4OUIA

Structure of vibrio cholerae chitin de-n-acetylase in complex with triacetylchitotriose (cto)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
403
structure length
403
Chain Sequence
PKGTIYLTFSDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
molecule keywords Deacetylase DA1
total genus 148
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2014-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4ouiA02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4ouiA01
2E67A 2XU2A 3HFTA 1V6TA 1W1A1 3CL6A 2C1GA 3CL7A 3QBUA 4V33A 4NY2A 2Y8UA 4NZ4A 4NYUA 2C1IA 2QV5A 1Z7AA 2VYOA 2I5IA 4NZ3A 3RXZA 4F9DA 4NZ1A 4WCJA 3WX7A 3VUSA 4L1GA 2C79A 5BU6A 2W3ZA 1NY1A 4LY4A 3S6OA 2C71A 4M1BA 4F9JA 2J13A 1XW8A 5JMUA 4OUIA 4HD5A 1W17A 2NLYA 3CL8A 2IW0A 1W1B1 2CC0A 4NYYA 2DFAA 4U10A 4NZ5A
chains in the Genus database with same CATH superfamily
1SFJA 4FO4A 4IQEA 2VFGA 1YE4A 1CGTA 1QI2A 2ZZ4A 4XZWA 5AKQA 4OE7A 4E2DA 4W85A 1UH2A 4C6BA 1FWSA 3W37A 1KBIA 3I6EA 1S2CA 1CBGA 4LYKA 3GXPA 2V0TA 2FVLA 2WAGA 4XIMA 5CC6A 1DP0A 3L0NA 4JQAA 2NVCA 4NNAA 3EKZA 4OU1A 4Z1AA 1J18A 2FIQA 2AQOA 3LPGA 4KRUA 5DFAA 4NSBA 3WENA 3ABXA 5BROA 4IPPA 2WWCA 2XPKA 4K2SA 4TQTA 4LPCA 2QIWA 4MWAA 2O9PA 1TX2A 4EANA 2E67A 5D2YA 4BEQA 4GK8A 2OWXA 2ZXBA 1HKWA 3L25A 4ZOBA 5AVHA 1W5NA 5D09A 2CFFA 3E49A 1EOMA 5K3VA 4QQ3A 2UV8G 5D04C 2ZZ3A 5TF0A 1OFOA 4XZNX 4ML9A 3QGAC 2ZWZA 3OPSA 3WH5A 3UESA 2Q8ZA 3KVJA 5PTDA 1EC7A 4WCJA 4HYRA 1S5VA 4F48A 1JCNA 2FHBA 3A6OA 4ZCWA 4O52A 4US6A 4D1IA 3TYEA 3A5FA 3GIQA 3N2MA 2R14A 2Y1HA 3SQLA 3S1WA 3MYOA 1GQNA 1NQ6A 4OOUA 3TYCA 3WNKA 1QOQA 3W2UA 1PX3A 4O54A 3H7VA 4HMCA 1VH7A 5CPQA 2QVNA 1C91A 1PIGA 4M3PA 3PBMA 1W3NA 1OF8A 3HFTA 1ZAHA 3VMNA 1IEVA 3VA8A 1HVQA 4MZ1A 1DBTA 4Y6GA 2A7NA 1B1YA 4AHOA 4O8RA 2GVLA 1W9BM 1DJYA 5CPTA 2OKOA 4AWEA 2JEQA 5A3HA 4IBIA 2Y0FA 1UZ4A 1FX6A 2Q8XA 3VYLA 2B31A 3HQ1A 3AIVA 2Y89A 3CUZA 5A6LA 3DFSA 3KX6A 2HXTA 3WLNA 1OK6A 1QW8A 4HHHA 2HMCA 4ZB0A 4LTSA 3S8HA 4GUFA 1M7JA 3U7BA 4DIAA 3HB9A 3BLEA 4FF5A 4MB3A 2EPOA 3K1DA 1KKOA 3GTFA 4ACZA 1VC4A 5FJPA 4AEOA 2VC9A 4DZ5A 3MI2A 3DC8A 2BGSA 3RLGA 3ARYA 3GR8A 4H7VA 3SJNA 4TV5A 4Q4PA 2OYLA 4DWSB 2QCMA 1V6UA 4JFSA 3H4XA 1JI2A 1HXJA 2Z2AA 4FPSA 4RZ4A 1NJJA 5HATA 3JZUA 1UMLA 4B91A 1RP8A 4QQUA 1OG0A 3HBLA 1HP4A 4CN1A 2A7RA 2RDUA 3W7MA 4DBSA 3NOYA 1BFNA 3PG9A 1J7MA 5I3KA 3RO6A 5BW6A 3TC7A 5D2VA 2Z1SA 5BRQA 3KRBA 3ZM8A 1CXWA 3MWCA 3NQ6A 2BOEX 3SN0A 2WJDA 4M29A 2CLPA 4I5UA 4X3ZA 3ID7A 1RJRA 2ONEA 5GJMA 4O10A 3QPYA 4QSHA 2ACQA 2GGIA 3G0SA 3WF1A 3HPXA 7ODCA 1ZSXA 4LRTA 3MQLA 3FNDA 2PD5A 2X40A 4Q32A 4XO7A 3QZEA 3TSMA 1YPXA 1TVLA 3MHUA 3MVIA 3SRKA 4GJJA 2OQLA 2G4JA 2CU0A 1XKJA 3VK5A 1R46A 1W91A 1BYBA 2ISWA 5IFTA 1L6SA 3HSHA 1H7RA 1B3ZA 6ALDA 2RHGA 3S1XA 3WD0A 1TV5A 3AMKA 2FFIA 3SZ8A 3GKAA 2WCGA 1AZ2A 3F4WA 1ECQA 3RNDA 2I9UA 1ECEA 1OFQA 3IV3A 1VB9A 2WYSA 5H2ZA 1KO0A 1KM3A 3FDKA 4Z08A 1R3SA 4IGMA 3INPA 5CG7A 2Z25A 4HK6A 3ZQ9A 2BHYA 4BJHA 2HBXA 4LAMA 4UFKA 2CERA 2WVVB 3SN1A 4IBDA 3PSWA 4YVPA 5DCEA 3VABA 4U2YA 1IEIA 3AS3A 4M51A 4HZ6A 2WNQA 2VHLA 4Y7EA 2C8NA 1JJKA 4O53A 4RJEA 3DC0A 1J96A 4MWAB 5IHRA 4IJCA 3EOEA 3ZWTA 1Q66A 4NU7A 1M7PA 1VJZA 3A3XA 3NL6A 1HZYA 1E3ZA 3V5FA 3E5PA 1MQRA 1SW7A 2PU1A 5DY2A 3TWAA 2P8CA 1Q7QA 3LBMA 2BVTA 2O92A 1JPKA 4GYPA 4YWSA 1L2QA 2BXVA 2INEA 3AS1A 4JBRA 4S2CA 3CEUA 3GO2A 4HPGA 3K2GA 3WBEA 3W1PA 1MI3A 3O3RA 3UGVA 4REQB 3LMZA 1EYEA 2W9MA 3QV8A 2W92A 3S5YA 4Y8FA 1ZHAA 9CGTA 3MCMA 3OA5A 2OO6A 3CAWA 1JL8A 5DCBA 1W6TA 3GAKA 3SRFA 3S42A 3S5NA 1JUEA 4JNMA 4WF7A 5I24A 3UCCA 3W28A 1LZOA 2Z2UA 4JXCA 1EZ2A 1SMDA 3ISIX 5LHFA 3W6LA 5ABTA 3UNTA 3TV8A 2CHOA 4AIUA 1K8CA 3WIJA 2BDQA 1M53A 3TYDA 2ZA2A 2WO5A 3L4TA 3MSRA 4QDMA 1HKJA 4JL1A 5BXPA 4H8NA 1LUCA 1P6BA 1J0ZA 5I7GA 4GE8A 1UR8A 4PCNA 5AOUA 2ODOA 2YL8A 4J2PA 4ONVA 1FWAC 2P8BA 2X41A 1KNWA 4DWSA 3SUVA 3CTLA 2H3BA 1AL8A 1RVGA 2OLHA 4DO6A 3FOKA 1WV2A 4CD5A 1GHSA 1WQ5A 3H2FA 3VO0A 3WQVA 4UWMA 4LAOA 1DPMA 3NZQA 1TZ7A 3V4BA 4DUWA 2HJPA 1US0A 2X30A 3PJXA 1UZHA 4IIDA 3TTEA 2FGZA 3C3NA 3UY8A 3DZ1A 1SZFA 2FKPA 1HKMA 2C19A 8XIMA 1R2RA 1XS2A 2PDIA 1CB7B 3LG3A 3HGJA 1OT2A 1ZJBA 3WQOA 1P48A 1Q6DA 1FCVA 4ZO8A 4BK9A 4DI8A 3A9BA 1DJHA 1FUYA 1V51A 1ZQ5A 1XP3A 3OJGA 2R1MA 4JYDA 5GQBA 4DAIA 4RL3A 1RQBA 3ITTA 1WDWA 3J7HA 3BG9A 2Z2BA 4CLMA 4LS2A 3B8DA 4PMOA 4W93A 5M2FX 1W17A 2BFGA 1PJ9A 1XBXA 1VYRA 2AGKA 4H8UA 4JTGA 2NXGA 1B3OA 3MI3A 1W5QA 3MA8A 1UW9A 1LT8A 1TFVA 2QUMA 1U1HA 1QBBA 3D3FA 4PUMA 4EOUA 3TQKA 1DE6A 2ZQ0A 4A6GA 3W7DA 3O2LA 3S5SA 4CEUC 4D6EA 2GVGA 3MUIA 3N04A 1VCFA 4L4LA 4GJ1A 3ZS4A 1SR9A 5AC6A 4Z1BA 2R82A 1FWGC 4PTMA 3C8FA 4PMZA 4IPJA 1W9UA 5CH9A 3SUTA 3WJXA 4ATWA 3FV9A 2ZX6A 1XFCA 4C6MA 3F4CA 2FGLA 4HZ7A 2NX1A 2D2JA 1C7SA 1JDDA 1LWJA 1TRIA 2NUXA 5DX7A 1GOQA 4PEKA 1TV4A 2DZWA 4F9JA 2TAAA 2Y5EA 1JXKA 3FY1A 5D30A 3IUDA 3CWNA 1VFFA 4D6CA 3PF3A 4AHPA 5EGRA 3NL5A 4I7UA 1UCWA 4ZQMA 5CJNA 1L0PA 2PDGA 5AYIA 3SFKA 3II1A 3LY0A 3WMCA 4HOWA 4GISA 3RU8X 1KV5A 4D6IA 2RGMA 3AHZA 2P10A 4DI9A 3WQ8A 4JTJA 4IBCA 3E2VA 4NKCA 5E0KA 2PDYA 3D3AA 2WVVA 1UROA 1XBZA 1K6AA 2F9RA 