4OUJA

Crystal structure of ha33b-lac
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
284
structure length
281
Chain Sequence
b'LNDKIVTISCKANTDLFFYQVPGNGNVSLFQQTRNYLERWRIIYDSNKAAYKIKSMNIYNTNLVLTWNAPTHNISAQQDSNADNQYWLLLKDIGNNSFIIASYKNPNLVLYADTVARNLKLSTLNNSSYIKFIIEDYVISDFKNFTCRISPILAGGKVVQQVSMTNLAVNLYIWNNDLNQKWTIIYNEEKAAYQFFNKILSNGVLTWIFSDGNTVRVSSSAQNNDAQYWLINPVSDRYTITNLRDKTKVLDLYGGQTADGTTIQVFNSNGGDNQKWNIRNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin component HA33
publication title High-resolution crystal structure of HA33 of botulinum neurotoxin type B progenitor toxin complex.
pubmed doi rcsb
source organism Clostridium botulinum b1
molecule tags Toxin
total genus 68
structure length 281
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4oujA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4oujA02
1AFCA 1FV3A 4ZFWB 4CJMA 3T8SA 3FUOA 1SZ6B 4HA2A 4IY9A 4JRAA 3CA1A 1G9CA 1WD3A 2MC2A 4J2KA 1Q04A 2KLLA 1VCLA 5E24E 1BASA 5I1BA 3PUBA 4ZFUB 4LO7C 3FJEA 5JMCA 3AH2A 4QBCA 3VT1A 2ZQOA 4OWJA 3F1RA 2VXRA 2UUSA 1V6WA 3WMUA 3W9TA 1FWUA 3UJ4A 3H6RB 1DZDA 2X2TA 1V6UA 2HWAA 3VWCA 2FDBM 4QKSA 4XFSA 3RMYA 3O44A 3S8JA 3RTJB 4LO7B 3BTAA 3PG0A 1TTUA 2FO1A 1XZZA 2Q9XA 3B9UA 4LO0A 3BRFA 5BQUC 2ESUA 1AVAC 2HZ9A 3P53A 1AF9A 3KMVA 4I4YA 2D23A 3Q7XA 1IILA 2GO2A 3NBCA 4IYBA 1FQ9A 4ENDA 3JRRA 1EV2A 2KI4A 3FJHA 3RSJA 3VUOA 3ZC9A 2NYYA 2RQ9A 1W3AA 1D0HA 1ONKB 3ILAA 3IM7A 5HPZA 1QXMA 5FZZA 1TIEA 3O4CA 3V0AB 5D61A 4GP3A 5FNXA 1XG6A 4F83A 3O4DA 3BA5A 2FFUA 4LO2C 4XFUA 4KEJA 4G9MA 3S8KA 1DLLA 4I7IA 4I4VA 4IZXA 5D63A 4EFPA 4KC3A 2NP0A 1BLAA 1GGPB 1S0DA 3N7KA 4I4SA 4LO1A 1T4QA 31BIA 5BXSA 2KKIA 4HJJA 5BOWA 4II0A 1IOBA 2MLLB 3ZXGA 2LIQA 3BB2A 3P6JA 4P0JA 2NM1A 4TLPA 2RG9B 3N7MA 3MPPG 4EFQA 3R4SA 3FFZA 4D8HA 4Z9WB 1DQGA 1NZKA 4QKRA 3VT2A 2K4AB 2VXTI 4OWKA 2NVHA 5F8SA 3AH1A 3HBWA 1DIWA 3BAHA 4ZFYB 3FJBA 4I4XA 1JQZA 4KEKA 3IM6A 1FN0A 1BA7A 3O5WB 3V0BA 1R8NA 1DQOA 3BX1C 3PMEA 5DUYA 1JTCA 1Q03A 3AKGA 3UDAA 3WA1A 4DCKC 4KEIA 3OBRA 4LO0C 1ITBA 1JY0A 1CVSA 1G82A 2R9KB 5F8WA 4AN6A 2FGFA 3VT0A 3ZC8A 3CA3A 2D1ZA 4OWLA 4OEGA 3O3QA 5EC5A 4H04A 2D7IA 4IHZA 3UD8A 5BXRA 5BXPA 1YF8B 1XHBA 4G6MA 4D0TA 2F2FA 1OQLB 4JP0A 2ERMA 3IAGC 2BEAA 3N7LA 2DREA 4LO2A 1BFCA 5GAQA 2KH2A 3MALA 2DRZA 1JT4A 3BAOA 1RMLA 3OJVA 2IHOA 4L4HA 1PZZA 4OEEA 2VU9A 4ZLBB 1T9FA 2D44A 1I1EA 1ISWA 1ISVA 2FFVA 4IQPA 4LO1C 4F34A 3BADA 1HKNA 3CA4A 3E8LC 3NBDA 4L4IA 5B2HA 1G9AA 4J2XA 2D24A 4OUJA 5EG6C 4G9NA 1BLDA 1Q1UA 3AKIA 3UD9A 5D62A 2Z49A 1R8OA 2ZQNA 1SR4A 3R4UA 2L5XA 2GZBA 5JLVA 4ZOTA 1FV2A 2Q3NB 4I4PA 4YOLA 4GAIA 1BFFA 3O49A 1F31A 3AZVA 4OEFA 4JKQA 4D0ZA 1BARA 1A8DA 1HIBA 1UPSA 1RY7A 8I1BA 1IHKA 2J3PA 1Z0HA 4X3AA 2IWTB 3PHZA 4EKXB 4I1EA 1NUNA 1Z2VA 3LLPA 6I1BA 1IRPA 1WBAA 3HOMA 4XFTA 4JAWA 1HWOB 21BIA 3LTQA 2F2FC 3V0BB 2K43A 1HWMB 1EYLA 4XKIA 5BP5C 4QD2C 2VSAA 3AH4A 4EFRA 1ILR1 1MC9A 2Y9GA 4P0KA 3FJJA 3IM5A 1CE7B 4R6UB 2DS0A 4Q91A 4I37A 1I1BA 1YYNA 2VLCA 3I2AA 5BVPI 1S0LA 4Q9PA 3BA4A 4H9WA 4A7ZA 4Z8SB 3A22A 3WO2A 1V6XA 4EB2B 1FWVA 1V6VA 4QD2B 4GOVA 3CA5A 4JQ0A 2E4MC 3BAQA 41BIA 3BAUA 1TOOA 4I2SA 1E0OA 1SR4C 4LO8B 2AXMA 3I2XA 1K5UA 1FMZA 1S0GA 1PC8B 4A7KA 4J2SA 3A23A 3F62B 3VSZA 1WD4A 1K5VA 3HN1A 3N7JA 4P0LA 2HW9A 4ZGRB 2BEBA 3H6QA 1AVXB 3JUTA 1EPWA 1PUMB 3I29B 4JPZA 3NBNA 4QALA 1MD6A 2Y9XE 4G6JA 1ABRB 3O4OA 3WMVA 5FNWA 2Y9WC 3C9ZA 1M16A 2WRYA 3AKFA 1HCDA 2P23A 3FJAA 2P39A 4FVVA 3OGGA 4GOYA 5BP5A 3FJDA 1HWPB 3V79C 4I4OA 1RG8A 1M2TB 3RMXA 1W3FA 4I8MA 4EEEB 4FGFA 5F90A 2RSTA 3CRGA 1S0BA 4LO3A 1DFCA 3WO3A 1YTOA 3CRIA 3Q7WA 4X37A 1ISYA 1Z4SA 3VSFA 3ZX7A 2NZ9A 3BAVA 4J2YA 3NBEA 1PUUB 2NTDA 3QR5A 1IJTA 1IRAX 1PWAA 5FZUA 2KI6B 4J23B 4ISQA 4USOA 3HSMA 3CRHA 3EF2A 2XOAA 2E4MA 1P63A 2ET2A 1WBCA 2AQZA 2AFGA 3H6SE 4AN7B 2X2SA 4IONA 1RZOB 5FZYA 3CQAA 1JT7A 2WBCA 1XYFA 3BRGC 3ZXDA 3O4BA 5G00A 4I4UA 2D20A 4ZA3B 