 2G37A 5C9RA 2BP1A 4NY2A 4JYDA 2P88A 2XFWA 4DPPA 2D0GA 2BMBA 5I7GA 1JZ5A 1AJZA 3U4AA 4UFMA 1RQEA 2Z2BA 3VFCA 4ZOBA 1FOBA 1UWSA 2Y7EA 5HA7A 3ZO9A 4UXDA 4ACZA 3ITGA 1US0A 1JJKA 2WSQA 1B4EA 1W1TA 1XYLA 1P0DA 5AHNA 3H26A 1Q45A 2ZX5A 1S38A 8A3HA 3VOGA 1WDRA 3UZYA 1NSJA 1XIBA 3IEBA 1JZ2A 1KS0A 4DVOA 3KS8A 5A6SA 3W83A 2Y24A 1V6VA 3AO0A 4L1XA 1CBGA 1JL8A 3KTXA 4DRSA 1XR2A 4L64A 4LALA 3BW2A 5HPCA 5GJPA 3LENA 1E3XA 4L61A 4IGHA 4IPNB 4US6A 2ZUTA 2RDUA 1RQHA 1UH3A 3WIJA 3A5FA 4YWIA 3UT0A 2V5JA 1LF1A 3QQWA 5BROA 1KRCC 4KCVA 3NQFA 3EDKA 3GVRA 4O52A 3WNKA 2XH2A 3CBWA 1T40A 3VU2A 1JULA 2GQ9A 4LUYA 5DFAA 2PA6A 4LS1A 4P7QA 3T78A 1XV8A 3V3WA 4DUWA 1FWNA 1IT7A 4FMVA 2DJLA 3U9IA 3VZYA 3T2OA 4RE3A 1P0BA 1CWYA 1K6WA 3L28A 4WGXA 1H7WA 3ABQA 4LWWA 4OKDA 3JU2A 5IM51 4HZ7A 4KRUA 4JQ2A 1BXCA 2WBKA 1QU4A 2PODA 4F2UA 3O06A 1TELA 1OC7A 5KTLA 1TE6A 1GZJA 4YYCA 1XBZA 1F9CA 1TSIA 3QQ0A 4PN2A 4NZ3A 4JQ3A 1JF6A 1X1NA 5F4SA 5JQ9A 3DFHA 1JYXA 1DP0A 1AZ2A 3IJ8A 2XJ7A 3UPMA 1UWTA 1QK0A 4YTQA 4XUYA 4JX4A 1WDWA 1OJXA 2ZX8A 1LZOA 4ZENA 1LLZA 2V68A 4DYKA 3DBPA 2NQLA 1R9XA 3EWBX 5D2XA 4LVBA 3ECQA 3L4UA 2OZ3A 2G41A 1J5SA 5HWMA 2IKIA 1JZ4A 4PEKA 4UWMA 4EKJA 4HT3A 1FDYA 3CB3A 2X2YA 4S23A 1BEUA 3EPMA 4MKVA 1CLVA 3ZSSA 3AXMA 3MJMA 3CWNA 2PTDA 4NZ1A 3M0HA 2DVTA 4R33A 5C2GA 4CCEA 2UY2A 3LQGA 4DO5A 3LLFA 3PNZA 5JBEA 2NLIA 4H8HA 3Q94A 3WJXA 3XINA 3WQPA 1RUSA 4LF1A 5FKYA 2BG1A 1DJYA 3PWGA 4EWND 4PRTA 5AOUA 2XISA 1GT8A 3GDMA 3ZVHA 1SW0A 2J7DA 3CJPA 4IP4A 3ANVA 4C6JA 1YQ2A 2DZBA 2ZZ1A 4CD8A 3V18A 4KRZA 1TQXA 4O28A 1E8BA 5D33A 4UFKA 2GFTA 2I1OA 3MCNA 1RP8A 1GPFA 3WNLA 3UWEA 4C6DA 1F73A 1PXGA 5HNTA 4GI9A 1HL9A 4HJWA 2WOQA 3L9CA 1XQKA 2RH9A 4QQUA 3WEMA 1MW0A 1O68A 1F8MA 2OCZA 4DF0A 3UERA 4LAUA 4PMNA 1UR3M 1V3LA 4P8VA 4FEZA 3ITLA 3E74A 1UKTA 3AJXA 1EL3A 2CPUA 4A8LA 3FA5A 3FVMA 4H3DA 3EDEA 5D05A 1HIZA 3S6OA 5M03A 2VRQA 2V69A 4GVHA 4FPSA 2Z1VA 3LRKA 4DXXA 2YGYA 4HHPA 3RAOA 1TE1A 5SWUA 3W7IA 1ZQ5A 3ITVA 4XAFA 4EIVA 4NKCA 1GGOA 3I10A 4XB3A 4BI5A 4BQ4A 2ZDRA 1GZ1A 3UJSA 2BXZA 5JXQA 2Y8KA 4HNTA 2JFEX 3TN3A 2D3NA 4ORIA 2JE5A 5IBXA 4HMCA 5LIYX 5DRIA 1L2UA 2EPOA 3KCOA 2ZBTA 3SZ8A 1J7MA 4A8NA 2JALA 4IF2A 1HJUA 4BKNA 1QO6A 2WPBA 5HJLA 4WHBA 3BZGA 2YR1A 1N8FA 5M3WA 3GAKA 3IANA 1K4GA 5HDRA 3WBXA 2P3EA 1AFSA 4JFUA 5HPOA 1AJ0A 4LPCA 4V2XA 3GC2A 5F4WA 3W2JA 3S5SA 3Q37A 1XLAA 1V3MA 4UCGA 3IIXA 4Y2WA 5EL1A 5LGXA 3IV8A 1V3JA 2DIKA 5KZMA 3BDKA 1VEPA 1IV8A 2NWRA 1DWAM 3S5ZA 3GC4A 1T41A 4L6OA 3VFLA 3MQLA 4AZHA 4JFWA 4A6GA 2FJKA 3AOFA 3KS5A 4H9MA 2YDRA 3FSUA 3BOXA 2UY4A 3HFTA 7REQB 1DJGA 1NDWA 1IE7C 4AMAA 4JD4A 3UWYA 2WHKA 2XH7A 1N8IA 2BVTA 1TO3A 3TXVA 3WDQA 3QYSA 3RK8A 2DZAA 3QHNA 5FF4A 2Y2IA 3FGCA 2YCEA 3IS4A 3EDJA 3W6LA 2Y5JA 2Y2LA 2DPEA 3CLMA 3PNUA 1GQLA 1D7FA 3CIWA 1LL4A 1GJWA 1EXPA 3P5YA 1EFZA 3SRDA 4OJPA 1LUCB 4HJFA 4US5A 1BRLB 2QCDB 1C93A 1KM2A 4BHYA 3HG5A 5EY5A 3CUZA 4ONVA 3IJDA 3R25A 2I17A 4UQ9A 4GHRA 3WK0A 1K6AA 1EPVA 4F0LA 4DO7A 2OO6A 3AI0A 4XD3A 4F0HA 1XWYA 4DO4A 2QR6A 3L21A 4I5RA 1SO3A 5FJRA 4ZOCA 2P53A 2XD5A 5EBAA 3TSDA 1IGSA 1OZQA 3CL6A 1EP3A 3DHFA 3MUAA 4CQ9A 3G1RA 3CIXA 5CEWA 4MTVA 2ZUNA 2QCLA 4GYPC 4LYQA 2E3ZA 2WJFA 2XVGA 1QNSA 2G8ZA 5G2WA 1WCGA 4CN6A 4XO7A 4AYGA 3VDGA 4NYUA 1UA3A 5BXTA 4XO6A 3QSRA 1XIDA 3GDBA 4AVFA 2QUTA 2XYLA 5CAHA 1EBHA 4IGMA 3NPVA 1W1YA 1ME8A 1CGUA 2D22A 3L2LA 5BU6A 4DZHA 2VHLA 3MWCA 4NX5A 1V3IA 1FFQA 1XRVA 3AS2A 1R6WA 3AHZA 4DJEA 4O50A 1KFCA 2VMFA 3OP2A 3QFEA 4PMUA 1Y5XA 4Q4SA 1HVQA 1M68A 3DC0A 5CPNA 1M7JA 1UR8A 3K2GA 5DX7A 3KVLA 3O2LA 1EKOA 3BUVA 3QN3A 4NJJA 4L65A 4DELA 3BC9A 4QE5A 3QHMA 4AC7C 5M17A 2VWTA 4G56A 4E3VA 4BF7A 1UD6A 4Q4MA 6TIMA 3WLLA 4JEJA 3DGRA 3QJAA 1H41A 2QV4A 5A6MA 4O17A 4EWJA 4E4PA 3S5NA 3RITA 1GW1A 1W3NA 3ZT6A 5I3JA 4BQ3A 1YU0A 5LNSA 2FTWA 4PEEA 1S3TC 1TPDA 2DW6A 4DBSA 4LY4A 5A1AA 1SMAA 3DYMA 4RK8A 4O1BA 2WMHA 2NWSA 3LTPA 3AHXA 4HHHA 4ZO6A 2C8NA 4UQAA 3MUZ1 5E6YA 4ROQA 1HUVA 2FZMA 2Q3OA 4MB5A 4J2MA 4NAFA 1JXJA 3CQIA 1PWLA 3LGEA 1R3SA 2Y7GA 2ZRZA 1KM3A 4QLKA 4R5EA 4OECA 4C6CA 3HQPA 1PEZA 3W2UA 1IWAA 4Q8MA 2NV2A 3EB2A 2DZWA 3HGJA 5CAKA 2PWEA 2I5QA 3IK4A 4LEFA 1JI2A 3CC1A 1IZKA 4REQA 4Q8TA 3ONBA 3U7BA 1QPKA 1EGMA 5J8LA 4A8RA 2Q71A 1KA9F 2ZWYA 1DHKA 3SCTA 3VD3A 1GQKA 1R3VA 2AKMA 3W70A 3DFPA 4EXBA 3QEZA 1UWIA 4IX2A 4LW7A 2PP3A 4FXJA 4CNPA 5I02A 1QTWA 4AX7A 4J3VA 4QX4A 2C16A 3GE7A 1R85A 3WK3A 1IXPA 3CPUA 1E1CA 4B5UA 5BMXA 4UTLA 2BHUA 3W2NA 1R8LA 2X40A 4XX6A 4JN7A 3MB9A 2ZDSA 3AQUA 4Q8WA 3VKCA 3PN8A 4A4AA 1UWRA 1BF2A 3NL5A 1P6WA 2UV8G 3CH0A 2XSXA 3PWIA 3WEZA 1ONXA 4AAJA 1OY0A 4B5SA 1JQVA 3SUUA 1KM1A 3WUGA 3N19B 4P7LA 4KMQA 3A9BA 5GJNA 1ITCA 3TSMA 2CU0A 2YZ5A 2ZRVA 3AMLA 1GOXA 1ELSA 4FOUA 1V0KA 1P4CA 3CTLA 3LRLA 3U8GA 4BZYA 2BGSA 1SVDA 4FK9A 1FP9A 4CLMA 4H9UA 1KCXA 1KKOA 4KESA 3W85A 7TAAA 3TMLA 1HP4A 1VBRA 