4OUJA

Crystal structure of ha33b-lac
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
284
structure length
281
Chain Sequence
LNDKIVTISCKANTDLFFYQVPGNGNVSLFQQTRNYLERWRIIYDSNKAAYKIKSMNIYNTNLVLTWNAPTHNISAQQDSNADNQYWLLLKDIGNNSFIIASYKNPNLVLYADTVARNLKLSTLNNSSYIKFIIEDYVISDFKNFTCRISPILAGGKVVQQVSMTNLAVNLYIWNNDLNQKWTIIYNEEKAAYQFFNKILSNGVLTWIFSDGNTVRVSSSAQNNDAQYWLINPVSDRYTITNLRDKTKVLDLYGGQTADGTTIQVFNSNGGDNQKWNIRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin component HA33
publication title High-resolution crystal structure of HA33 of botulinum neurotoxin type B progenitor toxin complex.
pubmed doi rcsb
source organism Clostridium botulinum b1
molecule tags Toxin
total genus 68
structure length 281
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4oujA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4oujA02
4KBBA 3WINC 2D20A 1IT0A 4GOYA 3I29B 5FZYA 4LO3C 5DVHA 3Q7WA 5EG6C 1BFGA 3R4UA 3OBTA 2Y9FA 1T9FA 3RTIB 4QC4A 4X3AA 2FO1A 1XZZA 3IM6A 1G9CA 5BQUC 1R8OA 2L5XA 1ISYA 1HCEA 1Q04A 1IOBA 3E8LC 4IONA 3WINA 4QD2B 5DZUA 3S8KA 4KEKA 1S0CA 3BAQA 4LO3A 3OJVA 3A23A 1R8NA 1BASA 1DZDA 4I4VA 3NBCA 1AVWB 4ZFYB 4FGFA 3BAGA 3UD8A 5F8YA 2ERMA 1Z4SA 4EKXB 4JP0A 1TTUA 5F8WA 1MD6A 5BVPI 1V6UA 3HMYA 3VSFA 5BQUA 2FFUA 2LIEA 3AZWA 3FUQA 4JPZA 3R4SA 4LO2C 3NBDA 3CRGA 4EFPA 1S0FA 2WRYA 2VUAA 4A7ZA 4I8MA 2AQZA 2RQ9A 1E0OA 4KEJA 2GZBA 4EEEB 3N0KA 2KI4A 1XHBA 1ISWA 1A8DA 1AVUA 3PG0A 1TP0A 5BXRA 3WMVA 3K1XA 2VXTI 2RG9B 4G9NA 1YYNA 2D24A 1TWEA 3T8SA 4OEGA 3BAHA 1G9AA 1RG8A 1S0BA 3H6QA 3FJAA 1FMMS 1IRPA 3NBNA 4XKIA 5D62A 1S0DA 5I1BA 2K43A 2VSAA 1YBIA 3BRGC 2X2TA 4I7IA 1DFCA 1YF8B 1XYFA 3VT0A 2HWAA 1AVXB 4LO2A 5DUYA 1AF9A 41BIA 3JRRA 3CQAA 1D0HA 1N4KA 3RSJA 1G9DA 1PUMB 5E24E 4J23B 4J2XA 3ZXGA 4IZEA 1S0GA 4P0JA 1F31A 9ILBA 3AH1A 1ONKB 1TWMA 4D8HA 4G9MA 4JRAA 3MALA 31BIA 1NZKA 3AH2A 3WMUA 4G6JA 1BLDA 4TLPA 3UDAA 2AAIB 3WO4A 2LIQA 1DLLA 1HKNA 3CRHA 1ILR1 1WBCA 5EHAA 1HCDA 2DS0A 3PUBA 4I6IA 4JQ0A 3V0AB 2DRZA 5EC5A 3C9ZA 3AZVA 1GGPB 3O3QA 2P23A 4H9WA 3SNVA 1RZOB 2Q3NB 2Z49A 3CA0A 4Z9WB 4I4YA 4I4UA 4I3NA 4GP3A 4GP0A 4KC3A 4QALA 3BA7A 2D22A 1ISXA 1RY7A 2NTDA 2VXRA 3D7WB 3LTQA 3VSZA 2ESUA 1G82A 3V0AA 1FV3A 1BFCA 4D0TA 2NYYA 1XG6A 3P6IA 1W3FA 3CA5A 4P0LA 4Q91A 4AN7B 3HOMA 1NUNA 3HBWA 5D61A 1S0LA 1I1EA 2VSEA 1BA7A 3FJFA 3CA1A 3IIRA 4QD2C 3ZX7A 4ZGRB 2HZ9A 1QXMA 3VT2A 1UPSA 3AKFA 3QYDA 4HA2A 2D43A 1AXMA 3PMEA 4I4SA 3O4OA 2F2FC 1YTOA 4I4PA 4OUJA 3ILAA 2VLCA 4USPA 3FJIA 4P6AA 3NJ5A 1YXWA 4LO1C 1IRAX 2D7RA 2NP0A 4USOA 3OJ2A 4DCKC 2R9KB 4I96A 2MC2A 1PWAA 3AH4A 3LLPA 4ZFUB 1FV2A 1BFFA 1ISZA 2AFGA 1EVTA 3UJ4A 4A7KA 3BA4A 1HWOB 1L2HA 3QR5A 4AN6A 4EFRA 1DQGA 3OBRA 4ZKTB 4OWJA 5JLVA 2I1BA 4GAFA 4FVVA 2ZQNA 1P63A 4H04A 4D0ZA 3IM5A 2F2FA 2F8XC 4LO8B 4QBVA 1FGAA 4F34A 4ENDA 1V6VA 3AKGA 3FJKA 1HWNB 4ZA3B 3UD9A 2YUGA 4LO1A 4HJJA 1QQLA 3HALA 2QYIB 2NM1A 3BAOA 2NVHA 1JT3A 1II4A 3I2XA 1BLAA 3BADA 3H6RB 4GOVA 2BFHA 4J2KA 1KNMA 1S0EA 1JLYA 3V79C 1K5UA 3P6JA 5BXSA 1DIWA 3VEQA 3O4DA 3Q7YA 5D63A 3S8JA 4LO0A 3BAUA 1M2TB 1BFBA 2Y9XE 4IY8A 4I4QA 5JMCA 1ISVA 3VWCA 4J2YA 4G6MA 3H6RA 4R6UB 1FWUA 1IILA 5BP5C 3EF2A 4IHZA 1I1BA 3VUOA 1T4QA 1DQOA 5DSSB 4DENA 1CVSA 4PC4A 5FZZA 3FUOA 2KLLA 3A22A 4GAIA 4ISRA 1AVAC 2KI6B 4JAWA 1BARA 1IHKA 4XFTA 1DFQA 4OW4A 3OGFA 2ZR1B 2IHOA 3RTJB 2HW9A 3F62B 3O4AA 3FJ8A 5HPZA 1SZ6B 4L4IA 1AFCA 5BP5A 2MLLB 3POKA 3AJ6A 4ZLBB 4Q9GA 4OWKA 3FJJA 2ET2A 4G1RA 2D7IA 1Z0HA 4QKSA 1K5VA 21BIA 3P53A 3N7LA 3OGGA 3VT1A 4KEIA 2WBCA 1IJTA 1W3AA 4I4RA 3N7JA 5BOWA 2KH2A 1EPWA 3OJMA 1Z2VA 3CA4A 3FJBA 4QO3A 3KMVA 3ZC8A 1DZCA 3PHZA 3FJEA 4ZFWB 2Q9XA 3UD7A 4ZOTA 4CJMA 3BB2A 3AKIA 3BTAA 1Q03A 2IWTB 2BEAA 3CA3A 1TOOA 1HWMB 3H6SE 3I2AA 1TFMB 2K4AB 2QN4A 4JKXB 1TIEA 4EFQA 5BXPA 2DRYA 1DJSB 1VCLA 2VU9A 3FFZA 4I0YA 5F90A 1FWVA 1MC9A 4WBCA 2D44A 3BRFA 3FJHA 3B9UA 3F1RA 4LO0C 2KKIA 2Z48A 3AJ5A 