5F8YA 1YXWA 5DZUA 3BAGA 3OGFA 2M49A 2Z48A 1JT3A 4HR6C 3Q7YA 1IT0A 3FJIA 1QQLA 3D7WB 3CU1B 4I96A 1DFQA 4I4QA 3OJMA 4OW4A 4P6AA 5EHAA 4USPA 3POKA 1ISZA 3FJKA 4X38A 3UJ0A 1TP0A 3WO4A 3CAHA 4QBVA 1YBIA 3IIRA 1KNMA 4I3NA 3P6IA 1AVWB 3BRDA 3CA0A 3TC2A 1FGAA 3WINA 4JKXB 2MIBA 3FJFA 3RTIB 4QC4A 1TFMB 3O4AA 2I1BA 4LO3C 4I1BA 3AJ5A 1JLYA 4IY8A 1QQKA 1S0CA 3H6RA 3A07A 1G9DA 2D22A 3UD7A 4ISRA 1N4KA 4QO3A 2HWMA 1TWEA 3SNVA 7I1BA 1JT5A 4GAFA 4DEPA 4WBCA 2VUAA 3AZWA 4Q9GA 4DENA 2QYIB 3AJ6A 2ZR1B 4A7YA 1TWMA 4G1RA 2VSEA 1ISXA 2D7RA 3OJ2A 5BXTA 2DRYA 4I6IA 2D43A 3FGMA 1AXMA 1FMMS 4ZKTB 1EVTA 2Y9FA 3FJ8A 3VEQA 1W3GA 1L2HA 4X39A 1J0SA 4GP0A 4KBBA 1II4A 3K1XA 2LIEA 3FUQA 1DJSB 2YUGA 5DVHA 1S0FA 3CA6A 3HMYA 1S0EA 2K8RA 2QN4A 3OBTA 3V0AA 2F8XC 1HWNB 5BQUA 1G9BA 3FJ9A 4I4RA 9ILBA 4IZEA 1BFGA 3NJ5A 4PC4A 5DSSB 4I0YA 1DZCA 3A21A 3QYDA 1AVUA 3AKHA 1JLXA 3BA7A 3WINC 2AAIB 2BFHA 1HCEA 3FJCA 1BFBA 3N0KA 3HALA 4ZBVB
chains in the Genus database with same CATH superfamily
1AFCA 1FV3A 4ZFWB 4CJMA 3T8SA 3FUOA 1SZ6B 4HA2A 4IY9A 4JRAA 3CA1A 1G9CA 1WD3A 2MC2A 4J2KA 1Q04A 2KLLA 1VCLA 5E24E 1BASA 5I1BA 3PUBA 4ZFUB 4LO7C 3FJEA 5JMCA 3AH2A 4QBCA 3VT1A 2ZQOA 4OWJA 3F1RA 2VXRA 2UUSA 1V6WA 3WMUA 3W9TA 1FWUA 3UJ4A 3H6RB 1DZDA 2X2TA 1V6UA 2HWAA 3VWCA 2FDBM 4QKSA 4XFSA 3RMYA 3O44A 3S8JA 3RTJB 4LO7B 3BTAA 3PG0A 1TTUA 2FO1A 2NS2A 1XZZA 2Q9XA 3B9UA 4LO0A 3BRFA 5BQUC 2ESUA 1AVAC 2HZ9A 3P53A 1AF9A 3KMVA 4I4YA 2D23A 3Q7XA 1IILA 2GO2A 3NBCA 4IYBA 1FQ9A 4ENDA 3JRRA 1EV2A 2KI4A 3FJHA 3RSJA 3VUOA 3ZC9A 2NYYA 2RQ9A 1W3AA 1D0HA 1ONKB 3ILAA 3IM7A 5HPZA 1QXMA 5FZZA 1TIEA 3O4CA 3V0AB 5D61A 4GP3A 5FNXA 1XG6A 4F83A 3O4DA 3BA5A 2FFUA 4LO2C 4XFUA 4KEJA 4G9MA 3S8KA 1DLLA 4I7IA 4I4VA 4IZXA 5D63A 4EFPA 4KC3A 2NP0A 1BLAA 1GGPB 1S0DA 3N7KA 4I4SA 4LO1A 1T4QA 31BIA 5BXSA 2KKIA 4HJJA 5BOWA 4II0A 1IOBA 2MLLB 3ZXGA 2LIQA 3BB2A 3P6JA 4P0JA 2NM1A 4TLPA 2RG9B 3N7MA 3MPPG 4EFQA 3R4SA 3FFZA 4D8HA 4Z9WB 1DQGA 1NZKA 4QKRA 3VT2A 2K4AB 2VXTI 4OWKA 2NVHA 5F8SA 3AH1A 3HBWA 1DIWA 3BAHA 4ZFYB 3FJBA 4I4XA 1JQZA 4KEKA 3IM6A 1FN0A 1BA7A 3O5WB 3V0BA 1R8NA 1DQOA 3BX1C 3PMEA 5DUYA 1JTCA 1Q03A 3AKGA 3UDAA 3WA1A 4DCKC 4KEIA 3OBRA 4LO0C 1ITBA 1JY0A 1CVSA 1G82A 2R9KB 5F8WA 4AN6A 2FGFA 3VT0A 3ZC8A 3CA3A 2D1ZA 4OWLA 4OEGA 3O3QA 5EC5A 4H04A 2D7IA 4IHZA 3UD8A 5BXRA 5BXPA 1YF8B 1XHBA 4G6MA 4D0TA 2F2FA 1OQLB 4JP0A 2ERMA 3IAGC 2BEAA 3N7LA 2DREA 4LO2A 1BFCA 5GAQA 2KH2A 3MALA 2DRZA 1JT4A 3BAOA 1RMLA 3OJVA 2IHOA 4L4HA 1PZZA 4OEEA 2VU9A 4ZLBB 1T9FA 2D44A 1I1EA 1ISWA 1ISVA 2FFVA 4IQPA 4LO1C 4F34A 3BADA 1HKNA 3CA4A 3E8LC 3NBDA 4L4IA 5B2HA 1G9AA 4J2XA 2D24A 4OUJA 5EG6C 4G9NA 1BLDA 1Q1UA 3AKIA 3UD9A 5D62A 2Z49A 1R8OA 2ZQNA 1SR4A 3R4UA 2L5XA 2GZBA 5JLVA 4ZOTA 1FV2A 2Q3NB 4I4PA 4YOLA 4GAIA 1BFFA 3O49A 1F31A 3AZVA 4OEFA 4JKQA 4D0ZA 1BARA 1A8DA 1HIBA 1UPSA 1RY7A 8I1BA 1IHKA 2J3PA 1Z0HA 4X3AA 2IWTB 3PHZA 4EKXB 4I1EA 1NUNA 1Z2VA 3LLPA 6I1BA 1IRPA 1WBAA 3HOMA 4XFTA 4JAWA 1HWOB 21BIA 3LTQA 2F2FC 3V0BB 2K43A 1HWMB 1EYLA 4XKIA 5BP5C 4QD2C 2VSAA 3AH4A 4EFRA 1ILR1 1MC9A 2Y9GA 4P0KA 3FJJA 3IM5A 1CE7B 4R6UB 2DS0A 4Q91A 4I37A 1I1BA 1YYNA 2VLCA 3I2AA 5BVPI 1S0LA 4Q9PA 3BA4A 4H9WA 4A7ZA 4Z8SB 3A22A 3WO2A 1V6XA 4EB2B 1FWVA 1V6VA 4QD2B 4GOVA 3CA5A 4JQ0A 2E4MC 3BAQA 41BIA 3BAUA 1TOOA 4I2SA 1E0OA 1SR4C 4LO8B 2AXMA 3I2XA 1K5UA 1FMZA 1S0GA 1PC8B 4A7KA 4J2SA 3A23A 3F62B 3VSZA 1WD4A 1K5VA 3HN1A 3N7JA 4P0LA 2HW9A 4ZGRB 2BEBA 3H6QA 1AVXB 3JUTA 1EPWA 1PUMB 3I29B 4JPZA 3NBNA 4QALA 1MD6A 2Y9XE 4G6JA 1ABRB 3O4OA 3WMVA 5FNWA 2Y9WC 3C9ZA 1M16A 2WRYA 3AKFA 1HCDA 2P23A 3FJAA 2P39A 4FVVA 3OGGA 4GOYA 5BP5A 3FJDA 1HWPB 3V79C 4I4OA 1RG8A 1M2TB 3RMXA 1W3FA 4I8MA 4EEEB 4FGFA 5F90A 2RSTA 3CRGA 1S0BA 4LO3A 1DFCA 3WO3A 1YTOA 3CRIA 3Q7WA 4X37A 1ISYA 1Z4SA 3VSFA 3ZX7A 2NZ9A 3BAVA 4J2YA 3NBEA 1PUUB 2NTDA 3QR5A 1IJTA 1IRAX 1PWAA 5FZUA 2KI6B 4J23B 4ISQA 4USOA 4MZHA 3HSMA 3CRHA 3EF2A 2XOAA 