2ZZ5A 1NOWA 3UZZA 4DUOA 3IJ6A 2PC4A 3B05A 4OBRA 4I90A 1I1WA 3NQDA 4PTVA 3PR2A 8A3HA 5LXEA 3V0TA 5E9AA 2J4GA 3BWWA 2Q8LA 1KWKA 3BOFA 2GGEA 2FPVA 4A4AA 4JS3A 4LY8A 5EBUA 5C54A 3TJLA 3S6DA 2XSAA 1U1UA 1PHQA 3UP8A 2VENA 2DUXA 4MAZA 3M7PA 2QCNA 1JPDX 3AHYA 1BG4A 3TN4A 1JQVA 2A0NA 5TNVA 3G2GA 3TAOA 4X2RA 3URQA 3AXMA 2ZRUA 3WY1A 2D3NA 5A1AA 2QR6A 1GG1A 3LHVA 3CAKA 3Q4DA 4GJIA 4Q8PA 2VR5A 4NJGA 1RLDA 2WMGA 3CNYA 1CECA 3A13A 2VRQA 1PE1A 1F07A 3HPAA 3V5CA 3SQSA 1KKRA 1PAMA 1UWAA 4HA3A 1M68A 5DXYA 4L6HA 4MM1A 3VKAA 5AZ1A 1TREA 2V3EA 1KFJA 3EWWA 2W0UA 3V36A 5KETA 4O16A 3ORWA 2Y2HA 4UZSA 3WJYA 3T40A 3BLOA 3N34A 3E38A 1XRFA 4UTWC 3CIVA 3W3OA 3DI1A 4AZ7A 1H7WA 1GWJA 4H9YA 1OIFA 3DAQA 2O56A 5AC5A 5EMJA 4HMEA 2BXZA 3I7RA 4GI9A 1VFUA 4LVDA 2BG1A 3G1FA 5D38A 1F3WA 3BLFA 1UASA 3EYPA 5LA2A 3ABSA 2PPGA 4DYJA 1CDGA 4KH2A 2QV5A 1PKLA 2VX5A 4PUWA 3N4EA 3OQEA 3CWOX 3ZZ1A 3NQVA 4O1AA 2ZE0A 3ARWA 1AJZA 3L4VA 1VBGA 4NT0A 3M47A 1L8NA 1W1A1 1AJ2A 5ABFA 2ATSA 4I9JA 4D71A 3NM1A 5I77A 4DF1A 3KE0A 2C91A 4Q4QA 1P6CA 5KEZA 1XIMA 1V3LA 2G0WA 3PP7A 4Y8EA 3BJFA 2X2GA 1EJTC 1UC4A 2UY3A 4PFHA 4CU6A 4HNVA 3NO1A 1QUMA 3O05A 1C3FA 2WPBA 2QUNA 2QULA 4H6RA 3N1AA 5LGZA 1WNOA 3MJMA 5E6YA 5HA7A 2RDXA 1VEOA 3LCFA 1F8IA 1XYFA 2WC7A 3ARPA 3W2NA 4JTKA 3BARA 2JIEA 3AS0A 2VZSA 3E12A 3TJIA 3RX4A 3N9KA 4C6PA 4DXKA 2ZC1A 3WDIA 3GUWA 4JTFA 2YBVA 2VMFA 3BAJA 1Z48A 3HM7A 4I7VA 4KIRA 3GNDA 1PKMA 2BZNA 1I2RA 1PZ1A 3KOFA 2ZZ6A 2Q02A 4CGTA 1MVYA 3R10A 2CITA 4O1FA 3UXDA 1XQLA 3EXTA 4KEZA 5EMLA 2Y8KA 3FVMA 4ZBCA 3T0TA 2JE5A 4O0KA 3BSMA 4LU0A 3BLKA 1YYAA 3DHDA 1M01A 1S2AA 2PU0A 2VD9A 2PE4A 3GUGA 3P3BA 4ERIA 2NWRA 4W7WA 4IFOA 4B5XA 4N6FA 3EWCA 1AIWA 2AQWA 4MY1A 3CK5A 5E0CA 1XLLA 2PWHA 4HJWA 4G56A 4OBTA 3EWYA 1A5OC 2GJLA 2Y61A 2MNRA 1C92A 5HK4A 3L5MA 2Y2PA 3T42A 3E6EA 2E6DA 1F8MA 3H54A 3FGCB 3OBAA 3BG5A 3LA4A 2IQDA 2ZZ1A 4QG6A 3ERPA 1AMKA 3N25A 1UBPC 1JYVA 3WFAA 1V6VA 3W75A 4FXJA 2EQDA 2PZNA 1K6WA 3GG8A 5EB8A 3OGVA 4W8BA 2PAJA 4GCAA 5LZLA 1XM3A 2C7FA 4DELA 1Z41A 2IKHA 2YBUA 1VEMA 5C2GA 1SM9A 3LGDA 5CAKA 1YX1A 2E77A 4CQAA 4JTQA 1L9WA 2EPLX 3PUGA 2DIEA 3EDFA 1ISVA 5C6MA 2E9LA 3P5YA 2V5JA 1BPLB 2ZDRA 2ISDA 2PTWA 2YB4A 3L68A 3TAKA 2E7FA 3KOZA 2RGLA 3E2RA 1Q45A 2Y5SA 4AF0A 3QYSA 4ENLA 4V15A 3PJTA 3H26A 1SO3A 5KZEA 1XLIA 2CETA 4QCFA 3UYCA 3M46A 3G3MA 3L2AA 3U9IA 3S2NA 3IV8A 2JF6A 4EPDC 4TX6A 1Q6QA 4P7NA 3G3DA 3R8RA 3OLEA 3TXZA 4NHVA 3CV1A 3QPZA 1H41A 3AIBA 1QBAA 1R30A 1J8VA 5JUVA 2G3JA 5G2WA 3DG6A 1EHNA 5H6HA 1HTIA 2QGYA 4O1DA 2PI6A 3GFZA 2BP1A 2BXYA 4B9YA 1B3XA 1ESWA 3CH0A 3CJPA 3CZGA 1PUDA 2RDTA 3ES8A 4FLOA 3ZWSA 3ITCA 5BRPA 1Q7ZA 4XQ6A 3UR8A 4DZAA 1IXOA 3FS2A 4O1BA 4LUIA 3VMPA 1GTHA 1TE1A 5G1YA 1A0EA 3W1AA 3HG3A 1KWGA 5BMWA 3CUGA 2V8ZA 2VFHA 4C6DA 1E43A 1T8XA 2WJZA 5HQLA 3CQ0A 2OZ0A 3BW3A 2BASA 3BV4A 3WF0A 3RMEA 3TDFA 1CXFA 2EJAA 3N14A 3TJXA 5HINA 1POJA 5AFDA 4JCMA 5HPCA 4E3VA 1TV7A 4GX9A 2JCHA 3MW7A 3TYAA 3K46A 3PPCA 3UXLA 3EOOA 1JZ2A 4LUSA 3PZGA 1KGWA 3W7HA 4IQLA 4PMRA 3WLIA 1JIBA 2XD1A 4H2CA 3HG4A 3IK4A 4WKAA 5A8GA 2AAAA 3BAWA 1DXIA 3PTQA 4MHBA 2ZTJA 3KW3A 5FL0A 4A3RA 1AQ0A 3T0DA 3EWBX 1TPDA 1Z9AA 3OZPA 3CZJA 3G8EA 2REQB 3E96A 4PCPA 2YXOA 3E0WA 2GJXA 1O5KA 2WLZA 3IACA 3WD1A 1N2VA 2FGBA 3OW1A 1IF2A 2GZXA 5A8MA 1GQIA 1UIOA 3PVFA 3A4XA 4N02A 2WJEA 2OMAA 3GTHA 1OADA 1QWKA 4EE9A 5HUOA 4PB3A 2YCKX 1F3EA 3IIPA 1R9XA 1RP9A 1JPMA 2VWSA 3P14A 3UWEA 3H2EA 4HOXA 1A80A 1NAL1 2F8QA 4H19A 1Q65A 3QTGA 4R9XA 4HSOA 5HNUA 5E6ZA 1EF3A 3PFMA 4OHQA 4G6CA 3GXIA 3DFTA 4JYEA 4MY8A 5CC5A 3UR5A 3EAUA 3MY9A 3ZR4A 1YXDA 3W7PA 4IBKA 1ZRQA 3T4CA 4H6EA 2QDGA 3FXYA 1XLHA 2BMBA 4QP0A 1SZNA 2FYMA 4W87A 3NPUA 4F2UA 2YDAA 3HURA 3GZ3A 4JD4A 4HZ8A 4DJED 4B16A 2E9BA 4AIOA 3ZOAA 5KZ6A 5DBTA 5AHMA 3NQGA 3VGBA 1OX4A 4HYVA 3FYOA 4ZFMA 2ZTKA 2P0IA 1Z3NA 3SY1A 5CGMA 3LI1A 1EDGA 4B5NA 4PTWA 3VDGA 3VD9A 4IX0A 3B9EA 4XAGA 4HCHA 3OVPA 1B3VA 1OFBA 4LNCA 1OWQA 2WMKA 3MMDA 3BLPX 1VHNA 3TLQA 4N7QA 1T7LA 5L9FA 3EX6A 1PZ3A 3GXMA 3BQ5A 3G1RA 1Q3NA 2OZTA 3EOUA 1GYLA 4JICA 1VRDA 2CZDA 3I6RA 4A2RA 3CUHA 3I3DA 1R7OA 4H6QA 1P0NA 4C6JA 1U5JA 1Q6LA 2XZ7A 4PODA 3P6LA 2PGWA 1CCWB 4H01A 2W6RA 1QPKA 1TO3A 4G8TA 3DHPA 4KCWA 4WKFA 3CQHA 1CLXA 1CLKA 2XFYA 1Y65A 3R89A 4DUXA 1W1B1 1PIFA 4XAYA 3SUUA 2XM2A 4MDPA 3C2FA 1YPFA 3TYBA 3C8NA 2V38A 3C0QA 3MP3A 2DGAA 1H61A 4P7LA 2P3ZA 2P3EA 5C0QA 2OYMA 4N9DA 3SECA 3AI0A 1TR9A 5M5DA 3VUPA 4GX8A 2J25A 1W1ZA 4B90A 1H11A 1DQXA 3BAXA 3H2OA 4GH1A 1OCQA 3SW6A 2YA1A 2LLEA 2QYGA 2V81A 2ZVRA 3T8QA 3REQA 3FW6A 3GH4A 4MJZA 1OX5A 2C0AA 4ERGA 1VFOA 3UGRA 1J10A 2DW7A 2XDFA 4GFSA 3UWUA 2NVAA 3OP2A 3RYSA 3SCWA 3HF3A 2WCAA 3UZXA 3MUCA 1BEUA 4UQ9A 1L8PA 3TC3A 3RAOA 3U3HA 4R27A 3L26A 1QI4A 3RM8A 4PMNA 1EJXC 2VD8A 1VCGA 2E4TA 3FIGA 2Q09A 1XLMA 4YPJA 2WCSA 1FWRA 1FFQA 4XAZA 1IT7A 1Q6OA 2TYSA 3BAKA 2OCZA 3PULA 5ECVA 4HP5A 1LL6A 1VFLA 7CGTA 3LNPA 1EBHA 6ENLA 4TV6A 5D4YA 3WDRA 3TNBA 2XH4A 3GWQA 4DWDA 2GDVA 5IBXC 1XLAA 2BVDA 5CSRA 1UH3A 1TTPA 4YMZA 5G2IA 2X1UA 5IRPA 4RK8A 1T8QA 2ZRWA 2QPXA 3HA1A 3WBYA 3AYVA 1E6PA 4GZIA 3AMDA 4GHAA 3FJNA 4D8LA 2DPEA 3VZXA 