4X39A 3WO2A 4ZBVB 2E4MC 2ZQOA 3N7KA 3ZXDA 4Z8SB 1RMLA 1WD3A 3FJCA 3O4BA 4IQPA 2FFVA 4I37A 4F83A 5B2HA 4YOLA 5BXTA 1JY0A 2Y9GA 3O44A 2K8RA 3CU1B 1OQLB 1FN0A 4OWLA 3FJ9A 4I4OA 1M16A 1PZZA 4I2SA 3BAVA 3NBEA 1WBAA 2MIBA 4EB2B 1EYLA 3MPPG 4L4HA 3O4CA 1V6WA 4QBCA 1G9BA 3IM7A 3FJDA 3HSMA 2X2SA 1JTCA 2M49A 4HR6C 1HWPB 4I4XA 4QKRA 3RMXA 4A7YA 2E4MA 3TC2A 4Q9PA 3W9TA 1EV2A 3O49A 4IZXA 3A21A 4XFUA 1QQKA 3WO3A 2BEBA 2P39A 1JT7A 3ZC9A 3V0BB 1SR4C 1PUUB 2GO2A 2UUSA 4II0A 1FQ9A 4I1BA 3BX1C 1V6XA 3Q7XA 4X38A 2AXMA 3BRDA 1ABRB 4ISQA 4J2SA 5GAQA 3O5WB 4I1EA 3V0BA 2DREA 3JUTA 8I1BA 3CA6A 3CRIA 1PC8B 4JKQA 5F8SA 4LO7C 1HIBA 2RSTA 1W3GA 3N7MA 2J3PA 3UJ0A 3HN1A 4X37A 4DEPA 3RMYA 4IYBA 2D23A 1ITBA 1Q1UA 7I1BA 2Y9WC 1SR4A 3BA5A 3AKHA 1JLXA 5FNWA 1FMZA 5G00A 4IY9A 4LO7B 1JT5A 5FZUA 3A07A 2FGFA 4OEFA 2HWMA 4P0KA 3WA1A 1J0SA 2XOAA 6I1BA 4XFSA 1WD4A 2FDBM 1JT4A 4OEEA 3IAGC 1JQZA 2D1ZA 2NZ9A 3FGMA 1CE7B 3CAHA 5FNXA
chains in the Genus database with same CATH superfamily
4KBBA 3WINC 2D20A 1IT0A 4GOYA 3I29B 5FZYA 4LO3C 5DVHA 3Q7WA 5EG6C 1BFGA 3R4UA 3OBTA 2Y9FA 1T9FA 3RTIB 4QC4A 4X3AA 2FO1A 1XZZA 3IM6A 1G9CA 5BQUC 1R8OA 2L5XA 1ISYA 1HCEA 1Q04A 1IOBA 3E8LC 4IONA 3WINA 4QD2B 5DZUA 3S8KA 4KEKA 1S0CA 3BAQA 4LO3A 3OJVA 3A23A 1R8NA 1BASA 1DZDA 4I4VA 3NBCA 1AVWB 4ZFYB 4FGFA 3BAGA 3UD8A 5F8YA 2ERMA 1Z4SA 4EKXB 4JP0A 1TTUA 5F8WA 1MD6A 5BVPI 1V6UA 3HMYA 3VSFA 5BQUA 2FFUA 2LIEA 3AZWA 3FUQA 4JPZA 3R4SA 4H75A 4LO2C 3NBDA 3CRGA 4EFPA 1S0FA 2WRYA 2VUAA 4A7ZA 4I8MA 2AQZA 2RQ9A 1E0OA 4KEJA 2GZBA 4EEEB 3N0KA 2KI4A 1XHBA 1ISWA 1A8DA 1AVUA 3PG0A 1TP0A 5BXRA 3WMVA 3K1XA 2VXTI 2RG9B 4G9NA 1YYNA 2D24A 1TWEA 3T8SA 4OEGA 3BAHA 1G9AA 1RG8A 1S0BA 3H6QA 3FJAA 1FMMS 1IRPA 3NBNA 4XKIA 5D62A 1S0DA 5I1BA 2K43A 2VSAA 1YBIA 3BRGC 2X2TA 4I7IA 1DFCA 1YF8B 1XYFA 3VT0A 2HWAA 1AVXB 4LO2A 5DUYA 1AF9A 41BIA 3JRRA 3CQAA 1D0HA 1N4KA 3RSJA 1G9DA 1PUMB 5E24E 4J23B 4J2XA 3ZXGA 4IZEA 1S0GA 4P0JA 1F31A 9ILBA 3AH1A 1ONKB 1TWMA 4D8HA 4G9MA 4JRAA 3MALA 31BIA 1NZKA 3AH2A 3WMUA 4G6JA 1BLDA 4TLPA 3UDAA 2AAIB 3WO4A 2LIQA 1DLLA 1HKNA 3CRHA 1ILR1 1WBCA 5EHAA 1HCDA 2DS0A 3PUBA 4I6IA 4JQ0A 3V0AB 2DRZA 4MZHA 5EC5A 3C9ZA 3AZVA 1GGPB 3O3QA 2P23A 4H9WA 3SNVA 1RZOB 2Q3NB 2Z49A 3CA0A 4Z9WB 4I4YA 4I4UA 4I3NA 4GP3A 4GP0A 4KC3A 4QALA 3BA7A 2D22A 1ISXA 1RY7A 2NTDA 2VXRA 3D7WB 3LTQA 3VSZA 2ESUA 1G82A 3V0AA 1FV3A 1BFCA 4D0TA 2NYYA 1XG6A 3P6IA 1W3FA 3CA5A 4P0LA 4Q91A 4AN7B 3HOMA 1NUNA 3HBWA 5D61A 4MZGB 1S0LA 1I1EA 2VSEA 1BA7A 3FJFA 3CA1A 3IIRA 4QD2C 3ZX7A 4ZGRB 2HZ9A 1QXMA 3VT2A 1UPSA 3AKFA 3QYDA 4HA2A 2D43A 1AXMA 3PMEA 4I4SA 3O4OA 2F2FC 1YTOA 4I4PA 4OUJA 3ILAA 2VLCA 4USPA 3FJIA 4P6AA 3NJ5A 1YXWA 4LO1C 1IRAX 2D7RA 2NP0A 4USOA 3OJ2A 4DCKC 2R9KB 4I96A 2MC2A 1PWAA 3AH4A 3LLPA 4ZFUB 1FV2A 1BFFA 1ISZA 2AFGA 1EVTA 3UJ4A 4A7KA 3BA4A 1HWOB 1L2HA 3QR5A 4AN6A 4EFRA 1DQGA 3OBRA 4ZKTB 4OWJA 5JLVA 2I1BA 4GAFA 4FVVA 2ZQNA 1P63A 4H04A 4D0ZA 3IM5A 2F2FA 2F8XC 4LO8B 4QBVA 1FGAA 4F34A 4ENDA 1V6VA 3AKGA 3FJKA 1HWNB 4ZA3B 3UD9A 2YUGA 4LO1A 4HJJA 1QQLA 3HALA 2QYIB 2NM1A 3BAOA 2NVHA 1JT3A 1II4A 3I2XA 1BLAA 3BADA 3H6RB 4GOVA 2BFHA 4J2KA 1KNMA 1S0EA 1JLYA 3V79C 1K5UA 3P6JA 5BXSA 1DIWA 3VEQA 3O4DA 3Q7YA 5D63A 3S8JA 4LO0A 3BAUA 1M2TB 1BFBA 2Y9XE 4IY8A 4I4QA 5JMCA 1ISVA 3VWCA 4J2YA 4G6MA 3H6RA 4R6UB 1FWUA 1IILA 5BP5C 3EF2A 4IHZA 1I1BA 3VUOA 1T4QA 1DQOA 5DSSB 4DENA 1CVSA 4PC4A 5FZZA 2NS2A 3FUOA 2KLLA 3A22A 4GAIA 4ISRA 1AVAC 2KI6B 4JAWA 1BARA 1IHKA 4XFTA 1DFQA 4OW4A 3OGFA 2ZR1B 2IHOA 3RTJB 2HW9A 3F62B 3O4AA 3FJ8A 5HPZA 1SZ6B 4L4IA 1AFCA 5BP5A 2MLLB 3POKA 3AJ6A 4ZLBB 4Q9GA 4OWKA 3FJJA 2ET2A 4G1RA 2D7IA 1Z0HA 4QKSA 1K5VA 21BIA 3P53A 3N7LA 3OGGA 3VT1A 4KEIA 2WBCA 1IJTA 1W3AA 4I4RA 3N7JA 5BOWA 2KH2A 1EPWA 3OJMA 1Z2VA 3CA4A 3FJBA 4QO3A 3KMVA 3ZC8A 1DZCA 3PHZA 3FJEA 4ZFWB 2Q9XA 3UD7A 4ZOTA 4CJMA 3BB2A 3AKIA 3BTAA 1Q03A 2IWTB 2BEAA 3CA3A 1TOOA 1HWMB 3H6SE 3I2AA 1TFMB 