3OHIA 3WQ8A 3F4NA 4ILSA 5A95A 3AC0A 3VPLA 2NQ9A 5G4HC 3SDOA 2DH3A 1EB3A 3ES7A 1R38A 2QCDA 3WD4A 3ITYA 4PTXA 2D2GA 3OBAA 1JZ3A 3RHGA 5F1UA 1ZUAX 1J79A 5IDZA 1L8PA 3HV9A 2PWUA 3UU0A 2V6AA 3KDNA 3EWCA 1EBGA 1ZHAA 3UG5A 3W0KA 3NM3A 1OD0A 1X98A 4ECLA 1GVIA 4CQAA 3WNNA 1DTUA 2GK1B 1O5RA 1J0IA 1RA5A 1E5JA 4MJMA 5D09A 1X6UA 3QVQA 1XLDA 4M5PA 4NAEB 3TR9A 3CZEA 1V0MA 2V82A 4I9TA 4W8LA 2PDPA 1GQIA 4TR9A 1J0ZA 3QKEA 1JD9A 1RJPA 1VJIA 4LQ1A 3RM4A 2BSLA 4AHOA 1W54A 2HMCA 4DBDA 4N2YA 2XIOA 3UZXA 4S2CA 1B3WA 4MY1A 4F79A 2A3CA 2P0IA 3U5UA 1TMLA 2AKZA 3P5ZA 4Z0JA 1NELA 2POTA 1DQUA 4H7ZA 5B7YA 4LUTA 4H6KA 4AEEA 3B0XA 1AZ1A 3G1XA 1HN1A 1IIHA 3FAWA 3N6HA 4JICA 1RJQA 3WLJA 4O57A 1W9VA 2GPTA 1Z3NA 4ZE4A 3VD9A 1JEZA 1QK2A 1WUFA 5MHBA 4K8HA 1CGTA 2J6VA 1JCTA 4LUSB 5J04A 2HTMA 3ZSTA 3CZJA 1DYSA 3L4TA 4LEQA 1PUDA 3UQNA 1W5QA 4ADUA 2VQUA 3PZQA 4YTTA 2ZRYA 2ABAA 1QWKA 1MRAA 2BG5A 2ACQA 4A8IA 1H50A 2O56A 2VEPA 3OTRA 4LAMA 4HMEA 1UWQA 3QV7A 4GI4A 2NVAA 4EAYA 4L80A 4A2SA 2PWHA 3RPDA 1LYXA 2CZEA 3KTCA 3JRKA 1A5BA 3QMSA 3QC3A 3TJIA 3B0UX 1LG1A 4Y7EA 4U2YA 1OIMA 3ES8A 3NURA 4YTSA 4DJFD 4E5TA 4FLSA 4KPLA 5JMUA 1Q63A 1K7XA 5CG0A 2PSNA 2VC9A 4JTLA 5AHLA 1W3JA 2R8WA 3KBVA 4NHVA 4XVDA 4JIRA 3UZWA 4GZIA 5I77A 1F76A 1AIWA 2WQDA 3C3NA 4O11A 5AHEA 3SGUA 5EMMA 3VDBA 1WXJA 2EQDA 4S38A 3EOSA 1BG4A 3OG2A 2R1NA 3ITOA 4F9JA 3ZR4A 2CLFA 2G3MA 2VR5A 3G24A 3VD4A 3A4WA 3DHUA 1QHPA 3DUGA 2PF0A 4JQ4A 3GX9A 2VGIA 2ZUSA 8XIMA 4H6RA 3GWQA 4NZJA 3AUJA 1P5BA 1DE5A 1XSKA 4J5NA 3MZNA 1S2AA 4LSBA 4MUPA 2NX1A 1UR4A 1A53A 1NIUA 3KOXA 4TV5A 4IM4A 3NWRA 4GINA 3W02A 1V03A 4E6MA 4S3BA 3VCRA 4JTFA 4AB4A 2D69A 3UCCA 1EWDA 1OADA 2IPWA 4RW3A 4DEFA 1LWJA 1QBAA 4X3ZA 2QJGA 3KBJA 1CGXA 3IRDA 1CB2A 2WVVB 3CUGA 1NWSA 5DT7A 2GL5A 4QHRA 1Q6GA 3N13A 3KCLA 1G7UA 3IJLA 1LBMA 2J7GA 2DIEA 3ZFHA 1VPYA 1N82A 3KAOA 5A8NA 3GIYA 3CK5A 2JGYA 3UJEA 1V3KA 1XDMA 4JGDA 3I7SA 1T96A 5AKQA 1MEHA 4ZXLA 1UB3A 2PLMA 3GFYA 2CCRA 4KWUA 1D3HA 2OXNA 2VWSA 2CZFA 1UPPA 4PUDA 2XHYA 1JDAA 3MUCA 2QIIA 3MI2A 1HKIA 4ZQRA 4Z2GA 1KXQA 2GJXA 1JUBA 4Z08A 1JPMA 3MSGA 3R12A 3RG6A 4QRNA 4F4RA 4TX8A 3IVSA 3P93A 1HZYA 3QYQA 1B3VA 4IHCA 2VR4A 5FJTA 5CCZA 4I7WA 1HGYA 2GGHA 5CSSA 4F40A 2YZRA 4IJRA 3DI0A 4QEEA 2EAWA 3C0LA 3PSVA 3AU6A 5I03A 1RAKA 4W7UA 5C9UA 4CNOA 4K1GA 4WY0A 1GORA 4HN8A 2GK1A 3UPWA 1K3UA 4BS0A 2JF7A 3WLKX 4GKTA 2OX4A 2GUUA 3NOEA 5C54A 3IGUA 2HXUA 3SM0A 4S3CA 3HTWA 3MKCA 3LXAA 1SO4A 1AW2A 3P8JA 2R9RA 4M0XA 5M1TA 1RLCL 3THAA 4GNVA 3VIFA 2O9TA 1JRCA 3W29A 1UWUA 3MVIA 9CGTA 3MV11 3V36A 3ARPA 3USBA 4JXCA 2ZUVA 3TNOA 2PUZA 1DXEA 4OVXA 5CGMA 2A21A 5HQEA 4Q33A 7ENLA 3BAXA 3UBPC 3AYRA 4ATDA 2QXWA 2QCNA 4JTEA 1C3FA 3NQAA 3UNDA 2OLSA 2ZZ7A 4PBEA 2FB3A 3WF0A 1TWSA 1J2WA 2PWFA 4A29A 3XISA 5I6SA 5GPRA 4H19A 4I7UA 4JTKA 1PIIA 3JVAA 3VZZA 5IFTA 1H5VA 2E8ZA 4ZA0A 4HPGA 1UD5A 1QATA 1R30A 4MDOA 2J47A 5C9ZA 2ZVRA 3UWQA 4GJIA 3EA3A 3N1AA 3LCLA 1XICA 4ICMA 3KE0A 4PUMA 3N29A 2V5DA 2QAPA 3F2CA 3KEHA 1XHGA 4E2OA 5I3GA 2VVNA 3NPXA 3T0TA 3NEVA 1A0EA 1C29A 4JHOA 5C2CA 5KINA 2FIQA 3UYCA 2QHAA 1EX1A 2ZXQA 5AZ1A 4J3ZA 2ODOA 3W81A 1CXHA 4IMGA 1X8FA 2OGJA 3NSMA 3VNYA 3W1MA 4K39A 2B31A 4LUIA 3UCDA 9XIAA 3KLKA 2Y2KA 3G3DA 1C8YA 3VYLA 4NI3A 1KV8A 1TREA 2OYLA 4EE9A 3VDAA 1E5NA 3S2JA 4XV0A 1NFGA 4NVTA 3PTQA 1VQTA 3QY7A 1LDCA 4DB7A 2NUYA 3UR7A 4I7VA 1W1VA 1VS1A 3LNMA 3NQEA 1GYLA 1BTMA 4CGTA 4MPQA 2DZTA 5H8UA 1UIOA 4GGHA 2ZXDA 1UR9A 2VT0A 3B8TA 4HNOA 4FO4A 3PVFA 4IMFA 4PUNA 1EDQA 1TV4A 3GW0A 2NXHA 1Q6LA 5CLTA 4LJ3A 3NEHA 3RPTA 3S3GA 4IJCA 4AEOA 1G69A 3NFUA 3ARTA 3UY8A 3W01A 3RPMA 5FAJA 4GH3A 3N73A 2Z4GA 3I4EA 3ZT7A 3C4UA 4LV9A 4QR6A 1XJBA 3QGVA 3DC8A 3MVTA 3BO9A 5E5CA 3HFYA 4TVUA 3LQLA 4G2DA 3AIBA 4KQNA 2A7RA 3N15A 1XLBA 4LVDA 4WXZA 4GUFA 3AWNA 4MWAB 3M0IA 2XIBA 3NIYA 3BMWA 4GXWA 2QKFA 4MLRA 3WQGA 3H7RA 3VOIA 4XZHA 2FVLA 4OFCA 3P82A 1HKMA 1RALA 3QMRA 4IJFA 3LXCA 4HPJA 4ZO7A 3TFCA 2WJEA 3QFWA 2PDLA 3H2OA 4Q4PA 4M7TA 3MMTA 3BSHA 1IQ8A 3SCNA 1DQWA 3SBFA 1A80A 3CAQA 2DZVA 2HDJA 4PUEA 2GVLA 1W5OA 1TV3A 1SZRA 2B81A 3SCPA 2FVKA 4OHQA 4LAZA 1VHCA 4E3TA 3TEVA 3OIXA 1TZ9A 3G1FA 4AZ5A 1JG9A 4KKXA 3GG7A 1ZJHA 2EO7A 4LX4A 3GUWA 2YL6A 3NL2A 2XSAA 3XIMA 2E1WA 2PS2A 4C5YA 4ATWA 2PCQA 3EMCA 1KTNA 5LHFA 2TSYA 2J8TA 1DJZA 4PMDA 4LU0A 1H11A 1KBLA 2WMIB 3WFZA 3WLHA 3OA3A 4CQCA 1DL3A 4HYWA 4W7VA 2JIWA 2WZHA 3U57A 1OG0A 4UC5A 2ISFA 3R7MA 1IEIA 5JBDA 3B0VC 5JH2A 4GX9A 4GVIA 2CBJA 4PFMA 3MU7A 3R8RA 1YNYA 4B9YA 2PDYA 3TTSA 2VKZG 5IDIA 2X1UA 4MY9A 5HNUA 4CQDA 5ABTA 2DZPA 4JTIA 5CGTA 1UROA 2WMKA 1G5AA 4A3QA 1TFVA 2E25A 4IIFA 3W7MA 1HO4A 2WC4A 4DWDA 3MHGA 2DUAA 4O53A 5FI8A 2TODA 3WLIA 3VDHA 2WV8A 1GKQA 3HPFA 4PCFA 3L5AA 2Y1HA 4GABA 4A35A 3S9ZA 5CJ5A 1BF6A 1OD8A 4MUZA 4DBEA 5CPLA 2VZOA 3V35A 1LQ2A 3M0YA 3OLEA 2JQXA 2FFCA 1P1XA 3G18A 1PIGA 1ZAJA 4WCJA 4S3AA 