2WOQA 4IBJA 1TWWA 1OC5A 3RX2A 3IJ7A 1UUMA 4B3KA 2OGYA 2VFFA 2BVYA 1QNVA 4HPHA 1S3TC 4O57A 1V3HA 2PODA 3AHVA 3VC6A 2INZA 2YPIA 1KV8A 1E55A 4UTTC 4RCXA 3WLPA 2P76A 3CQJA 3RLUA 5BPVA 4NG3A 4ZO7A 3BL3A 2FZBA 2ACSA 1LBFA 3WBWA 3IIVA 2X1RA 3NA8A 2OB3A 1OABA 4V1XA 1W5MA 4PTNA 5TBOA 4RE3A 3IJIA 2H9AB 1J5TA 1B9ZA 3V0UA 1X38A 2GLKA 2ISVA 2A4AA 1H7OA 4M6VA 4CQBA 4E2VA 2FN2A 4FR1A 1KB3A 4GVHA 1BXBA 1WUEA 2CLMA 4RUBA 1NM9A 1FQ0A 3LDVA 4YVXA 5HMDA 4DF0A 2UWFA 1K9FA 4CCEA 3BCFA 5MKGA 4JR5A 1RJPA 5I2UA 1H8PA 3RILA 1A5AA 5I0DA 1P43A 1FHDA 3W6MA 5CC3A 5I23A 1TJPA 1NTHA 2XG9A 1TUXA 3WLJA 3TE9A 3BPWA 1V77A 2J7EA 1HP5A 3QMTA 4QHRA 4R9OA 1J4EA 1OG6A 2QNEA 4JNZA 3R0UA 2X0SA 3WLMA 3BZJA 4JHZA 2VGFA 4QLKA 1H50A 4S2BA 1KFCA 4IL2A 1DQUA 3HMCA 1CGWA 1US2A 2VTFA 3PWIA 4AZ6A 4C7GA 4GQRA 1RPKA 3S46A 3CHDA 3E0FA 1TPC1 4BQ3A 3FHQA 1QNSA 4IGSA 3OA3A 3TTSA 4DBEA 3P7YA 3MJYA 5XINA 4MFDA 1FOBA 4XZIA 4JEJA 1UR9A 4DM2A 4F0KA 3RJYA 2G4FA 2WKJA 4KRTA 3PPHA 2AKMA 3LNMA 1ZUAX 1RQEA 2BSLA 1BVNP 3KCLA 1J0JA 3AUOA 2QJIA 2BOFX 3E9AA 2F6KA 5GNZA 4L6DA 3LS9A 1REQB 1HG3A 4GKLA 1ZU8A 2R6OA 4W8AA 5CSSA 1KW1A 4YJ5A 1EEXA 3PZTA 5IXEA 5ABEA 3TC6A 3LTPA 4FNPA 3F5JA 4EAMA 3TSBA 1QVBA 4EXBA 3CUXA 3KZPA 3UETA 1KGXA 3W6YA 4LC8A 2QZRA 4H00A 4GH9A 3PUDA 3N3MA 2VGBA 4WDXA 2RH9A 4B5VA 5AYBA 3OTRA 3ALFA 1SSDA 2DH2A 1GOWA 4Q4KA 5LNSA 4M6UA 4GYKA 4KWUA 1XRTA 4CQ9A 3KVKA 5I09A 4IJEA 5EYWA 1EWEA 3VKBA 1O1ZA 4WXZA 2PGFA 2O7SA 4U31A 4K39A 2YCJA 4JKKA 3R43A 2PRMA 1UR2A 2OKTA 3AIQA 4HA1A 2E40A 3B04A 5GJNA 1PCKA 1HJWA 3G8RA 3RU6A 4Z1YA 3PUEA 3TJ4A 3N4AA 3R0KA 9XIMA 4J2MA 1DWGM 1VD6A 1MEHA 4ERAA 1KM4A 4UTMA 5HMFA 4LS1A 4IMEA 2PWFA 4FXSA 1HGWA 1JULA 1U1JA 4R7JA 1V3JA 5GNXA 2VCCA 3VNLA 3KBNA 2H9AA 4Z1CA 3UWWA 2ZRZA 1GK8A 4HN4A 4KS0A 2WPGA 2A79A 3CO4A 2C1HA 1U5VA 2X8RA 4GACA 4ZOEA 3USBA 3LRMA 2UZ9A 4IMGA 1XRSA 2P1FA 1OEPA 5MKGB 1XLKA 2YCLA 1W0MA 4DNHA 3W9ZA 4RNFA 6XIMA 3RX3A 4MUZA 1B3WA 2ZCGA 3DXIA 3K4WA 1MQPA 1XUUA 3F7JA 1RV8A 2WHKA 1XKYA 4S23A 4XK2A 4MPQA 4RNHA 5AC8A 1VLWA 2F2KA 4EF8A 4G9PA 1N8FA 4D6DA 3OZMA 3T9PA 3IEBA 1I45A 5CXPA 1VBHA 1ZJAA 3BXWA 1AQMA 3DEQA 4XG1A 5C2XA 4C5YA 4AZHA 5CSUA 4Q8WA 4DJDD 2XFFA 2TPSA 3E0LA 3W83A 3KBJA 2CLOA 1XGZA 4JIRA 3MO7A 1X8CA 1GONA 5HWNA 1ZAIA 3QN3A 1H7NA 3AUJA 1GXDA 2Z6IA 5HOSA 2V3FA 2AGTA 4I7WA 3ITLA 2W27A 4BKNA 4CD8A 3CIXA 4LYQA 4G1KA 5G4HC 2Q3OA 5GNYA 1XIIA 3CZ8A 2XH7A 2OEJA 3JR2A 4CKQA 2ALRA 1MUCA 3GXNA 2PTYA 3S1UA 1NU5A 4QNLA 3PZVA 1E6XM 1V02E 3KVMA 1YPIA 5J04A 3BLLA 1B9BA 3SCNA 1UJPA 4MDOA 1Q6RA 4EK7A 1OQFA 4UFJA 5E70A 4ICNA 5LNRA 5JU6A 4JAWA 4LUSB 1TSIA 3A9IA 1QAPA 5FJRA 4UTUA 3T4WA 1W9XA 3VNMA 3ATYA 3M41A 1JNEA 1F3TA 3OYZA 1E6RA 1HQTA 4PH6A 1K7EA 1YUEA 4IISA 1FDYA 3OGRA 4D72A 1FWBC 2WJFA 2Y2GA 3T55A 1W31A 3UPWA 1IHIA 1NSJA 1I75A 2DSVA 7PTDA 5BRBA 3W84A 3AHTA 4HN8A 3NCOA 2XN0A 4GLEA 1FDZA 3AALA 2A1YA 3B9OA 1OCBA 4GBDA 5T9BG 1WP6A 1E0VA 4G7EB 4OV4A 1XIHA 8CGTA 2J27A 2DSKA 1V03A 3N2TA 1SJCA 4ROPA 4JFTA 5JH2A 4FOJA 1WKYA 3R25A 4PUKA 3T0BA 1DIKA 4XUYA 4HB7A 2WHMA 3CWHA 1PYFA 4IP7A 5C9ZA 1WDPA 4C6IA 1MZHA 1BWKA 4NX0A 1UJQA 1OYAA 3L9CA 4J3WA 3ENLA 4X0NA 4DZIA 1C8QA 4AXNA 2QF7A 5XIAA 3BK0A 1PDZA 4GCXA 3GDKA 2A3LA 3N29A 1B4KA 3W26A 1IGWA 1ZZMA 1KR0A 3CL8A 1AW1A 4TTGA 3W1XA 3TVAA 1VJSA 1GGOA 1CEOA 2C79A 4ACYA 4Q4OA 5EU9A 4AY1A 5CAHA 2WWDA 5AYYA 1PB0A 3WBXA 4A05A 3BJTA 3MBDA 3F5KA 3C2RA 1PV8A 1XSJA 4A8IA 4L56A 3PJWA 3STGA 2VM8A 1XGDA 1EJVC 1V5XA 1OJXA 3GNOA 5K9XA 4ACZB 3CMJA 3GG7A 1MEWA 1W37A 3G77A 2E1DA 2W67A 3NQ2A 4PZVA 3BW2A 1LOQA 4ZE4A 3C3UA 2YA2A 3LLDA 3VPLA 4DF2A 5A6TC 3QV6A 2YCLB 3L27A 4KWVA 3ZT6A 2G41A 3TR2A 3I7QA 2Z7KA 1XCXA 1YBQA 2NQHA 2Y2JA 2XH2A 1NOFA 2PCQA 1GKPA 4P7RA 3SCTA 5DRIA 1PZ2A 5FEZA 2PBOA 2EPMX 4AMCA 1A4MA 1ZNNA 2PDMA 4UTIA 2C6QA 4JCLA 2QF8A 3B8SA 3H24A 1ICSA 1T40A 4EXQA 2Y8UA 3KP0A 3BLIA 1PTDA 4XO6A 3G1AA 4RE4A 4TU1A 2VC6A 3MCNA 2XVLA 2HVOA 2X1TA 5C9XA 1E0WA 3B9DA 1JAKA 1GOIA 3EA2A 4OJ5A 3A64A 1OC6A 2XU2A 2GOKA 3N18A 3W7JA 2WQDA 1J2WA 3GYEA 2O9RA 3M9YA 3GD6A 3ARQA 3VNIA 3E2SA 1K8ZA 3RPMA 2XUCA 1X7FA 1QK0A 1Q4NX 1HW6A 2QCFA 3C2EA 2B81A 1MW1A 3IK2A 4DBUA 3KDNA 1KFLA 2E0PA 4PSRA 3M5YA 4AUBA 3FVDA 1A50A 4B5SA 2JGQA 4J3SA 3VNYA 2QCHA 1QI3A 2D20A 5CZJA 1XYBA 4S3CA 2QJHA 4KFOA 5IHSA 1I4NA 2BVWA 1V79A 3BV7A 3LHTA 2DZAA 4R88A 5G2HA 5HNNA 3L2IA 1XBYA 4PB5A 4S3DA 4E8DA 4YNGA 4EP8C 1ZY9A 5T9CE 3LV5A 3NL2A 2CZFA 2F7FA 4A3UA 3O07A 3N2CA 4AIEA 3EDJA 5U4NA 5CZTA 1CYGA 4XD4A 5KITA 4A3HA 4S3JA 4W88A 3T44A 5LNUA 5EL1A 3QW3A 1YTKA 2W3ZA 1QDSA 4C6KA 3GHTA 3URAA 5EKYA 5FL1A 1VP5A 4JTEA 5JIPA 3E0VA 3CQIA 2EKGA 4AZGA 1UR4A 1GVSA 5F4XA 5IOBA 2V3DA 4HK5A 1S3HA 1UPMB 2YW4A 3HU7A 3I4EA 4LCRA 2FZ8A 1ALDA 5LA0A 3UW6A 2PDKA 1X8FA 2EHHA 3L67A 1OF6A 1XUZA 2GPTA 3D5HA 1R3YA 2C15A 2J6XA 1EKOA 1QFEA 4JGDA 1MW2A 2Q3RA 1CIUA 3W38A 3NO3A 3W72A 5BCAA 5DY3A 3LOTA 1DHPA 2IKGA 1J0IA 3WDJA 3H70A 4E5TA 1ZP4A 3S6OA 1W9VA 4UQCA 3GTXA 2B7PA 4XWUA 3W81A 4QXIA 4GC3A 3I7SA 2QQ6A 3PZIA 2QUTA 3NYDA 2RTSA 3TWBA 1OYBA 4IJFA 3HZ3A 4KESA 4U3AA 1QMLA 3TIMA 3LMYA 2ZFAA 4WKHA 3N11A 2Z26A 4P7QA 4D1JA 2PD9A 