2K4AB 2QN4A 4JKXB 1TIEA 4EFQA 5BXPA 2DRYA 1DJSB 1VCLA 2VU9A 3FFZA 4I0YA 5F90A 1FWVA 1MC9A 4WBCA 4MZFB 2D44A 3BRFA 3FJHA 3B9UA 3F1RA 4LO0C 2KKIA 2Z48A 3AJ5A 4X39A 3WO2A 4ZBVB 2E4MC 2ZQOA 3N7KA 3ZXDA 4Z8SB 1RMLA 1WD3A 3FJCA 3O4BA 4IQPA 2FFVA 4I37A 4F83A 5B2HA 4YOLA 5BXTA 1JY0A 2Y9GA 3O44A 2K8RA 3CU1B 1OQLB 1FN0A 4OWLA 3FJ9A 4I4OA 1M16A 1PZZA 4I2SA 3BAVA 3NBEA 1WBAA 2MIBA 4EB2B 1EYLA 3MPPG 4L4HA 3O4CA 1V6WA 4QBCA 1G9BA 3IM7A 3FJDA 3HSMA 2X2SA 1JTCA 2M49A 4HR6C 1HWPB 4I4XA 4QKRA 3RMXA 4A7YA 2E4MA 3TC2A 4Q9PA 3W9TA 1EV2A 3O49A 4IZXA 3A21A 4XFUA 1QQKA 3WO3A 2BEBA 2P39A 1JT7A 3ZC9A 3V0BB 1SR4C 1PUUB 2GO2A 2UUSA 4II0A 1FQ9A 4I1BA 3BX1C 1V6XA 3Q7XA 4X38A 2AXMA 3BRDA 1ABRB 4ISQA 4J2SA 5GAQA 3O5WB 4I1EA 3V0BA 2DREA 3JUTA 8I1BA 3CA6A 3CRIA 1PC8B 4JKQA 4UY4A 5F8SA 4LO7C 1HIBA 2RSTA 1W3GA 3N7MA 2J3PA 3UJ0A 3HN1A 4X37A 4DEPA 3RMYA 4IYBA 2D23A 1ITBA 1Q1UA 7I1BA 2Y9WC 1SR4A 3BA5A 3AKHA 1JLXA 5FNWA 1FMZA 5G00A 4IY9A 4LO7B 1JT5A 5FZUA 3A07A 2FGFA 4OEFA 2HWMA 4P0KA 3WA1A 1J0SA 2XOAA 6I1BA 4XFSA 1WD4A 2FDBM 1JT4A 4OEEA 3IAGC 1JQZA 2D1ZA 2NZ9A 3FGMA 1CE7B 3CAHA 5FNXA
chains in the Genus database with same CATH topology
4KBBA 3WINC 2D20A 1IT0A 4GOYA 3I29B 5FZYA 4LO3C 5DVHA 3Q7WA 5EG6C 1BFGA 3R4UA 3OBTA 2Y9FA 1T9FA 3RTIB 4QC4A 4X3AA 2FO1A 1XZZA 3IM6A 1G9CA 5BQUC 1R8OA 2L5XA 1ISYA 1HCEA 1Q04A 1IOBA 3E8LC 4IONA 3WINA 4QD2B 5DZUA 3S8KA 4KEKA 1S0CA 3BAQA 4LO3A 3OJVA 3A23A 1R8NA 1BASA 1DZDA 4I4VA 3NBCA 1AVWB 4ZFYB 4FGFA 3BAGA 3UD8A 5F8YA 2ERMA 1Z4SA 4EKXB 4JP0A 1TTUA 5F8WA 1MD6A 5BVPI 1V6UA 3HMYA 3VSFA 5BQUA 2FFUA 2LIEA 3AZWA 3FUQA 4JPZA 3R4SA 4H75A 4LO2C 3NBDA 3CRGA 4EFPA 1S0FA 2WRYA 2VUAA 4A7ZA 4I8MA 2AQZA 2RQ9A 1E0OA 4KEJA 2GZBA 4EEEB 3N0KA 2KI4A 1XHBA 1ISWA 1A8DA 1AVUA 3PG0A 1TP0A 5BXRA 3WMVA 3K1XA 2VXTI 2RG9B 4G9NA 1YYNA 2D24A 1TWEA 3T8SA 4OEGA 3BAHA 1G9AA 1RG8A 1S0BA 3H6QA 3FJAA 1FMMS 1IRPA 3NBNA 4XKIA 5D62A 1S0DA 5I1BA 2K43A 2VSAA 1YBIA 3BRGC 2X2TA 4I7IA 1DFCA 1YF8B 1XYFA 3VT0A 2HWAA 1AVXB 4LO2A 5DUYA 1AF9A 41BIA 3JRRA 3CQAA 1D0HA 1N4KA 3RSJA 1G9DA 1PUMB 5E24E 4J23B 4J2XA 3ZXGA 4IZEA 1S0GA 4P0JA 1F31A 9ILBA 3AH1A 1ONKB 1TWMA 4D8HA 4G9MA 4JRAA 3MALA 31BIA 1NZKA 3AH2A 3WMUA 4G6JA 1BLDA 4TLPA 3UDAA 2AAIB 3WO4A 2LIQA 1DLLA 1HKNA 3CRHA 1ILR1 1WBCA 5EHAA 1HCDA 2DS0A 3PUBA 4I6IA 4JQ0A 3V0AB 2DRZA 4MZHA 5EC5A 3C9ZA 3AZVA 1GGPB 3O3QA 2P23A 4H9WA 3SNVA 1RZOB 2Q3NB 2Z49A 3CA0A 4Z9WB 4I4YA 4I4UA 4I3NA 4GP3A 4GP0A 4KC3A 4QALA 3BA7A 2D22A 1ISXA 1RY7A 2NTDA 2VXRA 3D7WB 3LTQA 3VSZA 2ESUA 1G82A 3V0AA 1FV3A 1BFCA 4D0TA 2NYYA 1XG6A 3P6IA 1W3FA 3CA5A 4P0LA 4Q91A 4AN7B 3HOMA 1NUNA 3HBWA 5D61A 4MZGB 1S0LA 1I1EA 2VSEA 1BA7A 3FJFA 3CA1A 3IIRA 4QD2C 3ZX7A 4ZGRB 2HZ9A 1QXMA 3VT2A 1UPSA 3AKFA 3QYDA 4HA2A 2D43A 1AXMA 3PMEA 4I4SA 3O4OA 2F2FC 1YTOA 4I4PA 4OUJA 3ILAA 2VLCA 4USPA 3FJIA 4P6AA 3NJ5A 1YXWA 4LO1C 1IRAX 2D7RA 2NP0A 4USOA 3OJ2A 4DCKC 2R9KB 4I96A 2MC2A 1PWAA 3AH4A 3LLPA 4ZFUB 1FV2A 1BFFA 1ISZA 2AFGA 1EVTA 3UJ4A 4A7KA 3BA4A 1HWOB 1L2HA 3QR5A 4AN6A 4EFRA 1DQGA 3OBRA 4ZKTB 4OWJA 5JLVA 2I1BA 4GAFA 4FVVA 2ZQNA 1P63A 4H04A 4D0ZA 3IM5A 2F2FA 2F8XC 4LO8B 4QBVA 1FGAA 4F34A 4ENDA 1V6VA 3AKGA 3FJKA 1HWNB 4ZA3B 3UD9A 2YUGA 4LO1A 4HJJA 1QQLA 3HALA 2QYIB 2NM1A 3BAOA 2NVHA 1JT3A 1II4A 3I2XA 1BLAA 3BADA 3H6RB 4GOVA 2BFHA 4J2KA 1KNMA 1S0EA 1JLYA 3V79C 1K5UA 3P6JA 5BXSA 1DIWA 3VEQA 3O4DA 3Q7YA 5D63A 3S8JA 4LO0A 3BAUA 1M2TB 1BFBA 2Y9XE 4IY8A 4I4QA 5JMCA 1ISVA 3VWCA 4J2YA 4G6MA 3H6RA 4R6UB 1FWUA 1IILA 5BP5C 3EF2A 4IHZA 1I1BA 3VUOA 1T4QA 1DQOA 5DSSB 4DENA 1CVSA 4PC4A 5FZZA 2NS2A 3FUOA 2KLLA 3A22A 4GAIA 4ISRA 1AVAC 2KI6B 4JAWA 1BARA 1IHKA 4XFTA 1DFQA 4OW4A 3OGFA 2ZR1B 2IHOA 3RTJB 2HW9A 3F62B 3O4AA 3FJ8A 5HPZA 1SZ6B 4L4IA 1AFCA 5BP5A 2MLLB 3POKA 3AJ6A 4ZLBB 4Q9GA 4OWKA 3FJJA 2ET2A 4G1RA 2D7IA 1Z0HA 4QKSA 1K5VA 21BIA 3P53A 3N7LA 3OGGA 3VT1A 4KEIA 2WBCA 1IJTA 1W3AA 4I4RA 3N7JA 5BOWA 2KH2A 1EPWA 3OJMA 