3AZSA 1TZ7A 1EYEA 5FA5A 4O1DA 1OK4A 1EQCA 2VFGA 4GX8A 3BW4A 1TV7A 3PY2A 3UWWA 1E55A 1ZSXA 3NR0A 1I1WA 1CECA 3WLOA 3ARRA 1TPB1 1WOAA 1UOKA 1R86A 3W6MA 3W6YA 3WFLA 2B7NA 2XM1A 2BXYA 3NSXA 1SM9A 2JEQA 1RVGA 4FI4A 1QO2A 1Z69A 1OG6A 3T8LA 1DEDA 3S2CA 3EGJA 3VGFA 3F5KA 1U83A 2B7PA 3W7NA 3LM7A 2IKJA 3ABZA 5C5YA 4DI9A 1XC6A 1ZCOA 3FJNA 2NXIA 2BOEX 2IW0A 2WCSA 1AG1O 3TC7A 2OGYA 1L2QA 2ZA2A 3WF4A 3MY9A 1K4HA 3T0CA 3SRHA 5HINA 2WLYA 1ONRA 1EEPA 1WDDA 4N6FA 3MSRA 1JCMP 4M6UA 4KWSA 3LDVA 5CPQA 1OT1A 1VFOA 5A2AA 1E6QM 1RPXA 1G7VA 3L12A 3LPGA 3VMOA 2Y0FA 3NDOA 2HPMA 1NJJA 3MT1A 4Z1BA 2H3DA 4PE8A 2WJZA 2WYSA 3L67A 3P7YA 1BHGA 5DN1A 4Q7IA 2GWGA 4ZOAA 4GYPA 1NTHA 4C7DA 3MKKA 1UH2A 4NILA 1OC5A 2FPTA 3LBOA 4YXGA 1RY8A 5KEZA 3E5PA 3BMXA 4O8AA 4EXQA 1FHDA 1YNQA 5L6UA 2O9RA 3VUPA 2ACRA 5CG7A 2ZTJA 4GQQA 4GYFA 2OZ8A 4B5WA 2JBMA 3H55A 2R94A 3GKFA 3BMVA 3NGFA 5F4XA 1VCFA 3FKEA 1YMYA 3S5OA 4IT1A 4C65A 3RCMA 3NAVA 4HK5A 2Y8UA 3GBEA 3NXFA 1TYGA 2YW4A 5B80A 2OELA 2Y63A 3KP1A 1EPXA 1EZ2A 5D38A 2WVSA 3WMLA 2KZHA 3GNNA 2E5DA 1ME7A 2QUUA 2AQVA 4WRHA 1LOSA 5CQ1A 2OYMA 2X1TA 3VX1A 1LROA 4PODA 4RDVA 3SFKA 3G5EA 1FDJA 1ADOA 3O16A 3V7PA 4G7EA 3FJ4A 1HG3A 4H00A 3HJEA 4M81A 4MPKA 5BCAA 1BXBA 3CAKA 3PUEA 5LGZA 3W7LA 3W82A 2QUVA 4WDWA 4AD2A 4JX5A 4JKMA 3STCA 2P10A 2FMOA 1OX5A 2GUBA 4Y9PA 2VRKA 4R3UA 8XIAA 4AXKA 4E2DA 3M44A 3TU9A 2Z25A 1LQ0A 1Z42A 5BRPA 1VB9A 3QZEA 1AJ2A 4BWLC 3BG9A 2VM8A 1M3UA 4JHZA 1QAPA 4MWAD 2WK2A 3VOCA 3ZT5A 3H7UA 4M24A 5DQPA 4IQJA 1YTEA 2HZGA 4HTBA 4JBRA 1FXQA 2WMIA 3W25A 1KCLA 2OKTA 3PTMA 4Q4RA 1XFCA 2PURA 4IFKB 1NWUA 1S5TA 4M1RA 2CEQA 3PJTA 4QCEA 2W92A 4DO6A 3NQDA 1HKWA 5D9PA 4ZFMA 5JIPA 2QVHA 9XIMA 2BDQA 2Y5EA 4LGXA 1QPNA 1QI5A 1XXXA 2VX4A 4K7VA 1VEMA 2W27A 4Y6GA 5CC6A 2EPKX 1ICSA 1ZALA 4CCZA 4C60A 4CD5A 2FB2A 5D8WA 2G3JA 2PDBA 3LRMA 3W84A 4LB4A 3CPGA 1HTIA 4MLJA 2OZTA 4ZQOA 4CN1A 2EG7A 4JAWA 4CNUA 4IIDA 4WXYA 3PPGA 5A8GA 3O8AA 3FYOA 4R27A 4S3EA 2X1IA 1MXDA 4FNRA 1QI2A 3DDMA 3GXDA 5CGQA 2R91A 2OVLA 3B8SA 2E0PA 3SB0A 1SZNA 3UJFA 2EBNA 1ZU8A 3K46A 4IFOA 2IKGA 4XZLX 3VILA 5EFFA 1K1DA 2WC7A 2VO5A 5IXEA 4ES4A 1CXWA 4FF7A 1CTNA 1MW3A 1KTBA 4EP8C 3K4WA 3SADA 1IWBA 1TA3B 3KHJA 1L0PA 3NVDA 2XH0A 3UZZA 2EJ1A 2V38A 1THFD 3CZLA 2Y7DA 4O18A 2CZ5A 3ALFA 3W1PA 4H7VA 2WSKA 1PL9A 2NQ5A 3T0AA 2V5LA 4J3XA 5AC5A 1GYMA 3TJLA 4P7OA 1K9FA 2OZ0A 1W2PA 1VHNA 4NXKA 4CEUC 4W86A 2ZIDA 2ZE3A 1B9BA 4PTWA 3U2OA 1I6NA 2QCGA 3AICA 1WAWA 2G3IA 1J0KA 1RSCA 1REQB 3AZRA 4WLCA 2GGGA 1R7AA 1F3XA 1J4EA 4LRTA 1UP3A 3N6QA 1PTDA 3T8QA 1OFQA 3PZOA 1YPFA 1Q6CA 1BKHA 1XPGA 3FJLA 3WQEA 4RPQA 1ODZA 1VRXA 3QPYA 1QI3A 3RUBL 1M6JA 3W1LA 3WSUA 1KD0A 5TBOA 1J5TA 4IP7A 1R3RA 4R9OA 4JCLA 2UZ9A 3UXAA 2BOFX 4OQVA 4IBJA 4B5NA 1ED7A 4MSSA 3N18A 2J7CA 1EUAA 4FNPA 2PWVA 2INFA 1PKYA 5D03A 2YKKA 1XLJA 2D2HA 1QXLA 3CWHA 3EMZA 2DH2A 5EMJA 1EC8A 2C0AA 3FS2A 1ZBVA 1R3TA 4NUWA 4P5UA 1KGWA 1UA7A 2I5GA 4KFNA 3WQDA 2YX0A 3GXNA 4H9VA 2HK0A 1HL2A 5LNRA 4UTMA 1KGUA 1TCMA 4HHLA 4QAIA 3CL8A 1TVNA 2E4TA 1EA0A 2DSZA 4FAMA 1NOFA 4O1EA 4YTRA 5DEZA 5RUBA 1SSDA 1O1HA 2RKXA 5M5DA 4GOAA 4MAZA 4GUIA 3LLDA 1K9EA 3WK2A 5FD0A 3N4EA 2Z00A 4JTUA 1MW1A 3GR7A 1V5XA 3SCSA 3AS1A 1RY0A 3HPAA 3FHAA 1G4SA 3IJ9A 5F2LA 1SJDA 5IHRA 5BPVA 4DLFA 2VX7A 4O4WA 3CZKA 3PBYA 1TR9A 3G1DA 4PULA 3H2MA 1VBGA 3VNIA 2PC8A 2XN1A 3IJ7A 2PAJA 3BSGA 1O7AA 4YCOA 5ECUA 3UYIA 5K9DA 4L6DA 3D46A 4PUKA 5A2BA 2C0HA 1RP9A 4GBDA 3UXLA 3TOPA 4H8VA 3R0KA 4IFKA 2RGLA 2QUMA 2PF8A 1YADA 3U48A 1KFEA 1A5NC 1E0XA 2YB1A 1BD0A 4CU6A 3H4WA 2W6RA 1Z8AA 1HVXA 5LIKX 5AYXA 2XWEA 1ZBWA 5LXXA 3BW3A 4O14A 2FZ9A 3BK0A 4N4PA 3ABXA 4HA4A 1QPRA 1UG6A 4ZQCA 4Y8FA 4D6EA 2QJIA 3EOEA 1Y5WA 1XYZA 4DF1A 2ONEA 3E1F1 3WBEA 1E0VA 5AC8A 5DELA 3EXSA 4W88A 4PL2A 1H0GA 2RTSA 1E6PA 2J79A 1JPKA 3AMKA 4AZIA 4H41A 2CBUA 4UIOA 1NDYA 2XH4A 1Z89A 4KW2A 2MUCA 3VDCA 3WMBA 1XIFA 2WNZA 3QF0A 2DQWA 1NEYA 4JTSA 3W7GA 3O15A 4A3UA 1YXYA 1HQTA 3FYPA 4L9XA 3SRKA 1NU5A 2DY3A 1V51A 3S6DA 3OEXA 3WJYA 3S1GA 2OKOA 3T0DA 4HU4A 3WH7A 1O1ZA 4DM1A 2VOTA 1D9EA 1MEWA 2ZVIA 5AVNA 4O4VA 1F5ZA 2Q8ZA 3I4KA 4B16A 3WMCA 1XG3A 2PD5A 3NQ6A 3IIOA 4S1FA 1XLFA 1KM5A 1AQMA 4IL0A 3WDPP 4Q4OA 3K1GA 3AIUA 4WSJA 1S3HA 4LF2A 4JZ5A 2V30A 5H8PA 1T8QA 2FYMA 4S3DA 1AD4A 4AWUA 2W0UA 1BYDA 3PC0A 3PFMA 1PBGA 4QE4A 4IUOA 3GXPA 1QOPA 2O9OA 1VYSX 2FGZA 4D6DA 4UZUA 3T6CA 1KWKA 4S3GA 2HVNA 1FWJC 1F6PA 3MMDA 5K9XA 3GQYA 4BF5A 2PE4A 1E15A 1VJZA 1XDLA 1REQA 1GOOA 1D3CA 3EDFA 4XAGA 3TA6A 1MDLA 1K70A 4IUGA 1FWSA 1GQJA 3BLLA 3GDLA 1E0UA 1XBYA 3DFSA 2BLEA 5AHFA 4Q8OA 4C7FA 3DYOA 3OBKA 1K77A 1KQYA 1KC7A 2FHBA 3ZZ1A 2V3EA 1ESWA 4KBXA 1R9YA 1E9LA 3WQ5A 3GNXA 6ENLA 1G4PA 5FJPA 4NI8A 1A5SA 1BKSA 2J8FA 3GH7A 2DV0A 3L4ZA 3WLMA 1LWHA 1AH4A 2XVKA 1KR0A 3CMFA 5G4WA 5TNVA 1XPYA 4PMJA 3ABRA 3NQ7A 3WQVA 1DVJA 1GVEA 2WCAA 1Q13A 