4P8UA 1XL9A 3FYPA 4HCLA 4ADTA 4BQ2A 3DFHA 4XZBA 4H6KA 3U2CA 1GKRA 1OC7A 3B0YA 3OZOA 3FEMA 3U4FA 1E70M 1NFGA 3CHVA 3LHZA 4KFNA 5LKYA 5C71A 2O9OA 3S2CA 4FALA 1GHRA 2NV2A 2PDPA 2Y2IA 1GVIA 2QJJA 3JZEA 1OZMA 2DT1A 2GGJA 2X7VA 3L28A 3NQEA 3THUA 1OFAA 4YYCA 1KM2A 3WFZA 3G6LA 3E02A 3MDWA 2PWEA 4H41A 2VDGA 4LAKA 4K68A 3KS8A 1MWOA 4FP1A 3O6CA 3ANYA 5DRCA 4HNTA 4NI3A 3WD2A 1JCTA 3A24A 1W3IA 5LIXX 3E0IA 1QWGA 3DYMA 3IARA 1BWVA 1G7UA 3SO7A 3OBEA 1QO6A 3ITYA 1Y7VA 2TSYA 4LX4A 4M6QA 3M0KA 1XI3A 3KCOA 5HULA 1JCXA 3DUGA 3H22A 3EWXA 1VIWA 4M82A 2QCGA 1M3UA 3RITA 1JZ4A 1X6NA 4EAYA 4JHOA 2PF8A 2YIHA 3I3BA 3AFBA 3Q58A 4WRHA 1W9PA 3UG5A 4H9VA 4GYJA 2BX7A 1KR1A 4B2DA 2OZ8A 4V33A 1YDVA 2XJ7A 3HQNA 1R2TA 5FA5A 4MYAA 3PBWA 3TU9A 3IIZA 3AMGA 1DJIA 3WDPP 3WO8A 1B54A 5EFFA 4V2XA 4E4FA 3M0HA 2NQ5A 2C13A 3NZGA 1JYWA 3VIOA 4NAEA 3T0AA 1QR7A 5H8PA 4Z2IA 4K1WA 4R5EA 1ICPA 2WV8A 3QBUA 1ADSA 3MU7A 2PWVA 2VT0A 1LLZA 1LL4A 1DXFA 3OVQA 4H8HA 4JX6A 2J7BA 4PRWA 1C8YA 1CGYA 3VZZA 3QKEA 1KA9F 2G3MA 5DMNA 1WOBA 1H51A 4MMWA 2G5WA 3QZAA 1O60A 3ZSSA 1LJYA 4JTRA 5A6SA 4PMXA 3WSUA 1TPWA 1J11A 1FWEC 2YLLA 3LZ5A 1AG1O 1J01A 1HKKA 5CZSA 1F6YA 3RR4A 2J13A 3W1TA 1GYNA 1L2UA 3D46A 3BTNA 2Y85A 2YJQA 3VNJA 4IPIA 4LGXA 5CGTA 4XSMA 1RHCA 5DANA 2Z24A 4RW3A 4GH3A 1U5HA 4L9ZA 1FHLA 2G3NA 4BA0A 1FCBA 3WEZA 3DI0A 3P93A 4G1NA 3VIKA 4ADUA 2IW0A 5T26A 4MLRA 5F4WA 5D9NA 4NQ1A 1XD0A 4NY2A 3V35A 1JZ7A 1FFRA 3PJUA 3LU2A 4YLWA 5FAJA 1S5NA 4C91A 4DBDA 2GVJA 2A21A 3W2MA 1ITXA 5AHFA 4IH3A 3WELA 4CCDA 1J6OA 3GTNA 1JGIA 4IZGA 2WVTA 1OFPA 3LSBA 4JTLA 1P6WA 2IXUA 4M24A 5F1VA 1XYAA 4QNWA 8TIMA 3MB9A 2VZUA 4MNLA 4AXKA 2DZUA 5FIPA 1KQYA 3DN5A 4IWWA 4R3UA 1HVXA 3S5OA 3NSXA 3ELFA 4FX7A 4WQ6A 1A5KC 1IXQA 3F2BA 4EKJA 2PDXA 3T2QA 2J74A 2D2OA 2WMFA 1Q63A 2QUUA 2B7QA 5B7YA 1OGGA 1TPFA 4GY1A 1XLCA 2W4XA 4K36A 3TLLA 3GLCA 2WVSA 1E9ZB 3ATZA 2R1PA 3H2NA 4F0MA 4HU4A 5GVJA 2OGJA 4UC5A 1DIEA 1T96A 1TJ1A 1NP2A 2VL4A 4NJHA 5H1WA 3LQLA 2QIIA 1TMLA 5EBAA 1UD5A 4I9TA 1QHZA 1EB3A 3TN6A 3WMLA 3JVAA 3F2DA 1OIMA 2GVYA 1SJAA 3SAZA 3WH8A 1F61A 4IX2A 1R85A 3N6HA 3R0DA 2Q01A 4J3VA 7REQB 3G0XA 4MY9A 3BQ6A 1E6ZA 4BF7A 3LCGA 2CYGA 3B3DA 1Y5VA 3IGSA 3NAVA 5K4XA 5I07A 3GIPA 2X1IA 1G7VA 3RCMA 2Y2LA 1KD0A 1AJ0A 4M56A 3PG8A 3KBSA 4HSHA 1BTCA 1LTDA 3GHUA 4LBUA 2E8ZA 5C7VA 2V2CA 1C8XA 1QRQA 2GJPA 1Q2SA 1XYZA 2AAMA 4C7DA 1ZBCA 5D2WA 1QCWA 3APTA 3IIXA 2GUUA 4NNCA 5CPMA 4S39A 4MJ2A 2RUSA 3W74A 1YLVA 4KEMA 4WSKA 1LQ2A 3WYZA 4LW7A 1TWIA 4RPQA 1KRBC 2FDMA 3EB4A 4LC6A 1VFSA 3W71A 1IE7C 4XD5A 3A12A 2WMIB 4EWND 1AH0A 2BB0A 1TTQA 3BCDA 4NIRA 4AX7A 1G4PA 2FB3A 3GW3A 3MVTA 4UTHA 2ESCA 1GVFA 4DLFA 4X63A 2Y7GA 1SJBA 1ITCA 3UJRA 3KBVA 1GW9A 1CB2A 4IPNB 5CPSA 1B30A 1FRBA 3M6YA 4XKYA 1JCMP 4AC1X 1HNYA 4ZB5A 2QJNA 2WSYA 4AU0A 3LI0A 1UKQA 4HHLA 2V67A 4N4QA 5FSDC 1KS0A 1UUQA 2J8TA 3AC0A 5FEPA 1MNSA 3W76A 2A85A 3P82A 1QK2A 4JX5A 3C56A 4ZE5A 3PNZA 1G0CA 2WSRA 4WJXA 4HSNA 1HKVA 1JUBA 1XLGA 2IQTA 5CCZA 2H8XA 1R3RA 1JAEA 1EF2A 5D2XA 1TVPA 1JRCA 2DZSA 2P88A 3T78A 3VNDA 3RCYA 3USZA 4JYFA 3LM7A 4QJ4B 2G96A 4DJFD 5AHIA 3T2OA 4MOZA 3MP4A 2QAPA 1XX1A 3CQKA 2W5FA 3GFYA 4JOMA 3W00A 3W7IA 1E4NA 1W5PA 2AL2A 3GXFA 3QQ0A 1Y8BA 5BU9A 3PBGA 4HZMA 2HWGA 2WZIA 3IANA 4UXDA 3R4IA 4Q6JA 3CUJA 2EKCA 2JKAA 3GX9A 4HU3A 3UXIA 1SVDA 1E56A 4YTUA 3WLKX 3PPGA 4C1LA 1PCWA 2QS8A 2W91A 3WN6A 4DXXA 1Z7AA 3G22A 4FIRA 1YEYA 4PFMA 3C2OA 1Q6FA 1V08A 1UD3A 4LFYA 4UQEA 4L9YA 5TQLA 4RPPA 1PDYA 4HOZA 2ON3A 3BZGA 5DT7A 5LIUX 3SY8A 4JDYA 2PDHA 4WGHA 4QLJA 4MZYA 3RPDA 4F3HA 5EMMA 2ZZ7A 1RA0A 2E5BA 4BQ5A 1GJPA 4CU7A 1OY0A 1FDJA 1K9DA 3CB8A 3DFOA 1J0KA 3W73A 1QU4A 1EP2A 1K03A 4S38A 1F6KA 1XPYA 1IWPA 2POTA 4L4MA 5F2MA 4NF7A 4AW7A 2X09A 4O18A 3SJ3A 4XBSA 4KRZA 1DORA 4TVUA 1D3CA 2XVNA 4JZ5A 1UH4A 1SYTA 2H8ZA 4MB1A 3W1UA 3WKZA 1W32A 2FPYA 2GK1A 1SGJA 4Z17A 1WA3A 1G4EA 3GIYA 4OJLA 1K9TA 2QVHA 2OWCA 4WDUA 4ECLA 5I78A 3RM4A 3SDOA 1JD9A 5HNTA 2VR2A 4A8LA 3SR7A 3TOPA 1IYXA 5DMYA 2DT0A 3MHFA 5CZKA 3SIZA 2F38A 1JF5A 3ZJ6A 2XINA 1J0HA 4Q7BA 4PUDA 4ATLA 2E8YA 2EAWA 1FHVA 1UWIA 1W9DM 2Y62A 2ZX9A 1KCZA 3IVUA 4C1KA 1KFWA 4DWSD 1VPYA 3ZJ7A 2D1ZA 1I9CB 3FJLA 1DVJA 1GOXA 1HJXA 3EMZA 3VILA 2WBGA 2V2HA 1RBAA 2D23A 2Y5JA 1WB0A 1POKA 3F1QA 3DBPA 1H5YA 3OVGA 3UJEA 4GUHA 2DY3A 5IDZA 1HJSA 1N7KA 4JEQA 1WO2A 7REQA 3CAQA 3LLFA 4GXWA 2GSEA 1Y5WA 3CYVA 1TPUA 1W3LA 1EDQA 1A5NC 3VIFA 1F73A 1UD6A 4P8VA 1N55A 1DJNA 3FSTA 2A6LA 1L6GA 5LSMA 3PZOA 3NM3A 1FWCC 1BGAA 3UG4A 1JR1A 2JALA 1GQLA 3H7RA 3D6NA 3TW9A 2C0HA 2VEGA 3OQ8A 4GIRA 4H04A 1XLDA 3DDMA 4URIA 5CKSA 3GKFA 4CCZA 4GNKB 1TV8A 4U5IA 4AHQA 1F05A 3UXAA 4AD3A 3EMQA 2CLIA 1TCDA 4O12A 3VZYA 2FZ9A 1RQHA 5BOEA 5I3GA 4B92A 1BVZA 2CPUA 4L65A 3I6TA 3AXKA 7ENLA 5JXQA 1IZJA 4XTIA 1AVAA 4X61A 3AIEA 3UZ5A 3VOFA 1LCOA 3OLIA 2D69A 3R8HA 1T99A 3VU2A 3M0XA 4C6CA 4KWWA 4W5UA 4FI4A 2PWDA 2GSJA 1AD4A 4MB5A 4N0RA 2HK1A 5A8NA 3I10A 5KTLA 4H9UA 4I5RA 1AW2A 4R7WA 2BHZA 2CW6A 4W8LA 4DRSA 3CT7A 5D05A 4IBFA 1EX1A 2GOUA 4DEFA 4BY3A 4DXVA 4KIEA 4Q22A 3WX7A 4WDTA 3L0GA 4N9EA 2ASHA 2PF0A 4GO8A 3GS6A 1HX0A 5A6AA 3KS4A 1XLBA 1ZCCA 