1Z2VA 3CA4A 3FJBA 4QO3A 3KMVA 3ZC8A 1DZCA 3PHZA 3FJEA 4ZFWB 2Q9XA 3UD7A 4ZOTA 4CJMA 3BB2A 3AKIA 3BTAA 1Q03A 2IWTB 2BEAA 3CA3A 1TOOA 1HWMB 3H6SE 3I2AA 1TFMB 2K4AB 2QN4A 4JKXB 1TIEA 4EFQA 5BXPA 2DRYA 1DJSB 1VCLA 2VU9A 3FFZA 4I0YA 5F90A 1FWVA 1MC9A 4WBCA 4MZFB 2D44A 3BRFA 3FJHA 3B9UA 3F1RA 4LO0C 2KKIA 2Z48A 3AJ5A 4X39A 3WO2A 4ZBVB 2E4MC 2ZQOA 3N7KA 3ZXDA 4Z8SB 1RMLA 1WD3A 3FJCA 3O4BA 4IQPA 2FFVA 4I37A 4F83A 5B2HA 4YOLA 5BXTA 1JY0A 2Y9GA 3O44A 2K8RA 3CU1B 1OQLB 1FN0A 4OWLA 3FJ9A 4I4OA 1M16A 1PZZA 4I2SA 3BAVA 3NBEA 1WBAA 2MIBA 4EB2B 1EYLA 3MPPG 4L4HA 3O4CA 1V6WA 4QBCA 1G9BA 3IM7A 3FJDA 3HSMA 2X2SA 1JTCA 2M49A 4HR6C 1HWPB 4I4XA 4QKRA 3RMXA 4A7YA 2E4MA 3TC2A 4Q9PA 3W9TA 1EV2A 3O49A 4IZXA 3A21A 4XFUA 1QQKA 3WO3A 2BEBA 2P39A 1JT7A 3ZC9A 3V0BB 1SR4C 1PUUB 2GO2A 2UUSA 4II0A 1FQ9A 4I1BA 3BX1C 1V6XA 3Q7XA 4X38A 2AXMA 3BRDA 1ABRB 4ISQA 4J2SA 5GAQA 3O5WB 4I1EA 3V0BA 2DREA 3JUTA 8I1BA 3CA6A 3CRIA 1PC8B 4JKQA 4UY4A 5F8SA 4LO7C 1HIBA 2RSTA 1W3GA 3N7MA 2J3PA 3UJ0A 3HN1A 4X37A 4DEPA 3RMYA 4IYBA 2D23A 1ITBA 1Q1UA 7I1BA 2Y9WC 1SR4A 3BA5A 3AKHA 1JLXA 5FNWA 1FMZA 5G00A 4IY9A 4LO7B 1JT5A 5FZUA 3A07A 2FGFA 4OEFA 2HWMA 4P0KA 3WA1A 1J0SA 2XOAA 6I1BA 4XFSA 1WD4A 2FDBM 1JT4A 4OEEA 3IAGC 1JQZA 2D1ZA 2NZ9A 3FGMA 1CE7B 3CAHA 5FNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBB A;  3WIN C;  2D20 A;  1IT0 A;  4GOY A;  3I29 B;  5FZY A;  4LO3 C;  5DVH A;  3Q7W A;  5EG6 C;  1BFG A;  3R4U A;  3OBT A;  2Y9F A;  1T9F A;  3RTI B;  4QC4 A;  4X3A A;  2FO1 A;  1XZZ A;  3IM6 A;  1G9C A;  5BQU C;  1R8O A;  2L5X A;  1ISY A;  1HCE A;  1Q04 A;  1IOB A;  3E8L C;  4ION A;  3WIN A;  4QD2 B;  5DZU A;  3S8K A;  4KEK A;  1S0C A;  3BAQ A;  4LO3 A;  3OJV A;  3A23 A;  1R8N A;  1BAS A;  1DZD A;  4I4V A;  3NBC A;  1AVW B;  4ZFY B;  4FGF A;  3BAG A;  3UD8 A;  5F8Y A;  2ERM A;  1Z4S A;  4EKX B;  4JP0 A;  1TTU A;  5F8W A;  1MD6 A;  5BVP I;  1V6U A;  3HMY A;  3VSF A;  5BQU A;  2FFU A;  2LIE A;  3AZW A;  3FUQ A;  4JPZ A;  3R4S A;  4LO2 C;  3NBD A;  3CRG A;  4EFP A;  1S0F A;  2WRY A;  2VUA A;  4A7Z A;  4I8M A;  2AQZ A;  2RQ9 A;  1E0O A;  4KEJ A;  2GZB A;  4EEE B;  3N0K A;  2KI4 A;  1XHB A;  1ISW A;  1A8D A;  1AVU A;  3PG0 A;  1TP0 A;  5BXR A;  3WMV A;  3K1X A;  2VXT I;  2RG9 B;  4G9N A;  1YYN A;  2D24 A;  1TWE A;  3T8S A;  4OEG A;  3BAH A;  1G9A A;  1RG8 A;  1S0B A;  3H6Q A;  3FJA A;  1FMM S;  1IRP A;  3NBN A;  4XKI A;  5D62 A;  1S0D A;  5I1B A;  2K43 A;  2VSA A;  1YBI A;  3BRG C;  2X2T A;  4I7I A;  1DFC A;  1YF8 B;  1XYF A;  3VT0 A;  2HWA A;  1AVX B;  4LO2 A;  5DUY A;  1AF9 A;  41BI A;  3JRR A;  3CQA A;  1D0H A;  1N4K A;  3RSJ A;  1G9D A;  1PUM B;  5E24 E;  4J23 B;  4J2X A;  3ZXG A;  4IZE A;  1S0G A;  4P0J A;  1F31 A;  9ILB A;  3AH1 A;  1ONK B;  1TWM A;  4D8H A;  4G9M A;  4JRA A;  3MAL A;  31BI A;  1NZK A;  3AH2 A;  3WMU A;  4G6J A;  1BLD A;  4TLP A;  3UDA A;  2AAI B;  3WO4 A;  2LIQ A;  1DLL A;  1HKN A;  3CRH A;  1ILR 1;  1WBC A;  5EHA A;  1HCD A;  2DS0 A;  3PUB A;  4I6I A;  4JQ0 A;  3V0A B;  2DRZ A;  5EC5 A;  3C9Z A;  3AZV A;  1GGP B;  3O3Q A;  2P23 A;  4H9W A;  3SNV A;  1RZO B;  2Q3N B;  2Z49 A;  3CA0 A;  4Z9W B;  4I4Y A;  4I4U A;  4I3N A;  4GP3 A;  4GP0 A;  4KC3 A;  4QAL A;  3BA7 A;  2D22 A;  1ISX A;  1RY7 A;  2NTD A;  2VXR A;  3D7W B;  3LTQ A;  3VSZ A;  2ESU A;  1G82 A;  3V0A A;  1FV3 A;  1BFC A;  4D0T A;  2NYY A;  1XG6 A;  3P6I A;  1W3F A;  3CA5 A;  4P0L A;  4Q91 A;  4AN7 B;  3HOM A;  1NUN A;  3HBW A;  5D61 A;  1S0L A;  1I1E A;  2VSE A;  1BA7 A;  3FJF A;  3CA1 A;  3IIR A;  4QD2 C;  3ZX7 A;  4ZGR B;  2HZ9 A;  1QXM A;  3VT2 A;  1UPS A;  3AKF A;  3QYD A;  4HA2 A;  2D43 A;  1AXM A;  3PME A;  4I4S A;  3O4O A;  2F2F C;  1YTO A;  4I4P A;  4OUJ A;  3ILA A;  2VLC A;  4USP A;  3FJI A;  4P6A A;  3NJ5 A;  1YXW A;  4LO1 C;  1IRA X;  2D7R A;  2NP0 A;  4USO A;  3OJ2 A;  4DCK C;  2R9K B;  4I96 A;  