3N2BA 3QV8A 3H6OA 3UFYA 1XISA 3O6CA 1W1PA 1DE6A 3REQB 1XRFA 1VIZA 1DXFA 4U3CA 2QCEA 3O9NA 2Y6ZA 3AIRA 5CPOA 4HP5A 1LOQA 3H2NA 2YFOA 4GIYA 4KFOA 3DU0A 2OWWA 1XF0A 3ZS4A 1XG4A 8RUCA 4WEVX 4KIEA 2E77A 1P7TA 1M41A 1DJHA 3AYVA 1W5MA 4LY8A 4QDWA 1SO5A 3G2GA 1VC4A 1RCOB 2A85A 3B40A 1D2KA 3GHSA 2R1PA 1SJAA 3OJGA 3IWPA 4W5UA 3HGRA 3B9DA 2HROA 5AFDA 1Y0EA 2Q09A 1FY6A 4O13A 4C5ZA 4U33A 4LVFA 2ZRXA 2BHYA 3HPSA 4A21A 3TYUA 4IPPA 4IBCA 3EWUA 4H2CA 1DV7A 1E9IA 3AHVA 1A49A 3CL7A 1MQRA 2I16A 5EYWA 3HOJA 4JTHA 2OTDA 4ROPA 2PDGA 2DZXA 4Q7BA 1E40A 3P2VA 3LY0A 3MO7A 1D8CA 3A4AA 1MYRA 4GC3A 4AXNA 4X0NA 4KERA 5E0FA 1H2JA 5ABFA 5MKGB 1JI1A 1XI3A 5U4NA 1VEOA 3ARUA 1OX4A 4Y90A 3PP7A 3KOFA 4FX7A 2JF6A 3TN5A 3N2TA 4IQDA 4MAVA 1JGIA 1YHTA 1GOMA 1W8GA 2HCVA 2G5WA 2ZTKA 3QM3A 3E0FA 5FF7A 2BZNA 1OX6A 2V8ZA 4ZBCA 4HK7A 1OCBA 1DIDA 1I9CB 2CXEA 3TSBA 5E6ZA 1XKYA 3S42A 4E38A 1U30A 2XD1A 2VEIA 5FSEC 3GTNA 4DZ5A 3C56A 3F4VA 3TJXA 2E5BA 2IOUA 1JR1A 4JTTA 2I9EA 3RF9A 3SUSA 3WL1A 3YPIA 3G1VA 4IZGA 5C9WA 1Y8BA 2XZ9A 1JNDA 3GTXA 2J7EA 4ZTYA 2XG9A 3LMYA 2GVEA 3O1NA 1PZ1A 3UCQA 3DFOA 3EKZA 4D6GA 2VZTA 3ZWTA 1BWVA 1EJUC 4DJDC 5J5RA 1EF3A 2ZADA 4XZ9A 3K30A 1SR9A 4DWSC 4IX0A 3W7CA 7ODCA 3DFTA 3R0UA 3UGRA 3H12A 3TTEA 3AU2A 3ARWA 1KKRA 4QAWA 3GZ3A 2SFPA 3M0ZA 4AIEA 1U22A 1B57A 3PK7A 1LWIA 5A2CA 3ICJA 3MUY1 1MFUA 4J2PA 4BEQA 2CLKA 3C6CA 4D6IA 2O92A 1XBXA 4XAPA 1PKNA 3GLCA 3WD0A 3PWAA 3SUWA 2ZUMA 4J3SA 3R4IA 2QS8A 1W3HA 1E88A 1LTDA 2FPVA 2B7QA 4POCA 3EOOA 4MF4A 1POKA 4GFIA 4DJDD 4ZR8A 4C1LA 4G1NA 1TPEA 1UH4A 3HMJG 3VKJA 2DORA 2CLEA 3AAMA 4WSHA 4RNFA 1KM4A 3F4CA 4W93A 4DZAA 4S3JA 3EAUA 3MANA 5REQA 4NSBA 4AIBA 4K8GA 3LX9A 3AJ7A 2RAGA 1TWDA 4RDYA 3LB0A 3CB8A 3VK5A 3G1SA 3NM1A 4UOJA 4GVFA 1ECQA 3QLDA 4H6QA 5AN7A 1GW9A 3IACA 1OBAA 3OODA 1CEOA 2XVLA 4GRSA 1VH7A 4UFIA 3H2EA 3TC6A 4GI8A 2VFDA 4AVNA 1UC4A 1DQXA 2OLHA 2PTXA 1H0IA 3MDUA 3BLPX 3I65A 4XTDA 4FLRA 5HJXA 1US2A 5DXYA 2ALRA 1WBJA 1AQFA 4ZGYA 3L4VA 2PTZA 3P67A 1ZB5A 3HG2A 3NCOA 3UR2A 3B8DA 4Q8UA 2WVTA 3IK2A 1VBUA 2WPGA 2DIJA 3SW6A 3TLLA 4NYYA 1MVYA 1QHZA 4XKMA 3QV9A 4ALDA 4AY1A 3LTSA 1AUSL 1QNVA 5FEPA 2JKAA 5K4ZA 2EPNA 4MNKA 1LCOA 1N8WA 5I09A 5FF3A 1R7OA 4C1KA 1PS9A 4B15A 1H49A 3DH7A 3DI1A 1T7LA 1YDOA 3A47A 3B9NA 1IEVA 1PIFA 5F7UA 3HB9A 3TIMA 4CNSA 4EPDC 2ABBA 2ON3A 1TWZA 2BY2A 4CU8A 1ISVA 3UP8A 1OK6A 1O5QA 1KXHA 2PDHA 2V63A 3E2VA 4BI7A 1VP5A 5FJJA 3TQVA 1GVYA 2ZQ0A 1K9TA 1RXOB 1HL8A 6XIAA 2BS9A 5LZLA 3R6IA 3WLTA 3WQCA 3GNOA 4H8NA 4FXFA 3FKRA 4W4QA 3QTPA 4M6VA 5HMEA 1DTNA 2P8CA 3G6LA 5HUPA 4HZ8A 4B2DD 1V4YA 2G0WA 2Z6IA 4QQ3A 1YE6A 3NDYA 4AEFA 2C14A 2W4XA 4MB4A 3LN3A 2VX5A 3W1NA 3D6NA 2VCCA 4R7WA 5AB3A 4WKAA 1CX9A 3WDIA 4HCHA 3F7JA 3VUSA 1OEPA 3ANUA 2Y2WA 5K3VA 3HPXA 4ZSTA 3LD5A 1ADDA 2OT1A 2QULA 3S46A 5GNZA 5FF0A 5I23A 1JDCA 3B9AA 3DKLA 4I90A 1NWRA 2ZA3A 3M5XA 4L7ZA 3W71A 2EG6A 1U1JA 3GH5A 1CXKA 3VIIA 4WQ6A 1NF0A 4N9BA 1XLHA 1D7KA 1EIXA 2GQ8A 4X60A 2H6RA 3SCVA 3IIZA 2Q8XA 3EB3A 2RFGA 3QPZA 2F8QA 3R8GA 5AYYA 1MFVA 3AHYA 1PX3A 2X7VA 3I3DA 4JYEA 1GOIA 5CSUA 4MIMA 4XTIA 4C1NA 2E6YA 1GQNA 1PTGA 4N6EA 1GCYA 1XGDA 4QEHA 1C90A 3OYXA 1SJBA 2AOSA 2GJNA 1IXNA 4GFSA 3FW6A 3TYEA 1MNSA 2VX6A 2GDUA 4HMNA 1X97A 2VL4A 3N14A 2HISA 1H8PA 3G1YA 3BJSA 2ANUA 2B7OA 3RIKA 1GTHA 3W76A 1RV8A 1SMDA 1TTPA 1DJQA 4YTUA 1GKPA 3G1AA 5EA9A 4Z2JA 1Z32X 4AZCA 4C6KA 1DPMA 1XS2A 1R5YA 3GXMA 2A3HA 3RILA 2RDWA 2Z0IA 2GDVA 4IXXA 3S1WA 4ADTA 3THQA 3PANA 4UTUA 1ENUA 3IRSA 1TRDA 2VJXA 1RCQA 1TZZA 3PFRA 1GJUA 1OCJA 4ZSUA 1B4KA 3E2SA 3OZMA 4XISA 3JZEA 3KVJA 2E9LA 3P0WA 4ZO8A 3OLGA 5HATA 2BXVA 1DOSA 3KM8A 1C7SA 4PFHA 3PZMA 3SFWA 1BYAA 2C6QA 4DI8A 1EWEA 2PP0A 5HMDA 4RZ4A 5DRCA 4UOQA 3FXYA 4BWLA 3K8LA 3CUHA 4HHMA 1ZAHA 1OF6A 3UXDA 2QYGA 1BSIA 3GVGA 2Y7FA 4OBRA 4Y8EA 3I3EA 2A3BA 2ZICA 1CXLA 5JU6A 3T08A 3WDRA 3GXIA 4N42A 5E0CA 4XD4A 1LRQA 3DBNA 1J12A 2JIEA 2Z7GA 1NF7A 2QGHA 4R7OA 3HO8A 5AC7A 2HWGA 4Y9AA 5HJYA 2A3LA 3ID7A 4NASA 2ALDA 4WJ8A 1VYRA 1LORA 2QJHA 3W2KA 4NF7A 3TMQA 4DQWA 4ZZ9A 1WDSA 3Q67A 2D0HA 2O9PA 5CPMA 1UC5A 4X22A 1XLEA 3AXIA 3K1DA 2W79A 3MWAA 4MY8A 1E4MM 3T09A 2FKPA 3NOYA 3E0VA 4WGHA 5HAOA 4KFPA 3VA8A 1VYPX 4HGXA 3RO6A 3FX4A 2AQWA 3VIKA 4HKPA 1C9WA 1WA3A 3MPGA 3PTDA 3SAZA 4GQ0A 3MMWA 4F48A 3VOFA 1QVBA 4FZIA 2J27A 1ZS2A 1YU2A 4H8UA 1X1OA 3C8FA 3IVUA 4RDZA 3FGCB 1RZMA 1VKFA 3RFAA 2YLAA 2YOCA 1LBFA 2WANA 3MJYA 3GS6A 3LERA 1RK5A 4WKHA 4Z1YA 4DBUA 5E9XA 4AZ6A 4QJ5B 2QCHA 1F61A 4AWEA 3U3HA 2AAMA 4ZO9A 5IOBA 3GU2A 1MQPA 4L1GA 4Z42C 3PUDA 1E6XM 3DX5A 4IBEA 1BXNA 3BAYA 4RX0A 1UP0A 3B8VA 4QROA 2V5KA 2ZOXA 1F74A 1P0NA 1UJPA 2INZA 1KLZA 3SJ3A 5C70A 3LXBA 3QTGA 4GJJA 1TIWA 3WD3A 3ATZA 4E8CA 3TDFA 2OYKA 3GHUA 4E4FA 1W9UA 3K8MA 5DO8A 1HX0A 2WNQA 1FWBC 4UCFA 2BASA 3E38A 5EB8A 1E72M 1M7PA 3LG3A 4GNKB 2ATSA 1H3GA 4GIRA 3DOPA 4DN1A 