1ZBVA 3R7MA 2MUCA 4GYPC 3LCHA 4ZO9A 2XFRA 3VD7A 5I3FA 4TX8A 1CXLA 2NWSA 3B4YA 1UD2A 2IPWA 4N9CA 1UKOA 2PDUA 2A5HA 1X1ZA 5G1TA 1RY8A 4IM4A 2ZXAA 1IR2A 4CEXC 3EWUA 2PDNA 2XGIA 4FK9A 1UR3M 5FF0A 4UNIA 1JUKA 1VGAA 4LUTA 1FTXA 3Q37A 4RW5A 5AHNA 3VINA 3H8AA 3QJAA 4A21A 3H6OA 1K77A 3A22A 5C9WA 3FJ4A 4AIBA 5C9UA 3GSMA 2DJXA 2V63A 5ABGA 1C90A 5BXRA 3NQMA 2JF7A 4OBSA 4JQ3A 4WK9A 4WGXA 5EMUA 1S2UA 1M65A 2PMQA 2NQ9A 3M0IA 4AQLA 4AZCB 1CGUA 4J9JA 4GPNA 3CYJA 1E71M 2FVMA 1RZMA 3M7SA 3F4VA 3ME3A 2FZNA 2O9TA 4L4OA 3WEOA 3SGGA 3ZJ8A 2C18A 4Q4SA 3W88A 2IS7A 5FJIA 2WVUA 4ZQOA 3SCPA 1CZ1A 1V6WA 1E88A 2ATMA 1JFXA 1GOMA 4OV9A 3ZLHA 2HE5A 4AD1A 1TPVA 4REQA 4B2DD 4O8AA 3APGA 4KGLA 3AXXA 3PNUA 4K37A 3W85A 3VIIA 3Q65A 3M44A 2CBJA 4QISA 2DJLA 2CCRA 3HPZA 3JU2A 4D9PA 1ZBKA 2OOGA 4ZVJA 4M80A 4A29A 1J93A 2Y24A 2C14A 1B4EA 2RJGA 3NSNA 3AAMA 4G2DA 2E6FA 3DFQA 1EJ7L 2J88A 3V1HA 4PMUA 5D03A 1D2KA 3MTWA 3O1NA 3C0SA 1JVNA 3R2GA 3H7UA 3AIUA 4X60A 4IMFA 1XRVA 4MJMA 1TZ9A 1W1VA 1V02A 3S2LA 4S3FA 2JE8A 1PXGA 2DSZA 4QEHA 1V0KA 3IGXA 4LVGA 1RALA 2WSPA 3T08A 1XPGA 3B9NA 1UD4A 3NNTA 1TTIA 2DSWA 1OD0A 1R3VA 3F03K 2YR1A 1EIBA 1TX0A 3NZPA 2Y63A 3S47A 3DG3A 2SFPA 4JY9A 5SWUA 4C60A 1QT1A 1ZB5A 2YW3A 4QDPA 2HXUA 1JDEA 4D6FA 4AWUA 1QI0A 5LXXA 1K4HA 1LOSA 4A35A 3NG3A 3M43A 1MO0A 3TQVA 4TVDA 2XVPA 1ZP3A 3BDKA 3UEQA 4IP5A 1ICQA 4AY8A 5F7UA 4UFHA 3P5ZA 3MBFA 1YHTA 1A3XA 2CHRA 3KOXA 5TD4A 1EWDA 1J79A 1JPIA 1TPB1 1XGEA 1H09A 4HPXA 4LB4A 1JZ3A 2O4MA 1Z69A 3LRLA 4XKMA 1KCKA 3SFWA 4JIPA 1H2JA 4UUIA 1BF2A 4GXMA 3FHAA 4O50A 4ZTYA 4NX5A 1XIEA 1WUFA 2DT3A 3FN9A 1ISXA 2YFNA 4JPGA 1NIUA 1S2TA 1QO5A 3UVAA 1VKFA 2VCBA 4PMDA 5LHEA 1JDCA 5FJTA 4EPEC 2OPJA 1I0DA 4RV3A 1NFBA 3ES7A 2VEIA 1KBBA 5K9DA 1IQ8A 3N13A 3IGHX 4HNOA 1GOOA 1O66A 3CMFA 3F4NA 4IICA 2VVSA 5C2CA 2H3DA 5DMLA 2X1SA 2WC3A 2HBVA 3ITVA 1DQWA 1XHGA 1E4IA 3WDHA 4BI6A 4CNPA 3N9SA 1F7BA 2Z1VA 1E0XA 3CMGA 4C6EA 2A3CA 1KCXA 3GW0A 1BHGA 3S9YA 1JZ6A 3ZLFA 1NH6A 4W7VA 2FHCA 3WCZA 1H4PA 3TH6A 4DJEC 2GWNA 3UJSA 4GHRA 3EEZA 4LUTB 2XGZA 1G5AA 4DNMA 2QMKA 3LCWA 2Q6ZA 4GABA 5G1MA 1LWIA 1W56A 3THQA 3M5VA 1RPXA 4LS0A 2F6UA 3SCQA 4EPBC 4TX9A 3W27A 4OGZA 3QR3A 1NP0A 1LQAA 4QAWA 2QW5A 3W87A 4XIAA 1N8WA 4AEFA 3W70A 1YNYA 3LX9A 2VR4A 2CBVA 1Q6EA 4X0VA 4PUNA 2IUZA 4F8XA 3TONA 4W5ZA 5HUPA 3MUY1 1NF7A 1YNPA 4H7ZA 3B06A 4K7VA 4P8WA 1JDFA 3M07A 2EXOA 5KMYA 4U5KA 4WZHA 2OEMA 4H7CA 1XSIA 2YLAA 1IWAA 2YDSA 1DJGA 2DQWA 3RIKA 3OYXA 1LDCA 9RUBA 4QROA 4F40A 2O7QA 3UR7A 3S4TA 3GU2A 4HVXA 2CLEA 1OYCA 1UWQA 4RDWA 3TZNA 3ABZA 3LD5A 3VNZA 1ME8A 4HNLA 2F84A 2QXWA 3SRHA 4KKXA 1EGZA 1XCFA 3JW7A 3FFSA 4AISA 5JIWA 4I6KA 4R34A 3BLDA 3AZRA 3AQUA 3KWSA 1JI1A 1TB3A 4FOUA 4D8AA 1XWYA 4C5ZA 3T07A 2DVUA 3WK1A 4OUEA 3N17A 4HQVA 4FNRA 4AYGA 4PULA 4A2SA 1KXTA 2W79A 1PHWA 3AYSA 1F74A 1GUVA 5T8GA 5FCZA 1MXSA 1IIHA 2JK2A 1RAKA 2HV5A 1DWFM 4UOJA 1B57A 1BGGA 1E72M 5HNRA 1BAGA 2EF9A 1V6TA 4NI8A 5A95A 2V5BA 2A3EA 3UCDA 3SCVA 4JIHA 1SW3A 3N2BA 1KM0A 3QHOA 3UU0A 4AG0A 3S83A 3PANA 3VMOA 2WKGA 5BU6A 4UMCA 1TYGA 1Q8AA 2NSOA 2XIQA 3FYYA 5DLCA 1W5OA 3L65A 5HR7A 5ABFB 4KFPA 4BR1A 1W2VA 3OHIA 2A2IA 5JQ9A 1N8IA 4QBXA 1GVOA 4QR6A 4Y9AA 1IIGA 4DPQA 3N6QA 4AYSA 2CKSA 5DCDA 5F1UA 4GQQA 1OB0A 3MKKA 4XISA 1RD5A 3OODA 1I2QA 1PYMA 3KHDA 4J4KA 4P7OA 1AA1B 1D7KA 3P0XA 1X6LA 4GQ0A 1J6PA 3TOYA 3AWNA 3ZXWA 4Q7IA 2XM1A 1I2OA 3QOKA 4FXFA 5CBBA 4FOKA 1YXYA 2CKRA 3B8VA 2PLJA 2JEPA 1V0MA 3NTYA 3L4YA 3GM8A 4LV4A 5LA1A 3M16A 3DHFA 3ABOA 1YU1A 4ZR8A 3GY1A 3PS7A 4I3GA 2BY0A 3K8KA 1YU0A 4EACA 4RXFA 5GJPA 1UZDA 4UFLA 3TW7A 5IDIA 2VRKA 4I5XA 4EXAA 5JBEA 2ZIDA 5JH1A 3AHXA 4HPJA 4A8RA 2A7PA 1W3TA 2OZ3A 3IUHA 1RCXB 3P8IA 1OD8A 5I06A 1X7IA 2GFTA 4HGXA 3EB2A 1A53A 4EIVA 1OHLA 3UZWA 4QJ3B 4AD2A 3PWGA 5BZAA 4QJ1A 1EO5A 3M64A 3EX1A 4Y9OA 1UUOA 3FXGA 4F9DA 3VUSA 3SADA 4GHLA 4FX6M 1VBUA 4PTDA 1X1OA 2FZDA 4DUVA 2E6AA 1FH8A 3GVWA 2ABBA 1AFSA 1UD8A 4NAFB 3GU9A 4HBKA 1XD1A 1J5SA 1Y5XA 4DYKA 2J78A 3URBA 1LORA 5JBFA 4UB9A 3WQ4A 1BTMA 1A4LA 3S6TA 3M0MA 4KF1A 2WNZA 5AZ0A 4US5A 5G4EA 1I6NA 4D2JA 3OG2A 4TOQA 1J0YA 4MNMA 4GG9A 2VELA 1P5BA 2F2HA 4WEVX 3OLDA 2QLYA 3GE7A 4QG8A 3VOHA 5FF2A 3IGUA 2VYOA 4Y9NA 1B0IA 1MDLA 4WXYA 3OZYA 1A0CA 3LHUA 1LRQA 1BSLA 3LLXA 5CSYA 5AYZA 4Q33A 4DO5A 3UZYA 1KBLA 2DV0A 1WBJA 4O17A 3WQCA 4GBUA 3EA3A 3I65A 4JN8A 3B8TA 3QSTA 7A3HA 2D73A 3WLTA 5DF0A 3TYZA 4QX4A 3WNLA 1IXPA 2DZPA 5A5WA 2R91A 3RXZA 4A3QA 1TA3B 1XIJA 2VCAA 1GTEA 1IEXA 2NV9A 2J75A 1PKYA 3TTQA 1XLFA 2ABAA 3VXGA 1PSCA 3AMCA 4AF0B 4DM1A 4H9ZA 3WLHA 4FHAA 2D3LA 3SEPA 4M7TA 3W82A 1GVRA 1EOKA 2BY2A 4NXSA 1RY0A 4HT3A 2VZOA 1XSKA 3TTYA 1GVQA 4QCEA 4LH8A 1H3GA 3NOEA 4LT9A 2HSAA 4ZFCA 2ISFA 4EF9A 3VFLA 3CV2A 1I2NA 3LPOA 4IFKB 2YL5A 4WLCA 3QHMA 2FJKA 2J8GA 1UA3A 1SO6A 1OVDA 2ZXDA 2B0MA 4O11A 4YTSA 1MXGA 2YXXA 3QW4B 3VFCA 3FCPA 4NVTA 3F2CA 2E68A 1M7XA 5HJXA 3VGDA 3VDAA 1T0OA 1ONWA 6TIMA 2C1GA 4AWSA 1G4SA 1JCYA 4RZ5A 3VAVA 2OLAA 1AH4A 4LB3A 5D32A 4ICMA 1DE5A 2QCLA 1T41A 4FSAA 4OQVA 4E0CA 4PMVA 2RJHA 5HAOA 1TWZA 2XSXA 3IUIA 3GBDA 5B7ZA 2AMGA 4QE5A 4US5D 4J40A 2C3ZA 2E5CA 3BG3A 