2E4MA 1P63A 2ET2A 1WBCA 2AQZA 2AFGA 3H6SE 4AN7B 2X2SA 4IONA 1RZOB 5FZYA 3CQAA 1JT7A 2WBCA 1XYFA 3BRGC 3ZXDA 4MZGB 3O4BA 5G00A 4I4UA 2D20A 4ZA3B 5F8YA 1YXWA 5DZUA 3BAGA 3OGFA 2M49A 2Z48A 1JT3A 4HR6C 3Q7YA 1IT0A 3FJIA 1QQLA 3D7WB 3CU1B 4I96A 1DFQA 4I4QA 3OJMA 4H75A 4OW4A 4P6AA 4USPA 3POKA 1ISZA 3FJKA 4X38A 5EHAA 3UJ0A 1TP0A 3WO4A 3CAHA 4QBVA 1YBIA 3IIRA 1KNMA 4I3NA 3P6IA 1AVWB 3BRDA 4UY4A 3CA0A 3TC2A 1FGAA 3WINA 4JKXB 2MIBA 3FJFA 4MZFB 3RTIB 4QC4A 1TFMB 3O4AA 2I1BA 4LO3C 4I1BA 3AJ5A 1JLYA 4IY8A 1QQKA 1S0CA 3H6RA 3A07A 1G9DA 2D22A 3UD7A 4ISRA 1N4KA 4QO3A 2HWMA 1TWEA 3SNVA 7I1BA 1JT5A 4GAFA 4DEPA 4WBCA 2VUAA 3AZWA 4Q9GA 4DENA 2QYIB 3AJ6A 2ZR1B 4A7YA 1TWMA 4G1RA 2VSEA 1ISXA 2D7RA 3OJ2A 5BXTA 2DRYA 4I6IA 2D43A 3FGMA 1AXMA 1FMMS 4ZKTB 1EVTA 2Y9FA 3FJ8A 3VEQA 1W3GA 1L2HA 4X39A 1J0SA 4GP0A 4KBBA 1II4A 3K1XA 2LIEA 3FUQA 1DJSB 2YUGA 5DVHA 1S0FA 3CA6A 3HMYA 1S0EA 2K8RA 2QN4A 3OBTA 3V0AA 2F8XC 1HWNB 5BQUA 1G9BA 3FJ9A 4I4RA 9ILBA 4IZEA 1BFGA 3NJ5A 4PC4A 5DSSB 4I0YA 1DZCA 3A21A 3QYDA 1AVUA 3AKHA 1JLXA 3BA7A 3WINC 2AAIB 2BFHA 1HCEA 3FJCA 1BFBA 3N0KA 3HALA 4ZBVB
chains in the Genus database with same CATH topology
1AFCA 1FV3A 4ZFWB 4CJMA 3T8SA 3FUOA 1SZ6B 4HA2A 4IY9A 4JRAA 3CA1A 1G9CA 1WD3A 2MC2A 4J2KA 1Q04A 2KLLA 1VCLA 5E24E 1BASA 5I1BA 3PUBA 4ZFUB 4LO7C 3FJEA 5JMCA 3AH2A 4QBCA 3VT1A 2ZQOA 4OWJA 3F1RA 2VXRA 2UUSA 1V6WA 3WMUA 3W9TA 1FWUA 3UJ4A 3H6RB 1DZDA 2X2TA 1V6UA 2HWAA 3VWCA 2FDBM 4QKSA 4XFSA 3RMYA 3O44A 3S8JA 3RTJB 4LO7B 3BTAA 3PG0A 1TTUA 2FO1A 2NS2A 1XZZA 2Q9XA 3B9UA 4LO0A 3BRFA 5BQUC 2ESUA 1AVAC 2HZ9A 3P53A 1AF9A 3KMVA 4I4YA 2D23A 3Q7XA 1IILA 2GO2A 3NBCA 4IYBA 1FQ9A 4ENDA 3JRRA 1EV2A 2KI4A 3FJHA 3RSJA 3VUOA 3ZC9A 2NYYA 2RQ9A 1W3AA 1D0HA 1ONKB 3ILAA 3IM7A 5HPZA 1QXMA 5FZZA 1TIEA 3O4CA 3V0AB 5D61A 4GP3A 5FNXA 1XG6A 4F83A 3O4DA 3BA5A 2FFUA 4LO2C 4XFUA 4KEJA 4G9MA 3S8KA 1DLLA 4I7IA 4I4VA 4IZXA 5D63A 4EFPA 4KC3A 2NP0A 1BLAA 1GGPB 1S0DA 3N7KA 4I4SA 4LO1A 1T4QA 31BIA 5BXSA 2KKIA 4HJJA 5BOWA 4II0A 1IOBA 2MLLB 3ZXGA 2LIQA 3BB2A 3P6JA 4P0JA 2NM1A 4TLPA 2RG9B 3N7MA 3MPPG 4EFQA 3R4SA 3FFZA 4D8HA 4Z9WB 1DQGA 1NZKA 4QKRA 3VT2A 2K4AB 2VXTI 4OWKA 2NVHA 5F8SA 3AH1A 3HBWA 1DIWA 3BAHA 4ZFYB 3FJBA 4I4XA 1JQZA 4KEKA 3IM6A 1FN0A 1BA7A 3O5WB 3V0BA 1R8NA 1DQOA 3BX1C 3PMEA 5DUYA 1JTCA 1Q03A 3AKGA 3UDAA 3WA1A 4DCKC 4KEIA 3OBRA 4LO0C 1ITBA 1JY0A 1CVSA 1G82A 2R9KB 5F8WA 4AN6A 2FGFA 3VT0A 3ZC8A 3CA3A 2D1ZA 4OWLA 4OEGA 3O3QA 5EC5A 4H04A 2D7IA 4IHZA 3UD8A 5BXRA 5BXPA 1YF8B 1XHBA 4G6MA 4D0TA 2F2FA 1OQLB 4JP0A 2ERMA 3IAGC 2BEAA 3N7LA 2DREA 4LO2A 1BFCA 5GAQA 2KH2A 3MALA 2DRZA 1JT4A 3BAOA 1RMLA 3OJVA 2IHOA 4L4HA 1PZZA 4OEEA 2VU9A 4ZLBB 1T9FA 2D44A 1I1EA 1ISWA 1ISVA 2FFVA 4IQPA 4LO1C 4F34A 3BADA 1HKNA 3CA4A 3E8LC 3NBDA 4L4IA 5B2HA 1G9AA 4J2XA 2D24A 4OUJA 5EG6C 4G9NA 1BLDA 1Q1UA 3AKIA 3UD9A 5D62A 2Z49A 1R8OA 2ZQNA 1SR4A 3R4UA 2L5XA 2GZBA 5JLVA 4ZOTA 1FV2A 2Q3NB 4I4PA 4YOLA 4GAIA 1BFFA 3O49A 1F31A 3AZVA 4OEFA 4JKQA 4D0ZA 1BARA 1A8DA 1HIBA 1UPSA 1RY7A 8I1BA 1IHKA 2J3PA 1Z0HA 4X3AA 2IWTB 3PHZA 4EKXB 4I1EA 1NUNA 1Z2VA 3LLPA 6I1BA 1IRPA 1WBAA 3HOMA 4XFTA 4JAWA 1HWOB 21BIA 3LTQA 2F2FC 3V0BB 2K43A 1HWMB 1EYLA 4XKIA 5BP5C 4QD2C 2VSAA 3AH4A 4EFRA 1ILR1 1MC9A 2Y9GA 4P0KA 3FJJA 3IM5A 1CE7B 4R6UB 2DS0A 4Q91A 4I37A 1I1BA 1YYNA 2VLCA 3I2AA 5BVPI 1S0LA 4Q9PA 3BA4A 4H9WA 4A7ZA 4Z8SB 3A22A 3WO2A 1V6XA 4EB2B 1FWVA 1V6VA 4QD2B 4GOVA 3CA5A 4JQ0A 2E4MC 3BAQA 41BIA 3BAUA 1TOOA 4I2SA 1E0OA 1SR4C 4LO8B 2AXMA 3I2XA 1K5UA 1FMZA 1S0GA 1PC8B 4A7KA 4J2SA 3A23A 3F62B 3VSZA 1WD4A 1K5VA 3HN1A 3N7JA 4P0LA 2HW9A 4ZGRB 2BEBA 3H6QA 1AVXB 3JUTA 1EPWA 1PUMB 3I29B 4JPZA 3NBNA 4QALA 1MD6A 2Y9XE 4G6JA 1ABRB 3O4OA 3WMVA 5FNWA 2Y9WC 3C9ZA 1M16A 2WRYA 3AKFA 1HCDA 2P23A 3FJAA 2P39A 4FVVA 3OGGA 4GOYA 5BP5A 3FJDA 1HWPB 3V79C 4I4OA 1RG8A 1M2TB 3RMXA 1W3FA 4I8MA 4EEEB 4FGFA 5F90A 2RSTA 3CRGA 1S0BA 4LO3A 1DFCA 3WO3A 1YTOA 