2MC2 A;  1PWA A;  3AH4 A;  3LLP A;  4ZFU B;  1FV2 A;  1BFF A;  1ISZ A;  2AFG A;  1EVT A;  3UJ4 A;  4A7K A;  3BA4 A;  1HWO B;  1L2H A;  3QR5 A;  4AN6 A;  4EFR A;  1DQG A;  3OBR A;  4ZKT B;  4OWJ A;  5JLV A;  2I1B A;  4GAF A;  4FVV A;  2ZQN A;  1P63 A;  4H04 A;  4D0Z A;  3IM5 A;  2F2F A;  2F8X C;  4LO8 B;  4QBV A;  1FGA A;  4F34 A;  4END A;  1V6V A;  3AKG A;  3FJK A;  1HWN B;  4ZA3 B;  3UD9 A;  2YUG A;  4LO1 A;  4HJJ A;  1QQL A;  3HAL A;  2QYI B;  2NM1 A;  3BAO A;  2NVH A;  1JT3 A;  1II4 A;  3I2X A;  1BLA A;  3BAD A;  3H6R B;  4GOV A;  2BFH A;  4J2K A;  1KNM A;  1S0E A;  1JLY A;  3V79 C;  1K5U A;  3P6J A;  5BXS A;  1DIW A;  3VEQ A;  3O4D A;  3Q7Y A;  5D63 A;  3S8J A;  4LO0 A;  3BAU A;  1M2T B;  1BFB A;  2Y9X E;  4IY8 A;  4I4Q A;  5JMC A;  1ISV A;  3VWC A;  4J2Y A;  4G6M A;  3H6R A;  4R6U B;  1FWU A;  1IIL A;  5BP5 C;  3EF2 A;  4IHZ A;  1I1B A;  3VUO A;  1T4Q A;  1DQO A;  5DSS B;  4DEN A;  1CVS A;  4PC4 A;  5FZZ A;  3FUO A;  2KLL A;  3A22 A;  4GAI A;  4ISR A;  1AVA C;  2KI6 B;  4JAW A;  1BAR A;  1IHK A;  4XFT A;  1DFQ A;  4OW4 A;  3OGF A;  2ZR1 B;  2IHO A;  3RTJ B;  2HW9 A;  3F62 B;  3O4A A;  3FJ8 A;  5HPZ A;  1SZ6 B;  4L4I A;  1AFC A;  5BP5 A;  2MLL B;  3POK A;  3AJ6 A;  4ZLB B;  4Q9G A;  4OWK A;  3FJJ A;  2ET2 A;  4G1R A;  2D7I A;  1Z0H A;  4QKS A;  1K5V A;  21BI A;  3P53 A;  3N7L A;  3OGG A;  3VT1 A;  4KEI A;  2WBC A;  1IJT A;  1W3A A;  4I4R A;  3N7J A;  5BOW A;  2KH2 A;  1EPW A;  3OJM A;  1Z2V A;  3CA4 A;  3FJB A;  4QO3 A;  3KMV A;  3ZC8 A;  1DZC A;  3PHZ A;  3FJE A;  4ZFW B;  2Q9X A;  3UD7 A;  4ZOT A;  4CJM A;  3BB2 A;  3AKI A;  3BTA A;  1Q03 A;  2IWT B;  2BEA A;  3CA3 A;  1TOO A;  1HWM B;  3H6S E;  3I2A A;  1TFM B;  2K4A B;  2QN4 A;  4JKX B;  1TIE A;  4EFQ A;  5BXP A;  2DRY A;  1DJS B;  1VCL A;  2VU9 A;  3FFZ A;  4I0Y A;  5F90 A;  1FWV A;  1MC9 A;  4WBC A;  2D44 A;  3BRF A;  3FJH A;  3B9U A;  3F1R A;  4LO0 C;  2KKI A;  2Z48 A;  3AJ5 A;  4X39 A;  3WO2 A;  4ZBV B;  2E4M C;  2ZQO A;  3N7K A;  3ZXD A;  4Z8S B;  1RML A;  1WD3 A;  3FJC A;  3O4B A;  4IQP A;  2FFV A;  4I37 A;  4F83 A;  5B2H A;  4YOL A;  5BXT A;  1JY0 A;  2Y9G A;  3O44 A;  2K8R A;  3CU1 B;  1OQL B;  1FN0 A;  4OWL A;  3FJ9 A;  4I4O A;  1M16 A;  1PZZ A;  4I2S A;  3BAV A;  3NBE A;  1WBA A;  2MIB A;  4EB2 B;  1EYL A;  3MPP G;  4L4H A;  3O4C A;  1V6W A;  4QBC A;  1G9B A;  3IM7 A;  3FJD A;  3HSM A;  2X2S A;  1JTC A;  2M49 A;  4HR6 C;  1HWP B;  4I4X A;  4QKR A;  3RMX A;  4A7Y A;  2E4M A;  3TC2 A;  4Q9P A;  3W9T A;  1EV2 A;  3O49 A;  4IZX A;  3A21 A;  4XFU A;  1QQK A;  3WO3 A;  2BEB A;  2P39 A;  1JT7 A;  3ZC9 A;  3V0B B;  1SR4 C;  1PUU B;  2GO2 A;  2UUS A;  4II0 A;  1FQ9 A;  4I1B A;  3BX1 C;  1V6X A;  3Q7X A;  4X38 A;  2AXM A;  3BRD A;  1ABR B;  4ISQ A;  4J2S A;  5GAQ A;  3O5W B;  4I1E A;  3V0B A;  2DRE A;  3JUT A;  8I1B A;  3CA6 A;  3CRI A;  1PC8 B;  4JKQ A;  5F8S A;  4LO7 C;  1HIB A;  2RST A;  1W3G A;  3N7M A;  2J3P A;  3UJ0 A;  3HN1 A;  4X37 A;  4DEP A;  3RMY A;  4IYB A;  2D23 A;  1ITB A;  1Q1U A;  7I1B A;  2Y9W C;  1SR4 A;  3BA5 A;  3AKH A;  1JLX A;  5FNW A;  1FMZ A;  5G00 A;  4IY9 A;  4LO7 B;  1JT5 A;  5FZU A;  3A07 A;  2FGF A;  4OEF A;  2HWM A;  4P0K A;  3WA1 A;  1J0S A;  2XOA A;  6I1B A;  4XFS A;  1WD4 A;  2FDB M;  1JT4 A;  4OEE A;  3IAG C;  1JQZ A;  2D1Z A;  2NZ9 A;  3FGM A;  1CE7 B;  3CAH A;  5FNX A; 
#chains in the Genus database with same CATH topology