3CIWA 1EIXA 1SZRA 3VTRA 3IWPA 1XJBA 1Q4WA 1ITUA 1RH9A 1WAUA 5G5IA 3FAWA 3GXTA 4UR9A 3L0KA 1XISA 4J3XA 4DBWA 2J7FA 2CC0A 1OGBA 2NXHA 5T91A 2WB5A 3H55A 1YDOA 3N9RA 4YCOA 4GY7A 1UR1A 4M6PA 3WLOA 4FXRA 2RKXA 4MKNA 5H8UA 5HPOA 3CPUA 2XGBA 3AICA 3VIHA 1FY6A 3L5AA 4UQAA 3QGVA 3RRAA 4UTJA 3VDCA 3ZIZA 3HPSA 3GHRA 4UIOA 1E6NA 3I68A 2AKZA 1TELA 1YXCA 3B4UA 4J1OA 5A8OA 1JYXA 3ARSA 2Z0IA 3KOWA 4GO9A 2V9DA 3O6AA 3DKJA 3RN6A 3V16A 3Q2DA 1O4UA 2BOGX 4NAFA 3N73A 1LT7A 3FKRA 1X98A 3VIPA 1ODUA 1AUSL 3BUVA 5I5RA 4WY0A 3H2MA 1YNQA 2I5IA 3W25A 2VP8A 5CC7A 3VD4A 4LEQA 4TIMA 4PMJA 1W8SA 3EEGA 3G1SA 3RMJA 3RGTA 4GC4A 4C1NA 1F3XA 3IPWA 1K7XA 1F2JA 4YVVA 4Q7NA 1DJXA 1NDVA 1KRMA 2F61A 3QQWA 2F6XA 1EPXA 1UOKA 2G8ZA 3ZT5A 1D3GA 4HHMA 3W1NA 2EJ1A 2I5QA 3VCRA 2WBKA 2PDCA 1IGSA 4PCFA 3NJ3A 5A2BA 2VUNA 1IT0A 2GJXB 4K1GA 3PPFA 3S1VA 3TCSA 4HNNA 2X16A 4OJPA 3G1HA 4HMNA 3IIOA 3TR9A 3CV6A 1WZAA 5K7JA 1YU3A 3DH7A 3LBOA 2YZ5A 1PKNA 2BNJA 3EXSA 1ONEA 1XF0A 4WJ8A 2ZUNA 1X1NA 3VOIA 2NLIA 1LG2A 4OJYA 4QGCA 3VGFA 3WNMA 4GKTA 3VVGA 4WX2A 1K3UA 3DESA 2D0HA 1TJ2A 3CUFA 4ZQPA 1I0BA 2DUAA 2XVKA 4MYXA 1ZLPA 1ZL1A 1ISWA 4IIHA 3RDKA 3RCNA 3W24A 3T09A 2ZZ2A 4CQDA 2GGHA 4FNQA 3STCA 3O0KA 3SURA 2PP1A 4WUIA 1NELA 2HQAA 4OKDA 3O06A 1SO5A 1A47A 1UQYA 4RNIA 1H60A 1U33A 1RJQA 2TRSA 3GVRA 1K9EA 3AJ7A 4CU8A 1D9EA 3DENA 3PM6A 1CT5A 4IGNA 3ARXA 1OX4B 4XZHA 2NQZA 3BICA 1KXHA 4JQ4A 1CNVA 3STEA 4PMYA 4ORIA 4GY0A 4U10A 3H12A 3NSMA 1C7TA 3NGFA 4DY1A 4ZMGA 2NVDA 4WVXA 4KBXA 3MUXA 1DXEA 3EX3A 3L12A 2QUVA 3RUBL 2E28A 4Y9MA 3VX1A 4ES4A 5L6UA 4I9MA 3W22A 1IV8A 3WK0A 4UTTA 2V5KA 2CZVA 2I7GA 1IWBA 3QY7A 1I60A 3TMQA 3KBMA 3BMWA 1JNDA 3LBCA 3GG1A 3PC0A 4MNJA 1IXNA 1A5SA 2A3BA 1KXQA 4W86A 2QGHA 1UB3A 3KBWA 3QF0A 4J7RA 2A3AA 2YYTA 3QY8A 2W63A 1V8EA 4MWAD 4GZ7A 3OIHA 4YHGA 1VRXA 4E4UA 1N82A 2C16A 4LSBA 3W1MA 2PGEA 1XYCA 1B5TA 4OOZA 1AW5A 1KTNA 3CPGA 3O15A 1GORA 3CZLA 3F5LA 2JQXA 3QZ6A 3S2MA 3KRZA 2BS9A 3C2YA 4WY0B 1K4GA 2WW5A 3V7PA 1EXBA 2G50A 4MWAC 1P0DA 3U2ZA 2OODA 3REQB 1FWDC 4F0RA 3POCA 4D6JA 3HGOA 3NZ1A 3QXBA 2XIJA 4BF5A 2J9XA 1GOKA 3BURA 1XDLA 2GGGA 1S1PA 1PWLA 2XZ9A 4IG2A 4L64A 1T6MA 4N42A 5HMEA 1M9HA 4ZSUA 3VKDA 2OT0A 1SMAA 1E0TA 2PCEA 2EG6A 3O9NA 1EZWA 1QTWA 2RFGA 3W2LA 3W4RA 4LUYA 2I16A 3RFAA 1C9WA 2HTMA 4UMBA 2FB2A 4NZ3A 2XFWA 1EGMA 2ZRVA 4GQBA 2PRHA 2DZTA 5LIWX 5CJ5A 5FJOA 4AD0A 6REQB 2D0FA 4UR8A 4IQDA 3SCOA 1E9LA 3RF9A 1WZKA 3W7NA 4Q8UA 5AVNA 3W7EA 3M0VA 2DW6A 4HYWA 1BXCA 3C52A 3BGJA 3OB8A 3KXQA 4M7SA 3KM8A 1MUWA 2UWXA 1EEPA 2FH6A 3U4AA 1H0GA 3W7LA 4I6VA 3S0CA 2XN2A 2VOTA 2XIBA 4PSPA 2YDQA 4UTLA 2O55A 4W4QA 5CPNA 1U30A 1CXIA 4NZFA 3W53A 1R5YA 1E6QM 2FTWA 4K7YA 3RLVA 3LK6A 3UCQA 2VZVA 4IL0A 3LYEA 4UTWA 4UFIA 2GJRA 3A3HA 1M5WA 2CEQA 4B5WA 4NRSA 2CLHA 5BOOA 4E38A 4I8YA 3O63A 3NWRA 3VKCA 1WXYA 2Z1BA 2FLIA 1B31A 2V30A 3P84A 1PWMA 1O95A 2Y6ZA 5D8WA 2ZVIA 4PRTA 1BVWA 4XB3A 5HJLA 3CT2A 3W1RA 2DDXA 3NQ8A 1S46A 1BYCA 1FHUA 2E1WA 4Q3MA 3TK7A 1QW7A 4ZEPA 2I9EA 1HJVA 1OFDA 4IFRA 9XIAA 1E9IA 3UA3A 2BWGA 4LAZA 4FF7A 5J5DA 3NXFA 2YXGA 1OCJA 2HDJA 2QPSA 3H2CA 1RVKA 2OYKA 3NEVA 2PB1A 2DORA 3KDOA 2Y7FA 3GYCA 1WKEA 3IJLA 4KGJA 3TTOA 3AXHA 1KLYA 3JS3A 1R3WA 3TKFA 1RR2A 1LQ0A 1PX4A 3ITGA 2RAGA 3QLDA 4LALA 2ZUWA 5FKYA 3G24A 3WEMA 2PLMA 3ARTA 3KTCA 1PX8A 1U22A 2EPNA 3C0JA 1W3HA 5CBIA 1W1TA 4NZJA 1R47A 5I3DA 3FKKA 4ICCX 3KUMA 4HU0A 3GVVA 2P53A 1MMFA 2G3IA 2X0YA 3EXRA 5A2AA 5REQA 1PVNA 1LLOA 3MT1A 3WNOA 1VCVA 3K13A 1HJQA 4A22A 5EMYA 2YCIX 2V82A 2PTXA 3DIPA 3O8AA 3SIMA 3WBAA 1FWHC 4QFUA 2OLSA 3XINA 4XAFA 4AZCA 5AHEA 1R86A 3TFCA 5FD0A 5AN7A 2Y2QA 2OFJA 1XICA 2FTPA 5HMSA 2E3ZA 3M0YA 3W7KA 4UTKA 4J5NA 3BGGA 4LY4A 5A8PA 1VIZA 3P0WA 2GWGA 2XIMA 2HVMA 4HTBA 4IG2B 2PWUA 5CZ0A 1G94A 2ZUTA 3GDRA 1LROA 4O14A 4KW2A 4E4PA 4DX3A 2OG9A 4X9YA 4D6GA 1QXLA 1V3IA 3S3GA 2XISA 1MDRA 4HNCA 3K8LA 2JBMA 1C93A 4DJFC 1G1YA 1O94A 3ZT7A 4H9MA 2X2YA 1TZZA 1EC9A 1WE5A 2FHFA 2YKKA 1ML1A 2DIKA 2HVNA 2FH8A 2QJMA 3QQ1A 2EPHA 4GFIA 3PB2A 3B0PA 4RV8A 1YDNA 2V68A 4UOQA 4RDYA 2QHAA 3R79A 2OELA 4RKAA 1RD6A 3WNNA 4XZ9A 1EHAA 2B4GA 1GEHA 1WDRA 1JFHA 1AODA 1YTEA 3QV9A 4HK7A 4A3YA 2ZKMX 1ZPTA 4H8VA 5ENLA 2D0GA 1TMHA 4Y2WA 1SJDA 1V0NA 3MV11 4JIEA 3L5LA 4HA0A 1AQFA 1J9YA 2RDWA 1SFTA 6REQA 5KZDA 3CL7A 5LNVA 3ZVHB 1NWRA 4ZOCA 4GI6A 2VEFA 2ZBTA 3BVJA 1LWHA 5D37A 1S2WA 1EXPA 3MSYA 3AYTA 4B4FA 1R3TA 1VFTA 1DJZA 4UCGA 4CNSA 4IJBA 4LWWA 3QFEA 3IJQA 4QJ5B 3NUKA 1ZAJA 1P7TA 1BXNA 3S5ZA 3VKJA 2G37A 5CQ1A 3W01A 2AL2B 5K9CA 1R6WA 4W84A 3H23A 2DZBA 3EPMA 5K4ZA 2HRWA 1XLEA 3GNXA 3GNPA 5D9MA 2WZHA 1TRDA 1E51A 1OGSA 2JKPA 4C90A 3QEZA 3WLRA 4IBGA 4OJ6A 3WQWA 4GQGA 3FA3A 3N15A 5M17A 1V7AA 3PAOA 4EWJA 4IGHA 1NWUA 4OUIA 4RX0A 3EOLA 4TUFA 1JF6A 1EFZA 2VFDA 4GWEA 4LG2A 3AYRA 3PBYA 1WCGA 4CD4A 1NDYA 2J47A 5HXMA 1EC8A 2BY1A 1ENUA 2VFEA 3BANA 2HNEA 3KL5A 2GQ8A 2QDDA 4RZ6A 3UFYA 3HIJA 1HUVA 2OQYA 2I57A 2C71A 3LQGA 3G18A 3AIWA 1X97A 4D8ZA 2VX4A 5M3WA 1TJRA 4Q8TA 3CAVA 1DWJM 3AROA 4K38A 4XAPA 3RM9A 4JL2A 4R53A 3WUEA 4S3EA 3FKEA 1E1EA 1Z8AA 4UQDA 1LM1A 4K3ZA 4MGGA 1VHCA 2WXDM 3EPNA 3SCUA 1Z89A 