1ISYA 2H8ZA 4GD0A 2YA0A 1P6BA 3TR2A 3T4CA 5HNRA 4B3KA 2RJHA 1AL7A 1QI0A 3MUXA 3RRAA 1J8VA 2PGEA 1UKPA 2VGGA 7PTDA 4O0QA 3RO8A 3SURA 1V7YA 5XINA 1PV8A 1WXZA 1H4PA 2JKPA 2KAUC 4HIBA 3VD7A 4XBJA 2E67A 1KFWA 3H7VA 4TMCA 2Z29A 2V3GA 4JR5A 1LBLA 3N2XA 2DFAA 3GFZA 3R58A 1EOMA 4LV4A 2Y2HA 1J01A 5HWNA 4JCMA 4IMEA 2EGZA 4AU0A 1TV5A 3B8WA 3VABA 4N7QA 3NDZA 3WUFA 3V0UA 1O95A 1X6LA 2Y70A 3A13A 3M0MA 3EA2A 4OIFA 4QDPA 1BQCA 3CHDA 4DXKA 2PZNA 4AMCA 4UOZA 3OZOA 1E43A 4UNIA 3TW9A 1OQFA 2NSOA 2CHNA 4PMQA 1PVNA 4QNEA 1HJXA 1IZJA 1A3HA 3APYA 4D6JA 4AZ7A 2L5HA 1S2WA 4I5UA 3L29A 3ZR5A 3KZSA 3KBNA 3NZPA 1MO0A 2INEA 4NAFB 4ERIA 3IUDA 1B3ZA 2WMGA 2PBGA 4CKQA 2OEMA 4TV6A 3R2GA 1R2RA 1UP2A 4AW7A 1YU3A 2YCKX 1JVNA 3O6DA 2F38A 2VZVA 3WN6A 1PKMA 3HURA 1HXJA 2IUZA 4JL2A 4LCQA 2PPGA 1VD6A 1JZ7A 1IR2A 1V6XA 5GQBA 1JCXA 2CHOA 2J9YA 4GG9A 1OYAA 3E96A 4V1YA 1EC7A 4WIWA 4EPEC 4REQB 1XUUA 2HQAA 3GG0A 2PDCA 3SY1A 1F8IA 3OA5A 1NM9A 4JOMA 1CXIA 2CW6A 1HKJA 4PL1A 2PLKA 1E6SM 1G1YA 3GNPA 4RR4A 4YVVA 1VFLA 1Q6FA 4FNTA 2BVDA 2YL9A 3LA4A 4HA3A 4HNVA 4IBIA 1A5OC 2V3FA 3L2IA 1PDZA 1FCQA 1J9YA 1E1CB 4LYPA 3ZOAA 3BCFA 3O7UA 1H1ZA 2OODA 2D49A 3STEA 2FH6A 3GU9A 2I9UA 3TP4A 5E93A 1EO5A 4TIMA 4IG2B 3ITTA 4LS0A 1GWJA 1WP6A 1U5JA 4DWSB 3FSTA 4IGSA 2PLCA 2VELA 3N9KA 4Z0SA 2Z28A 2V81A 3FEMA 4GQRA 1YIXA 4G7FA 1V8EA 4GLEA 1JYNA 1KNWA 2ZZ4A 3LI1A 1J0HA 4ZL1A 1X8CA 1H7RA 2VZSA 1EP2A 1QMLA 1XC4A 3C2EA 3W22A 2YXGA 1K02A 2HVMA 5TD4A 3UWVA 3HPZA 4R85A 4FNSA 5I3HA 1E6ZA 5CBIA 2D3LA 3CXOA 3QY6A 4IQLA 2D2JA 4YJ5A 4UFHA 3B3DA 4DAFA 1P43A 3URQA 3W1XA 2QCMA 1FWGC 3VCCA 1RQBA 2QMKA 3BQ5A 2PB1A 3EKLA 4IH3A 4HCLA 4YIWA 3E0LA 4GZ7A 4CD4A 2QLYA 1UZ1A 3WJSA 1QNRA 3FCPA 1OT2A 3R8HA 3VM7A 2XFRA 4QJ3B 4IFRA 1AQHA 3MDWA 3NO3A 4MZYA 4G1KA 1HJVA 5FACA 4W7WA 5H2ZA 2QVNA 1QT1A 2E6FA 2QCCA 4CQBA 2GOUA 4F0RA 3DFQA 2D73A 1TVPA 2Y88A 1WQ5A 1UASA 1JCLA 4B4FA 2BVYA 3H8AA 4AHQA 1KBBA 2J77A 3GUGA 1IEQA 3N2CA 3U5YA 4QG6A 3VMPA 2Q3RA 3QH2A 3CTTA 3W24A 5C6MA 4TX9A 3CMGA 3SGZA 1FQ0A 3B06A 4EVZA 1TCDA 3O6YX 1PHWA 1TJRA 2RHGA 2F6KA 4LUTB 2IXVA 2WKLA 2NVCA 1U1UA 2PDKA 2YJQA 1Q6DA 1KW1A 3MBFA 1Q4WA 2F7FA 1WO2A 4LCRA 4X63A 4JY9A 5E9AA 1HT6A 3FXGA 2V2DA 5I2UA 2VENA 4D6CA 3MQTA 1UHVA 2PWGA 4IGNA 3M4HA 1W9DM 1XLKA 1KWGA 4YL2A 3FIGA 2HXTA 3K13A 4KWOA 4AIUA 4UBPC 4BJHA 2FGBA 1FHLA 1AODA 1GUVA 2FTPA 4U5IA 4IMAA 1GK8A 3AHTA 4WSKA 1A50A 3RM8A 2OT0A 5BRBA 5G1YA 1S2VA 1XH2A 2TPSA 5KETA 4GVGA 2FZDA 1B3YA 2XTKA 1OYBA 1DXIA 4ASTA 3C8NA 3EEZA 3P8IA 1IZCA 3LUTA 3A24A 5IFPA 1EGZA 3FLUA 4A2RA 5HWJA 3C0QA 3FNDA 1F6YA 4LXFA 4NIRA 1EHNA 2OG9A 3KL5A 5BYWA 1DBTA 4UTJA 1EHAA 4NQ1A 5A69A 1BSLA 1XIHA 4UTKA 5FOOA 3URAA 5HQMA 4L1WA 2R1KA 1TUFA 1LP6A 3TYDA 3UXKA 2GYIA 3SQSA 5FAGA 3NZ1A 3L27A 2C91A 3HV8A 3OQEA 1E3ZA 1HGWA 3IUHA 4NJKA 1FWIC 3WG6A 3DERA 4NX0A 4Q6JA 5CZ0A 3M7WA 4N9CA 4E8DA 4R88A 3VKDA 6ALDA 2A6NA 3I7RA 3ZIZA 1X1ZA 3HONA 1AH0A 3SN4A 3P74A 3T07A 1OABA 1KFLA 4P8XA 2DT0A 2EKGA 3W7DA 2UWFA 4MFEA 5I3KA 2CITA 1VJSA 4K6AA 1JPDX 3WNOA 2DGAA 3VIJA 1TTQA 3D0CA 1P0KA 2VNCA 3AFBA 1S5NA 3F2DA 3BGAA 4IP5A 1VENA 4O16A 1XD1A 1M04A 1YBQA 4JYFA 2NQHA 1A5AA 2A7PA 1SZEA 4GZEA 4UNLA 3AROA 5KMYA 4IG2A 2R1MA 2GJRA 4DJDA 3FV9A 1EUNA 3B4UA 2ZE0A 5CXPA 4DWSA 2HBVA 3IPWA 3QOKA 5ABEA 5C2XA 3S0CA 3CQKA 4PMXA 4RPPA 1B3XA 5CZSA 3WL0A 1RLDA 4FF5A 4JIEA 2V3DA 3QR3A 4OV4A 3H24A 2D1ZA 4Z2KA 2G97A 1G4TA 5J5DA 2GSEA 4RUBA 3THCA 1IEXA 4H04A 4QSHA 4Q8NA 2NW0A 4ZODA 1R2TA 3CYJA 2GJXB 4INFA 4L56A 5E70A 5CC3A 3L0GA 4AD3A 1IIGA 3RX4A 4JQAA 5BXRA 2NT0A 4W85A 3G8RA 1V08A 5D4YA 4FOJA 1CI1A 3EBVA 1SJCA 3H70A 4CNTA 3GVWA 5D2YA 3WY1A 2OOGA 1PCKA 1H1NA 4YNGA 4UTFA 5EKYA 1Q2RA 1S5MA 3KBSA 3PB0A 3W26A 5D37A 3BCJA 4WY0B 1O5KA 2Z27A 3GXFA 2C1IA 3S1UA 3KBMA 4K8EA 4PSPA 1LOLA 5DXXA 4IIHA 3IV3A 2F84A 1W32A 1NDZA 4QTGA 5LA1A 4Y96A 1XGZA 2XVNA 2H9AA 3GTIA 1JAEA 3JR2A 3PZTA 1M7OA 4V15A 3TW6A 3AXHA 3C61A 4WOQA 3S2NA 3S8HA 3APTA 1WBHA 4FIQA 2IQTA 2OJPA 1O94A 2AAAA 3M5YA 1FCBA 1ZJIA 2C1GA 1FCUA 2DT2A 5ECVA 2QQ6A 4K2SA 2WZIA 1NY1A 1FH9A 1KGXA 3O6AA 1BVWA 3GTHA 4I6KA 4DJFC 4DY1A 1XQLA 1MWOA 2OWCA 3EB4A 4Z2HA 3TROA 1Q2SA 2DVXA 1FWFC 1JQXA 3EX3A 3NO5A 4NP7A 4B2DA 1LLOA 3DFNA 4W9TA 3WLSA 4GUJA 3AYTA 4O1AA 2HSAA 1YPIA 3VINA 3GG1A 2MANA 3PHAA 1T8XA 2BGNE 1K8ZA 3L26A 4Y9MA 2PC4A 1YU4A 3P0XA 5LIUX 4NU7A 1I0BA 1WZMA 3IJ6A 3B03A 3KRZA 1ODUA 3MUIA 3SCUA 4OBSA 1HJQA 3W38A 4C6LA 1M53A 2D24A 5BU9A 1BG9A 1PPIA 4BFAA 3PZIA 1J18A 3N3FA 2WM0A 2FN2A 3FK4A 4U28A 1H63A 5TIMA 3S83A 5K2ZA 5IHSA 4TVCA 1S2CA 4JTDA 4W5ZA 3WF2A 3NL6A 3VCNA 4N9DA 3E0WA 4JTRA 2YCLA 1XCWA 3LI0A 2H3BA 2VCAA 3KDOA 1O5XA 4IQEA 2R24A 1A5CA 2PU0A 2HBXA 1FDZA 3GB6A 2XSBA 1W37A 4IPIA 2X09A 3WQ6A 3CEUA 3HGOA 3FFSA 3PJUA 3BOFA 1F2JA 4FB7A 2Y2PA 1NP0A 1E70M 1B5TA 5FEWA 1MEIA 3KTSA 1U1HA 2DT1A 3PBGA 4F0MA 3Q4DA 3EWXA 