4OUNA

Crystal structure of mini-ribonuclease 3 from bacillus subtilis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
131
structure length
125
Chain Sequence
FDTIKDSKQLNGLALAYIGDAIFEVYVRHHLLKQGFTKPNDLHKKSSRIVSAKSQAEILFFLQNQSFFTEEEEAVLKRGRNAKNTDVQTYRYSTAFQALLGYLFLEKKEERLSQLVAEAIQFGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mini-ribonuclease 3
publication title Sequence-specific cleavage of dsRNA by Mini-III RNase
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 55
structure length 125
sequence length 131
ec nomenclature ec 3.1.26.-:
pdb deposition date 2014-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4ounA00
1RC5A 4OOGC 1I4SA 3C4BA 4M2ZA 1JFZA 3RV0A 3O2RA 2FFLA 4M30A 1RC7A 1O0WA 1YZ9A 2GSLA 2EZ6A 1YYWA 1U61A 3RV1A 1YYOA 1YYKA 2QVWA 3C4TA 2EB1A 2NUEA 3O2RB 3N3WA 4OUNA 2NUGA 2NUFA 2A11A
chains in the Genus database with same CATH superfamily
1RC5A 4OOGC 1I4SA 3C4BA 4M2ZA 1JFZA 3RV0A 3O2RA 2FFLA 4M30A 1RC7A 1O0WA 1YZ9A 2GSLA 2EZ6A 1ZTDA 1YYWA 1U61A 3RV1A 1YYOA 1YYKA 2QVWA 3C4TA 2EB1A 2NUEA 3O2RB 3N3WA 4OUNA 2NUGA 2NUFA 2A11A
chains in the Genus database with same CATH topology
1RC5A 4OOGC 1I4SA 3C4BA 4M2ZA 1JFZA 3RV0A 3O2RA 2FFLA 4M30A 1RC7A 1O0WA 1YZ9A 2GSLA 2EZ6A 1YYWA 1U61A 3RV1A 1YYOA 1YYKA 2QVWA 3C4TA 2EB1A 2NUEA 3O2RB 3N3WA 4OUNA 2NUGA 2NUFA 2A11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RC5 A;  4OOG C;  1I4S A;  3C4B A;  4M2Z A;  1JFZ A;  3RV0 A;  3O2R A;  2FFL A;  4M30 A;  1RC7 A;  1O0W A;  1YZ9 A;  2GSL A;  2EZ6 A;  1YYW A;  1U61 A;  3RV1 A;  1YYO A;  1YYK A;  2QVW A;  3C4T A;  2EB1 A;  2NUE A;  3O2R B;  3N3W A;  4OUN A;  2NUG A;  2NUF A;  2A11 A; 
#chains in the Genus database with same CATH topology
 1RC5 A;  4OOG C;  1I4S A;  3C4B A;  4M2Z A;  1JFZ A;  3RV0 A;  3O2R A;  2FFL A;  4M30 A;  1RC7 A;  1O0W A;  1YZ9 A;  2GSL A;  2EZ6 A;  1ZTD A;  1YYW A;  1U61 A;  3RV1 A;  1YYO A;  1YYK A;  2QVW A;  3C4T A;  2EB1 A;  2NUE A;  3O2R B;  3N3W A;  4OUN A;  2NUG A;  2NUF A;  2A11 A; 
#chains in the Genus database with same CATH homology
 1RC5 A;  4OOG C;  1I4S A;  3C4B A;  4M2Z A;  1JFZ A;  3RV0 A;  3O2R A;  2FFL A;  4M30 A;  1RC7 A;  1O0W A;  1YZ9 A;  2GSL A;  2EZ6 A;  1YYW A;  1U61 A;  3RV1 A;  1YYO A;  1YYK A;  2QVW A;  3C4T A;  2EB1 A;  2NUE A;  3O2R B;  3N3W A;  4OUN A;  2NUG A;  2NUF A;  2A11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...