3CRIA 3Q7WA 4X37A 1ISYA 1Z4SA 3VSFA 3ZX7A 2NZ9A 3BAVA 4J2YA 3NBEA 1PUUB 2NTDA 3QR5A 1IJTA 1IRAX 1PWAA 5FZUA 2KI6B 4J23B 4ISQA 4USOA 4MZHA 3HSMA 3CRHA 3EF2A 2XOAA 2E4MA 1P63A 2ET2A 1WBCA 2AQZA 2AFGA 3H6SE 4AN7B 2X2SA 4IONA 1RZOB 5FZYA 3CQAA 1JT7A 2WBCA 1XYFA 3BRGC 3ZXDA 4MZGB 3O4BA 5G00A 4I4UA 2D20A 4ZA3B 5F8YA 1YXWA 5DZUA 3BAGA 3OGFA 2M49A 2Z48A 1JT3A 4HR6C 3Q7YA 1IT0A 3FJIA 1QQLA 3D7WB 3CU1B 4I96A 1DFQA 4I4QA 3OJMA 4H75A 4OW4A 4P6AA 4USPA 3POKA 1ISZA 3FJKA 4X38A 5EHAA 3UJ0A 1TP0A 3WO4A 3CAHA 4QBVA 1YBIA 3IIRA 1KNMA 4I3NA 3P6IA 1AVWB 3BRDA 4UY4A 3CA0A 3TC2A 1FGAA 3WINA 4JKXB 2MIBA 3FJFA 4MZFB 3RTIB 4QC4A 1TFMB 3O4AA 2I1BA 4LO3C 4I1BA 3AJ5A 1JLYA 4IY8A 1QQKA 1S0CA 3H6RA 3A07A 1G9DA 2D22A 3UD7A 4ISRA 1N4KA 4QO3A 2HWMA 1TWEA 3SNVA 7I1BA 1JT5A 4GAFA 4DEPA 4WBCA 2VUAA 3AZWA 4Q9GA 4DENA 2QYIB 3AJ6A 2ZR1B 4A7YA 1TWMA 4G1RA 2VSEA 1ISXA 2D7RA 3OJ2A 5BXTA 2DRYA 4I6IA 2D43A 3FGMA 1AXMA 1FMMS 4ZKTB 1EVTA 2Y9FA 3FJ8A 3VEQA 1W3GA 1L2HA 4X39A 1J0SA 4GP0A 4KBBA 1II4A 3K1XA 2LIEA 3FUQA 1DJSB 2YUGA 5DVHA 1S0FA 3CA6A 3HMYA 1S0EA 2K8RA 2QN4A 3OBTA 3V0AA 2F8XC 1HWNB 5BQUA 1G9BA 3FJ9A 4I4RA 9ILBA 4IZEA 1BFGA 3NJ5A 4PC4A 5DSSB 4I0YA 1DZCA 3A21A 3QYDA 1AVUA 3AKHA 1JLXA 3BA7A 3WINC 2AAIB 2BFHA 1HCEA 3FJCA 1BFBA 3N0KA 3HALA 4ZBVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFC A;  1FV3 A;  4ZFW B;  4CJM A;  3T8S A;  3FUO A;  1SZ6 B;  4HA2 A;  4IY9 A;  4JRA A;  3CA1 A;  1G9C A;  1WD3 A;  2MC2 A;  4J2K A;  1Q04 A;  2KLL A;  1VCL A;  5E24 E;  1BAS A;  5I1B A;  3PUB A;  4ZFU B;  4LO7 C;  3FJE A;  5JMC A;  3AH2 A;  4QBC A;  3VT1 A;  2ZQO A;  4OWJ A;  3F1R A;  2VXR A;  2UUS A;  1V6W A;  3WMU A;  3W9T A;  1FWU A;  3UJ4 A;  3H6R B;  1DZD A;  2X2T A;  1V6U A;  2HWA A;  3VWC A;  2FDB M;  4QKS A;  4XFS A;  3RMY A;  3O44 A;  3S8J A;  3RTJ B;  4LO7 B;  3BTA A;  3PG0 A;  1TTU A;  2FO1 A;  1XZZ A;  2Q9X A;  3B9U A;  4LO0 A;  3BRF A;  5BQU C;  2ESU A;  1AVA C;  2HZ9 A;  3P53 A;  1AF9 A;  3KMV A;  4I4Y A;  2D23 A;  3Q7X A;  1IIL A;  2GO2 A;  3NBC A;  4IYB A;  1FQ9 A;  4END A;  3JRR A;  1EV2 A;  2KI4 A;  3FJH A;  3RSJ A;  3VUO A;  3ZC9 A;  2NYY A;  2RQ9 A;  1W3A A;  1D0H A;  1ONK B;  3ILA A;  3IM7 A;  5HPZ A;  1QXM A;  5FZZ A;  1TIE A;  3O4C A;  3V0A B;  5D61 A;  4GP3 A;  5FNX A;  1XG6 A;  4F83 A;  3O4D A;  3BA5 A;  2FFU A;  4LO2 C;  4XFU A;  4KEJ A;  4G9M A;  3S8K A;  1DLL A;  4I7I A;  4I4V A;  4IZX A;  5D63 A;  4EFP A;  4KC3 A;  2NP0 A;  1BLA A;  1GGP B;  1S0D A;  3N7K A;  4I4S A;  4LO1 A;  1T4Q A;  31BI A;  5BXS A;  2KKI A;  4HJJ A;  5BOW A;  4II0 A;  1IOB A;  2MLL B;  3ZXG A;  2LIQ A;  3BB2 A;  3P6J A;  4P0J A;  2NM1 A;  4TLP A;  2RG9 B;  3N7M A;  3MPP G;  4EFQ A;  3R4S A;  3FFZ A;  4D8H A;  4Z9W B;  1DQG A;  1NZK A;  4QKR A;  3VT2 A;  2K4A B;  2VXT I;  4OWK A;  2NVH A;  5F8S A;  3AH1 A;  3HBW A;  1DIW A;  3BAH A;  4ZFY B;  3FJB A;  4I4X A;  1JQZ A;  4KEK A;  3IM6 A;  1FN0 A;  1BA7 A;  3O5W B;  3V0B A;  1R8N A;  1DQO A;  3BX1 C;  3PME A;  5DUY A;  1JTC A;  1Q03 A;  3AKG A;  3UDA A;  3WA1 A;  4DCK C;  4KEI A;  3OBR A;  4LO0 C;  1ITB A;  1JY0 A;  1CVS A;  1G82 A;  2R9K B;  5F8W A;  4AN6 A;  2FGF A;  3VT0 A;  3ZC8 A;  3CA3 A;  2D1Z A;  4OWL A;  4OEG A;  3O3Q A;  5EC5 A;  4H04 A;  2D7I A;  4IHZ A;  3UD8 A;  5BXR A;  5BXP A;  1YF8 B;  1XHB A;  4G6M A;  4D0T A;  2F2F A;  1OQL B;  4JP0 A;  2ERM A;  3IAG C;  2BEA A;  3N7L A;  2DRE A;  4LO2 A;  1BFC A;  5GAQ A;  2KH2 A;  3MAL A;  2DRZ A;  1JT4 A;  3BAO A;  1RML A;  3OJV A;  2IHO A;  4L4H A;  1PZZ A;  4OEE A;  2VU9 A;  4ZLB B;  1T9F A;  2D44 A;  1I1E A;  1ISW A;  1ISV A;  2FFV A;  4IQP A;  4LO1 C;  4F34 A;  3BAD A;  1HKN A;  3CA4 A;  3E8L C;  3NBD A;  4L4I A;  5B2H A;  1G9A A;  4J2X A;  2D24 A;  4OUJ A;  5EG6 C;  4G9N A;  1BLD A;  1Q1U A;  3AKI A;  3UD9 A;  5D62 A;  2Z49 A;  1R8O A;  2ZQN A;  1SR4 A;  3R4U A;  2L5X A;  2GZB A;  