2HS6A 3H2AA 3GSMA 3VNDA 3S6TA 3W7KA 3FKKA 2J78A 3RLVA 3E0IA 2I57A 4PTDA 4D1JA 3CQJA 4RKAA 2OQHA 4YLWA 5BWAA 4BK9A 1Z9AA 1GZGA 1QDSA 3PBVA 4IPLA 5DY2A 1GG0A 1WB0A 4PB3A 3QXBA 1G9HA 2NUWA 3W88A 1FWEC 4HZ6A 4H9YA 3FHQA 4NNBA 3TNBA 3RMEA 1YTDA 3IGXA 3HN3A 3PM6A 4L9YA 3MCMA 3FEQA 3WD2A 1K03A 1W9BM 4EANA 4UQCA 1WZAA 3TTOA 2ZUWA 4HA1A 1JZ8A 2FJUB 3TA9A 4IBGA 1XLMA 3WNPA 3QGKC 3N34A 4BA0A 1L8NA 2ISWA 1RA0A 2HNHA 3VKKA 1FCVA 2WZMA 3DG7A 2FQIA 3LV5A 2DSKA 2FFIA 3W7OA 5G2HA 4A3RA 4L6HA 3EKGA 4HSHA 3RCNA 1E73M 1NWTA 2XFYA 3R5EA 2A2IA 3K4DA 1XINA 4MHBA 1CCWB 3W73A 1E6RA 3LCWA 2E9MA 3SSJA 2DSUA 4QJ4B 2WW5A 4GY1A 1IXOA 2HK1A 4C7GA 2E6AA 2G95A 5T9BG 3R43A 3M46A 1PDYA 2YPIA 5A6TC 4KCWA 3ZJ8A 4XZNX 1FBAA 2PBOA 1CK7A 4ACYA 1AW5A 2E9BA 1ZL1A 3MHFA 3L0NA 1QPOA 4M51A 2OLAA 2OSYA 3CZ8A 3DG6A 3W37A 1ZFJA 2F6UA 5AECA 4IMCA 4MZ8A 4OU1A 1VCVA 3VIOA 3S1XA 2P3ZA 4J1OA 4CCDA 3OLDA 1U5HA 1DJNA 4RXFA 2XINA 3N04A 4JTJA 3WH9A 4NXSA 4PTVA 4OGZA 1CNVA 1BQGA 1F4HA 2ZWZA 5FL1A 3VOJA 3A64A 3KS6A 3RCYA 5C55A 2FLIA 2QMJA 4XK2A 1WOBA 3BV7A 4OJYA 2OR2A 4YS1A 1VFHA 3M9YA 3DGBA 3WDJA 1EJWC 3WLQA 3MP5A 1OGSA 1Y65A 3N2MA 2VR2A 4JPGA 2J24A 3G77A 3GDRA 4PBFA 3MKVA 5GJMA 3BLEA 4P8WA 3SR7A 4IOTA 1J96A 2RGMA 4RJEA 1HW6A 3LGDA 3MHUA 1I60A 1H7PA 5C9XA 2FZBA 4FR6A 3CQ0A 4D6HA 3D5HA 1Z44A 4LVAA 3O3RA 2FH8A 4YN5A 1MQQA 4MZ1A 4QXIA 1CGVA 1PHQA 3N11A 3W9ZA 3CMJA 3KL3A 3H53A 1ITQA 4XSLA 4B9ZA 2DU2A 2RDXA 2O55A 1J0JA 4I8DA 2WSRA 2VEKA 5BOEA 1D8WA 4GO8A 4PRRA 3ENLA 4X61A 1UZHA 1EJSC 3DESA 1DJWA 3E6EA 2Y4SA 4WX2A 2XZ7A 3G6MA 1O60A 4KETA 3UG4A 4EF9A 1O4UA 3AXKA 4I5XA 3S9IA 1E4LA 5DMNA 4I9AA 3TAKA 3WH6A 4WJXA 3SUVA 3S2MA 3CEPA 4N9EA 3C0SA 2MNRA 4MNLA 4MNJA 2JEPA 4MMWA 2VDIA 1W1B1 2C71A 5I06A 3L2MA 4FNQA 2AL2A 2J7FA 1JUKA 3OPSA 2WSPA 4IMDA 4UZSA 5TF0A 5DLCA 3ZLFA 2J6XA 2OSXA 2QPXA 4H9ZA 2GQ3A 2VC5A 3QGAC 2VXNA 2CFFA 4AX6A 1W2VA 4AQLA 3GNDA 3BG5A 4UQEA 3RX3A 4R9XA 4G6CA 4LCSA 2CLMA 2KX9A 3KVKA 3NQGA 4CQ8A 4GBUA 2PGWA 2E7FA 4ZCWA 1JFHA 4J40A 2DDXA 5DBTA 3IJIA 3LCHA 1SYTA 3LSBA 3M43A 2ACUA 3AMDA 1EJ7L 5CH9A 4QNWA 1A5UA 4LG2A 4UTTA 5K7JA 4XZBA 2WSYA 4WJEA 4YWSA 3O07A 1WE5A 1VR6A 4EACA 1HP5A 4AD0A 4H7CA 1F05A 3C3UA 4XZWA 3VGBA 4JNYA 4GK8A 3L7RA 4ZMGA 1Q6OA 2EG8A 4DM2A 2HNEA 1GYNA 3UA3A 2VD8A 2Z26A 1IT0A 1R47A 3GIQA 3BQ6A 2PDNA 1BYBA 2WBGA 2XFFA 3LHYA 1GVOA 1H09A 2VEFA 5G1TA 5BWFA 2C13A 4K7YA 1Y5VA 2FMNA 4PBGA 1R3QA 2X8RA 4GYKA 4D1IA 4M6PA 3W53A 2PEVA 2ZC8A 4MKSA 1XSIA 3ZQ9A 3MBDA 4IJBA 3PPFA 4XAYA 1E6NA 3KS4A 4KS0A 4CNNA 2CLOA 4M19A 4DUXA 4RNJA 4K38A 1VRDA 2BNJA 1WXYA 4E8GA 2W3ZA 3PG9A 4B5VA 1R3YA 1YYAA 2YA1A 3TCSA 1CIUA 5EMKA 9RUBA 3EWDA 4KGLA 3USZA 4CD6A 1IYXA 2VEMA 5EPDA 2PI6A 5BOOA 3NZGA 2PRHA 3NJ3A 1D3GA 3RM9A 4G7EB 3B4YA 3TVAA 4HMDA 4LYKA 2E5CA 5EU9A 4FX6M 5H1WA 2BVWA 4L5ZA 3VVGA 3QPEA 3EOLA 3BAKA 5KZEA 4AYSA 4OE7A 3K8KA 4IXHA 1NAL1 1BPLB 3WX7A 2PDMA 4AG0A 5CLWA 1B2YA 3PPHA 3QQ1A 3WBAA 3CPRA 4F2BA 3SQLA 4BCEA 2YBVA 2YYTA 2P8BA 1L6JA 2IPJA 5DF0A 3M1ZA 3ONCA 4GXMA 4IPJA 3CV1A 1AMYA 1FX6A 4R34A 4S3KA 1M7XA 1H7XA 3HBLA 2R82A 3BLDA 4XZIA 3BTNA 1BLIA 1V79A 4C6MA 4V28A 3JUGA 1DWIM 4C6BA 1KR1A 3V0SA 7CGTA 3HZ3A 2FZNA 4GNJA 3L68A 4NJHA 3WELA 3W1QA 4M29A 3EX4A 2YXXA 4WR3A 1JPIA 6REQA 3KWSA 2C15A 1UKSA 2WKGA 2FGLA 2VDGA 1L9WA 3M47A 4WK9A 3A6OA 1MI3A 4M6QA 5FSDC 4OOZA 2D2OA 3A4XA 4QM1A 4GZJA 2P0OA 4PZVA 4PYSA 2X7WA 4MB3A 4O0ZA 3WJZA 2DT3A 1UD8A 3HSHA 3Q58A 4J7RA 4ORMA 3NZRA 4F2TA 3NQ2A 2FDSA 4GY7A 1X39A 2BGQA 3C5QA 3HA1A 2D20A 1CZ1A 5D02A 1GHSA 1FKXA 3CQHA 5EFDA 4RV8A 1DWFM 1W9XA 1W17A 2QAFA 2IMRA 3N4FA 3QZAA 1JCJA 4G5DA 1QR7A 3L0KA 2YBTA 3ZJ7A 3SIZA 2P5NA 2TMDA 2D0FA 2G4JA 1Q6RA 3GR4A 4K36A 5AHIA 3SEPA 3N25A 3MMUA 2CIPA 3SJNA 1WKEA 3W00A 3PSWA 3ZYZA 2DP3A 3M16A 2Z2AA 4XBKA 2YL8A 5DT5A 3D47A 3FY1A 1FVPA 3T81A 5AYBA 2ZZ2A 2WC3A 2QJJA 1UUQA 4LAOA 3BLKA 2A7NA 3MZ2A 4ICCX 5GNYA 3BV4A 3JZUA 1RJRA 3B05A 1TV8A 4ZQPA 1LQAA 1YPXA 3EXTA 4MNMA 4DLMA 3EPNA 4RLIA 1JF5A 2W91A 3GZAA 2YB4A 1OM0A 4ADSA 3CT2A 4HOWA 1E1EA 4QG8A 1ZJAA 4HYRA 2A5HA 4RE2A 4GH9A 3WZ0E 3WQOA 4KIRA 1ZZMA 3R13A 1EJVC 3VX0A 1FRBA 3CV7A 1M03A 3GHTA 3ORWA 2PGRA 3VNLA 1SW3A 3RXZA 2GVYA 5AY7A 3C2RA 2G96A 3QZ6A 4O12A 3K4AA 1AD1A 3AUOA 4LC6A 4QJ1A 2PD9A 1P6CA 5ABGA 1BVZA 4IWWA 4FLQA 3ZVIA 2RDTA 3FOKA 1J93A 2CBVA 3NGJA 2OQLA 4FS9A 3A21A 4TTUA 1BAGA 1V93A 3OBEA 5DCBA 1C91A 4FR1A 2UBPC 1OIFA 5AC4A 5C7HA 1UZ4A 1BYCA 2ZX6A 3TONA 3V1PA 3HQOA 4QP0A 3G8EA 1W31A 2DW7A 4GI6A 5AZ0A 2GQAA 3VAVA 1OB0A 3RNDA 4BQ5A 2EPMX 4JEQA 3W2MA 4EX4A 2OPJA 4OWGA 1PJ9A 3O0KA 2BY0A 3E49A 1JDEA 3FJ6A 4PMZA 2J66A 1CXEA 3F5JA 5KSWA 1A4MA 4UR9A 4RE0A 2QIWA 1CLXA 1FKWA 4LC8A 3QW4B 3LS9A 1UCWA 3ISIX 3MYPA 2XWDA 3M0JA 3SRFA 1OCQA 1E9YB 2J7BA 3F1QA 2XN2A 2GLKA 4LANA 3VI2A 3BLOA 3VMNA 4AD1A 3TFXA 4GQGA 2YBUA 1FFRA 4PA8A 4MWAC 3TJ4A 2PDFA 