2HS6A 1NVMA 2WNNA 1KCLA 4FLSA 1GQKA 1TV2A 4C7FA 1RUSA 5J8LA 3WZ0E 1WX0A 2ZOXA 1UHVA 3T05A 4M1RA 3LPPA 1UIPA 3THCA 3DBNA 4N9BA 4QS5A 3SGUA 4KT2A 3NVDA 2O4QA 3CC1A 4IOTA 1PTAA 4LOCA 3DHUA 3CBWA 4O1CA 4PGLA 4JNYA 1QPRA 5AY7A 4IPLA 1P4CA 4KCVA 5C7HA 5REQB 3GFXA 4QEEA 4ZODA 1WYIA 3QH2A 1GJWA 1G9HA 1VPXA 5BWFA 3WL0A 1M1BA 3CM4A 3TUUA 5A8QA 3AXIA 1KM6A 1XIBA 3TQ0A 1CGVA 3VKKA 5F4SA 3HGSA 1UYQA 1OT1A 4L61A 4J3ZA 3COTA 1BSIA 3BE7A 3ZO9A 1D3HA 3DERA 3WQEA 3AOFA 1JEZA 2NW0A 4AX6A 3CS2A 2JGYA 3OU8A 3D0CA 4G7FA 2ALDA 2XWDA 3LXBA 2PBGA 1E9YB 1GVYA 2V3GA 4Z2GA 3FEQA 2DZXA 3ZR6A 4UMAA 2X42A 3NL3A 4FS9A 1A3WA 1W1YA 4RDZA 3GXDA 3U0HA 4FNUA 4LCSA 3UJ2A 4HTYA 4G7EA 3ONCA 3CH9A 4LCQA 3H2AA 3GNNA 4X9SA 5HDRA 3L4UA 2NUYA 3VDBA 4IXXA 3DX5A 1O5XA 2OOFA 1UOZA 4ZSTA 3K1GA 4BWLA 2HE8A 4E2BA 5AC4A 3U48A 4UBPC 3RG6A 4HCDA 3STFA 4XV0A 1IT8A 2BLEA 3UPMA 3W7QA 2Z27A 1B90A 1IZCA 3TQPA 4FAMA 2QAFA 3VIJA 2G97A 4LF1A 1L6FA 2WM0A 1FP8A 4QNEA 5LYRA 4NUWA 4N6EA 3MKCA 4Y9PA 3QYQA 2EO7A 3NQ7A 1RBLA 4YL2A 3T0CA 2IKJA 3NZRA 3WUFA 1UKTA 3LXAA 3LSCA 4NL1A 4CD6A 1RK5A 2Z1KA 2Y2MA 1FCQA 3MZNA 1H49A 3P2VA 1DJQA 1QNQA 4JHMA 3UXKA 3ZVHA 1XC6A 2G95A 3KAOA 1SFSA 3P8JA 1NEYA 4AVOA 4F2BA 4L1GA 3UWZA 2V5LA 4UOZA 1A5LC 3BOLA 4Z1DA 3PY2A 4INFA 2J8FA 1JQXA 4H3DA 4V28A 3JUGA 1UR0A 2GL5A 2PLKA 2OXNA 3MMUA 5KZMA 3N4FA 1XC4A 3VGGA 3HG5A 2QT3A 1D8WA 5F2GA 5I02A 3HOJA 5FOOA 2EPKX 3A21A 2NX9A 4W9TA 3CLMA 2DVXA 4ZOAA 1CXHA 4YS1A 4ZA0A 3HTWA 4AVFA 1HL8A 3AO0A 3GAYA 2ZX7A 4LF2A 1X96A 3QMRA 4MFEA 3VDHA 2J7CA 1WZLA 4MKVA 1YTDA 1SUXA 1JG9A 3UYIA 3APYA 4XSLA 2ZWYA 4XX6A 5J5RA 2YL9A 3H4GA 3GK0A 2XN1A 1RK6A 1PPIA 4E8CA 1WDSA 4DYEA 3MANA 2ZADA 2I14A 3HJZA 2Z1XA 2X05A 4OWGA 3PB0A 1KBJA 1SO4A 2H90A 3FGCA 2ZA3A 2QEZA 5HJYA 1E40A 1JPHA 3KZSA 3M0ZA 3WNPA 5EY5A 4GNJA 1HN1A 7TAAA 1QOXA 4HD5A 1W1PA 1ZBWA 3EWZA 3C86A 3PTDA 5F2IA 1PZ0A 2OSWA 1RCOB 4L5ZA 3T6CA 3GVGA 4F4RA 3MUZ1 3W23A 2NV1A 4NJKA 3SI9A 3WLLA 3TA6A 1UWUA 3W7GA 1Q6CA 4QIUA 1NDWA 1E5NA 2FPTA 5A6MA 2R94A 3RK8A 1HF6A 5I79A 3G1XA 4XD6A 2FJUB 3R13A 4TXEA 3CLWA 4S1FA 5C5YA 2VDIA 3ICJA 1OCNA 4GRSA 2WMHA 3IJDA 2XVGA 1H7PA 3HONA 3R11A 1AH3A 3IAPA 2OX4A 1TPEA 3PBUA 1MQQA 4ADSA 3IJ9A 2TODA 1QNPA 1LP6A 1FBAA 2J24A 3LM3A 4NNBA 3B0VC 4ZQCA 3WJZA 4ZQNA 1LRTA 4IUGA 2GUBA 1Q5MA 2PS2A 2GDQA 4N4PA 3C2VA 1QATA 1XYMA 5FF3A 1OFRA 3EWDA 3FAXA 1KXVA 4GIAA 4CN6A 1EUAA 2ZUVA 3LCLA 2HROA 4KCTA 1ED7A 2OU4A 1AMYA 1DWHM 4DJDA 3CZKA 4TO8A 3V75A 5D9OA 4IBEA 2NSXA 4XTDA 1FXQA 1WXZA 5C9RA 3UA4A 3CV7A 4GXPA 5DN1A 1SSGA 4GVGA 3WLSA 2L5HA 1ADDA 1L6YA 1MFUA 1GQJA 4E2OA 1FWNA 2ICSA 2EG7A 1LG1A 2GYIA 1IEQA 1ELSA 5D2TA 4DAFA 2E6YA 4K6AA 1S5TA 1KFBA 1MYRA 4QSFA 1E0UA 3NQAA 2PC8A 1HT6A 4FB7A 3UNDA 1HGYA 1HO1A 2GDUA 3CZEA 4UNLA 4YXGA 2DT2A 4ZGYA 1XDJA 3OIXA 1C9DA 5BYWA 3GH5A 1FKXA 4Q4MA 3LV6A 1PO9A 1BD0A 1VYPX 1EQCA 4Y90A 5BNKA 2PSNA 3G1VA 3DYOA 1CGXA 4BCEA 3ARVA 4Z2JA 2Q71A 4JTSA 3VC5A 5FACA 6A3HA 3WQFA 4TMCA 3WLQA 3O7UA 3LHYA 4LAUA 3W02A 5MF5A 1CI1A 4XVEA 4JDBA 2BODX 3CGTA 3R1ZA 3E1F1 4PR4A 2ACRA 3P61A 1E5JA 3DU0A 3SGZA 8RUCA 4HJFA 2BV9A 4IUOA 3W1QA 1S39A 1FCUA 4HA4A 4CN4A 2FVKA 1EYWA 2XIOA 1JCLA 1RXOB 2QCEA 3VGEA 4BF9A 4R85A 3SUWA 3PZMA 3EDDA 5BXTA 3FJ6A 4NYYA 3HJEA 3POHA 3PZUA 3SM0A 3DYPA 3OEXA 1UWRA 2V69A 1FWJC 4O15A 3RPTA 1ISZA 1MZRA 3UD6A 1SW0A 3IS4A 2VZTA 1W3KA 1PL9A 2WZTA 1KBKA 3HPFA 2ZRYA 1GW1A 5A69A 3E5BA 3ABQA 4R33A 3KP1A 5MHBA 4DJFA 2WANA 1VR6A 2PTDA 1CXEA 4TR9A 3FDGA 5A6JA 1K70A 4YTQA 2OJPA 4PCSA 2XD5A 3LERA 4B5UA 3VM7A 3CEPA 3QC0A 2QPUA 1UZ1A 3OG3A 1I1XA 1QHPA 1K8YA 4Z42C 1JDAA 3QV7A 4UZUA 3S2JA 1P0EA 3VNKA 1PEZA 3P60A 1W54A 3WL1A 1H0IA 4NZCA 3PFRA 2VO5A 1R7AA 2GQAA 4WJEA 4AFYA 2PZ0A 4FR6A 3UQNA 3OBKA 2DFAA 4XD3A 3ARUA 1NWSA 4FNTA 4LEFA 4B3LA 3MS8A 4PUEA 5I3HA 3IJ8A 2XHYA 3KRUA 1JXJA 2IMRA 3M0LA 1MRAA 5E9XA 2Y2OA 2YDRA 2Z6JA 3RHGA 2AL1A 3U2OA 3WMSA 3N2XA 4GUIA 4HPNA 5BMXA 4ZENA 3GDTA 3C0LA 3R8GA 1KQZA 4PBEA 5FF7A 1A3HA 4DVOA 4IXHA 1R9ZA 1EL3A 3M7WA 5FESA 1PBGA 1PS9A 1XH0A 2KZHA 3RO8A 4AZIA 1Q8JA 4QTGA 2KAUC 3IVTA 4C6FA 4MZ8A 2BTMA 2PDQA 2BG5A 1VFHA 3AISA 1F9CA 5BWAA 1O5QA 1YE6A 4BZYA 3QRHA 4Z2KA 3HV9A 2HS8A 2XIIA 3E3HA 1V7YA 4CNTA 4DPPA 2DVTA 4LXFA 4XZMX 3WQPA 1TMQA 5G4WA 1Z6KA 1FWWA 2QMJA 3T2PA 4MPKA 4PUUA 4MUPA 1X39A 3VD3A 1EPVA 2IPGA 1DKWA 1TE6A 4DO7A 4MSSA 3BO9A 1E6SM 3L21A 2P0OA 3KL0A 2P50A 5IBXA 5HR6A 2VQUA 3KEHA 1EX5A 4NZ5A 2AMXA 3AS2A 4M8UA 3L4ZA 4WSHA 2V5OA 1GVEA 2EGZA 5TIMA 1NDZA 1NOUA 3KLKA 3TN5A 1KRAC 2UY4A 4WR3A 1L6WA 1MUMA 4Y96A 4O13A 1K02A 1QPNA 1S2VA 4XBJA 3VE9A 1FA2A 4CD7A 1TUFA 1UWSA 4NILA 3VCNA 3RRXA 4EPKA 4IP4A 3GRIA 3PAJA 1TTJA 4MTVA 1MFVA 4MG4A 4K8GA 4IBBA 1ZJIA 4NASA 3EZ4A 4LV9A 3MZ2A 3VOJA 2OX1A 4UNKA 2DU2A 3DOPA 4QG9A 1SPQA 3THAA 1DWIM 1IEWA 1XYLA 2YCEA 2YGYA 5HWJA 3G5EA 4GVIA 3MUAA 1V6XA 4OT7A 1ONRA 3THDA 3MO4A 2R24A 1PIIA 2OO0A 1RSCA 4MADA 1Y0EA 4ZL1A 4GVFA 1KFEA 5RUBA 4Q4RA 4B9ZA 2J66A 4P8XA 2WKLA 1VLIA 4GIEA 4PB4A 3SSZA 3T1GA 1FH7A 1KTBA 3ALGA 1G6CA 1V93A 5FSEC 1WDQA 1YMYA 4POCA 2PP0A 4MAVA 3MV01 2E5DA 3GC5A 3B0XA 1O12A 2WMIA 4LVBA 5C8BB 3XIMA 4TMBA 1T5AA 