5JLV A;  4ZOT A;  1FV2 A;  2Q3N B;  4I4P A;  4YOL A;  4GAI A;  1BFF A;  3O49 A;  1F31 A;  3AZV A;  4OEF A;  4JKQ A;  4D0Z A;  1BAR A;  1A8D A;  1HIB A;  1UPS A;  1RY7 A;  8I1B A;  1IHK A;  2J3P A;  1Z0H A;  4X3A A;  2IWT B;  3PHZ A;  4EKX B;  4I1E A;  1NUN A;  1Z2V A;  3LLP A;  6I1B A;  1IRP A;  1WBA A;  3HOM A;  4XFT A;  4JAW A;  1HWO B;  21BI A;  3LTQ A;  2F2F C;  3V0B B;  2K43 A;  1HWM B;  1EYL A;  4XKI A;  5BP5 C;  4QD2 C;  2VSA A;  3AH4 A;  4EFR A;  1ILR 1;  1MC9 A;  2Y9G A;  4P0K A;  3FJJ A;  3IM5 A;  1CE7 B;  4R6U B;  2DS0 A;  4Q91 A;  4I37 A;  1I1B A;  1YYN A;  2VLC A;  3I2A A;  5BVP I;  1S0L A;  4Q9P A;  3BA4 A;  4H9W A;  4A7Z A;  4Z8S B;  3A22 A;  3WO2 A;  1V6X A;  4EB2 B;  1FWV A;  1V6V A;  4QD2 B;  4GOV A;  3CA5 A;  4JQ0 A;  2E4M C;  3BAQ A;  41BI A;  3BAU A;  1TOO A;  4I2S A;  1E0O A;  1SR4 C;  4LO8 B;  2AXM A;  3I2X A;  1K5U A;  1FMZ A;  1S0G A;  1PC8 B;  4A7K A;  4J2S A;  3A23 A;  3F62 B;  3VSZ A;  1WD4 A;  1K5V A;  3HN1 A;  3N7J A;  4P0L A;  2HW9 A;  4ZGR B;  2BEB A;  3H6Q A;  1AVX B;  3JUT A;  1EPW A;  1PUM B;  3I29 B;  4JPZ A;  3NBN A;  4QAL A;  1MD6 A;  2Y9X E;  4G6J A;  1ABR B;  3O4O A;  3WMV A;  5FNW A;  2Y9W C;  3C9Z A;  1M16 A;  2WRY A;  3AKF A;  1HCD A;  2P23 A;  3FJA A;  2P39 A;  4FVV A;  3OGG A;  4GOY A;  5BP5 A;  3FJD A;  1HWP B;  3V79 C;  4I4O A;  1RG8 A;  1M2T B;  3RMX A;  1W3F A;  4I8M A;  4EEE B;  4FGF A;  5F90 A;  2RST A;  3CRG A;  1S0B A;  4LO3 A;  1DFC A;  3WO3 A;  1YTO A;  3CRI A;  3Q7W A;  4X37 A;  1ISY A;  1Z4S A;  3VSF A;  3ZX7 A;  2NZ9 A;  3BAV A;  4J2Y A;  3NBE A;  1PUU B;  2NTD A;  3QR5 A;  1IJT A;  1IRA X;  1PWA A;  5FZU A;  2KI6 B;  4J23 B;  4ISQ A;  4USO A;  3HSM A;  3CRH A;  3EF2 A;  2XOA A;  2E4M A;  1P63 A;  2ET2 A;  1WBC A;  2AQZ A;  2AFG A;  3H6S E;  4AN7 B;  2X2S A;  4ION A;  1RZO B;  5FZY A;  3CQA A;  1JT7 A;  2WBC A;  1XYF A;  3BRG C;  3ZXD A;  3O4B A;  5G00 A;  4I4U A;  2D20 A;  4ZA3 B;  5F8Y A;  1YXW A;  5DZU A;  3BAG A;  3OGF A;  2M49 A;  2Z48 A;  1JT3 A;  4HR6 C;  3Q7Y A;  1IT0 A;  3FJI A;  1QQL A;  3D7W B;  3CU1 B;  4I96 A;  1DFQ A;  4I4Q A;  3OJM A;  4OW4 A;  4P6A A;  5EHA A;  4USP A;  3POK A;  1ISZ A;  3FJK A;  4X38 A;  3UJ0 A;  1TP0 A;  3WO4 A;  3CAH A;  4QBV A;  1YBI A;  3IIR A;  1KNM A;  4I3N A;  3P6I A;  1AVW B;  3BRD A;  3CA0 A;  3TC2 A;  1FGA A;  3WIN A;  4JKX B;  2MIB A;  3FJF A;  3RTI B;  4QC4 A;  1TFM B;  3O4A A;  2I1B A;  4LO3 C;  4I1B A;  3AJ5 A;  1JLY A;  4IY8 A;  1QQK A;  1S0C A;  3H6R A;  3A07 A;  1G9D A;  2D22 A;  3UD7 A;  4ISR A;  1N4K A;  4QO3 A;  2HWM A;  1TWE A;  3SNV A;  7I1B A;  1JT5 A;  4GAF A;  4DEP A;  4WBC A;  2VUA A;  3AZW A;  4Q9G A;  4DEN A;  2QYI B;  3AJ6 A;  2ZR1 B;  4A7Y A;  1TWM A;  4G1R A;  2VSE A;  1ISX A;  2D7R A;  3OJ2 A;  5BXT A;  2DRY A;  4I6I A;  2D43 A;  3FGM A;  1AXM A;  1FMM S;  4ZKT B;  1EVT A;  2Y9F A;  3FJ8 A;  3VEQ A;  1W3G A;  1L2H A;  4X39 A;  1J0S A;  4GP0 A;  4KBB A;  1II4 A;  3K1X A;  2LIE A;  3FUQ A;  1DJS B;  2YUG A;  5DVH A;  1S0F A;  3CA6 A;  3HMY A;  1S0E A;  2K8R A;  2QN4 A;  3OBT A;  3V0A A;  2F8X C;  1HWN B;  5BQU A;  1G9B A;  3FJ9 A;  4I4R A;  9ILB A;  4IZE A;  1BFG A;  3NJ5 A;  4PC4 A;  5DSS B;  4I0Y A;  1DZC A;  3A21 A;  3QYD A;  1AVU A;  3AKH A;  1JLX A;  3BA7 A;  3WIN C;  2AAI B;  2BFH A;  1HCE A;  3FJC A;  1BFB A;  3N0K A;  3HAL A;  4ZBV B; 
#chains in the Genus database with same CATH topology