1WDQA 4O8RA 3TYCA 2WM1A 3N3TA 1RVKA 1A3WA 2J88A 2C7FA 2FPYA 4KWWA 1ZBCA 1YDVA 3T44A 5JBFA 3A3HA 4KEVA 3UNTA 1L6YA 2BY3A 3W1AA 3NTYA 3UGVA 2DUZA 4OJ6A 1XLIA 4BF9A 2YIHA 3LCFA 3ABSA 1DIEA 1O12A 5BW6A 3VGDA 3QBUA 2BBFA 3VIGA 4NZFA 3INPA 4D9PA 2E28A 1PCWA 1VGAA 1PE1A 5CSYA 2GVGA 3GKAA 1AK5A 4RZBA 1MSSA 5FESA 1LT8A 2ASHA 2E09A 4A3YA 1ZP4A 4KRTA 3ZM8A 4O1CA 3B8IA 1ZLPA 4GPNA 1PX4A 2DZUA 1QCWA 1ZJBA 5T26A 1ME9A 2R6OA 3V5CA 1UKOA 1V0NA 2G4FA 1UZDA 1AVAA 2I56A 3OB8A 3LTYA 1XDJA 2CETA 3KOZA 4TU1A 4HPHA 5CBJA 3KCJA 4BY3A 2HS8A 3U2EA 3H22A 1ZCCA 1CPUA 1JDFA 3TV8A 1TPWA 2GSHA 1JNEA 4QBXA 2Z6JA 3R79A 1VFMA 1HF6A 3TN6A 1W1A1 2QT3A 3BAJA 3WLRA 3WQWA 4GXPA 2VDHA 4HCDA 3CT7A 3QR0A 4GE8A 1W6TA 4C6OA 2Y85A 5KZ6A 4CN4A 4AISA 2NQJA 2A4AA 3WEOA 1EYWA 2OU4A 3H2FA 4D8AA 5A8QA 5I3IA 2X0SA 3Q2DA 2WZTA 1XIIA 1W3IA 3CAWA 3DN5A 3GDKA 4PCPA 2YDSA 4GA8A 3TYAA 4PTMA 3CUIA 4CVWA 4RZ6A 4LTSA 4J9JA 3S2LA 4XWUA 3GFXA 4GMEA 3LLXA 2YDQA 3GC5A 2W61A 3GXTA 1HO1A 4NZCA 1PDCA 4OOUA 2IQ0A 3P80A 1L6SA 5DANA 3LHTA 3O0FA 3QRHA 3W3OA 3MSDA 1PSCA 4JFTA 1ALDA 1BWLA 5D9NA 5LSMA 3EX6A 1MUWA 2UY3A 4QFUA 1Z6KA 2REQB 1OGGA 3S5YA 4MJZA 2ATMA 2ZZ6A 2W62A 3U7VA 1QI4A 7REQA 1UWAA 4TUFA 5DMLA 1WZLA 1SU5A 4WY0F 1QRQA 4F8XA 4PR4A 2HEJA 2YLLA 2NZLA 1I2PA 3T7VA 2C18A 2QJNA 2DVUA 5HMFA 1UIPA 3V0TA 1WUEA 4A05A 3M0KA 3R94A 5HK4A 1YLVA 1LUCA 3EWWA 3SSZA 3H4GA 2JE8A 2GZXA 1JZ6A 2E6DA 4HNUA 1XBVA 1C8VA 1BRLA 5CBBA 4IICA 3OVGA 2J62A 1IGWA 1J6OA 3RU6A 1DIKA 3GH4A 2HE5A 4TTGA 5FEXA 2VUNA 3L2AA 4HSNA 4ZE5A 1Z7AA 1JCNA 3I6TA 3LCGA 1B9ZA 1J2BA 4AVOA 1OFAA 2QJMA 3B9OA 2EXOA 3P84A 3AIEA 2O0TA 1LL7A 2XM2A 3POCA 2WNWA 3P60A 3PZNA 4GC4A 2V5CA 1DJXA 1OVDA 2DQXA 3KLLA 3PG8A 2ZUUA 3A23A 3BH4A 4QLJA 1XYMA 2TYSA 4AY7A 4YMZA 2VFFA 1ADSA 1CT5A 4H4IA 1TX0A 1YU1A 1XW8A 3VXGA 2PMQA 1K8CA 1R0MA 2QF8A 1L6GA 3AIQA 1YRRA 1BGGA 3SY5A 3RDKA 4S3FA 2C3ZA 4KWVA 1SGJA 3S47A 3BOLA 1OFPA 3PAOA 3M6DA 4M3PA 3G0XA 4S2BA 4HZMA 1XCXA 4TXEA 3AISA 3DFYA 4YPJA 1G4EA 4DJFA 2VEGA 4Q7NA 2WZEA 4MJ2A 1KBIA 7TIMA 4UMCA 5K9CA 2DEPA 4U3AA 1C7TA 3IJQA 1KFBA 4GUHA 2X42A 2E68A 3VOHA 2OQYA 1FUYA 3D3AA 3SECA 4QLLA 5A6BD 4AD4A 3RJYA 5EMLA 4LYRA 2HJPA 4HNCA 2NLYA 2YSWA 1EX5A 3E2QA 5HR7A 4GCAA 4NNCA 1ICQA 3NQ8A 4AC1X 4HA0A 4HK6A 2F9RA 2CKSA 2CESA 4NRSA 2FZ8A 4Z1DA 2JGQA 2VCBA 5I24A 1EJTC 1P7TB 3BVJA 4P7RA 3NUKA 2B4GA 2XU2A 3PPCA 1MZHA 2ZX9A 3L5MA 2Z1WA 5D2TA 4ZFCA 1FWCC 3ZJKA 5CPSA 5HR6A 3VIHA 4W8BA 3LGGA 1NQKA 2ZXBA 5JIWA 1H51A 1NOWA 1UR0A 2YA2A 2ZKMX 3SCRA 3GD6A 3NO1A 1W56A 2OEKA 1W3LA 1N2VA 5LYRA 2VZUA 3VIPA 1SR0A 1Q6QA 2WO5A 2X0HA 4MB1A 1XSJA 5F2IA 1VFFA 5FF2A 3II1A 1DHPA 1QHOA 2VP8A 1KRAC 5ABFB 1I4NA 3POHA 5AYIA 3OVPA 1XLGA 1Q66A 3WYZA 1MMFA 4X0VA 1TMHA 2OO0A 1OX4B 4PCTA 4DXVA 3N9SA 3GW3A 2POZA 4W87A 3LHVA 3W7QA 3NYZA 5G4EA 4C90A 4WZHA 1LG2A 4OJOA 4ML9A 1Q65A 3RMJA 4FXSA 1SFJA 4GY0A 4UTIA 1BFNA 1KB3A 1GVFA 4U31A 4H01A 1KFKA 5BMWA 3FDKA 5BRQA 3KUMA 1UOZA 3BAIA 1TMQA 1K7FA 4RV3A 3A9IA 3KZPA 5LHEA 2QUNA 4UR8A 5I0DA 1VLWA 2ISVA 5ABHA 1ISZA 1HNYA 1XD0A 3PS7A 4E0CA 4J27A 3PJXA 1EP1A 1IHIA 3WK1A 1RBOB 5A6KA 3PTKA 4QSFA 1V6TA 2J7HA 3LZ3A 4Y9NA 1FH7A 1WPCA 2PTYA 2ZA1A 3MO4A 1EF2A 2REQA 1Z48A 3NPUA 1TWWA 2XUCA 1V0LA 4P7NA 2E1DA 4TMBA 4ZQNA 1DJIA 3SN1A 3JS3A 3SUTA 1RD5A 3OOQA 1W3TA 1GVSA 4MOZA 4HVXA 2HVOA 2J75A 5F2MA 3IIVA 1T0OA 4OBTA 2XIQA 4PC8A 1IEWA 5G1MA 2OEJA 4IBDA 5REQB 3B04A 2FVMA 1MXSA 1R2SA 3G0SA 3S1VA 5G2IA 2GGIA 2PGFA 4JN6A 2GGJA 2QDGA 4MM1A 2H8XA 3LYEA 2CWXA 3VGGA 3U2CA 1VZWA 3E5BA 3PUGA 3KHDA 2QNEA 3W74A 2EKCA 4Q6XA 4DNHA 5HULA 3WUEA 3RLGA 5BXSA 1OYCA 1PYMA 4JNZA 5A6AA 4MKNA 1DIOA 1PAMA 1XP3A 2CC0A 4NAEA 3T4WA 2BTMA 4B90A 8TIMA 2V2HA 1DWGM 4I8YA 3TN4A 5KZDA 1WDPA 4HB7A 2CKRA 3C52A 2IKHA 3BGGA 3NVTA 1UPMB 5CZKA 1IT8A 1TPUA 3OW1A 4X2RA 5I79A 1NH6A 2XGZA 3VGHA 3EEGA 1Q4NX 1ONEA 1S2TA 1E9ZB 3M7SA 1QW7A 1IWPA 3E2RA 3J7HA 2O4QA 3UZJA 3W07A 1GEQA 3GDTA 1U2YA 1JFXA 2DSWA 3LHZA 1CW2A 3UESA 1FA2A 1SSGA 4CU7A 4LUSA 3U2ZA 3KRSA 3ZR6A 5A8OA 4PCNA 4JTGA 1C9DA 1MUMA 4JS3A 3BURA 1GOWA 4PRWA 2ADAA 5K4XA 2WWDA 3CAVA 3M0VA 4OZOA 3N4AA 3BG3A 4JN8A 1C8XA 2PFHA 4A3HA 3QKZA 4HTYA 3UETA 3VKAA 2Q02A 4U10A 3N6JA 3LHUA 1EAKA 3V4BA 3CH9A 5HBFA 4GCXA 4UQDA 6PTDA 4XZMX 3TX9A 2WHMA 3LSCA 3G0UA 1CYGA 3WBWA 3RR1A 3F5LA 2EPHA 3N2OA 3UVAA 1UD4A 3UD6A 4QDMA 2A3AA 2ICSA 3UXIA 2J25A 1VPXA 4FX8A 4CEXC 3HF3A 3AIWA 5CZJA 2Y2GA 3HQNA 4TX6A 3WMSA 3UR5A 4X2PA 2Y2OA 4UTWC 2I14A 3NQCA 3CHCA 1AW1A 3T40A 4FALA 1EZWA 3BAWA 3RLUA 3M7PA 1TPC1 2W9MA 4XAZA 1KTCA 3DG3A 1F3WA 4C1NB 3CYVA 4PMYA 4ATLA 1HKKA 3ABOA 3GVQA 1XFBA 1NDVA 4YHGA 2ISDA 4D2JA 3ZJ6A 2V9DA 5IRPA 4DX3A 3CUFA 4Q4KA 1NVMA 2X41A 1EGVA 4WKFA 1W1ZA 5I3DA 3RGTA 1ICPA 1WNOA 4J28A 1O6IA 3VE7A 4E2BA 4J3TA 1EA9C 4KT2A 1FWTA 4TVDA 2BODX 3OZPA 5HANA 1ZPTA 3KX6A 3FN9A 3FA3A 4UTHA 4L4MA 3QHOA 