 4KBB A;  3WIN C;  2D20 A;  1IT0 A;  4GOY A;  3I29 B;  5FZY A;  4LO3 C;  5DVH A;  3Q7W A;  5EG6 C;  1BFG A;  3R4U A;  3OBT A;  2Y9F A;  1T9F A;  3RTI B;  4QC4 A;  4X3A A;  2FO1 A;  1XZZ A;  3IM6 A;  1G9C A;  5BQU C;  1R8O A;  2L5X A;  1ISY A;  1HCE A;  1Q04 A;  1IOB A;  3E8L C;  4ION A;  3WIN A;  4QD2 B;  5DZU A;  3S8K A;  4KEK A;  1S0C A;  3BAQ A;  4LO3 A;  3OJV A;  3A23 A;  1R8N A;  1BAS A;  1DZD A;  4I4V A;  3NBC A;  1AVW B;  4ZFY B;  4FGF A;  3BAG A;  3UD8 A;  5F8Y A;  2ERM A;  1Z4S A;  4EKX B;  4JP0 A;  1TTU A;  5F8W A;  1MD6 A;  5BVP I;  1V6U A;  3HMY A;  3VSF A;  5BQU A;  2FFU A;  2LIE A;  3AZW A;  3FUQ A;  4JPZ A;  3R4S A;  4H75 A;  4LO2 C;  3NBD A;  3CRG A;  4EFP A;  1S0F A;  2WRY A;  2VUA A;  4A7Z A;  4I8M A;  2AQZ A;  2RQ9 A;  1E0O A;  4KEJ A;  2GZB A;  4EEE B;  3N0K A;  2KI4 A;  1XHB A;  1ISW A;  1A8D A;  1AVU A;  3PG0 A;  1TP0 A;  5BXR A;  3WMV A;  3K1X A;  2VXT I;  2RG9 B;  4G9N A;  1YYN A;  2D24 A;  1TWE A;  3T8S A;  4OEG A;  3BAH A;  1G9A A;  1RG8 A;  1S0B A;  3H6Q A;  3FJA A;  1FMM S;  1IRP A;  3NBN A;  4XKI A;  5D62 A;  1S0D A;  5I1B A;  2K43 A;  2VSA A;  1YBI A;  3BRG C;  2X2T A;  4I7I A;  1DFC A;  1YF8 B;  1XYF A;  3VT0 A;  2HWA A;  1AVX B;  4LO2 A;  5DUY A;  1AF9 A;  41BI A;  3JRR A;  3CQA A;  1D0H A;  1N4K A;  3RSJ A;  1G9D A;  1PUM B;  5E24 E;  4J23 B;  4J2X A;  3ZXG A;  4IZE A;  1S0G A;  4P0J A;  1F31 A;  9ILB A;  3AH1 A;  1ONK B;  1TWM A;  4D8H A;  4G9M A;  4JRA A;  3MAL A;  31BI A;  1NZK A;  3AH2 A;  3WMU A;  4G6J A;  1BLD A;  4TLP A;  3UDA A;  2AAI B;  3WO4 A;  2LIQ A;  1DLL A;  1HKN A;  3CRH A;  1ILR 1;  1WBC A;  5EHA A;  1HCD A;  2DS0 A;  3PUB A;  4I6I A;  4JQ0 A;  3V0A B;  2DRZ A;  4MZH A;  5EC5 A;  3C9Z A;  3AZV A;  1GGP B;  3O3Q A;  2P23 A;  4H9W A;  3SNV A;  1RZO B;  2Q3N B;  2Z49 A;  3CA0 A;  4Z9W B;  4I4Y A;  4I4U A;  4I3N A;  4GP3 A;  4GP0 A;  4KC3 A;  4QAL A;  3BA7 A;  2D22 A;  1ISX A;  1RY7 A;  2NTD A;  2VXR A;  3D7W B;  3LTQ A;  3VSZ A;  2ESU A;  1G82 A;  3V0A A;  1FV3 A;  1BFC A;  4D0T A;  2NYY A;  1XG6 A;  3P6I A;  1W3F A;  3CA5 A;  4P0L A;  4Q91 A;  4AN7 B;  3HOM A;  1NUN A;  3HBW A;  5D61 A;  4MZG B;  1S0L A;  1I1E A;  2VSE A;  1BA7 A;  3FJF A;  3CA1 A;  3IIR A;  4QD2 C;  3ZX7 A;  4ZGR B;  2HZ9 A;  1QXM A;  3VT2 A;  1UPS A;  3AKF A;  3QYD A;  4HA2 A;  2D43 A;  1AXM A;  3PME A;  4I4S A;  3O4O A;  2F2F C;  1YTO A;  4I4P A;  4OUJ A;  3ILA A;  2VLC A;  4USP A;  3FJI A;  4P6A A;  3NJ5 A;  1YXW A;  4LO1 C;  1IRA X;  2D7R A;  2NP0 A;  4USO A;  3OJ2 A;  4DCK C;  2R9K B;  4I96 A;  2MC2 A;  1PWA A;  3AH4 A;  3LLP A;  4ZFU B;  1FV2 A;  1BFF A;  1ISZ A;  2AFG A;  1EVT A;  3UJ4 A;  4A7K A;  3BA4 A;  1HWO B;  1L2H A;  3QR5 A;  4AN6 A;  4EFR A;  1DQG A;  3OBR A;  4ZKT B;  4OWJ A;  5JLV A;  2I1B A;  4GAF A;  4FVV A;  2ZQN A;  1P63 A;  4H04 A;  4D0Z A;  3IM5 A;  2F2F A;  2F8X C;  4LO8 B;  4QBV A;  1FGA A;  4F34 A;  4END A;  1V6V A;  3AKG A;  3FJK A;  1HWN B;  4ZA3 B;  3UD9 A;  2YUG A;  4LO1 A;  4HJJ A;  1QQL A;  3HAL A;  2QYI B;  2NM1 A;  3BAO A;  2NVH A;  1JT3 A;  1II4 A;  3I2X A;  1BLA A;  3BAD A;  3H6R B;  4GOV A;  2BFH A;  4J2K A;  1KNM A;  1S0E A;  1JLY A;  3V79 C;  1K5U A;  3P6J A;  5BXS A;  1DIW A;  3VEQ A;  3O4D A;  3Q7Y A;  5D63 A;  3S8J A;  4LO0 A;  3BAU A;  1M2T B;  1BFB A;  2Y9X E;  4IY8 A;  4I4Q A;  5JMC A;  1ISV A;  3VWC A;  4J2Y A;  4G6M A;  3H6R A;  4R6U B;  1FWU A;  1IIL A;  5BP5 C;  3EF2 A;  4IHZ A;  1I1B A;  3VUO A;  1T4Q A;  1DQO A;  5DSS B;  4DEN A;  1CVS A;  4PC4 A;  5FZZ A;  2NS2 A;  3FUO A;  2KLL A;  3A22 A;  4GAI A;  4ISR A;  1AVA C;  2KI6 B;  4JAW A;  1BAR A;  1IHK A;  4XFT A;  1DFQ A;  4OW4 A;  3OGF A;  2ZR1 B;  2IHO A;  3RTJ B;  2HW9 A;  3F62 B;  3O4A A;  3FJ8 A;  5HPZ A;  1SZ6 B;  4L4I A;  1AFC A;  5BP5 A;  2MLL B;  3POK A;  3AJ6 A;  4ZLB B;  4Q9G A;  4OWK A;  3FJJ A;  2ET2 A;  4G1R A;  2D7I A;  1Z0H A;  4QKS A;  1K5V A;  21BI A;  3P53 A;  3N7L A;  3OGG A;  3VT1 A;  4KEI A;  2WBC A;  1IJT A;  1W3A A;  4I4R A;  3N7J A;  5BOW A;  2KH2 A;  1EPW A;  3OJM A;  1Z2V A;  3CA4 A;  3FJB A;  4QO3 A;  3KMV A;  3ZC8 A;  1DZC A;  3PHZ A;  3FJE A;  4ZFW B;  2Q9X A;  3UD7 A;  4ZOT A;  4CJM A;  3BB2 A;  3AKI A;  3BTA A;  1Q03 A;  2IWT B;  2BEA A;  3CA3 A;  1TOO A;  1HWM B;  3H6S E;  3I2A A;  1TFM B;  2K4A