 1AFC A;  1FV3 A;  4ZFW B;  4CJM A;  3T8S A;  3FUO A;  1SZ6 B;  4HA2 A;  4IY9 A;  4JRA A;  3CA1 A;  1G9C A;  1WD3 A;  2MC2 A;  4J2K A;  1Q04 A;  2KLL A;  1VCL A;  5E24 E;  1BAS A;  5I1B A;  3PUB A;  4ZFU B;  4LO7 C;  3FJE A;  5JMC A;  3AH2 A;  4QBC A;  3VT1 A;  2ZQO A;  4OWJ A;  3F1R A;  2VXR A;  2UUS A;  1V6W A;  3WMU A;  3W9T A;  1FWU A;  3UJ4 A;  3H6R B;  1DZD A;  2X2T A;  1V6U A;  2HWA A;  3VWC A;  2FDB M;  4QKS A;  4XFS A;  3RMY A;  3O44 A;  3S8J A;  3RTJ B;  4LO7 B;  3BTA A;  3PG0 A;  1TTU A;  2FO1 A;  2NS2 A;  1XZZ A;  2Q9X A;  3B9U A;  4LO0 A;  3BRF A;  5BQU C;  2ESU A;  1AVA C;  2HZ9 A;  3P53 A;  1AF9 A;  3KMV A;  4I4Y A;  2D23 A;  3Q7X A;  1IIL A;  2GO2 A;  3NBC A;  4IYB A;  1FQ9 A;  4END A;  3JRR A;  1EV2 A;  2KI4 A;  3FJH A;  3RSJ A;  3VUO A;  3ZC9 A;  2NYY A;  2RQ9 A;  1W3A A;  1D0H A;  1ONK B;  3ILA A;  3IM7 A;  5HPZ A;  1QXM A;  5FZZ A;  1TIE A;  3O4C A;  3V0A B;  5D61 A;  4GP3 A;  5FNX A;  1XG6 A;  4F83 A;  3O4D A;  3BA5 A;  2FFU A;  4LO2 C;  4XFU A;  4KEJ A;  4G9M A;  3S8K A;  1DLL A;  4I7I A;  4I4V A;  4IZX A;  5D63 A;  4EFP A;  4KC3 A;  2NP0 A;  1BLA A;  1GGP B;  1S0D A;  3N7K A;  4I4S A;  4LO1 A;  1T4Q A;  31BI A;  5BXS A;  2KKI A;  4HJJ A;  5BOW A;  4II0 A;  1IOB A;  2MLL B;  3ZXG A;  2LIQ A;  3BB2 A;  3P6J A;  4P0J A;  2NM1 A;  4TLP A;  2RG9 B;  3N7M A;  3MPP G;  4EFQ A;  3R4S A;  3FFZ A;  4D8H A;  4Z9W B;  1DQG A;  1NZK A;  4QKR A;  3VT2 A;  2K4A B;  2VXT I;  4OWK A;  2NVH A;  5F8S A;  3AH1 A;  3HBW A;  1DIW A;  3BAH A;  4ZFY B;  3FJB A;  4I4X A;  1JQZ A;  4KEK A;  3IM6 A;  1FN0 A;  1BA7 A;  3O5W B;  3V0B A;  1R8N A;  1DQO A;  3BX1 C;  3PME A;  5DUY A;  1JTC A;  1Q03 A;  3AKG A;  3UDA A;  3WA1 A;  4DCK C;  4KEI A;  3OBR A;  4LO0 C;  1ITB A;  1JY0 A;  1CVS A;  1G82 A;  2R9K B;  5F8W A;  4AN6 A;  2FGF A;  3VT0 A;  3ZC8 A;  3CA3 A;  2D1Z A;  4OWL A;  4OEG A;  3O3Q A;  5EC5 A;  4H04 A;  2D7I A;  4IHZ A;  3UD8 A;  5BXR A;  5BXP A;  1YF8 B;  1XHB A;  4G6M A;  4D0T A;  2F2F A;  1OQL B;  4JP0 A;  2ERM A;  3IAG C;  2BEA A;  3N7L A;  2DRE A;  4LO2 A;  1BFC A;  5GAQ A;  2KH2 A;  3MAL A;  2DRZ A;  1JT4 A;  3BAO A;  1RML A;  3OJV A;  2IHO A;  4L4H A;  1PZZ A;  4OEE A;  2VU9 A;  4ZLB B;  1T9F A;  2D44 A;  1I1E A;  1ISW A;  1ISV A;  2FFV A;  4IQP A;  4LO1 C;  4F34 A;  3BAD A;  1HKN A;  3CA4 A;  3E8L C;  3NBD A;  4L4I A;  5B2H A;  1G9A A;  4J2X A;  2D24 A;  4OUJ A;  5EG6 C;  4G9N A;  1BLD A;  1Q1U A;  3AKI A;  3UD9 A;  5D62 A;  2Z49 A;  1R8O A;  2ZQN A;  1SR4 A;  3R4U A;  2L5X A;  2GZB A;  5JLV A;  4ZOT A;  1FV2 A;  2Q3N B;  4I4P A;  4YOL A;  4GAI A;  1BFF A;  3O49 A;  1F31 A;  3AZV A;  4OEF A;  4JKQ A;  4D0Z A;  1BAR A;  1A8D A;  1HIB A;  1UPS A;  1RY7 A;  8I1B A;  1IHK A;  2J3P A;  1Z0H A;  4X3A A;  2IWT B;  3PHZ A;  4EKX B;  4I1E A;  1NUN A;  1Z2V A;  3LLP A;  6I1B A;  1IRP A;  1WBA A;  3HOM A;  4XFT A;  4JAW A;  1HWO B;  21BI A;  3LTQ A;  2F2F C;  3V0B B;  2K43 A;  1HWM B;  1EYL A;  4XKI A;  5BP5 C;  4QD2 C;  2VSA A;  3AH4 A;  4EFR A;  1ILR 1;  1MC9 A;  2Y9G A;  4P0K A;  3FJJ A;  3IM5 A;  1CE7 B;  4R6U B;  2DS0 A;  4Q91 A;  4I37 A;  1I1B A;  1YYN A;  2VLC A;  3I2A A;  5BVP I;  1S0L A;  4Q9P A;  3BA4 A;  4H9W A;  4A7Z A;  4Z8S B;  3A22 A;  3WO2 A;  1V6X A;  4EB2 B;  1FWV A;  1V6V A;  4QD2 B;  4GOV A;  3CA5 A;  4JQ0 A;  2E4M C;  3BAQ A;  41BI A;  3BAU A;  1TOO A;  4I2S A;  1E0O A;  1SR4 C;  4LO8 B;  2AXM A;  3I2X A;  1K5U A;  1FMZ A;  1S0G A;  1PC8 B;  4A7K A;  4J2S A;  3A23 A;  3F62 B;  3VSZ A;  1WD4 A;  1K5V A;  3HN1 A;  3N7J A;  4P0L A;  2HW9 A;  4ZGR B;  2BEB A;  3H6Q A;  1AVX B;  3JUT A;  1EPW A;  1PUM B;  3I29 B;  4JPZ A;  3NBN A;  4QAL A;  1MD6 A;  2Y9X E;  4G6J A;  1ABR B;  3O4O A;  3WMV A;  5FNW A;  2Y9W C;  3C9Z A;  1M16 A;  2WRY A;  3AKF A;  1HCD A;  2P23 A;  3FJA A;  2P39 A;  4FVV A;  3OGG A;  4GOY A;  5BP5 A;  3FJD A;  1HWP B;  3V79 C;  4I4O A;  1RG8 A;  1M2T B;  3RMX A;  1W3F A;  4I8M A;  4EEE B;  4FGF A;  5F90 A;  2RST A;  3CRG A;  1S0B A;  4LO3 A;  1DFC A;  3WO3 A;  1YTO A;  3CRI A;  3Q7W A;  4X37 A;  1ISY A;  1Z4S A;  3VSF A;  3ZX7 A;  2NZ9 A;  3BAV A;  4J2Y A;  3NBE A;  1PUU B;  2NTD A;  3QR5 A;  1IJT A;  1IRA X;  1PWA A;  5FZU A;  2KI6 B;  4J23 B;  4ISQ A;  4USO A;  4MZH A;  3HSM A;  3CRH A;  3EF2 A;  2XOA A;  2E4M