3QGKC 4F0HA 5M1TA 3CO8A 3URNA 1UP3A 3HMJG 1LL7A 4CVUA 3NDZA 2PLCA 4Q8VA 3FSUA 4M0XA 4V27A 1UWTA 3U5UA 3BSGA 3QC3A 2VQTA 3TSDA 2ZICA 3GG0A 4EX4A 4O0ZA 4KWOA 3VIMA 3KTXA 3HN3A 4JIQA 2AQVA 1F4AA 3VOCA 1TR1A 4ALDA 3NQFA 2BGNE 2CLLA 3QFWA 3RJXA 1R2SA 2CIPA 4GOAA 1JCJA 3UWVA 3E74A 3QSRA 1UA7A 3UPBA 1LBLA 1DV7A 1XXXA 5E09A 3AIRA 3I4KA 4IMDA 5BOFA 4ZO6A 3K8MA 3MCOA 3WQDA 1JZ5A 5DEZA 5FAGA 2YA0A 1XH1A 1KFKA 1A49A 2I56A 4MF4A 3U6WA 1SZGA 5DT5A 4XUGA 4CNNA 1VF8A 4MJ4A 3ARZA 2D24A 3QKZA 2V5DA 1RA5A 2QJGA 1XINA 4GZJA 3GHSA 3WUBA 1JRBA 1XW8A 3NQBA 4PC8A 1D8CA 3CXOA 2EBNA 2YFOA 4HIBA 1QI5A 1CLVA 3GDBA 1IZKA 4CVWA 1XIFA 5I3IA 5ECUA 3Q45A 3EX2A 3VOGA 4AC7C 3E2QA 2UY2A 2ZX8A 4YYFA 3TZFA 3B8WA 3LEPA 5D02A 3BMXA 1A5UA 4LBRA 4NJJA 4DLMA 4YCPA 4YN5A 4MNKA 2HZGA 1MNZA 3S1GA 1XIGA 2OQHA 1H1NA 4FLQA 3W86A 3CASA 2FFFB 2GJNA 4FLRA 1OM0A 4L1XA 3UJFA 5D8ZA 1VZWA 1Z42A 3V0SA 1UG6A 1REQA 1QO2A 4I9AA 3R94A 5H8MA 2IPFA 2PDFA 1BQCA 1AZ1A 1Z32X 2VEMA 5AECA 1FVPA 3B97A 4HU8A 1HKIA 4JN7A 1TWDA 2G3FA 3ARRA 3LXCA 4RDVA 3TW6A 3QTPA 1EJRC 3GC2A 5CG0A 3A4WA 4JIIX 5EFDA 4J3TA 2MANA 1QOPA 3UBPC 3PBVA 3PZNA 3MYPA 3UT0A 5FF4A 4ML4A 3FA4A 3VCCA 4AWTA 4GUJA 1M6JA 3L4WA 6XIAA 2VGIA 3PSVA 3GU1A 3CB3A 4JQ1A 1W2PA 2FZMA 4NRRA 1VPQA 1R0MA 5U7SA 4NXKA 4DO4A 3MMTA 5FJJA 3CPRA 4BI5A 1CX9A 4M1BA 2BBFA 3WD3A 3W2JA 3MSGA 2YBTA 4L4PA 2PDLA 4XKYB 5CBJA 3O6DA 1J2BA 1CXKA 5FJUA 3L29A 2NXIA 2Y2WA 3W7OA 3MKVA 3WQ6A 5BXSA 3F4DA 5ABHA 2GK1B 3O6YX 4GMEA 3G1YA 3KFTA 4CUCA 3UZJA 1K1DA 1Q6GA 3DECA 3PTMA 3WJWA 3HQOA 3K30A 1W3JA 3M4HA 1PTGA 3MDUA 2JKEA 3PK7A 4L9XA 4DZHA 1QASA 4W89A 4JKMA 4IIBA 4S3AA 1E4MM 1PDCA 4WIWA 1BG9A 1XLJA 1EUNA 5DO8A 2PDWA 2OT1A 1V3MA 2PP3A 3KCJA 1O5RA 1TPH1 4Q8NA 5A94A 4QM1A 2OWWA 3WF4A 3I3EA 4Z2HA 1LOLA 3GVQA 1UBSA 5EA9A 3PWAA 4M5PA 3PZ9A 4QDWA 4A8NA 4KEVA 4PBFA 1TIWA 2ADAA 4O28A 1ONXA 1V6YA 1E4LA 2VURA 4JY8A 3TYUA 3QR0A 2CWNA 3KTSA 4C65A 1FWFC 2ZXQA 3QM3A 4EVZA 4FIQA 1VQTA 4RNJA 1CENA 1UPPA 3BJSA 2CXEA 1Z44A 2VNCA 3NQCA 1VJIA 4X22A 1YDYA 1XCWA 2Y2NA 2EG8A 1TCMA 3GH7A 1GYMA 4J28A 3R12A 4E3TA 4RXGA 3CL6A 3KWXA 1S1RA 4JTAA 4GUGA 2FTYA 5DMMA 1V0LA 5CJMA 3BC9A 2VJXA 3FA5A 1ME7A 2GUYA 4S3BA 1E3XA 1GPFA 2YYUA 1VYSX 3EKGA 3ZJKA 2Z29A 1AL7A 4MWAE 4GGHA 5LIYX 3NGJA 5AYXA 2CZEA 2YB1A 1BRLB 3C6CA 3JRKA 2HEJA 1NQKA 4HKPA 4UFMA 3NPVA 1E8BA 3SBFA 4QE1A 2QV4A 1GKQA 5CLTA 4OFCA 4NYUA 3R6IA 1VBJA 4YWIA 3EMCA 1ZFJA 1I8JA 1R8LA 3UWQA 1TQXA 1FP9A 3N3TA 3UVIA 4LYPA 2PWGA 3WQ5A 1THFD 2I1OA 2YOCA 4FMVA 4LQ1A 3QLLA 1Q7MA 3WMBA 4ZXLA 1CTNA 3ZR5A 1H62A 1UMYA 3O0FA 4XZLX 4CQ8A 1UQZA 4BS0A 1F6PA 1G67A 1QW9A 4AZBA 1EDTA 1NARA 1U83A 4ZQRA 1EAKA 4XVDA 3ZSTA 4PMQA 3QY6A 1XG3A 3W7CA 3U7VA 1UP2A 2R1NA 4GD0A 4U33A 3LGGA 3G0UA 3OHMB 1VEPA 4WD0A 3BOXA 2WMJA 3NYZA 2CLKA 4Z2LA 3UG3A 2HCVA 4H83A 2DZVA 4PUJA 1QHOA 3K4DA 3WK2A 2WM1A 4F66A 3STPA 1DIDA 3Q94A 1TWSA 4O0QA 1Q85A 4K8EA 1E1FA 1L6JA 2IPJA 2OR2A 4GA8A 1LYXA 5E5CA 1BLIA 3SUSA 2A3HA 2Z1WA 2GQ9A 4DN1A 4JFVA 1C8VA 2J79A 4HMDA 3M1ZA 1C29A 4AVNA 2YZRA 4BFAA 4LNYA 1ISYA 3XISA 4CCCA 1P1XA 3C4UA 4J35A 4AD4A 2VEPA 4PEEA 4JKLA 4J27A 2I5GA 5A6BA 4PTXA 2Z00A 1FXPA 1A5CA 4KETA 2VX7A 5JMUA 3UG8A 2VKZG 3LPFA 1V4YA 3NPXA 4QITA 4AEEA 2KX9A 2QCCA 3PTKA 2QDHA 3KL3A 4TTUA 3CHEA 5HQMA 1XQKA 3VGHA 1BKHA 3NURA 1DOSA 5F2LA 3ZMRA 1CPUA 3FK4A 4YU1A 5CEWA 1R38A 3R5EA 2POZA 1KC7A 4GINA 5A2CA 2J9ZA 3U5YA 5TAOA 5CGQA 5FEWA 3MP5A 3CHFA 3L7RA 1H7XA 2IQ0A 5KSWA 3MWAA 3WG6A 4NZ1A 2J6VA 1CK7A 2B7NA 4H4IA 5I6SA 3U8GA 1ITQA 4B15A 2NX3A 1DL3A 2OTDA 1W1IE 4BHYA 1TG7A 3KLLA 2V5CA 1P0BA 2PDBA 4GNVA 3SRDA 4UQBA 3GB6A 1G01A 4OVXA 3KRSA 3IRSA 2VOMA 3N6JA 2ZDSA 2OSXA 1QNOA 3IAQA 1GZ1A 2JFEX 4LJ3A 4PA8A 4H2HA 1EBGA 3N12A 1EP1A 6TAAA 3N2OA 1GPWA 1BYDA 3Q67A 1O1HA 4RE2A 2PURA 3SCSA 2CESA 1BKSA 1LF1A 2Y70A 3A3WA 1HJUA 4PL2A 2WZEA 4L80A 4PE8A 7XIMA 4IHCA 4JN6A 3NPWA 2WZMA 3OO2A 4FX8A 4L7ZA 4J3UA 2VXNA 4IMAA 2XSBA 4YHEA 1YBQB 3L2LA 4GZEA 4P5UA 3EGJA 2WC4A 2R1LA 3WUGA 3LN3A 3B03A 4IT1A 1OINA 4PCTA 4C6LA 3HG2A 2QCDB 5JBDA 4OJOA 2Z28A 4LYRA 4JTCA 2PDJA 3QPEA 2NT1A 1MSSA 1QPQA 4Z0JA 1EA9C 5DELA 3HGRA 5CPOA 1TV3A 3P80A 4DB7A 3TCEA 3MC5A 2D2HA 3R58A 2J7HA 4IJRA 4GGBA 1VENA 1EP3A 4E8GA 1XR2A 4KPLA 3OOQA 1SU5A 3MI6A 1BRLA 1ZGDA 1CW2A 3UF9A 4D6HA 2V6AA 1EGVA 3UY7A 4ASTA 3U57A 1R3QA 4OECA 2OSYA 3ABRA 2AOSA 3OGSA 2HK0A 4WOQA 2X0HA 1SQ7A 2UY5A 2XYLA 1RBOB 3W29A 3LHWA 1O68A 1EQPA 2OVLA 4Q8QA 1R9YA 2W61A 1VAHA 1WZMA 1HIZA 5C55A 4MB4A 4KQNA 4QRNA 1DWAM 2HPIA 3AWOA 3MMWA 2NZLA 5E93A 3ZVIA 4Z0SA 4KERA 4CNOA 4GIYA 4AB4A 1ODZA 2V2DA 3GDMA 3GQYA 3PHAA 3QVQA 2R1KA 3NIYA 3DGRA 3NR0A 2FDSA 4RZBA 2CXGA 1M7OA 3V1PA 2WHJA 1RLCL 2VEKA 1P1MA 1E73M 4QLLA 1XV8A 4IIGA 3BMVA 3SY5A 3L66A 4LVFA 5A6BD 2PEVA 4LBSA 4K8HA 3BW4A 2VDHA 2WHLA 3KS5A 3NEHA 5D33A 5AC7A 1YADA 4B5TA 2Z4GA 3GBEA 3KHJA 3T8LA 3ZFHA 1EJUC 2VX6A 5HANA 3CU2A 2WQPA 2W62A 3EKLA 4JTUA 4KWSA 4FNSA 4ZTXA 2DSUA 2ZUUA 3GC4A 1D7FA 3L4XA 4GI8A 1NWTA 3P74A 3ZYZA 1F5ZA 3TX9A 1W8GA 1WXJA 4NAEB 1BQGA 1YRRA 1A0DA 1GZJA 2ZRXA 5FI8A 1OX6A 1B2YA 4C6NA 3W1LA 1E15A 3DCPA 4DQWA 3D47A 3VI2A 1O6IA