4YVPA 2A1YA 2VUYA 2WVVA 5LXEA 1SW7A 4FHAA 1RD6A 4AZCB 3PULA 3OGSA 3PBWA 3MS8A 4IBKA 5JUVA 3SN0A 4XQ6A 3OZYA 4TOQA 3WLPA 2NQZA 3T2QA 3TYZA 4PH6A 1UMYA 1Q7ZA 2BX7A 3RJXA 3H54A 2FTYA 4DBWA 4UFJA 3L5LA 1M5WA 2XGIA 4GIAA 4R53A 3DEQA 3CS2A 2WAGA 3L4YA 5I07A 5H8MA 2JCHA 2AMXA 1CDGA 2OB3A 3G22A 5A8MA 4BR1A 4V33A 2E40A 4EAMA 4GHAA 5FJOA 1RPKA 4H1ZA 3W7PA 3GU1A 3GIPA 2YL5A 1V7AA 4PB5A 3HM7A 1OWQA 3BSMA 3GTFA 4PGLA 4C91A 4FSAA 3U4FA 4OJLA 1EDTA 4WDUA 4MFDA 1FWWA 2DJXA 3CHEA 1B90A 3SI9A 2VD9A 3BXWA 1N55A 1LRNA 4HSOA 1UBSA 3SY8A 3BANA 1M65A 3E12A 5D32A 4WD0A 4Q8PA 3WQFA 4LRSA 5FJIA 3VE9A 1J10A 3PR2A 3UVIA 2Y8VA 2YCJA 4KCUA 1KRBC 1FTXA 3BL3A 4I9JA 3EXRA 2J13A 1QBBA 3OO2A 3F4DA 3MI3A 4JIQA 3R0DA 2AL1A 4ZB5A 5JH1A 4JKLA 1JCYA 1XCFA 5PTDA 1QASA 1OFBA 1W5PA 4HBKA 3B97A 4AIOA 1QNQA 4JDBA 1H5YA 2VQTA 3DKJA 1WV2A 3QW3A 3NQMA 3QSTA 4JTQA 1ZBKA 2ZZ3A 3OGVA 1YDNA 4F0KA 4MGGA 5D2WA 3QOMA 1N7KA 5DMMA 5HUOA 3GY1A 4P61A 1ISXA 1TJPA 3PZGA 3SCOA 2AGKA 1L6FA 4UB9A 5CPTA 1SFSA 4OUIA 1AL8A 3QV6A 2V0TA 3MCOA 3LEPA 1CB7B 4NZ4A 1ISWA 5T9CE 5LA0A 1RCXB 3MV01 1V02A 1Q7MA 3TZNA 4C6QA 1XYFA 3UG8A 5T91A 1W91A 3A12A 5JVLA 1AH3A 5M2FX 3O05A 4JFSA 4B3ZA 3ITCA 1UUMA 1WX0A 3URBA 4IJEA 1Q5MA 4NJGA 3EWZA 1UMLA 4AHPA 3MI6A 1I2OA 4CCCA 1KCKA 3WH8A 3G1HA 3S4TA 1Q8AA 4CVUA 3ARQA 2J8GA 1Q3NA 4IIBA 5LNUA 4DYJA 4DIAA 3OLIA 3M41A 4Z1CA 4ZXOA 2NV9A 4D8LA 3F2BA 3C0JA 5I3FA 5FJUA 4H9XA 1TIMA 4EF8A 4O15A 1C92A 1YDYA 3LBCA 1PTAA 5EMYA 1HFBA 3WKZA 1OFEA 3LOTA 4Z1AA 1KXVA 4K37A 1MDRA 1Q8JA 4YU1A 4ZB2A 3H2CA 1VAHA 2V5OA 2DUXA 3I68A 2PU1A 2BV9A 1K7EA 3N9RA 3APGA 3EPOA 3ARZA 1OGBA 3NSNA 3SCWA 2NVDA 3PF3A 4WDXA 4Y9OA 3T9PA 1EOKA 3C2YA 1X6NA 1TPFA 4AZBA 4ZEPA 2F6XA 2FDMA 3ANYA 2ZZ5A 4V1XA 3EOUA 3E02A 3PZUA 3P6LA 2ZXAA 4HU8A 3WO8A 2A79A 3D3FA 1WYIA 2C19A 4NG3A 4ERAA 4JDYA 3CWOX 2C79A 3LHWA 3CV2A 1H7OA 3R10A 2NT1A 2CWNA 3TUUA 4NJIA 2WLZA 1JYWA 2GJPA 5L9FA 2VGBA 3WENA 1EDGA 2PWDA 3VD5A 4H2HA 1OCNA 1P1MA 1B31A 1T6MA 2BFGA 1RK6A 3MP4A 4C6FA 1ZNNA 2QPSA 3EX1A 3RR4A 3OHMB 2P50A 4NL1A 1S46A 4URIA 1GOQA 4MVAA 4C6EA 4OUEA 3FVDA 1W1IE 4QISA 1RHCA 3T42A 4N0RA 4HOZA 4RZ5A 1G67A 3NL3A 3TKFA 4MJ4A 1BGAA 2GWNA 2XPKA 1G6CA 3W7JA 3M0XA 1H7NA 3PJWA 4BEUA 4PMOA 2EJAA 5CC7A 1E0TA 1F4AA 2WKJA 2F2HA 3CV6A 5XIMA 4MWAA 1JIBA 2IXUA 3IGSA 1PWMA 2CLIA 1E51A 3KW3A 2WWCA 3V16A 1VFTA 2NXGA 1E1FA 1SPQA 3W7HA 3GR8A 2EHHA 4IL2A 1JD7A 3HG4A 4JIPA 2J9XA 2ZRUA 4DZIA 2FFFB 2E8YA 3RN6A 1Q6EA 1XLCA 1OFRA 4JL1A 3PBMA 3V5OA 1DKWA 3NXLA 1OINA 4LNYA 3SIMA 4XUGA 4RCXA 1XGEA 1XYBA 4G8TA 1TJ1A 2C1HA 2Q8LA 3TYBA 3DYPA 1YKWA 4V27A 3VTRA 3W23A 4AH7A 1OFDA 1SZGA 2TRSA 1SQ7A 2J9ZA 5TAOA 4KGJA 3PUOA 3CZGA 4D6FA 1QFEA 2AMGA 2PDUA 1J0YA 5C7VA 4E4UA 3OIHA 5CC5A 1VFUA 1PYFA 1UD2A 3WNMA 4W84A 1KRMA 1S1PA 1WAUA 3C86A 1QNOA 4NNAA 4Q3MA 5B7ZA 3ZLHA 4KH2A 3PZVA 4S39A 2P1FA 3EDDA 4XVEA 1GJPA 2VC7A 1OHLA 2BY1A 3E9AA 3WLNA 3K5XA 1T5AA 1BWKA 3IGHX 5U7SA 5LNWA 5FEZA 2I5IA 1XLLA 3GYCA 1XM3A 1BVNP 4XBSA 5D30A 1S39A 4XIMA 3W1UA 4JNMA 5CJNA 1U5VA 3CUXA 2DSVA 2EF9A 4HOXA 2YDAA 3IIPA 2RJGA 1B0IA 2FHFA 4WF7A 3B0PA 3WF1A 1I0DA 3STGA 1R87A 1XIMA 2PP1A 3AYSA 1ZTVA 3A5VA 5LA2A 4GH1A 4Z2LA 2J74A 1TG7A 3PBUA 2QW5A 3EX2A 4BI6A 2QPUA 1GG1A 4YCPA 3P14A 2GUYA 1SUXA 2OWXA 1QJWA 1VPQA 2JKEA 2O7SA 1JRBA 2PZ0A 3OVQA 3AIVA 1K8XA 4F66A 2O4MA 1OFOA 4GHLA 4FA3A 1MZRA 1MUCA 4CUCA 1UYQA 1XKJA 2WCGA 4QGCA 4GWEA 5EGRA 3BCDA 3TK7A 4XSMA 3STFA 4PB4A 1TR1A 3BWWA 1GVRA 5F1VA 4ERGA 1PZ3A 3TWAA 3CASA 5DMYA 4IIGA 2ZC1A 4I6VA 2ZFAA 3GBDA 1US3A 2OSWA 3UG3A 1E4IA 3WF3A 8CGTA 3VO0A 1FHVA 5HMSA 3I6EA 4M82A 3B0YA 2VFHA 4B4HA 3FA4A 5BZAA 2CERA 3L66A 3QC0A 2WXDM 2EEXA 4PMVA 4UTTC 4J3WA 2BHZA 3LK6A 1DWHM 1XIJA 4Q8QA 1JGMA 4MYAA 1Q7QA 1A4LA 1H62A 3KFTA 1QOXA 6A3HA 3LV6A 1F07A 3UJRA 4EXAA 1PB0A 3Q65A 3AS0A 5A6BA 1RBLA 4F0SA 3DZ1A 5BXPA 1TTIA 1K9DA 4HQVA 6CGTA 4LB3A 1KQZA 1OC6A 3WFAA 1I2QA 7XIMA 2XN0A 3BZJA 2XDFA 3VGEA 3SGGA 2AQOA 4A22A 5G5IA 3OGRA 3BLIA 5BOFA 5EMUA 3TCEA 5E0KA 1FH8A 1UUOA 1O66A 1ONWA 3W4RA 2G3NA 2B0MA 2PTWA 5HQLA 5D9OA 2YW3A 3FAXA 3T0BA 4AWSA 3CNYA 4QCFA 3WJWA 3H21A 3GO2A 1E56A 5DY3A 2ZRWA 2CHRA 3TH6A 1A5MC 1UQZA 3TTQA 3AXXA 3IAQA 2QEZA 4HYVA 1ML1A 2OMAA 1ZP3A 4DUVA 3HU7A 4LFYA 4UNKA 1M01A 3G3MA 4P2VA 3CGTA 2OOFA 4OTKA 1QNPA 3TQKA 4JFVA 1VIWA 1FWHC 4E2VA 3Q45A 1E4NA 2NX3A 2X05A 3SO7A 5FIPA 1QOQA 2LLEA 4PUUA 1NFPA 4UR7A 2VRJA 2Z7KA 1B54A 4DAIA 4M7SA 1GKRA 2XVPA 1LL6A 1XH1A 3ARXA 1RH9A 3RX2A 3KBWA 3DENA 1POJA 3EZ4A 3TOYA 1UW9A 3AMGA 4O1FA 4X9SA 1A5KC 4AF0B 1PZ2A 3HJZA 3OQ8A 4K3ZA 3EMQA 1V3HA 3RRXA 1ZRQA 2OFJA 4L4OA 3H23A 5GVJA 4UMBA 4AZGA 3EA1A 2YYUA 4C6IA 2CBIA 1NOUA 3NG3A 3CHVA 5HOSA 2R1LA 3TE9A 1P0EA 5IBXC 4ENLA 2ISSA 3MYOA 3I3BA 3VIMA 4L4PA 3R11A 3BE7A 1GNXA 5D9MA 4PSRA 3WBYA 3KOYA 4IBFA 3IARA 1Y7VA 3KWXA 1DORA 3QLLA 4B3LA 3UR8A 1UBPC 3OVRA