B;  2QN4 A;  4JKX B;  1TIE A;  4EFQ A;  5BXP A;  2DRY A;  1DJS B;  1VCL A;  2VU9 A;  3FFZ A;  4I0Y A;  5F90 A;  1FWV A;  1MC9 A;  4WBC A;  4MZF B;  2D44 A;  3BRF A;  3FJH A;  3B9U A;  3F1R A;  4LO0 C;  2KKI A;  2Z48 A;  3AJ5 A;  4X39 A;  3WO2 A;  4ZBV B;  2E4M C;  2ZQO A;  3N7K A;  3ZXD A;  4Z8S B;  1RML A;  1WD3 A;  3FJC A;  3O4B A;  4IQP A;  2FFV A;  4I37 A;  4F83 A;  5B2H A;  4YOL A;  5BXT A;  1JY0 A;  2Y9G A;  3O44 A;  2K8R A;  3CU1 B;  1OQL B;  1FN0 A;  4OWL A;  3FJ9 A;  4I4O A;  1M16 A;  1PZZ A;  4I2S A;  3BAV A;  3NBE A;  1WBA A;  2MIB A;  4EB2 B;  1EYL A;  3MPP G;  4L4H A;  3O4C A;  1V6W A;  4QBC A;  1G9B A;  3IM7 A;  3FJD A;  3HSM A;  2X2S A;  1JTC A;  2M49 A;  4HR6 C;  1HWP B;  4I4X A;  4QKR A;  3RMX A;  4A7Y A;  2E4M A;  3TC2 A;  4Q9P A;  3W9T A;  1EV2 A;  3O49 A;  4IZX A;  3A21 A;  4XFU A;  1QQK A;  3WO3 A;  2BEB A;  2P39 A;  1JT7 A;  3ZC9 A;  3V0B B;  1SR4 C;  1PUU B;  2GO2 A;  2UUS A;  4II0 A;  1FQ9 A;  4I1B A;  3BX1 C;  1V6X A;  3Q7X A;  4X38 A;  2AXM A;  3BRD A;  1ABR B;  4ISQ A;  4J2S A;  5GAQ A;  3O5W B;  4I1E A;  3V0B A;  2DRE A;  3JUT A;  8I1B A;  3CA6 A;  3CRI A;  1PC8 B;  4JKQ A;  4UY4 A;  5F8S A;  4LO7 C;  1HIB A;  2RST A;  1W3G A;  3N7M A;  2J3P A;  3UJ0 A;  3HN1 A;  4X37 A;  4DEP A;  3RMY A;  4IYB A;  2D23 A;  1ITB A;  1Q1U A;  7I1B A;  2Y9W C;  1SR4 A;  3BA5 A;  3AKH A;  1JLX A;  5FNW A;  1FMZ A;  5G00 A;  4IY9 A;  4LO7 B;  1JT5 A;  5FZU A;  3A07 A;  2FGF A;  4OEF A;  2HWM A;  4P0K A;  3WA1 A;  1J0S A;  2XOA A;  6I1B A;  4XFS A;  1WD4 A;  2FDB M;  1JT4 A;  4OEE A;  3IAG C;  1JQZ A;  2D1Z A;  2NZ9 A;  3FGM A;  1CE7 B;  3CAH A;  5FNX A; 
#chains in the Genus database with same CATH homology
 4KBB A;  3WIN C;  2D20 A;  1IT0 A;  4GOY A;  3I29 B;  5FZY A;  4LO3 C;  5DVH A;  3Q7W A;  5EG6 C;  1BFG A;  3R4U A;  3OBT A;  2Y9F A;  1T9F A;  3RTI B;  4QC4 A;  4X3A A;  2FO1 A;  1XZZ A;  3IM6 A;  1G9C A;  5BQU C;  1R8O A;  2L5X A;  1ISY A;  1HCE A;  1Q04 A;  1IOB A;  3E8L C;  4ION A;  3WIN A;  4QD2 B;  5DZU A;  3S8K A;  4KEK A;  1S0C A;  3BAQ A;  4LO3 A;  3OJV A;  3A23 A;  1R8N A;  1BAS A;  1DZD A;  4I4V A;  3NBC A;  1AVW B;  4ZFY B;  4FGF A;  3BAG A;  3UD8 A;  5F8Y A;  2ERM A;  1Z4S A;  4EKX B;  4JP0 A;  1TTU A;  5F8W A;  1MD6 A;  5BVP I;  1V6U A;  3HMY A;  3VSF A;  5BQU A;  2FFU A;  2LIE A;  3AZW A;  3FUQ A;  4JPZ A;  3R4S A;  4H75 A;  4LO2 C;  3NBD A;  3CRG A;  4EFP A;  1S0F A;  2WRY A;  2VUA A;  4A7Z A;  4I8M A;  2AQZ A;  2RQ9 A;  1E0O A;  4KEJ A;  2GZB A;  4EEE B;  3N0K A;  2KI4 A;  1XHB A;  1ISW A;  1A8D A;  1AVU A;  3PG0 A;  1TP0 A;  5BXR A;  3WMV A;  3K1X A;  2VXT I;  2RG9 B;  4G9N A;  1YYN A;  2D24 A;  1TWE A;  3T8S A;  4OEG A;  3BAH A;  1G9A A;  1RG8 A;  1S0B A;  3H6Q A;  3FJA A;  1FMM S;  1IRP A;  3NBN A;  4XKI A;  5D62 A;  1S0D A;  5I1B A;  2K43 A;  2VSA A;  1YBI A;  3BRG C;  2X2T A;  4I7I A;  1DFC A;  1YF8 B;  1XYF A;  3VT0 A;  2HWA A;  1AVX B;  4LO2 A;  5DUY A;  1AF9 A;  41BI A;  3JRR A;  3CQA A;  1D0H A;  1N4K A;  3RSJ A;  1G9D A;  1PUM B;  5E24 E;  4J23 B;  4J2X A;  3ZXG A;  4IZE A;  1S0G A;  4P0J A;  1F31 A;  9ILB A;  3AH1 A;  1ONK B;  1TWM A;  4D8H A;  4G9M A;  4JRA A;  3MAL A;  31BI A;  1NZK A;  3AH2 A;  3WMU A;  4G6J A;  1BLD A;  4TLP A;  3UDA A;  2AAI B;  3WO4 A;  2LIQ A;  1DLL A;  1HKN A;  3CRH A;  1ILR 1;  1WBC A;  5EHA A;  1HCD A;  2DS0 A;  3PUB A;  4I6I A;  4JQ0 A;  3V0A B;  2DRZ A;  4MZH A;  5EC5 A;  3C9Z A;  3AZV A;  1GGP B;  3O3Q A;  2P23 A;  4H9W A;  3SNV A;  1RZO B;  2Q3N B;  2Z49 A;  3CA0 A;  4Z9W B;  4I4Y A;  4I4U A;  4I3N A;  4GP3 A;  4GP0 A;  4KC3 A;  4QAL A;  3BA7 A;  2D22 A;  1ISX A;  1RY7 A;  2NTD A;  2VXR A;  3D7W B;  3LTQ A;  3VSZ A;  2ESU A;  1G82 A;  3V0A A;  1FV3 A;  1BFC A;  4D0T A;  2NYY A;  1XG6 A;  3P6I A;  1W3F A;  3CA5 A;  4P0L A;  4Q91 A;  4AN7 B;  3HOM A;  1NUN A;  3HBW