A;  1P63 A;  2ET2 A;  1WBC A;  2AQZ A;  2AFG A;  3H6S E;  4AN7 B;  2X2S A;  4ION A;  1RZO B;  5FZY A;  3CQA A;  1JT7 A;  2WBC A;  1XYF A;  3BRG C;  3ZXD A;  4MZG B;  3O4B A;  5G00 A;  4I4U A;  2D20 A;  4ZA3 B;  5F8Y A;  1YXW A;  5DZU A;  3BAG A;  3OGF A;  2M49 A;  2Z48 A;  1JT3 A;  4HR6 C;  3Q7Y A;  1IT0 A;  3FJI A;  1QQL A;  3D7W B;  3CU1 B;  4I96 A;  1DFQ A;  4I4Q A;  3OJM A;  4H75 A;  4OW4 A;  4P6A A;  4USP A;  3POK A;  1ISZ A;  3FJK A;  4X38 A;  5EHA A;  3UJ0 A;  1TP0 A;  3WO4 A;  3CAH A;  4QBV A;  1YBI A;  3IIR A;  1KNM A;  4I3N A;  3P6I A;  1AVW B;  3BRD A;  4UY4 A;  3CA0 A;  3TC2 A;  1FGA A;  3WIN A;  4JKX B;  2MIB A;  3FJF A;  4MZF B;  3RTI B;  4QC4 A;  1TFM B;  3O4A A;  2I1B A;  4LO3 C;  4I1B A;  3AJ5 A;  1JLY A;  4IY8 A;  1QQK A;  1S0C A;  3H6R A;  3A07 A;  1G9D A;  2D22 A;  3UD7 A;  4ISR A;  1N4K A;  4QO3 A;  2HWM A;  1TWE A;  3SNV A;  7I1B A;  1JT5 A;  4GAF A;  4DEP A;  4WBC A;  2VUA A;  3AZW A;  4Q9G A;  4DEN A;  2QYI B;  3AJ6 A;  2ZR1 B;  4A7Y A;  1TWM A;  4G1R A;  2VSE A;  1ISX A;  2D7R A;  3OJ2 A;  5BXT A;  2DRY A;  4I6I A;  2D43 A;  3FGM A;  1AXM A;  1FMM S;  4ZKT B;  1EVT A;  2Y9F A;  3FJ8 A;  3VEQ A;  1W3G A;  1L2H A;  4X39 A;  1J0S A;  4GP0 A;  4KBB A;  1II4 A;  3K1X A;  2LIE A;  3FUQ A;  1DJS B;  2YUG A;  5DVH A;  1S0F A;  3CA6 A;  3HMY A;  1S0E A;  2K8R A;  2QN4 A;  3OBT A;  3V0A A;  2F8X C;  1HWN B;  5BQU A;  1G9B A;  3FJ9 A;  4I4R A;  9ILB A;  4IZE A;  1BFG A;  3NJ5 A;  4PC4 A;  5DSS B;  4I0Y A;  1DZC A;  3A21 A;  3QYD A;  1AVU A;  3AKH A;  1JLX A;  3BA7 A;  3WIN C;  2AAI B;  2BFH A;  1HCE A;  3FJC A;  1BFB A;  3N0K A;  3HAL A;  4ZBV B; 
#chains in the Genus database with same CATH homology
 1AFC A;  1FV3 A;  4ZFW B;  4CJM A;  3T8S A;  3FUO A;  1SZ6 B;  4HA2 A;  4IY9 A;  4JRA A;  3CA1 A;  1G9C A;  1WD3 A;  2MC2 A;  4J2K A;  1Q04 A;  2KLL A;  1VCL A;  5E24 E;  1BAS A;  5I1B A;  3PUB A;  4ZFU B;  4LO7 C;  3FJE A;  5JMC A;  3AH2 A;  4QBC A;  3VT1 A;  2ZQO A;  4OWJ A;  3F1R A;  2VXR A;  2UUS A;  1V6W A;  3WMU A;  3W9T A;  1FWU A;  3UJ4 A;  3H6R B;  1DZD A;  2X2T A;  1V6U A;  2HWA A;  3VWC A;  2FDB M;  4QKS A;  4XFS A;  3RMY A;  3O44 A;  3S8J A;  3RTJ B;  4LO7 B;  3BTA A;  3PG0 A;  1TTU A;  2FO1 A;  2NS2 A;  1XZZ A;  2Q9X A;  3B9U A;  4LO0 A;  3BRF A;  5BQU C;  2ESU A;  1AVA C;  2HZ9 A;  3P53 A;  1AF9 A;  3KMV A;  4I4Y A;  2D23 A;  3Q7X A;  1IIL A;  2GO2 A;  3NBC A;  4IYB A;  1FQ9 A;  4END A;  3JRR A;  1EV2 A;  2KI4 A;  3FJH A;  3RSJ A;  3VUO A;  3ZC9 A;  2NYY A;  2RQ9 A;  1W3A A;  1D0H A;  1ONK B;  3ILA A;  3IM7 A;  5HPZ A;  1QXM A;  5FZZ A;  1TIE A;  3O4C A;  3V0A B;  5D61 A;  4GP3 A;  5FNX A;  1XG6 A;  4F83 A;  3O4D A;  3BA5 A;  2FFU A;  4LO2 C;  4XFU A;  4KEJ A;  4G9M A;  3S8K A;  1DLL A;  4I7I A;  4I4V A;  4IZX A;  5D63 A;  4EFP A;  4KC3 A;  2NP0 A;  1BLA A;  1GGP B;  1S0D A;  3N7K A;  4I4S A;  4LO1 A;  1T4Q A;  31BI A;  5BXS A;  2KKI A;  4HJJ A;  5BOW A;  4II0 A;  1IOB A;  2MLL B;  3ZXG A;  2LIQ A;  3BB2 A;  3P6J A;  4P0J A;  2NM1 A;  4TLP A;  2RG9 B;  3N7M A;  3MPP G;  4EFQ A;  3R4S A;  3FFZ A;  4D8H A;  4Z9W B;  1DQG A;  1NZK A;  4QKR A;  3VT2 A;  2K4A B;  2VXT I;  4OWK A;  2NVH A;  5F8S A;  3AH1 A;  3HBW A;  1DIW A;  3BAH A;  4ZFY B;  3FJB A;  4I4X A;  1JQZ A;  4KEK A;  3IM6 A;  1FN0 A;  1BA7 A;  3O5W B;  3V0B A;  1R8N A;  1DQO A;  3BX1 C;  3PME A;  5DUY A;  1JTC A;  1Q03 A;  3AKG A;  3UDA A;  3WA1 A;  4DCK C;  4KEI A;  3OBR A;  4LO0 C;  1ITB A;  1JY0 A;  1CVS A;  1G82 A;  2R9K B;  5F8W A;  4AN6 A;  2FGF A;  3VT0 A;  3ZC8 A;  3CA3 A;  2D1Z A;  4OWL A;  4OEG A;  3O3Q A;  5EC5 A;  4H04 A;  2D7I A;  4IHZ A;  3UD8 A;  5BXR A;  5BXP A;  1YF8 B;  1XHB A;  4G6M A;  4D0T A;  2F2F A;  1OQL B;  4JP0 A;  2ERM A;  3IAG C;  2BEA A;  3N7L A;  2DRE A;  4LO2 A;  1BFC A;  5GAQ A;  2KH2 A;  3MAL A;  2DRZ A;  1JT4 A;  3BAO