A;  5D61 A;  4MZG B;  1S0L A;  1I1E A;  2VSE A;  1BA7 A;  3FJF A;  3CA1 A;  3IIR A;  4QD2 C;  3ZX7 A;  4ZGR B;  2HZ9 A;  1QXM A;  3VT2 A;  1UPS A;  3AKF A;  3QYD A;  4HA2 A;  2D43 A;  1AXM A;  3PME A;  4I4S A;  3O4O A;  2F2F C;  1YTO A;  4I4P A;  4OUJ A;  3ILA A;  2VLC A;  4USP A;  3FJI A;  4P6A A;  3NJ5 A;  1YXW A;  4LO1 C;  1IRA X;  2D7R A;  2NP0 A;  4USO A;  3OJ2 A;  4DCK C;  2R9K B;  4I96 A;  2MC2 A;  1PWA A;  3AH4 A;  3LLP A;  4ZFU B;  1FV2 A;  1BFF A;  1ISZ A;  2AFG A;  1EVT A;  3UJ4 A;  4A7K A;  3BA4 A;  1HWO B;  1L2H A;  3QR5 A;  4AN6 A;  4EFR A;  1DQG A;  3OBR A;  4ZKT B;  4OWJ A;  5JLV A;  2I1B A;  4GAF A;  4FVV A;  2ZQN A;  1P63 A;  4H04 A;  4D0Z A;  3IM5 A;  2F2F A;  2F8X C;  4LO8 B;  4QBV A;  1FGA A;  4F34 A;  4END A;  1V6V A;  3AKG A;  3FJK A;  1HWN B;  4ZA3 B;  3UD9 A;  2YUG A;  4LO1 A;  4HJJ A;  1QQL A;  3HAL A;  2QYI B;  2NM1 A;  3BAO A;  2NVH A;  1JT3 A;  1II4 A;  3I2X A;  1BLA A;  3BAD A;  3H6R B;  4GOV A;  2BFH A;  4J2K A;  1KNM A;  1S0E A;  1JLY A;  3V79 C;  1K5U A;  3P6J A;  5BXS A;  1DIW A;  3VEQ A;  3O4D A;  3Q7Y A;  5D63 A;  3S8J A;  4LO0 A;  3BAU A;  1M2T B;  1BFB A;  2Y9X E;  4IY8 A;  4I4Q A;  5JMC A;  1ISV A;  3VWC A;  4J2Y A;  4G6M A;  3H6R A;  4R6U B;  1FWU A;  1IIL A;  5BP5 C;  3EF2 A;  4IHZ A;  1I1B A;  3VUO A;  1T4Q A;  1DQO A;  5DSS B;  4DEN A;  1CVS A;  4PC4 A;  5FZZ A;  2NS2 A;  3FUO A;  2KLL A;  3A22 A;  4GAI A;  4ISR A;  1AVA C;  2KI6 B;  4JAW A;  1BAR A;  1IHK A;  4XFT A;  1DFQ A;  4OW4 A;  3OGF A;  2ZR1 B;  2IHO A;  3RTJ B;  2HW9 A;  3F62 B;  3O4A A;  3FJ8 A;  5HPZ A;  1SZ6 B;  4L4I A;  1AFC A;  5BP5 A;  2MLL B;  3POK A;  3AJ6 A;  4ZLB B;  4Q9G A;  4OWK A;  3FJJ A;  2ET2 A;  4G1R A;  2D7I A;  1Z0H A;  4QKS A;  1K5V A;  21BI A;  3P53 A;  3N7L A;  3OGG A;  3VT1 A;  4KEI A;  2WBC A;  1IJT A;  1W3A A;  4I4R A;  3N7J A;  5BOW A;  2KH2 A;  1EPW A;  3OJM A;  1Z2V A;  3CA4 A;  3FJB A;  4QO3 A;  3KMV A;  3ZC8 A;  1DZC A;  3PHZ A;  3FJE A;  4ZFW B;  2Q9X A;  3UD7 A;  4ZOT A;  4CJM A;  3BB2 A;  3AKI A;  3BTA A;  1Q03 A;  2IWT B;  2BEA A;  3CA3 A;  1TOO A;  1HWM B;  3H6S E;  3I2A A;  1TFM B;  2K4A B;  2QN4 A;  4JKX B;  1TIE A;  4EFQ A;  5BXP A;  2DRY A;  1DJS B;  1VCL A;  2VU9 A;  3FFZ A;  4I0Y A;  5F90 A;  1FWV A;  1MC9 A;  4WBC A;  4MZF B;  2D44 A;  3BRF A;  3FJH A;  3B9U A;  3F1R A;  4LO0 C;  2KKI A;  2Z48 A;  3AJ5 A;  4X39 A;  3WO2 A;  4ZBV B;  2E4M C;  2ZQO A;  3N7K A;  3ZXD A;  4Z8S B;  1RML A;  1WD3 A;  3FJC A;  3O4B A;  4IQP A;  2FFV A;  4I37 A;  4F83 A;  5B2H A;  4YOL A;  5BXT A;  1JY0 A;  2Y9G A;  3O44 A;  2K8R A;  3CU1 B;  1OQL B;  1FN0 A;  4OWL A;  3FJ9 A;  4I4O A;  1M16 A;  1PZZ A;  4I2S A;  3BAV A;  3NBE A;  1WBA A;  2MIB A;  4EB2 B;  1EYL A;  3MPP G;  4L4H A;  3O4C A;  1V6W A;  4QBC A;  1G9B A;  3IM7 A;  3FJD A;  3HSM A;  2X2S A;  1JTC A;  2M49 A;  4HR6 C;  1HWP B;  4I4X A;  4QKR A;  3RMX A;  4A7Y A;  2E4M A;  3TC2 A;  4Q9P A;  3W9T A;  1EV2 A;  3O49 A;  4IZX A;  3A21 A;  4XFU A;  1QQK A;  3WO3 A;  2BEB A;  2P39 A;  1JT7 A;  3ZC9 A;  3V0B B;  1SR4 C;  1PUU B;  2GO2 A;  2UUS A;  4II0 A;  1FQ9 A;  4I1B A;  3BX1 C;  1V6X A;  3Q7X A;  4X38 A;  2AXM A;  3BRD A;  1ABR B;  4ISQ A;  4J2S A;  5GAQ A;  3O5W B;  4I1E A;  3V0B A;  2DRE A;  3JUT A;  8I1B A;  3CA6 A;  3CRI A;  1PC8 B;  4JKQ A;  4UY4 A;  5F8S A;  4LO7 C;  1HIB A;  2RST A;  1W3G A;  3N7M A;  2J3P A;  3UJ0 A;  3HN1 A;  4X37 A;  4DEP A;  3RMY A;  4IYB A;  2D23 A;  1ITB A;  1Q1U A;  7I1B A;  2Y9W C;  1SR4 A;  3BA5 A;  3AKH A;  1JLX A;  5FNW A;  1FMZ A;  5G00 A;  4IY9 A;  4LO7 B;  1JT5 A;  5FZU A;  3A07 A;  2FGF A;  4OEF A;  2HWM A;  4P0K A;  3WA1 A;  1J0S A;  2XOA A;  6I1B A;  4XFS A;  1WD4 A;  2FDB M;  1JT4 A;  4OEE A;  3IAG C;  1JQZ A;  2D1Z A;  2NZ9 A;  3FGM A;  1CE7 B;  3CAH A;  5FNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...