A;  1RML A;  3OJV A;  2IHO A;  4L4H A;  1PZZ A;  4OEE A;  2VU9 A;  4ZLB B;  1T9F A;  2D44 A;  1I1E A;  1ISW A;  1ISV A;  2FFV A;  4IQP A;  4LO1 C;  4F34 A;  3BAD A;  1HKN A;  3CA4 A;  3E8L C;  3NBD A;  4L4I A;  5B2H A;  1G9A A;  4J2X A;  2D24 A;  4OUJ A;  5EG6 C;  4G9N A;  1BLD A;  1Q1U A;  3AKI A;  3UD9 A;  5D62 A;  2Z49 A;  1R8O A;  2ZQN A;  1SR4 A;  3R4U A;  2L5X A;  2GZB A;  5JLV A;  4ZOT A;  1FV2 A;  2Q3N B;  4I4P A;  4YOL A;  4GAI A;  1BFF A;  3O49 A;  1F31 A;  3AZV A;  4OEF A;  4JKQ A;  4D0Z A;  1BAR A;  1A8D A;  1HIB A;  1UPS A;  1RY7 A;  8I1B A;  1IHK A;  2J3P A;  1Z0H A;  4X3A A;  2IWT B;  3PHZ A;  4EKX B;  4I1E A;  1NUN A;  1Z2V A;  3LLP A;  6I1B A;  1IRP A;  1WBA A;  3HOM A;  4XFT A;  4JAW A;  1HWO B;  21BI A;  3LTQ A;  2F2F C;  3V0B B;  2K43 A;  1HWM B;  1EYL A;  4XKI A;  5BP5 C;  4QD2 C;  2VSA A;  3AH4 A;  4EFR A;  1ILR 1;  1MC9 A;  2Y9G A;  4P0K A;  3FJJ A;  3IM5 A;  1CE7 B;  4R6U B;  2DS0 A;  4Q91 A;  4I37 A;  1I1B A;  1YYN A;  2VLC A;  3I2A A;  5BVP I;  1S0L A;  4Q9P A;  3BA4 A;  4H9W A;  4A7Z A;  4Z8S B;  3A22 A;  3WO2 A;  1V6X A;  4EB2 B;  1FWV A;  1V6V A;  4QD2 B;  4GOV A;  3CA5 A;  4JQ0 A;  2E4M C;  3BAQ A;  41BI A;  3BAU A;  1TOO A;  4I2S A;  1E0O A;  1SR4 C;  4LO8 B;  2AXM A;  3I2X A;  1K5U A;  1FMZ A;  1S0G A;  1PC8 B;  4A7K A;  4J2S A;  3A23 A;  3F62 B;  3VSZ A;  1WD4 A;  1K5V A;  3HN1 A;  3N7J A;  4P0L A;  2HW9 A;  4ZGR B;  2BEB A;  3H6Q A;  1AVX B;  3JUT A;  1EPW A;  1PUM B;  3I29 B;  4JPZ A;  3NBN A;  4QAL A;  1MD6 A;  2Y9X E;  4G6J A;  1ABR B;  3O4O A;  3WMV A;  5FNW A;  2Y9W C;  3C9Z A;  1M16 A;  2WRY A;  3AKF A;  1HCD A;  2P23 A;  3FJA A;  2P39 A;  4FVV A;  3OGG A;  4GOY A;  5BP5 A;  3FJD A;  1HWP B;  3V79 C;  4I4O A;  1RG8 A;  1M2T B;  3RMX A;  1W3F A;  4I8M A;  4EEE B;  4FGF A;  5F90 A;  2RST A;  3CRG A;  1S0B A;  4LO3 A;  1DFC A;  3WO3 A;  1YTO A;  3CRI A;  3Q7W A;  4X37 A;  1ISY A;  1Z4S A;  3VSF A;  3ZX7 A;  2NZ9 A;  3BAV A;  4J2Y A;  3NBE A;  1PUU B;  2NTD A;  3QR5 A;  1IJT A;  1IRA X;  1PWA A;  5FZU A;  2KI6 B;  4J23 B;  4ISQ A;  4USO A;  4MZH A;  3HSM A;  3CRH A;  3EF2 A;  2XOA A;  2E4M A;  1P63 A;  2ET2 A;  1WBC A;  2AQZ A;  2AFG A;  3H6S E;  4AN7 B;  2X2S A;  4ION A;  1RZO B;  5FZY A;  3CQA A;  1JT7 A;  2WBC A;  1XYF A;  3BRG C;  3ZXD A;  4MZG B;  3O4B A;  5G00 A;  4I4U A;  2D20 A;  4ZA3 B;  5F8Y A;  1YXW A;  5DZU A;  3BAG A;  3OGF A;  2M49 A;  2Z48 A;  1JT3 A;  4HR6 C;  3Q7Y A;  1IT0 A;  3FJI A;  1QQL A;  3D7W B;  3CU1 B;  4I96 A;  1DFQ A;  4I4Q A;  3OJM A;  4H75 A;  4OW4 A;  4P6A A;  4USP A;  3POK A;  1ISZ A;  3FJK A;  4X38 A;  5EHA A;  3UJ0 A;  1TP0 A;  3WO4 A;  3CAH A;  4QBV A;  1YBI A;  3IIR A;  1KNM A;  4I3N A;  3P6I A;  1AVW B;  3BRD A;  4UY4 A;  3CA0 A;  3TC2 A;  1FGA A;  3WIN A;  4JKX B;  2MIB A;  3FJF A;  4MZF B;  3RTI B;  4QC4 A;  1TFM B;  3O4A A;  2I1B A;  4LO3 C;  4I1B A;  3AJ5 A;  1JLY A;  4IY8 A;  1QQK A;  1S0C A;  3H6R A;  3A07 A;  1G9D A;  2D22 A;  3UD7 A;  4ISR A;  1N4K A;  4QO3 A;  2HWM A;  1TWE A;  3SNV A;  7I1B A;  1JT5 A;  4GAF A;  4DEP A;  4WBC A;  2VUA A;  3AZW A;  4Q9G A;  4DEN A;  2QYI B;  3AJ6 A;  2ZR1 B;  4A7Y A;  1TWM A;  4G1R A;  2VSE A;  1ISX A;  2D7R A;  3OJ2 A;  5BXT A;  2DRY A;  4I6I A;  2D43 A;  3FGM A;  1AXM A;  1FMM S;  4ZKT B;  1EVT A;  2Y9F A;  3FJ8 A;  3VEQ A;  1W3G A;  1L2H A;  4X39 A;  1J0S A;  4GP0 A;  4KBB A;  1II4 A;  3K1X A;  2LIE A;  3FUQ A;  1DJS B;  2YUG A;  5DVH A;  1S0F A;  3CA6 A;  3HMY A;  1S0E A;  2K8R A;  2QN4 A;  3OBT A;  3V0A A;  2F8X C;  1HWN B;  5BQU A;  1G9B A;  3FJ9 A;  4I4R A;  9ILB A;  4IZE A;  1BFG A;  3NJ5 A;  4PC4 A;  5DSS B;  4I0Y A;  1DZC A;  3A21 A;  3QYD A;  1AVU A;  3AKH A;  1JLX A;  3BA7 A;  3WIN C;  2AAI B;  2BFH A;  1HCE A;  3FJC A;  1BFB A;  3N0K A;  3HAL A;  4ZBV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...